2G8CO

Atomic-resolution crystal structure of borrelia burgdorferi ospa via surface entropy reduction
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords outer surface protein A
publication title Atomic-resolution crystal structure of Borrelia burgdorferi outer surface protein A via surface engineering.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Lipid binding protein
total genus 49
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2006-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2g8cO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2g8cO02
2OL8O 2OY1O 1OSPO 2OY5O 2OY8A 5B11O 2PI3O 3CKGA 2FKGA 1P4PA 2I5VO 2OL6O 3EC5A 2G8CO 2OY7A 2I5ZO 2OL7A 2FKJA 5B10O 5B2AO 2AF5A 3CKFA 3AUMO 5B3MO 2OYBO 2HKDA 1FJ1E
chains in the Genus database with same CATH superfamily
1KL4A 3BX7A 3GE2A 2LBAA 3RY1A 2RTKA 5F6BA 3PQUA 3V8UA 1HN2A 3WOVA 3TGBA 1FELA 3NX2A 4R0BA 2X34A 1YJ9E 5IO7A 3MBTA 2AT0X 5B29A 4QGWA 2R73A 4OKAA 3B2LA 3BU9A 3WZNA 1Z24A 3G6EE 4DCBA 1LDQA 1K9MG 1ZNHA 2WEXA 3LTWA 1BSQA 2Y3EA 4HWMA 2A2GA 1EPBA 3VE1A 2JGSA 2PI3O 1KFFA 4GGTA 2A3FX 1FE3A 2IZEB 2Y3FA 1U0XA 1Y52X 3TGCA 5H8TA 1KC8G 1O1UA 4K19A 2OVEA 1NBXA 1RXHA 2LKKA 2FKGA 3IGEA 1G5WA 3ZWEA 2NP1A 5H9AA 2C1SA 2JU7A 1UZ2X 5B2AO 2POAA 3KFIA 1W5RA 1H91A 2IZHB 3RDOA 3ZW2A 3CC7E 4QRLA 2HZRA 5DM7E 3HTYA 2MWHA 5L8NA 5EEEA 2JMBA 3RWXA 4ORSA 4NW4A 2Q4NA 3FW4A 4RUNA 4AZPA 1VWLB 4GJVA 1SWCA 5DG4A 1KOIA 3FR2A 1M1KG 1ZNGA 2AT8X 5C0NA 3CBSA 2ZAGA 5HZ8A 3D97A 1SWSA 1K24A 3Q34A 2DJGA 4INNA 2G8CO 3VG5A 2RTPB 4MEEA 1KT4A 2G78A 1DV9A 3F8AA 2Q9SA 4GK9A 1RSTB 2AVIA 5K67A 1CRBA 5HCCC 1QFTA 1SXXA 1SMPI 1SWJA 2IZDB 3CCLE 3CWKA 1D3SA 3WZPA 4GGZA 2C4IA 2KT4B 4YDBA 1MOYA 3IA8A 5B11O 5FQ6E 1I04A 3FR4A 1Y0GA 3KZAA 1ZNDA 1SY1A 1KL5A 2MHDA 1GT3A 2ZJQE 5HZ9A 3CCUE 2WQ9A 2CZUA 1AQBA 5LJCA 5H9LA 3FLLA 3O2YA 4YMYA 1VQ9E 3PPTA 5FQ7E 1ADLA 2M4LA 3SZIA 1IIUA 1SWQA 4U67E 2Q39A 3EBWA 4NV7A 1VWQB 1GT5A 2WUTA 4O49A 5LJDA 1SWOA 2GTLO 2DM5A 1BWYA 4QZUA 3IG9A 3RDSA 3FIQA 4YH0A 2AT5X 1VWPB 4A1HA 3EC5A 4NNTA 5DM6E 4ZGFA 1SY3A 2AF5A 3CCME 5KICA 3MX7A 3ZZVA 4GJSA 1VQ5E 1GX3A 3AKMA 4AZRA 3JS1A 3WJGA 3CKGA 4DQ4A 2MO5A 1DZMA 2GTLN 1LIBA 4LZVA 4U46A 2RTAA 2ZJPE 1GGLA 2OF8A 4ARHA 1SRGA 1YJWE 3CCEE 4U3QA 1X8OA 3WYQA 5GAGG 1YJNE 4ALBA 4WFNE 4BJ8A 3WVMA 2QCBA 3FMZA 1E06A 1G7NA 4JNJA 4LQZA 1NJIG 3BS2A 3WZQA 1SRFA 1ERBA 3JSQA 4FGIB 1Y53X 3ZW0A 3BLGA 1NC9A 3SLOA 5JVGE 1IFCA 4QGVA 4ORXA 2OY5O 1STPA 3VG2A 3I56E 1IKJA 4JO6A 1W6FA 2AKQA 2LB6A 5D45A 2RCTA 3ZUOA 4XMDA 4OMWA 3CQRA 1SWRA 2L67A 1DZJA 3CF5E 2BT9A 2RTEB 3QQ2A 1U17A 2A5BA 5L8OA 1WUBA 2XKLA 4O3ZA 1VQNE 3K3LA 4I6SA 2RN4A 1QY2A 3VG7A 2QM9A 1SWTA 4IRWA 4ZHFA 1KZWA 3B2IA 4BCSA 1MX8A 2CZTA 2X8TA 3SZHA 3WJEA 1N8RG 1SWFA 1SRJA 2WSJA 4ODDA 1G74A 3CCJE 5KHPA 3FEKA 2RA6A 5B3MO 5BVQA 2OTJE 1SA8A 2Q2PA 4ID2A 4O3YA 3VG4A 4TKBA 1B56A 1G85A 1A57A 5AN9B 3B2HA 3CC4E 1VWIB 5IO5A 4LZUA 2WEWA 1YP6A 3AKNA 4M7MA 3WJDA 3CR6A 1MEPA 2HNXA 4OEMA 1JBHA 1Y9TA 3TGAA 4YVBA 1S44A 3Q6LA 1VPRA 4Z2OA 2RD7C 4HPCA 3VHHA 4GD9A 2Q2MA 2LBVA 4XMGA 1W2BE 2QA4E 1PBOA 1HMTA 3KVNA 4WFVA 2IZJA 3RY2A 1MVGA 2FWVA 4OS3A 1YP7A 1DZPA 1NP4A 1RBPA 2RQ0A 3PH5A 1STSB 4WFUA 1BM5A 4GU8A 1AVEA 3HK1A 2ASNX 1KL3A 4WFBE 4GRJA 3P24A 3G7XA 4CDDA 1VQ8E 2L9CA 2P8GA 3KFFA 3U9PC 1JJXA 3T6FA 2GTFX 4D6AA 3RDUA 3ZW0B 4CDFA 1X89A 1K73G 5LKFA 1N4JA 1EI5A 1VQLE 5F58A 4CPHA 1HMSA 1I78A 1NGLA 1OEKA 4NYRA 3FEPA 2OYBO 2C1QA 1YIJE 1DF8A 2JU8A 4ORRA 1ERXA 5GAHG 1JYDA 4CPEA 1OPBA 3CPWE 3RE5A 1KGLA 2JOZA 3BRNA 5EDCA 3P6CA 1DF3A 3D9WA 3FA8A 2RTGB 4ZGUA 1OSPO 4AZOA 2RTQB 1ZNLA 2HYSA 3SZJA 2N93A 5K06A 2RTDB 1R0UA 1KQSE 1ALBA 4AYHA 4GGRA 1JIWI 4KT5A 1A18A 1CBIA 5HBSA 4YDAA 1N9MA 5LJKA 3WZOA 1RL6A 3RDMA 1ML7A 4GDAA 4DQ3A 1OPAA 3U0DA 1VWMB 1YWCA 3FELA 4M6SA 1YWAA 1FTPA 1S72E 3SAOA 1AELA 3BSZE 1SWPA 4LKPA 4BX6A 4BX7A 1SLDB 4WFAE 2G7BA 2IZLB 4XMHA 1JJ2E 1QABE 4O4XA 4IB7A 4YKOA 1TW4A 2X8FA 1Y55X 4I3DA 1AVGI 1VQKE 4YCHA 1P4PA 3BY0A 4HPDA 1BJ7A 3TF6A 1BRQA 3U03A 1CBRA 2NNEA 3SOTA 3HWDA 3C78X 3FA7A 3P02A 1BRPA 2X45A 5B27A 4YFRA 3ZUIA 1RSUB 1TVQA 4JHQA 2QOSC 2CM9A 2OL7A 1SWUA 1PTSA 3D95A 1BSOA 3CKFA 1LIDA 2ANSA 2OL8O 3UEWA 1GKAB 1HXLA 4FBOA 1N43A 5BVTA 2IFBA 4IAWA 1YI2E 2BS5A 4QYNA 1QFVA 4B55A 4MVIA 2GC9A 4CPHB 3P6GA 4O4OA 4ES7A 1S2PA 4N7DA 3D4RA 3EW2A 5EPQA 3STKA 2LFOA 4I3BA 4CDCA 1A3YA 4YFPA 2VFBA 1EXSA 1OBPA 4IB9A 2G5LA 1AVDA 1X8PA 1VWBB 3UEVA 3BU1A 2L5PA 1LKEA 1VYOA 2R74A 4YFQA 4U8UM 2HMBA 3FA9A 2IZCB 3HOEA 3B2JA 1Q7YG 4OMXA 3PECA 1ZNKA 1BBPA 1EPAA 5FFHA 3J7ZG 1Q86G 1K8AG 5IO6A 1LIEA 4Y59A 4IOCE 1SWEA 3RSWA 5AJBA 2AT6X 4MIRA 3O22A 5MLCH 2ALLX 4MVLA 1XCAA 5GADG 5EZ2A 3STNA 4ON1A 4FBVA 4YKMA 1VYFA 1X8NA 5CYBA 5LKEA 1T0VA 3NR3A 4NP1A 2A8GA 1BLRA 4LKTA 2X56A 2ZAIA 3CCRE 1SWNA 4C5PA 2RTBB 3STMX 5H9NA 3BDRA 4KC8A 2QO4A 3CMEE 3CXCE 1MUPA 3VHMA 3DSZA 2JN3A 2IZAA 5IXGA 1E2TA 1MK5A 1T8VA 3D96A 2E4JA 2KW1A 1KT5A 4XMFA 1JV4A 2OVSA 4ORYA 4Z6JA 1M90G 3MG5A 2OZQA 4O4SA 3S5VA 4IBAA 5B5FA 3G71E 4QNIA 1CJ5A 3WXQA 1E00A 1JJJA 4IMOA 3FYFA 1SRHA 1IKEA 3P6DA 4ORWA 2RTRB 2AT3X 4BX5A 2OY7A 2W2AA 1EUOA 3LHNA 3VHIA 3EW1A 5HTDA 4CPIA 4A1YA 4GE1A 4KC7A 4UY8G 2F01A 1CBQA 3UEUA 4AW8A 4PJ2A 3ZW1A 1VQOE 2FS6A 3CMPA 1FJ1E 1VWEB 3F6ZB 1Q81G 1E5PA 1W4TA 5KIDA 1B8EA 3RKGA 1JQPA 4IB8A 3NPOA 4IAXA 5L3YA 4Y0PA 1EIIA 2FKJA 2X32A 1X71A 3O19A 2RTJA 2HKDA 4ZCBA 2RTFB 1O8VA 1FEMA 2KTSA 3E3CA 1SXYA 1LPJA 3EYCA 2FTBA 2WR6A 3CMAE 3APWA 1X8UA 3OD9A 4ZJ0A 1ZRYA 1O1VA 3PDFA 1RLBE 4ORUA 2W2BA 3HWGA 1SWHA 3CCVE 3T2WA 1IW2A 1GM6A 1LCVA 1SWDA 1TOUA 2A13A 4QGXA 3EMMA 2K23A 5BYPA 3VU1A 4CDEA 1NQMA 2GJ5A 1LDOA 1GT4A 2AMMX 1SY0A 3EBKA 3RDXA 5JVHE 4GUZA 1RJLC 4TNNA 4PSQA 3CCSE 1LCWA 2FR2A 1QQSA 3HOLA 4GNWA 3VG3A 5K68A 4Y0QA 3RBYA 2MJIA 1FENA 2F73A 4YGGA 2QOMA 2F09A 1LFOA 4EDEA 4MISA 4TKHA 1EIOA 2YMSA 3S60A 3RDQA 1UYOX 4KH8A 4UU3A 3WYPA 2OY1O 4ZHCA 1VQPE 1DFVA 4GDZA 2CBSA 2RTMA 2GH7A 2I5ZO 2VDFA 3ELXA 4GNYA 1LIFA 2WQAE 1JMXA 4FBRA 3IFBA 4A60A 2X4MA 5HA0A 1VWKB 3PEDA 1SXWA 1RXJA 1VWHB 1CBSA 4NLIA 1LELA 5IRAA 3I55E 1PMPA 1S7DA 2XSTA 1B4MA 4ALOA 1AB0A 1HQQA 1MM9A 4COTA 1LF7A 4BBOA 2Y32A 2HLVA 3HPEA 3KFHA 2RTNB 5H9KA 4I60A 4IMNA 3PP6A 5JR8A 2OFAA 3WJBA 2UZ2A 1N9YA 4OELA 3OE3A 4GH7A 2FRSA 5CSEA 1D2UA 4TKJA 5HCEC 3P6EA 3T1DA 4WF9E 1KT3A 5F6ZA 4CPFA 3L4RA 1MDCA 3F9DA 4BOEA 2AL0X 1WBIA 5AJCA 5AEOA 1SLEB 1PEEA 3C77X 4TQ2A 3FA6A 2RTOB 4U9CA 2OFRX 5HWZA 5D8JA 3NQ3A 4BQUA 4RUUA 1VWCB 1SLFB 2MF6A 4Z2PA 1KT6A 3P6FA 2RTIB 3APUA 1Y9LA 2KD2A 3UAQA 1GT1A 5F7GA 3OBLA 2BC3A 4ZHDA 3CD6E 3FR5A 4O3WA 1KZXA 3OJYC 3APXA 1RXKA 2IZIA 3PIPE 3H3IA 4AZNA 2FT9A 2QO6A 5JD2A 1YITE 2A5CA 4ZHHA 1HQPA 2BHVA 5D48A 3WBGA 1A2DA 3APVA 1SWKA 1DZKA 3AUMO 1HXZA 1OEEA 4ML7B 5FENA 2OVAA 5DPQA 1KT7A 1N0SA 4ZFXA 1LNMA 2OY8A 2BSZA 1UREA 4IABA 2K62A 1N7YA 3I17A 2VFCA 5B5GA 4Z28A 3FW5A 2GTLM 4IB6A 2X8SA 3HWFA 1SLGB 3VGWA 4I95A 3NADA 3FIDA 4GETA 3CBCA 2FHNX 1HY2A 1QY0A 5EEDA 3ZQ3A 4FQBB 3WJFA 1B0OA 2QO5A 4Y0RA 4NV8A 4TLJA 5F1EA 3UEXA 2IZGB 3X00A 4Z27A 1LCZA 4I9SA 2W2FA 4A8ZA 4D6BA 4O9SA 1YWBA 3DLLE 3MM0A 4QAEA 5BVSA 1BEBA 3SLJA 2O62A 2X46A 3GAQA 4QZTA 4EFGA 2BLGA 1RAVA 4EKVA 2CQLA 5IRUA 2X55A 3MVFA 3WJCA 1VYGA 4WBKA 2FHLA 3NQKA 4O4UA 3ZI8A 4I3CA 3NBXX 5FAZA 1NP1A 4WCEE 1QWDA 2A0AA 2DJFA 5IRWA 1I4UA 4UU2A 2RTLA 5L8IA 5HCDC 1LICA 1I9HA 1VWFB 4HPBA 1EALA 1OBQA 2Z4IA 2ACOA 2FGSA 1SREA 3HWEA 1YWDA 4OS0A 2IZKA 4DNEA 1Q82G 1VWGB 1E02A 1PM1X 2WPUA 3PH6A 1P6PA 4EEJA 1SWLA 2YG2A 2UYWA 4KCAA 3SLTA 5HL7E 3P6HA 4BX6B 4BX7B 1VQ6E 2A2UA 1VQ7E 2Z4HA 3PIOE 4KIIA 1VWRB 3VPJE 5B10O 2ACPX 4WHIA 2OF9A 2KTDA 1TXLA 3KQ0A 1KXOA 3I0AA 4ZR2A 4L1NA 2IZFB 1KQWA 2I5VO 2L68A 4BVMA 5EDBA 4CSBA 2FR3A 1JYJA 1BSYA 3JQOA 5HAEA 2EU7X 3NQ9A 4NNSA 2CBRA 5LJEA 3B2KA 1EW3A 1X8QA 3CQNA 3KFGA 1I06A 3TZSA 4OS8A 4AZMA 2OTLE 5HZ5A 1YHQE 3C76X 1OEJA 4Y5DA 2ZJRE 2QMIA 4QQ1A 4XMEA 3NX1A 1L6MA 4U8UO 2WWPA 1NQNA 4QYPA 3CCQE 1DC9A 1JJUA 1JMZA 2LA7A 2NNDA 5HTEA 1HBQA 1QY1A 3RE6A 5F2BA 3RZYA 2OFMX 4IO9E 1VQME 4HFOA 2HZQA 1I05A 2RTCB 3NP1A 2R56A 2NNQA 1VWOB 5H1SI 1VQ4E 2QEXE 4TJZA 5HZQA 5CE4A 2OL6O 4ZH6A 1SRIA 1T68X 3CC2E 1HBPA 2JU3A 4MVKA 4U8UN 1OBUA 4YGHA 1SY2A 4I9RA 3BX8A 1YIVA 1GXAA 1VWAB 5HZ6A 2FLJA 4GKCA 3FENA 1GX8A 2RTHB 2ZSCA 4JGLA 5CHKA 1PBYA 2IZBA 1SXUA 2RCQA 2JW1A 2BS6A 1U18A 3S5XA 5FQ8E 5LJHA 1MX7A 1TOWA 4EQAC 4ZHGA 1EQDA 1KQXA 1LUQA 1NDJA 4HPAA 1SWGA 1IJ8A 1JZUA 3T6LA 5GAEG 5LJBA 4CV7A 4O3XB 3QKGA 1ZNEA 4YGZA 3PQSA 2AH7X 1ACDA 2CAMA 3N91A 1VWDB 3G4SE 1VWJB 4YBUA 3ELZA 2G79A 1FDQA 3FDCA 1K3BA 1XKIA 4GZVA 3S26A 5D4AA 1SWBA 2CM4A 2MM3A 4Z2VA 4MVEA 3DTQA 1KD1G 2OFBA 3PK2A 4NLJA 4NYQA 3OW2E 4XMCA 5D47A 4BX5B 4YBPA 2OVDA 3EM0A 1GX9A 4AZQA 5HA1A 1VWNB 2PY1A 4CK4A 3VE2A 4IOAE 4Y0SA 4BGFA 1IFBA 5AQ6A 1YUPA 1SWAA 4N7CA 4YCEA 3ZW1B 4ZH9A 1ICNA 3AEHA 1GKAA 1ICMA 4EXZA 1QVGE 3VG6A 2FS7A 1HMRA 4L3RA 3LV4A 1UYNX 5LJGA 1STRB 3T2XA 1QG5A 1QVFE
chains in the Genus database with same CATH topology
2OL8O 2OY1O 3IG9A 1OSPO 2OY5O 2OY8A 5B11O 2PI3O 3CKGA 2FKGA 1P4PA 2I5VO 2OL6O 3EC5A 3IGEA 2G8CO 2OY7A 2I5ZO 2OL7A 1RJLC 2FKJA 5B10O 5B2AO 2AF5A 3CKFA 3AUMO 5B3MO 2OYBO 2HKDA 1FJ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL8 O;  2OY1 O;  1OSP O;  2OY5 O;  2OY8 A;  5B11 O;  2PI3 O;  3CKG A;  2FKG A;  1P4P A;  2I5V O;  2OL6 O;  3EC5 A;  2G8C O;  2OY7 A;  2I5Z O;  2OL7 A;  2FKJ A;  5B10 O;  5B2A O;  2AF5 A;  3CKF A;  3AUM O;  5B3M O;  2OYB O;  2HKD A;  1FJ1 E; 
#chains in the Genus database with same CATH topology
 1KL4 A;  3BX7 A;  3GE2 A;  2LBA A;  3RY1 A;  2RTK A;  5F6B A;  3PQU A;  3V8U A;  1HN2 A;  3WOV A;  3TGB A;  1FEL A;  3NX2 A;  4R0B A;  2X34 A;  1YJ9 E;  5IO7 A;  3MBT A;  2AT0 X;  5B29 A;  4QGW A;  2R73 A;  4OKA A;  3B2L A;  3BU9 A;  3WZN A;  1Z24 A;  3G6E E;  4DCB A;  1LDQ A;  1K9M G;  1ZNH A;  2WEX A;  3LTW A;  1BSQ A;  2Y3E A;  4HWM A;  2A2G A;  1EPB A;  3VE1 A;  2JGS A;  2PI3 O;  1KFF A;  4GGT A;  2A3F X;  1FE3 A;  2IZE B;  2Y3F A;  1U0X A;  1Y52 X;  3TGC A;  5H8T A;  1KC8 G;  1O1U A;  4K19 A;  2OVE A;  1NBX A;  1RXH A;  2LKK A;  2FKG A;  3IGE A;  1G5W A;  3ZWE A;  2NP1 A;  5H9A A;  2C1S A;  2JU7 A;  1UZ2 X;  5B2A O;  2POA A;  3KFI A;  1W5R A;  1H91 A;  2IZH B;  3RDO A;  3ZW2 A;  3CC7 E;  4QRL A;  2HZR A;  5DM7 E;  3HTY A;  2MWH A;  5L8N A;  5EEE A;  2JMB A;  3RWX A;  4ORS A;  4NW4 A;  2Q4N A;  3FW4 A;  4RUN A;  4AZP A;  1VWL B;  4GJV A;  1SWC A;  5DG4 A;  1KOI A;  3FR2 A;  1M1K G;  1ZNG A;  2AT8 X;  5C0N A;  3CBS A;  2ZAG A;  5HZ8 A;  3D97 A;  1SWS A;  1K24 A;  3Q34 A;  2DJG A;  4INN A;  2G8C O;  3VG5 A;  2RTP B;  4MEE A;  1KT4 A;  2G78 A;  1DV9 A;  3F8A A;  2Q9S A;  4GK9 A;  1RST B;  2AVI A;  5K67 A;  1CRB A;  5HCC C;  1QFT A;  1SXX A;  1SMP I;  1SWJ A;  2IZD B;  3CCL E;  3CWK A;  1D3S A;  3WZP A;  4GGZ A;  2C4I A;  2KT4 B;  4YDB A;  1MOY A;  3IA8 A;  5B11 O;  5FQ6 E;  1I04 A;  3FR4 A;  1Y0G A;  3KZA A;  1ZND A;  1SY1 A;  1KL5 A;  2MHD A;  1GT3 A;  2ZJQ E;  5HZ9 A;  3CCU E;  2WQ9 A;  2CZU A;  1AQB A;  5LJC A;  5H9L A;  3FLL A;  3O2Y A;  4YMY A;  1VQ9 E;  3PPT A;  5FQ7 E;  1ADL A;  2M4L A;  3SZI A;  1IIU A;  1SWQ A;  4U67 E;  2Q39 A;  3EBW A;  4NV7 A;  1VWQ B;  1GT5 A;  2WUT A;  4O49 A;  5LJD A;  1SWO A;  2GTL O;  2DM5 A;  1BWY A;  4QZU A;  3IG9 A;  3RDS A;  3FIQ A;  4YH0 A;  2AT5 X;  1VWP B;  4A1H A;  3EC5 A;  4NNT A;  5DM6 E;  4ZGF A;  1SY3 A;  2AF5 A;  3CCM E;  5KIC A;  3MX7 A;  3ZZV A;  4GJS A;  1VQ5 E;  1GX3 A;  3AKM A;  4AZR A;  3JS1 A;  3WJG A;  3CKG A;  4DQ4 A;  2MO5 A;  1DZM A;  2GTL N;  1LIB A;  4LZV A;  4U46 A;  2RTA A;  2ZJP E;  1GGL A;  2OF8 A;  4ARH A;  1SRG A;  1YJW E;  3CCE E;  4U3Q A;  1X8O A;  3WYQ A;  5GAG G;  1YJN E;  4ALB A;  4WFN E;  4BJ8 A;  3WVM A;  2QCB A;  3FMZ A;  1E06 A;  1G7N A;  4JNJ A;  4LQZ A;  1NJI G;  3BS2 A;  3WZQ A;  1SRF A;  1ERB A;  3JSQ A;  4FGI B;  1Y53 X;  3ZW0 A;  3BLG A;  1NC9 A;  3SLO A;  5JVG E;  1IFC A;  4QGV A;  4ORX A;  2OY5 O;  1STP A;  3VG2 A;  3I56 E;  1IKJ A;  4JO6 A;  1W6F A;  2AKQ A;  2LB6 A;  5D45 A;  2RCT A;  3ZUO A;  4XMD A;  4OMW A;  3CQR A;  1SWR A;  2L67 A;  1DZJ A;  3CF5 E;  2BT9 A;  2RTE B;  3QQ2 A;  1U17 A;  2A5B A;  5L8O A;  1WUB A;  2XKL A;  4O3Z A;  1VQN E;  3K3L A;  4I6S A;  2RN4 A;  1QY2 A;  3VG7 A;  2QM9 A;  1SWT A;  4IRW A;  4ZHF A;  1KZW A;  3B2I A;  4BCS A;  1MX8 A;  2CZT A;  2X8T A;  3SZH A;  3WJE A;  1N8R G;  1SWF A;  1SRJ A;  2WSJ A;  4ODD A;  1G74 A;  3CCJ E;  5KHP A;  3FEK A;  2RA6 A;  5B3M O;  5BVQ A;  2OTJ E;  1SA8 A;  2Q2P A;  4ID2 A;  4O3Y A;  3VG4 A;  4TKB A;  1B56 A;  1G85 A;  1A57 A;  5AN9 B;  3B2H A;  3CC4 E;  1VWI B;  5IO5 A;  4LZU A;  2WEW A;  1YP6 A;  3AKN A;  4M7M A;  3WJD A;  3CR6 A;  1MEP A;  2HNX A;  4OEM A;  1JBH A;  1Y9T A;  3TGA A;  4YVB A;  1S44 A;  3Q6L A;  1VPR A;  4Z2O A;  2RD7 C;  4HPC A;  3VHH A;  4GD9 A;  2Q2M A;  2LBV A;  4XMG A;  1W2B E;  2QA4 E;  1PBO A;  1HMT A;  3KVN A;  4WFV A;  2IZJ A;  3RY2 A;  1MVG A;  2FWV A;  4OS3 A;  1YP7 A;  1DZP A;  1NP4 A;  1RBP A;  2RQ0 A;  3PH5 A;  1STS B;  4WFU A;  1BM5 A;  4GU8 A;  1AVE A;  3HK1 A;  2ASN X;  1KL3 A;  4WFB E;  4GRJ A;  3P24 A;  3G7X A;  4CDD A;  1VQ8 E;  2L9C A;  2P8G A;  3KFF A;  3U9P C;  1JJX A;  3T6F A;  2GTF X;  4D6A A;  3RDU A;  3ZW0 B;  4CDF A;  1X89 A;  1K73 G;  5LKF A;  1N4J A;  1EI5 A;  1VQL E;  5F58 A;  4CPH A;  1HMS A;  1I78 A;  1NGL A;  1OEK A;  4NYR A;  3FEP A;  2OYB O;  2C1Q A;  1YIJ E;  1DF8 A;  2JU8 A;  4ORR A;  1ERX A;  5GAH G;  1JYD A;  4CPE A;  1OPB A;  3CPW E;  3RE5 A;  1KGL A;  2JOZ A;  3BRN A;  5EDC A;  3P6C A;  1DF3 A;  3D9W A;  3FA8 A;  2RTG B;  4ZGU A;  1OSP O;  4AZO A;  2RTQ B;  1ZNL A;  2HYS A;  3SZJ A;  2N93 A;  5K06 A;  2RTD B;  1R0U A;  1KQS E;  1ALB A;  4AYH A;  4GGR A;  1JIW I;  4KT5 A;  1A18 A;  1CBI A;  5HBS A;  4YDA A;  1N9M A;  5LJK A;  3WZO A;  1RL6 A;  3RDM A;  1ML7 A;  4GDA A;  4DQ3 A;  1OPA A;  3U0D A;  1VWM B;  1YWC A;  3FEL A;  4M6S A;  1YWA A;  1FTP A;  1S72 E;  3SAO A;  1AEL A;  3BSZ E;  1SWP A;  4LKP A;  4BX6 A;  4BX7 A;  1SLD B;  4WFA E;  2G7B A;  2IZL B;  4XMH A;  1JJ2 E;  1QAB E;  4O4X A;  4IB7 A;  4YKO A;  1TW4 A;  2X8F A;  1Y55 X;  4I3D A;  1AVG I;  1VQK E;  4YCH A;  1P4P A;  3BY0 A;  4HPD A;  1BJ7 A;  3TF6 A;  1BRQ A;  3U03 A;  1CBR A;  2NNE A;  3SOT A;  3HWD A;  3C78 X;  3FA7 A;  3P02 A;  1BRP A;  2X45 A;  5B27 A;  4YFR A;  3ZUI A;  1RSU B;  1TVQ A;  4JHQ A;  2QOS C;  2CM9 A;  2OL7 A;  1SWU A;  1PTS A;  3D95 A;  1BSO A;  3CKF A;  1LID A;  2ANS A;  2OL8 O;  3UEW A;  1GKA B;  1HXL A;  4FBO A;  1N43 A;  5BVT A;  2IFB A;  4IAW A;  1YI2 E;  2BS5 A;  4QYN A;  1QFV A;  4B55 A;  4MVI A;  2GC9 A;  4CPH B;  3P6G A;  4O4O A;  4ES7 A;  1S2P A;  4N7D A;  3D4R A;  3EW2 A;  5EPQ A;  3STK A;  2LFO A;  4I3B A;  4CDC A;  1A3Y A;  4YFP A;  2VFB A;  1EXS A;  1OBP A;  4IB9 A;  2G5L A;  1AVD A;  1X8P A;  1VWB B;  3UEV A;  3BU1 A;  2L5P A;  1LKE A;  1VYO A;  2R74 A;  4YFQ A;  4U8U M;  2HMB A;  3FA9 A;  2IZC B;  3HOE A;  3B2J A;  1Q7Y G;  4OMX A;  3PEC A;  1ZNK A;  1BBP A;  1EPA A;  5FFH A;  3J7Z G;  1Q86 G;  1K8A G;  5IO6 A;  1LIE A;  4Y59 A;  4IOC E;  1SWE A;  3RSW A;  5AJB A;  2AT6 X;  4MIR A;  3O22 A;  5MLC H;  2ALL X;  4MVL A;  1XCA A;  5GAD G;  5EZ2 A;  3STN A;  4ON1 A;  4FBV A;  4YKM A;  1VYF A;  1X8N A;  5CYB A;  5LKE A;  1T0V A;  3NR3 A;  4NP1 A;  2A8G A;  1BLR A;  4LKT A;  2X56 A;  2ZAI A;  3CCR E;  1SWN A;  4C5P A;  2RTB B;  3STM X;  5H9N A;  3BDR A;  4KC8 A;  2QO4 A;  3CME E;  3CXC E;  1MUP A;  3VHM A;  3DSZ A;  2JN3 A;  2IZA A;  5IXG A;  1E2T A;  1MK5 A;  1T8V A;  3D96 A;  2E4J A;  2KW1 A;  1KT5 A;  4XMF A;  1JV4 A;  2OVS A;  4ORY A;  4Z6J A;  1M90 G;  3MG5 A;  2OZQ A;  4O4S A;  3S5V A;  4IBA A;  5B5F A;  3G71 E;  4QNI A;  1CJ5 A;  3WXQ A;  1E00 A;  1JJJ A;  4IMO A;  3FYF A;  1SRH A;  1IKE A;  3P6D A;  4ORW A;  2RTR B;  2AT3 X;  4BX5 A;  2OY7 A;  2W2A A;  1EUO A;  3LHN A;  3VHI A;  3EW1 A;  5HTD A;  4CPI A;  4A1Y A;  4GE1 A;  4KC7 A;  4UY8 G;  2F01 A;  1CBQ A;  3UEU A;  4AW8 A;  4PJ2 A;  3ZW1 A;  1VQO E;  2FS6 A;  3CMP A;  1FJ1 E;  1VWE B;  3F6Z B;  1Q81 G;  1E5P A;  1W4T A;  5KID A;  1B8E A;  3RKG A;  1JQP A;  4IB8 A;  3NPO A;  4IAX A;  5L3Y A;  4Y0P A;  1EII A;  2FKJ A;  2X32 A;  1X71 A;  3O19 A;  2RTJ A;  2HKD A;  4ZCB A;  2RTF B;  1O8V A;  1FEM A;  2KTS A;  3E3C A;  1SXY A;  1LPJ A;  3EYC A;  2FTB A;  2WR6 A;  3CMA E;  3APW A;  1X8U A;  3OD9 A;  4ZJ0 A;  1ZRY A;  1O1V A;  3PDF A;  1RLB E;  4ORU A;  2W2B A;  3HWG A;  1SWH A;  3CCV E;  3T2W A;  1IW2 A;  1GM6 A;  1LCV A;  1SWD A;  1TOU A;  2A13 A;  4QGX A;  3EMM A;  2K23 A;  5BYP A;  3VU1 A;  4CDE A;  1NQM A;  2GJ5 A;  1LDO A;  1GT4 A;  2AMM X;  1SY0 A;  3EBK A;  3RDX A;  5JVH E;  4GUZ A;  1RJL C;  4TNN A;  4PSQ A;  3CCS E;  1LCW A;  2FR2 A;  1QQS A;  3HOL A;  4GNW A;  3VG3 A;  5K68 A;  4Y0Q A;  3RBY A;  2MJI A;  1FEN A;  2F73 A;  4YGG A;  2QOM A;  2F09 A;  1LFO A;  4EDE A;  4MIS A;  4TKH A;  1EIO A;  2YMS A;  3S60 A;  3RDQ A;  1UYO X;  4KH8 A;  4UU3 A;  3WYP A;  2OY1 O;  4ZHC A;  1VQP E;  1DFV A;  4GDZ A;  2CBS A;  2RTM A;  2GH7 A;  2I5Z O;  2VDF A;  3ELX A;  4GNY A;  1LIF A;  2WQA E;  1JMX A;  4FBR A;  3IFB A;  4A60 A;  2X4M A;  5HA0 A;  1VWK B;  3PED A;  1SXW A;  1RXJ A;  1VWH B;  1CBS A;  4NLI A;  1LEL A;  5IRA A;  3I55 E;  1PMP A;  1S7D A;  2XST A;  1B4M A;  4ALO A;  1AB0 A;  1HQQ A;  1MM9 A;  4COT A;  1LF7 A;  4BBO A;  2Y32 A;  2HLV A;  3HPE A;  3KFH A;  2RTN B;  5H9K A;  4I60 A;  4IMN A;  3PP6 A;  5JR8 A;  2OFA A;  3WJB A;  2UZ2 A;  1N9Y A;  4OEL A;  3OE3 A;  4GH7 A;  2FRS A;  5CSE A;  1D2U A;  4TKJ A;  5HCE C;  3P6E A;  3T1D A;  4WF9 E;  1KT3 A;  5F6Z A;  4CPF A;  3L4R A;  1MDC A;  3F9D A;  4BOE A;  2AL0 X;  1WBI A;  5AJC A;  5AEO A;  1SLE B;  1PEE A;  3C77 X;  4TQ2 A;  3FA6 A;  2RTO B;  4U9C A;  2OFR X;  5HWZ A;  5D8J A;  3NQ3 A;  4BQU A;  4RUU A;  1VWC B;  1SLF B;  2MF6 A;  4Z2P A;  1KT6 A;  3P6F A;  2RTI B;  3APU A;  1Y9L A;  2KD2 A;  3UAQ A;  1GT1 A;  5F7G A;  3OBL A;  2BC3 A;  4ZHD A;  3CD6 E;  3FR5 A;  4O3W A;  1KZX A;  3OJY C;  3APX A;  1RXK A;  2IZI A;  3PIP E;  3H3I A;  4AZN A;  2FT9 A;  2QO6 A;  5JD2 A;  1YIT E;  2A5C A;  4ZHH A;  1HQP A;  2BHV A;  5D48 A;  3WBG A;  1A2D A;  3APV A;  1SWK A;  1DZK A;  3AUM O;  1HXZ A;  1OEE A;  4ML7 B;  5FEN A;  2OVA A;  5DPQ A;  1KT7 A;  1N0S A;  4ZFX A;  1LNM A;  2OY8 A;  2BSZ A;  1URE A;  4IAB A;  2K62 A;  1N7Y A;  3I17 A;  2VFC A;  5B5G A;  4Z28 A;  3FW5 A;  2GTL M;  4IB6 A;  2X8S A;  3HWF A;  1SLG B;  3VGW A;  4I95 A;  3NAD A;  3FID A;  4GET A;  3CBC A;  2FHN X;  1HY2 A;  1QY0 A;  5EED A;  3ZQ3 A;  4FQB B;  3WJF A;  1B0O A;  2QO5 A;  4Y0R A;  4NV8 A;  4TLJ A;  5F1E A;  3UEX A;  2IZG B;  3X00 A;  4Z27 A;  1LCZ A;  4I9S A;  2W2F A;  4A8Z A;  4D6B A;  4O9S A;  1YWB A;  3DLL E;  3MM0 A;  4QAE A;  5BVS A;  1BEB A;  3SLJ A;  2O62 A;  2X46 A;  3GAQ A;  4QZT A;  4EFG A;  2BLG A;  1RAV A;  4EKV A;  2CQL A;  5IRU A;  2X55 A;  3MVF A;  3WJC A;  1VYG A;  4WBK A;  2FHL A;  3NQK A;  4O4U A;  3ZI8 A;  4I3C A;  3NBX X;  5FAZ A;  1NP1 A;  4WCE E;  1QWD A;  2A0A A;  2DJF A;  5IRW A;  1I4U A;  4UU2 A;  2RTL A;  5L8I A;  5HCD C;  1LIC A;  1I9H A;  1VWF B;  4HPB A;  1EAL A;  1OBQ A;  2Z4I A;  2ACO A;  2FGS A;  1SRE A;  3HWE A;  1YWD A;  4OS0 A;  2IZK A;  4DNE A;  1Q82 G;  1VWG B;  1E02 A;  1PM1 X;  2WPU A;  3PH6 A;  1P6P A;  4EEJ A;  1SWL A;  2YG2 A;  2UYW A;  4KCA A;  3SLT A;  5HL7 E;  3P6H A;  4BX6 B;  4BX7 B;  1VQ6 E;  2A2U A;  1VQ7 E;  2Z4H A;  3PIO E;  4KII A;  1VWR B;  3VPJ E;  5B10 O;  2ACP X;  4WHI A;  2OF9 A;  2KTD A;  1TXL A;  3KQ0 A;  1KXO A;  3I0A A;  4ZR2 A;  4L1N A;  2IZF B;  1KQW A;  2I5V O;  2L68 A;  4BVM A;  5EDB A;  4CSB A;  2FR3 A;  1JYJ A;  1BSY A;  3JQO A;  5HAE A;  2EU7 X;  3NQ9 A;  4NNS A;  2CBR A;  5LJE A;  3B2K A;  1EW3 A;  1X8Q A;  3CQN A;  3KFG A;  1I06 A;  3TZS A;  4OS8 A;  4AZM A;  2OTL E;  5HZ5 A;  1YHQ E;  3C76 X;  1OEJ A;  4Y5D A;  2ZJR E;  2QMI A;  4QQ1 A;  4XME A;  3NX1 A;  1L6M A;  4U8U O;  2WWP A;  1NQN A;  4QYP A;  3CCQ E;  1DC9 A;  1JJU A;  1JMZ A;  2LA7 A;  2NND A;  5HTE A;  1HBQ A;  1QY1 A;  3RE6 A;  5F2B A;  3RZY A;  2OFM X;  4IO9 E;  1VQM E;  4HFO A;  2HZQ A;  1I05 A;  2RTC B;  3NP1 A;  2R56 A;  2NNQ A;  1VWO B;  5H1S I;  1VQ4 E;  2QEX E;  4TJZ A;  5HZQ A;  5CE4 A;  2OL6 O;  4ZH6 A;  1SRI A;  1T68 X;  3CC2 E;  1HBP A;  2JU3 A;  4MVK A;  4U8U N;  1OBU A;  4YGH A;  1SY2 A;  4I9R A;  3BX8 A;  1YIV A;  1GXA A;  1VWA B;  5HZ6 A;  2FLJ A;  4GKC A;  3FEN A;  1GX8 A;  2RTH B;  2ZSC A;  4JGL A;  5CHK A;  1PBY A;  2IZB A;  1SXU A;  2RCQ A;  2JW1 A;  2BS6 A;  1U18 A;  3S5X A;  5FQ8 E;  5LJH A;  1MX7 A;  1TOW A;  4EQA C;  4ZHG A;  1EQD A;  1KQX A;  1LUQ A;  1NDJ A;  4HPA A;  1SWG A;  1IJ8 A;  1JZU A;  3T6L A;  5GAE G;  5LJB A;  4CV7 A;  4O3X B;  3QKG A;  1ZNE A;  4YGZ A;  3PQS A;  2AH7 X;  1ACD A;  2CAM A;  3N91 A;  1VWD B;  3G4S E;  1VWJ B;  4YBU A;  3ELZ A;  2G79 A;  1FDQ A;  3FDC A;  1K3B A;  1XKI A;  4GZV A;  3S26 A;  5D4A A;  1SWB A;  2CM4 A;  2MM3 A;  4Z2V A;  4MVE A;  3DTQ A;  1KD1 G;  2OFB A;  3PK2 A;  4NLJ A;  4NYQ A;  3OW2 E;  4XMC A;  5D47 A;  4BX5 B;  4YBP A;  2OVD A;  3EM0 A;  1GX9 A;  4AZQ A;  5HA1 A;  1VWN B;  2PY1 A;  4CK4 A;  3VE2 A;  4IOA E;  4Y0S A;  4BGF A;  1IFB A;  5AQ6 A;  1YUP A;  1SWA A;  4N7C A;  4YCE A;  3ZW1 B;  4ZH9 A;  1ICN A;  3AEH A;  1GKA A;  1ICM A;  4EXZ A;  1QVG E;  3VG6 A;  2FS7 A;  1HMR A;  4L3R A;  3LV4 A;  1UYN X;  5LJG A;  1STR B;  3T2X A;  1QG5 A;  1QVF E; 
#chains in the Genus database with same CATH homology
 2OL8 O;  2OY1 O;  3IG9 A;  1OSP O;  2OY5 O;  2OY8 A;  5B11 O;  2PI3 O;  3CKG A;  2FKG A;  1P4P A;  2I5V O;  2OL6 O;  3EC5 A;  3IGE A;  2G8C O;  2OY7 A;  2I5Z O;  2OL7 A;  1RJL C;  2FKJ A;  5B10 O;  5B2A O;  2AF5 A;  3CKF A;  3AUM O;  5B3M O;  2OYB O;  2HKD A;  1FJ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...