3CC7E

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cc7E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3cc7E01
5GAEG 1VQOE 3CCME 3CC7E 1KD1G 5GADG 4WF9E 3CC2E 2ZJPE 1K9MG 3CCRE 5AN9B 3G71E 5GAHG 4UY8G 1YHQE 1YJWE 1N8RG 1VQKE 4IO9E 1VQPE 4WFBE 1VQ6E 3CF5E 3CMEE 1W2BE 1KQSE 3CCJE 1QVFE 5MLCH 1VQLE 3CCSE 1M1KG 3J7ZG 3PIPE 1RL6A 3OW2E 1YIJE 3DLLE 5H1SI 1JJ2E 4IOAE 3CMAE 1NJIG 3I55E 3CCLE 1YJ9E 1VQ8E 3CXCE 5JVGE 3CCUE 1K8AG 3CPWE 5HL7E 3I56E 1K73G 2QA4E 4WFAE 4WFNE 1YJNE 3CC4E 2OTLE 3CCEE 5DM6E 5GAGG 2QEXE 4U67E 1Q81G 1S72E 1Q86G 3CCVE 1M90G 1VQ4E 2ZJRE 4IOCE 3G4SE 4WCEE 1Q7YG 3PIOE 1YI2E 1VQ9E 5DM7E 1VQ5E 1VQNE 3CD6E 3CCQE 2ZJQE 2CQLA 1QVGE 1YITE 2OTJE 1Q82G 1VQ7E 1KC8G 3G6EE 1VQME 5JVHE
chains in the Genus database with same CATH superfamily
3CKGA 5GAEG 1VQOE 3CCME 3CC7E 1KD1G 2I5VO 5GADG 4WF9E 3CC2E 2ZJPE 2FKJA 5B10O 1K9MG 3CCRE 1FJ1E 5AN9B 3G71E 5GAHG 4UY8G 1YHQE 1YJWE 1N8RG 1VQKE 2FKGA 4IO9E 1VQPE 4WFBE 1VQ6E 2AF5A 3CF5E 3CMEE 1W2BE 1KQSE 3CCJE 1QVFE 5MLCH 1VQLE 3CCSE 1M1KG 3J7ZG 3PIPE 1RL6A 5B11O 3IG9A 2OY8A 2OY7A 3AUMO 3OW2E 2PI3O 1YIJE 3DLLE 3CKFA 5H1SI 1JJ2E 2OL7A 4IOAE 3CMAE 1NJIG 3I55E 3CCLE 1YJ9E 1VQ8E 3CXCE 5JVGE 3CCUE 2OL6O 3EC5A 1K8AG 3CPWE 5HL7E 1OSPO 3I56E 1K73G 2QA4E 4WFAE 4WFNE 1YJNE 1RJLC 2OY5O 3CC4E 3CCEE 2OTLE 5DM6E 5GAGG 2QEXE 5B3MO 4U67E 2G8CO 1Q81G 2OYBO 1S72E 1Q86G 3CCVE 1M90G 1VQ4E 2ZJRE 4IOCE 3G4SE 4WCEE 1Q7YG 3PIOE 1YI2E 1VQ9E 5DM7E 1VQ5E 1VQNE 3CD6E 1P4PA 2OY1O 3CCQE 3IGEA 2ZJQE 2CQLA 1QVGE 1YITE 2OTJE 1Q82G 1VQ7E 2HKDA 5B2AO 1KC8G 3G6EE 1VQME 2I5ZO 5JVHE 2OL8O
chains in the Genus database with same CATH topology
5GAEG 1VQOE 3CCME 3CC7E 1KD1G 5GADG 4WF9E 3CC2E 2ZJPE 1K9MG 3CCRE 5AN9B 3G71E 5GAHG 4UY8G 1YHQE 1YJWE 1N8RG 1VQKE 4IO9E 1VQPE 4WFBE 1VQ6E 3CF5E 3CMEE 1W2BE 1KQSE 3CCJE 1QVFE 5MLCH 1VQLE 3CCSE 1M1KG 3J7ZG 3PIPE 1RL6A 3OW2E 1YIJE 3DLLE 5H1SI 1JJ2E 4IOAE 3CMAE 1NJIG 3I55E 3CCLE 1YJ9E 1VQ8E 3CXCE 5JVGE 3CCUE 1K8AG 3CPWE 5HL7E 3I56E 1K73G 2QA4E 4WFAE 4WFNE 1YJNE 3CC4E 2OTLE 3CCEE 5DM6E 5GAGG 2QEXE 4U67E 1Q81G 1S72E 1Q86G 3CCVE 1M90G 1VQ4E 2ZJRE 4IOCE 3G4SE 4WCEE 1Q7YG 3PIOE 1YI2E 1VQ9E 5DM7E 1VQ5E 1VQNE 3CD6E 3CCQE 2ZJQE 2CQLA 1QVGE 1YITE 2OTJE 1Q82G 1VQ7E 1KC8G 3G6EE 1VQME 5JVHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE G;  1VQO E;  3CCM E;  3CC7 E;  1KD1 G;  5GAD G;  4WF9 E;  3CC2 E;  2ZJP E;  1K9M G;  3CCR E;  5AN9 B;  3G71 E;  5GAH G;  4UY8 G;  1YHQ E;  1YJW E;  1N8R G;  1VQK E;  4IO9 E;  1VQP E;  4WFB E;  1VQ6 E;  3CF5 E;  3CME E;  1W2B E;  1KQS E;  3CCJ E;  1QVF E;  5MLC H;  1VQL E;  3CCS E;  1M1K G;  3J7Z G;  3PIP E;  1RL6 A;  3OW2 E;  1YIJ E;  3DLL E;  5H1S I;  1JJ2 E;  4IOA E;  3CMA E;  1NJI G;  3I55 E;  3CCL E;  1YJ9 E;  1VQ8 E;  3CXC E;  5JVG E;  3CCU E;  1K8A G;  3CPW E;  5HL7 E;  3I56 E;  1K73 G;  2QA4 E;  4WFA E;  4WFN E;  1YJN E;  3CC4 E;  2OTL E;  3CCE E;  5DM6 E;  5GAG G;  2QEX E;  4U67 E;  1Q81 G;  1S72 E;  1Q86 G;  3CCV E;  1M90 G;  1VQ4 E;  2ZJR E;  4IOC E;  3G4S E;  4WCE E;  1Q7Y G;  3PIO E;  1YI2 E;  1VQ9 E;  5DM7 E;  1VQ5 E;  1VQN E;  3CD6 E;  3CCQ E;  2ZJQ E;  2CQL A;  1QVG E;  1YIT E;  2OTJ E;  1Q82 G;  1VQ7 E;  1KC8 G;  3G6E E;  1VQM E;  5JVH E; 
#chains in the Genus database with same CATH topology
 3CKG A;  5GAE G;  1VQO E;  3CCM E;  3CC7 E;  1KD1 G;  2I5V O;  5GAD G;  4WF9 E;  3CC2 E;  2ZJP E;  2FKJ A;  5B10 O;  1K9M G;  3CCR E;  1FJ1 E;  5AN9 B;  3G71 E;  5GAH G;  4UY8 G;  1YHQ E;  1YJW E;  1N8R G;  1VQK E;  2FKG A;  4IO9 E;  1VQP E;  4WFB E;  1VQ6 E;  2AF5 A;  3CF5 E;  3CME E;  1W2B E;  1KQS E;  3CCJ E;  1QVF E;  5MLC H;  1VQL E;  3CCS E;  1M1K G;  3J7Z G;  3PIP E;  1RL6 A;  5B11 O;  3IG9 A;  2OY8 A;  2OY7 A;  3AUM O;  3OW2 E;  2PI3 O;  1YIJ E;  3DLL E;  3CKF A;  5H1S I;  1JJ2 E;  2OL7 A;  4IOA E;  3CMA E;  1NJI G;  3I55 E;  3CCL E;  1YJ9 E;  1VQ8 E;  3CXC E;  5JVG E;  3CCU E;  2OL6 O;  3EC5 A;  1K8A G;  3CPW E;  5HL7 E;  1OSP O;  3I56 E;  1K73 G;  2QA4 E;  4WFA E;  4WFN E;  1YJN E;  1RJL C;  2OY5 O;  3CC4 E;  3CCE E;  2OTL E;  5DM6 E;  5GAG G;  2QEX E;  5B3M O;  4U67 E;  2G8C O;  1Q81 G;  2OYB O;  1S72 E;  1Q86 G;  3CCV E;  1M90 G;  1VQ4 E;  2ZJR E;  4IOC E;  3G4S E;  4WCE E;  1Q7Y G;  3PIO E;  1YI2 E;  1VQ9 E;  5DM7 E;  1VQ5 E;  1VQN E;  3CD6 E;  1P4P A;  2OY1 O;  3CCQ E;  3IGE A;  2ZJQ E;  2CQL A;  1QVG E;  1YIT E;  2OTJ E;  1Q82 G;  1VQ7 E;  2HKD A;  5B2A O;  1KC8 G;  3G6E E;  1VQM E;  2I5Z O;  5JVH E;  2OL8 O; 
#chains in the Genus database with same CATH homology
 5GAE G;  1VQO E;  3CCM E;  3CC7 E;  1KD1 G;  5GAD G;  4WF9 E;  3CC2 E;  2ZJP E;  1K9M G;  3CCR E;  5AN9 B;  3G71 E;  5GAH G;  4UY8 G;  1YHQ E;  1YJW E;  1N8R G;  1VQK E;  4IO9 E;  1VQP E;  4WFB E;  1VQ6 E;  3CF5 E;  3CME E;  1W2B E;  1KQS E;  3CCJ E;  1QVF E;  5MLC H;  1VQL E;  3CCS E;  1M1K G;  3J7Z G;  3PIP E;  1RL6 A;  3OW2 E;  1YIJ E;  3DLL E;  5H1S I;  1JJ2 E;  4IOA E;  3CMA E;  1NJI G;  3I55 E;  3CCL E;  1YJ9 E;  1VQ8 E;  3CXC E;  5JVG E;  3CCU E;  1K8A G;  3CPW E;  5HL7 E;  3I56 E;  1K73 G;  2QA4 E;  4WFA E;  4WFN E;  1YJN E;  3CC4 E;  2OTL E;  3CCE E;  5DM6 E;  5GAG G;  2QEX E;  4U67 E;  1Q81 G;  1S72 E;  1Q86 G;  3CCV E;  1M90 G;  1VQ4 E;  2ZJR E;  4IOC E;  3G4S E;  4WCE E;  1Q7Y G;  3PIO E;  1YI2 E;  1VQ9 E;  5DM7 E;  1VQ5 E;  1VQN E;  3CD6 E;  3CCQ E;  2ZJQ E;  2CQL A;  1QVG E;  1YIT E;  2OTJ E;  1Q82 G;  1VQ7 E;  1KC8 G;  3G6E E;  1VQM E;  5JVH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...