1VQ7E

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vq7E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vq7E01
3PIPE 3CCEE 1VQ9E 1VQME 1VQ7E 1Q86G 5JVHE 1KC8G 1KQSE 1K8AG 1VQOE 4IOCE 3OW2E 2QA4E 1VQNE 1VQ8E 4WFAE 1M90G 1YJWE 1YI2E 1YIJE 3CC4E 4UY8G 3PIOE 5MLCH 5JVGE 5DM6E 4IOAE 3CCUE 3CCSE 3CC7E 1KD1G 2OTJE 3I55E 3G6EE 1JJ2E 1YJ9E 3CD6E 3CF5E 1K73G 1NJIG 3CCLE 3CCQE 1VQ6E 5GAHG 5GAGG 1YJNE 1Q81G 4U67E 3CCVE 4IO9E 1QVFE 1YHQE 2ZJPE 1Q82G 1VQPE 3CMEE 1N8RG 3G4SE 5H1SI 3DLLE 3CPWE 3CC2E 4WF9E 5DM7E 1K9MG 3I56E 2ZJQE 3CCRE 1S72E 4WFBE 1W2BE 1VQKE 5GADG 3CXCE 3CCME 5GAEG 3CCJE 1QVGE 1YITE 1RL6A 1Q7YG 4WFNE 1M1KG 2ZJRE 3J7ZG 1VQLE 2QEXE 3G71E 4WCEE 5HL7E 3CMAE 1VQ4E 2CQLA 1VQ5E 2OTLE 5AN9B
chains in the Genus database with same CATH superfamily
1FJ1E 3CKGA 1RJLC 3PIPE 3CCEE 1VQ9E 1VQME 1VQ7E 1Q86G 5B11O 5JVHE 1KC8G 1KQSE 1K8AG 1VQOE 4IOCE 2OY5O 5B3MO 2OL8O 3OW2E 2QA4E 1VQNE 1VQ8E 4WFAE 1M90G 5B10O 2OY8A 1YJWE 3EC5A 1YI2E 3CC4E 1YIJE 2OYBO 4UY8G 3PIOE 5MLCH 5JVGE 5DM6E 4IOAE 3CCUE 3CCSE 2AF5A 1P4PA 3CC7E 1KD1G 2OTJE 3I55E 2OL7A 3G6EE 2FKJA 1JJ2E 1YJ9E 3CD6E 3CF5E 1K73G 1NJIG 3CCLE 2OL6O 3CCQE 1OSPO 1VQ6E 5GAHG 5GAGG 1YJNE 1Q81G 3IG9A 5B2AO 2FKGA 4U67E 2I5ZO 3CCVE 2OY7A 4IO9E 1QVFE 1YHQE 2ZJPE 3CKFA 1Q82G 1VQPE 3CMEE 1N8RG 3G4SE 5H1SI 3DLLE 3CPWE 3CC2E 4WF9E 2HKDA 5DM7E 1K9MG 3I56E 2ZJQE 3CCRE 2PI3O 3AUMO 4WFBE 1S72E 1W2BE 1VQKE 5GADG 3CXCE 3CCME 5GAEG 3CCJE 1QVGE 3IGEA 1YITE 1RL6A 2I5VO 1Q7YG 4WFNE 1M1KG 2ZJRE 2OY1O 3J7ZG 1VQLE 2QEXE 3G71E 4WCEE 5HL7E 3CMAE 1VQ4E 2G8CO 2CQLA 1VQ5E 2OTLE 5AN9B
chains in the Genus database with same CATH topology
3PIPE 3CCEE 1VQ9E 1VQME 1VQ7E 1Q86G 5JVHE 1KC8G 1KQSE 1K8AG 1VQOE 4IOCE 3OW2E 2QA4E 1VQNE 1VQ8E 4WFAE 1M90G 1YJWE 1YI2E 1YIJE 3CC4E 4UY8G 3PIOE 5MLCH 5JVGE 5DM6E 4IOAE 3CCUE 3CCSE 3CC7E 1KD1G 2OTJE 3I55E 3G6EE 1JJ2E 1YJ9E 3CD6E 3CF5E 1K73G 1NJIG 3CCLE 3CCQE 1VQ6E 5GAHG 5GAGG 1YJNE 1Q81G 4U67E 3CCVE 4IO9E 1QVFE 1YHQE 2ZJPE 1Q82G 1VQPE 3CMEE 1N8RG 3G4SE 5H1SI 3DLLE 3CPWE 3CC2E 4WF9E 5DM7E 1K9MG 3I56E 2ZJQE 3CCRE 1S72E 4WFBE 1W2BE 1VQKE 5GADG 3CXCE 3CCME 5GAEG 3CCJE 1QVGE 1YITE 1RL6A 1Q7YG 4WFNE 1M1KG 2ZJRE 3J7ZG 1VQLE 2QEXE 3G71E 4WCEE 5HL7E 3CMAE 1VQ4E 2CQLA 1VQ5E 2OTLE 5AN9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP E;  3CCE E;  1VQ9 E;  1VQM E;  1VQ7 E;  1Q86 G;  5JVH E;  1KC8 G;  1KQS E;  1K8A G;  1VQO E;  4IOC E;  3OW2 E;  2QA4 E;  1VQN E;  1VQ8 E;  4WFA E;  1M90 G;  1YJW E;  1YI2 E;  1YIJ E;  3CC4 E;  4UY8 G;  3PIO E;  5MLC H;  5JVG E;  5DM6 E;  4IOA E;  3CCU E;  3CCS E;  3CC7 E;  1KD1 G;  2OTJ E;  3I55 E;  3G6E E;  1JJ2 E;  1YJ9 E;  3CD6 E;  3CF5 E;  1K73 G;  1NJI G;  3CCL E;  3CCQ E;  1VQ6 E;  5GAH G;  5GAG G;  1YJN E;  1Q81 G;  4U67 E;  3CCV E;  4IO9 E;  1QVF E;  1YHQ E;  2ZJP E;  1Q82 G;  1VQP E;  3CME E;  1N8R G;  3G4S E;  5H1S I;  3DLL E;  3CPW E;  3CC2 E;  4WF9 E;  5DM7 E;  1K9M G;  3I56 E;  2ZJQ E;  3CCR E;  1S72 E;  4WFB E;  1W2B E;  1VQK E;  5GAD G;  3CXC E;  3CCM E;  5GAE G;  3CCJ E;  1QVG E;  1YIT E;  1RL6 A;  1Q7Y G;  4WFN E;  1M1K G;  2ZJR E;  3J7Z G;  1VQL E;  2QEX E;  3G71 E;  4WCE E;  5HL7 E;  3CMA E;  1VQ4 E;  2CQL A;  1VQ5 E;  2OTL E;  5AN9 B; 
#chains in the Genus database with same CATH topology
 1FJ1 E;  3CKG A;  1RJL C;  3PIP E;  3CCE E;  1VQ9 E;  1VQM E;  1VQ7 E;  1Q86 G;  5B11 O;  5JVH E;  1KC8 G;  1KQS E;  1K8A G;  1VQO E;  4IOC E;  2OY5 O;  5B3M O;  2OL8 O;  3OW2 E;  2QA4 E;  1VQN E;  1VQ8 E;  4WFA E;  1M90 G;  5B10 O;  2OY8 A;  1YJW E;  3EC5 A;  1YI2 E;  3CC4 E;  1YIJ E;  2OYB O;  4UY8 G;  3PIO E;  5MLC H;  5JVG E;  5DM6 E;  4IOA E;  3CCU E;  3CCS E;  2AF5 A;  1P4P A;  3CC7 E;  1KD1 G;  2OTJ E;  3I55 E;  2OL7 A;  3G6E E;  2FKJ A;  1JJ2 E;  1YJ9 E;  3CD6 E;  3CF5 E;  1K73 G;  1NJI G;  3CCL E;  2OL6 O;  3CCQ E;  1OSP O;  1VQ6 E;  5GAH G;  5GAG G;  1YJN E;  1Q81 G;  3IG9 A;  5B2A O;  2FKG A;  4U67 E;  2I5Z O;  3CCV E;  2OY7 A;  4IO9 E;  1QVF E;  1YHQ E;  2ZJP E;  3CKF A;  1Q82 G;  1VQP E;  3CME E;  1N8R G;  3G4S E;  5H1S I;  3DLL E;  3CPW E;  3CC2 E;  4WF9 E;  2HKD A;  5DM7 E;  1K9M G;  3I56 E;  2ZJQ E;  3CCR E;  2PI3 O;  3AUM O;  4WFB E;  1S72 E;  1W2B E;  1VQK E;  5GAD G;  3CXC E;  3CCM E;  5GAE G;  3CCJ E;  1QVG E;  3IGE A;  1YIT E;  1RL6 A;  2I5V O;  1Q7Y G;  4WFN E;  1M1K G;  2ZJR E;  2OY1 O;  3J7Z G;  1VQL E;  2QEX E;  3G71 E;  4WCE E;  5HL7 E;  3CMA E;  1VQ4 E;  2G8C O;  2CQL A;  1VQ5 E;  2OTL E;  5AN9 B; 
#chains in the Genus database with same CATH homology
 3PIP E;  3CCE E;  1VQ9 E;  1VQM E;  1VQ7 E;  1Q86 G;  5JVH E;  1KC8 G;  1KQS E;  1K8A G;  1VQO E;  4IOC E;  3OW2 E;  2QA4 E;  1VQN E;  1VQ8 E;  4WFA E;  1M90 G;  1YJW E;  1YI2 E;  1YIJ E;  3CC4 E;  4UY8 G;  3PIO E;  5MLC H;  5JVG E;  5DM6 E;  4IOA E;  3CCU E;  3CCS E;  3CC7 E;  1KD1 G;  2OTJ E;  3I55 E;  3G6E E;  1JJ2 E;  1YJ9 E;  3CD6 E;  3CF5 E;  1K73 G;  1NJI G;  3CCL E;  3CCQ E;  1VQ6 E;  5GAH G;  5GAG G;  1YJN E;  1Q81 G;  4U67 E;  3CCV E;  4IO9 E;  1QVF E;  1YHQ E;  2ZJP E;  1Q82 G;  1VQP E;  3CME E;  1N8R G;  3G4S E;  5H1S I;  3DLL E;  3CPW E;  3CC2 E;  4WF9 E;  5DM7 E;  1K9M G;  3I56 E;  2ZJQ E;  3CCR E;  1S72 E;  4WFB E;  1W2B E;  1VQK E;  5GAD G;  3CXC E;  3CCM E;  5GAE G;  3CCJ E;  1QVG E;  1YIT E;  1RL6 A;  1Q7Y G;  4WFN E;  1M1K G;  2ZJR E;  3J7Z G;  1VQL E;  2QEX E;  3G71 E;  4WCE E;  5HL7 E;  3CMA E;  1VQ4 E;  2CQL A;  1VQ5 E;  2OTL E;  5AN9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...