4U67E

Crystal structure of the large ribosomal subunit (50s) of deinococcus radiodurans containing a three residue insertion in l22
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4u67E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4u67E01
3CCJE 1QVFE 3CCSE 1Q7YG 1VQME 1VQNE 1NJIG 1KC8G 1YJ9E 2OTLE 5H1SI 3G4SE 1VQLE 3I56E 4IO9E 3G71E 1Q86G 1M90G 3CCME 4IOAE 1M1KG 2QEXE 3CC4E 3CC2E 3CCQE 4WFAE 1YJWE 1VQ4E 5GAHG 1K9MG 1VQ9E 3CMAE 3CCUE 5DM6E 3CCRE 1YI2E 5AN9B 3DLLE 2ZJRE 1KQSE 3CD6E 2QA4E 1N8RG 4WFBE 5HL7E 1VQ7E 3CMEE 3CCEE 3J7ZG 3CXCE 1YJNE 1W2BE 1YITE 3CF5E 1K73G 3OW2E 4UY8G 3G6EE 1VQ5E 3I55E 2OTJE 5GADG 2ZJPE 5JVHE 3CCVE 1VQOE 1VQ8E 3CPWE 4WCEE 1VQKE 5GAEG 3PIPE 1Q81G 3PIOE 5JVGE 4U67E 1S72E 1VQ6E 3CC7E 5MLCH 4WFNE 1Q82G 1K8AG 5DM7E 5GAGG 1YHQE 4IOCE 1VQPE 2CQLA 1YIJE 2ZJQE 1RL6A 4WF9E 1JJ2E 3CCLE 1QVGE 1KD1G
chains in the Genus database with same CATH superfamily
3CCJE 3EC5A 2OY8A 1QVFE 3CCSE 1Q7YG 1VQME 1VQNE 1NJIG 1KC8G 1YJ9E 2OTLE 5H1SI 1OSPO 3IGEA 2OY7A 3G4SE 1VQLE 3I56E 4IO9E 3G71E 1Q86G 1M90G 3CCME 4IOAE 1M1KG 2QEXE 3CC4E 3CC2E 2HKDA 3CCQE 4WFAE 1YJWE 2I5ZO 1VQ4E 2OYBO 2OL6O 5GAHG 1K9MG 1VQ9E 3CMAE 3CCUE 5B11O 5DM6E 3CCRE 1YI2E 3AUMO 5AN9B 3DLLE 2ZJRE 1KQSE 2AF5A 3CD6E 2FKJA 2QA4E 5B3MO 1N8RG 5B10O 3CKFA 3CKGA 4WFBE 5HL7E 1VQ7E 3CMEE 3CCEE 3J7ZG 2OY1O 3CXCE 1YJNE 1W2BE 1YITE 3CF5E 1K73G 3OW2E 4UY8G 3G6EE 1VQ5E 2FKGA 3I55E 2I5VO 2OTJE 5B2AO 2OL8O 5GADG 2ZJPE 5JVHE 3CCVE 2OL7A 1VQOE 1VQ8E 3CPWE 4WCEE 1VQKE 5GAEG 1FJ1E 3PIPE 1Q81G 3PIOE 5JVGE 4U67E 1S72E 1VQ6E 3CC7E 5MLCH 1P4PA 4WFNE 1Q82G 1K8AG 5DM7E 5GAGG 2G8CO 1YHQE 3IG9A 4IOCE 1VQPE 2CQLA 1RJLC 2OY5O 1YIJE 2PI3O 1RL6A 2ZJQE 4WF9E 1JJ2E 3CCLE 1QVGE 1KD1G
chains in the Genus database with same CATH topology
3CCJE 1QVFE 3CCSE 1Q7YG 1VQME 1VQNE 1NJIG 1KC8G 1YJ9E 2OTLE 5H1SI 3G4SE 1VQLE 3I56E 4IO9E 3G71E 1Q86G 1M90G 3CCME 4IOAE 1M1KG 2QEXE 3CC4E 3CC2E 3CCQE 4WFAE 1YJWE 1VQ4E 5GAHG 1K9MG 1VQ9E 3CMAE 3CCUE 5DM6E 3CCRE 1YI2E 5AN9B 3DLLE 2ZJRE 1KQSE 3CD6E 2QA4E 1N8RG 4WFBE 5HL7E 1VQ7E 3CMEE 3CCEE 3J7ZG 3CXCE 1YJNE 1W2BE 1YITE 3CF5E 1K73G 3OW2E 4UY8G 3G6EE 1VQ5E 3I55E 2OTJE 5GADG 2ZJPE 5JVHE 3CCVE 1VQOE 1VQ8E 3CPWE 4WCEE 1VQKE 5GAEG 3PIPE 1Q81G 3PIOE 5JVGE 4U67E 1S72E 1VQ6E 3CC7E 5MLCH 4WFNE 1Q82G 1K8AG 5DM7E 5GAGG 1YHQE 4IOCE 1VQPE 2CQLA 1YIJE 2ZJQE 1RL6A 4WF9E 1JJ2E 3CCLE 1QVGE 1KD1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ E;  1QVF E;  3CCS E;  1Q7Y G;  1VQM E;  1VQN E;  1NJI G;  1KC8 G;  1YJ9 E;  2OTL E;  5H1S I;  3G4S E;  1VQL E;  3I56 E;  4IO9 E;  3G71 E;  1Q86 G;  1M90 G;  3CCM E;  4IOA E;  1M1K G;  2QEX E;  3CC4 E;  3CC2 E;  3CCQ E;  4WFA E;  1YJW E;  1VQ4 E;  5GAH G;  1K9M G;  1VQ9 E;  3CMA E;  3CCU E;  5DM6 E;  3CCR E;  1YI2 E;  5AN9 B;  3DLL E;  2ZJR E;  1KQS E;  3CD6 E;  2QA4 E;  1N8R G;  4WFB E;  5HL7 E;  1VQ7 E;  3CME E;  3CCE E;  3J7Z G;  3CXC E;  1YJN E;  1W2B E;  1YIT E;  3CF5 E;  1K73 G;  3OW2 E;  4UY8 G;  3G6E E;  1VQ5 E;  3I55 E;  2OTJ E;  5GAD G;  2ZJP E;  5JVH E;  3CCV E;  1VQO E;  1VQ8 E;  3CPW E;  4WCE E;  1VQK E;  5GAE G;  3PIP E;  1Q81 G;  3PIO E;  5JVG E;  4U67 E;  1S72 E;  1VQ6 E;  3CC7 E;  5MLC H;  4WFN E;  1Q82 G;  1K8A G;  5DM7 E;  5GAG G;  1YHQ E;  4IOC E;  1VQP E;  2CQL A;  1YIJ E;  2ZJQ E;  1RL6 A;  4WF9 E;  1JJ2 E;  3CCL E;  1QVG E;  1KD1 G; 
#chains in the Genus database with same CATH topology
 3CCJ E;  3EC5 A;  2OY8 A;  1QVF E;  3CCS E;  1Q7Y G;  1VQM E;  1VQN E;  1NJI G;  1KC8 G;  1YJ9 E;  2OTL E;  5H1S I;  1OSP O;  3IGE A;  2OY7 A;  3G4S E;  1VQL E;  3I56 E;  4IO9 E;  3G71 E;  1Q86 G;  1M90 G;  3CCM E;  4IOA E;  1M1K G;  2QEX E;  3CC4 E;  3CC2 E;  2HKD A;  3CCQ E;  4WFA E;  1YJW E;  2I5Z O;  1VQ4 E;  2OYB O;  2OL6 O;  5GAH G;  1K9M G;  1VQ9 E;  3CMA E;  3CCU E;  5B11 O;  5DM6 E;  3CCR E;  1YI2 E;  3AUM O;  5AN9 B;  3DLL E;  2ZJR E;  1KQS E;  2AF5 A;  3CD6 E;  2FKJ A;  2QA4 E;  5B3M O;  1N8R G;  5B10 O;  3CKF A;  3CKG A;  4WFB E;  5HL7 E;  1VQ7 E;  3CME E;  3CCE E;  3J7Z G;  2OY1 O;  3CXC E;  1YJN E;  1W2B E;  1YIT E;  3CF5 E;  1K73 G;  3OW2 E;  4UY8 G;  3G6E E;  1VQ5 E;  2FKG A;  3I55 E;  2I5V O;  2OTJ E;  5B2A O;  2OL8 O;  5GAD G;  2ZJP E;  5JVH E;  3CCV E;  2OL7 A;  1VQO E;  1VQ8 E;  3CPW E;  4WCE E;  1VQK E;  5GAE G;  1FJ1 E;  3PIP E;  1Q81 G;  3PIO E;  5JVG E;  4U67 E;  1S72 E;  1VQ6 E;  3CC7 E;  5MLC H;  1P4P A;  4WFN E;  1Q82 G;  1K8A G;  5DM7 E;  5GAG G;  2G8C O;  1YHQ E;  3IG9 A;  4IOC E;  1VQP E;  2CQL A;  1RJL C;  2OY5 O;  1YIJ E;  2PI3 O;  1RL6 A;  2ZJQ E;  4WF9 E;  1JJ2 E;  3CCL E;  1QVG E;  1KD1 G; 
#chains in the Genus database with same CATH homology
 3CCJ E;  1QVF E;  3CCS E;  1Q7Y G;  1VQM E;  1VQN E;  1NJI G;  1KC8 G;  1YJ9 E;  2OTL E;  5H1S I;  3G4S E;  1VQL E;  3I56 E;  4IO9 E;  3G71 E;  1Q86 G;  1M90 G;  3CCM E;  4IOA E;  1M1K G;  2QEX E;  3CC4 E;  3CC2 E;  3CCQ E;  4WFA E;  1YJW E;  1VQ4 E;  5GAH G;  1K9M G;  1VQ9 E;  3CMA E;  3CCU E;  5DM6 E;  3CCR E;  1YI2 E;  5AN9 B;  3DLL E;  2ZJR E;  1KQS E;  3CD6 E;  2QA4 E;  1N8R G;  4WFB E;  5HL7 E;  1VQ7 E;  3CME E;  3CCE E;  3J7Z G;  3CXC E;  1YJN E;  1W2B E;  1YIT E;  3CF5 E;  1K73 G;  3OW2 E;  4UY8 G;  3G6E E;  1VQ5 E;  3I55 E;  2OTJ E;  5GAD G;  2ZJP E;  5JVH E;  3CCV E;  1VQO E;  1VQ8 E;  3CPW E;  4WCE E;  1VQK E;  5GAE G;  3PIP E;  1Q81 G;  3PIO E;  5JVG E;  4U67 E;  1S72 E;  1VQ6 E;  3CC7 E;  5MLC H;  4WFN E;  1Q82 G;  1K8A G;  5DM7 E;  5GAG G;  1YHQ E;  4IOC E;  1VQP E;  2CQL A;  1YIJ E;  2ZJQ E;  1RL6 A;  4WF9 E;  1JJ2 E;  3CCL E;  1QVG E;  1KD1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...