3I55E

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 40
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3i55E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3i55E01
1YITE 3CMAE 5DM6E 4IOAE 4WFNE 1M90G 1VQNE 4WCEE 1S72E 3G6EE 1N8RG 1KQSE 2ZJPE 3CC7E 1VQPE 1K9MG 1VQ8E 1YJ9E 3CCJE 2ZJRE 5AN9B 5MLCH 4WF9E 3CCSE 3I55E 5JVGE 1YI2E 1VQ9E 2OTLE 5GAEG 1VQ7E 1VQLE 1VQME 1JJ2E 1VQ5E 1Q82G 5GAHG 3DLLE 2CQLA 3G4SE 3CXCE 1QVGE 1VQ4E 3PIPE 1VQOE 3CCLE 3CC2E 1RL6A 3CCEE 1VQ6E 2OTJE 5GADG 1QVFE 3I56E 1W2BE 3CMEE 5GAGG 1KD1G 5H1SI 3G71E 1K73G 3CC4E 3CPWE 4WFAE 1KC8G 5DM7E 1YIJE 4WFBE 1VQKE 1K8AG 3CCVE 4IOCE 1YJWE 1YHQE 4U67E 1M1KG 3CCME 3CCUE 3PIOE 4UY8G 3CCQE 3CF5E 5HL7E 2QA4E 3OW2E 2QEXE 5JVHE 4IO9E 1Q7YG 1NJIG 1YJNE 3J7ZG 1Q81G 3CD6E 1Q86G 3CCRE 2ZJQE
chains in the Genus database with same CATH superfamily
1YITE 3CMAE 2I5ZO 5DM6E 2HKDA 3IGEA 4IOAE 4WFNE 1M90G 1VQNE 2AF5A 4WCEE 2FKJA 1S72E 2OY5O 3G6EE 1N8RG 1KQSE 3AUMO 2ZJPE 3CC7E 1VQPE 1K9MG 1VQ8E 2OL6O 1YJ9E 3CCJE 2PI3O 2ZJRE 5AN9B 5MLCH 4WF9E 3CCSE 5B10O 1OSPO 3I55E 5JVGE 1YI2E 1VQ9E 3EC5A 2OTLE 5GAEG 1VQ7E 3CKFA 1VQLE 1VQME 1JJ2E 1VQ5E 3IG9A 1Q82G 5GAHG 3DLLE 2CQLA 3G4SE 5B3MO 3CXCE 1QVGE 1VQ4E 3PIPE 1VQOE 2OY7A 3CCLE 3CC2E 1RL6A 3CCEE 1VQ6E 2OTJE 5GADG 2OYBO 5B11O 2I5VO 2OY8A 2OL7A 3I56E 1W2BE 1QVFE 3CMEE 5GAGG 1KD1G 1P4PA 5H1SI 3G71E 2FKGA 1K73G 3CC4E 3CPWE 3CKGA 4WFAE 1KC8G 5DM7E 1YIJE 4WFBE 1FJ1E 1VQKE 1RJLC 1K8AG 3CCVE 4IOCE 1YJWE 1YHQE 4U67E 1M1KG 3CCME 3CCUE 3PIOE 4UY8G 3CCQE 3CF5E 5HL7E 5B2AO 2G8CO 2QA4E 3OW2E 2QEXE 2OY1O 5JVHE 4IO9E 1Q7YG 1NJIG 1YJNE 2OL8O 3J7ZG 1Q81G 3CD6E 1Q86G 3CCRE 2ZJQE
chains in the Genus database with same CATH topology
1YITE 3CMAE 5DM6E 4IOAE 4WFNE 1M90G 1VQNE 4WCEE 1S72E 3G6EE 1N8RG 1KQSE 2ZJPE 3CC7E 1VQPE 1K9MG 1VQ8E 1YJ9E 3CCJE 2ZJRE 5AN9B 5MLCH 4WF9E 3CCSE 3I55E 5JVGE 1YI2E 1VQ9E 2OTLE 5GAEG 1VQ7E 1VQLE 1VQME 1JJ2E 1VQ5E 1Q82G 5GAHG 3DLLE 2CQLA 3G4SE 3CXCE 1QVGE 1VQ4E 3PIPE 1VQOE 3CCLE 3CC2E 1RL6A 3CCEE 1VQ6E 2OTJE 5GADG 1QVFE 3I56E 1W2BE 3CMEE 5GAGG 1KD1G 5H1SI 3G71E 1K73G 3CC4E 3CPWE 4WFAE 1KC8G 5DM7E 1YIJE 4WFBE 1VQKE 1K8AG 3CCVE 4IOCE 1YJWE 1YHQE 4U67E 1M1KG 3CCME 3CCUE 3PIOE 4UY8G 3CCQE 3CF5E 5HL7E 2QA4E 3OW2E 2QEXE 5JVHE 4IO9E 1Q7YG 1NJIG 1YJNE 3J7ZG 1Q81G 3CD6E 1Q86G 3CCRE 2ZJQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT E;  3CMA E;  5DM6 E;  4IOA E;  4WFN E;  1M90 G;  1VQN E;  4WCE E;  1S72 E;  3G6E E;  1N8R G;  1KQS E;  2ZJP E;  3CC7 E;  1VQP E;  1K9M G;  1VQ8 E;  1YJ9 E;  3CCJ E;  2ZJR E;  5AN9 B;  5MLC H;  4WF9 E;  3CCS E;  3I55 E;  5JVG E;  1YI2 E;  1VQ9 E;  2OTL E;  5GAE G;  1VQ7 E;  1VQL E;  1VQM E;  1JJ2 E;  1VQ5 E;  1Q82 G;  5GAH G;  3DLL E;  2CQL A;  3G4S E;  3CXC E;  1QVG E;  1VQ4 E;  3PIP E;  1VQO E;  3CCL E;  3CC2 E;  1RL6 A;  3CCE E;  1VQ6 E;  2OTJ E;  5GAD G;  1QVF E;  3I56 E;  1W2B E;  3CME E;  5GAG G;  1KD1 G;  5H1S I;  3G71 E;  1K73 G;  3CC4 E;  3CPW E;  4WFA E;  1KC8 G;  5DM7 E;  1YIJ E;  4WFB E;  1VQK E;  1K8A G;  3CCV E;  4IOC E;  1YJW E;  1YHQ E;  4U67 E;  1M1K G;  3CCM E;  3CCU E;  3PIO E;  4UY8 G;  3CCQ E;  3CF5 E;  5HL7 E;  2QA4 E;  3OW2 E;  2QEX E;  5JVH E;  4IO9 E;  1Q7Y G;  1NJI G;  1YJN E;  3J7Z G;  1Q81 G;  3CD6 E;  1Q86 G;  3CCR E;  2ZJQ E; 
#chains in the Genus database with same CATH topology
 1YIT E;  3CMA E;  2I5Z O;  5DM6 E;  2HKD A;  3IGE A;  4IOA E;  4WFN E;  1M90 G;  1VQN E;  2AF5 A;  4WCE E;  2FKJ A;  1S72 E;  2OY5 O;  3G6E E;  1N8R G;  1KQS E;  3AUM O;  2ZJP E;  3CC7 E;  1VQP E;  1K9M G;  1VQ8 E;  2OL6 O;  1YJ9 E;  3CCJ E;  2PI3 O;  2ZJR E;  5AN9 B;  5MLC H;  4WF9 E;  3CCS E;  5B10 O;  1OSP O;  3I55 E;  5JVG E;  1YI2 E;  1VQ9 E;  3EC5 A;  2OTL E;  5GAE G;  1VQ7 E;  3CKF A;  1VQL E;  1VQM E;  1JJ2 E;  1VQ5 E;  3IG9 A;  1Q82 G;  5GAH G;  3DLL E;  2CQL A;  3G4S E;  5B3M O;  3CXC E;  1QVG E;  1VQ4 E;  3PIP E;  1VQO E;  2OY7 A;  3CCL E;  3CC2 E;  1RL6 A;  3CCE E;  1VQ6 E;  2OTJ E;  5GAD G;  2OYB O;  5B11 O;  2I5V O;  2OY8 A;  2OL7 A;  3I56 E;  1W2B E;  1QVF E;  3CME E;  5GAG G;  1KD1 G;  1P4P A;  5H1S I;  3G71 E;  2FKG A;  1K73 G;  3CC4 E;  3CPW E;  3CKG A;  4WFA E;  1KC8 G;  5DM7 E;  1YIJ E;  4WFB E;  1FJ1 E;  1VQK E;  1RJL C;  1K8A G;  3CCV E;  4IOC E;  1YJW E;  1YHQ E;  4U67 E;  1M1K G;  3CCM E;  3CCU E;  3PIO E;  4UY8 G;  3CCQ E;  3CF5 E;  5HL7 E;  5B2A O;  2G8C O;  2QA4 E;  3OW2 E;  2QEX E;  2OY1 O;  5JVH E;  4IO9 E;  1Q7Y G;  1NJI G;  1YJN E;  2OL8 O;  3J7Z G;  1Q81 G;  3CD6 E;  1Q86 G;  3CCR E;  2ZJQ E; 
#chains in the Genus database with same CATH homology
 1YIT E;  3CMA E;  5DM6 E;  4IOA E;  4WFN E;  1M90 G;  1VQN E;  4WCE E;  1S72 E;  3G6E E;  1N8R G;  1KQS E;  2ZJP E;  3CC7 E;  1VQP E;  1K9M G;  1VQ8 E;  1YJ9 E;  3CCJ E;  2ZJR E;  5AN9 B;  5MLC H;  4WF9 E;  3CCS E;  3I55 E;  5JVG E;  1YI2 E;  1VQ9 E;  2OTL E;  5GAE G;  1VQ7 E;  1VQL E;  1VQM E;  1JJ2 E;  1VQ5 E;  1Q82 G;  5GAH G;  3DLL E;  2CQL A;  3G4S E;  3CXC E;  1QVG E;  1VQ4 E;  3PIP E;  1VQO E;  3CCL E;  3CC2 E;  1RL6 A;  3CCE E;  1VQ6 E;  2OTJ E;  5GAD G;  1QVF E;  3I56 E;  1W2B E;  3CME E;  5GAG G;  1KD1 G;  5H1S I;  3G71 E;  1K73 G;  3CC4 E;  3CPW E;  4WFA E;  1KC8 G;  5DM7 E;  1YIJ E;  4WFB E;  1VQK E;  1K8A G;  3CCV E;  4IOC E;  1YJW E;  1YHQ E;  4U67 E;  1M1K G;  3CCM E;  3CCU E;  3PIO E;  4UY8 G;  3CCQ E;  3CF5 E;  5HL7 E;  2QA4 E;  3OW2 E;  2QEX E;  5JVH E;  4IO9 E;  1Q7Y G;  1NJI G;  1YJN E;  3J7Z G;  1Q81 G;  3CD6 E;  1Q86 G;  3CCR E;  2ZJQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...