2OL7A

The crystal structure of ospa mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
250
structure length
250
Chain Sequence
b'SHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKIIIDGIIIEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title beta-Strand Flipping and Slipping Triggered by Turn Replacement Reveal the Opportunistic Nature of beta-Strand Pairing
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 49
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2ol7A01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2ol7A02
3AUMO 3CKGA 2OYBO 2OL7A 2AF5A 5B3MO 2I5ZO 1P4PA 2FKJA 2OY5O 2HKDA 1OSPO 2OL8O 2OY8A 2OY1O 5B2AO 2OY7A 3CKFA 2PI3O 2I5VO 3EC5A 5B10O 2OL6O 2FKGA 5B11O 2G8CO 1FJ1E
chains in the Genus database with same CATH superfamily
3AUMO 4WHIA 4WFNE 1DC9A 4AZPA 1VWKB 5H9LA 1MOYA 3OBLA 1SWUA 2IZKA 4BX6A 4DNEA 4AW8A 4Y5DA 4QNIA 4CPFA 4O4UA 2AVIA 5HZ6A 2RD7C 1GKAA 3P24A 3V8UA 1I78A 1W2BE 1VQNE 5K67A 1KQXA 1VWLB 1X8UA 3X00A 2LBAA 1KT3A 4ZJ0A 2O62A 3NP1A 4OS0A 1N4JA 3RE6A 2HYSA 3G6EE 1KL3A 1FJ1E 1QVGE 1QY2A 4FBVA 2L68A 5JVHE 3I17A 3PIOE 1LDQA 3BSZE 1JV4A 4UY8G 3CMEE 2R74A 5D48A 2X32A 1SWFA 1HQQA 2ACPX 3HWGA 4FGIB 2IZDB 1JJUA 1OEJA 3ZUIA 4BGFA 3CQRA 2WQAE 1KT4A 1ZNEA 2KT4B 2RTQB 4UU3A 1E2TA 4IAWA 2M4LA 1SWNA 1ACDA 4Z2OA 1LCZA 4A8ZA 3EMMA 5MLCH 3CCUE 1BWYA 1AVGI 2Y32A 4ODDA 2IZJA 1KQSE 3FMZA 1FENA 3FA7A 4U8UO 1EIOA 1SWPA 2F09A 1STRB 2OVAA 4XMFA 1JJ2E 1JYJA 1VWAB 1EPAA 1FEMA 3FEPA 3RSWA 1AELA 2RTFB 4ZHHA 1SWKA 3T6LA 3AKMA 4CK4A 3FLLA 1KZXA 2F01A 1UZ2X 2JU7A 2MJIA 1ALBA 1HY2A 1YWBA 2NNQA 3VGWA 1VWNB 4Z2VA 3LTWA 2Y3EA 3D96A 1NQMA 4GD9A 3J7ZG 1M1KG 3S5XA 5LJEA 1G85A 1VWMB 4JHQA 5KHPA 2BSZA 1K8AG 4A1YA 1W6FA 5LJCA 2X8FA 2IZEB 5CSEA 1VQ4E 3HK1A 1SWJA 2CZTA 3VG6A 5KIDA 1SA8A 5DG4A 2AKQA 2OFMX 5LJDA 4ORYA 5H9KA 2RCTA 1ZNHA 3WJCA 3G4SE 2HLVA 2WWPA 1N9YA 3LHNA 1GX9A 4U3QA 2OVEA 1HBPA 3CXCE 4GNWA 2ZSCA 2UYWA 3SAOA 1VWPB 4BBOA 4WFBE 1R0UA 2ASNX 3OD9A 4EXZA 1GXAA 1D3SA 5EDBA 1SLFB 3SZJA 4K19A 1VYGA 3CCLE 2OTLE 4YH0A 5D45A 4D6AA 2OFBA 3C76X 1AVEA 2IZCB 1XCAA 4MVLA 3PQUA 1SWGA 1SRGA 1E5PA 1Y52X 3B2LA 1HMSA 1O1UA 3NBXX 2CM4A 3EBWA 5HZQA 4PJ2A 3UAQA 2G78A 3ZWEA 3P6DA 3CCJE 2FWVA 4XMCA 3U9PC 4U46A 1CBSA 1SRHA 1TOUA 4IOCE 1GKAB 3WVMA 3PH5A 4N7DA 1TXLA 5GADG 1WBIA 3CKFA 2OL6O 4IOAE 5CYBA 1JJJA 1RXHA 4TKHA 2RTRB 1VWHB 3KFFA 5EZ2A 3KFGA 4BX7B 4OMWA 2ZAGA 2RTAA 3FR5A 1QY1A 3ZUOA 5AJBA 4DQ3A 3CMAE 4I3CA 2IZHB 1X8PA 1JBHA 3RKGA 5FFHA 2Q2MA 1NP1A 4OS8A 1VWFB 5FENA 4U67E 3RZYA 2RTJA 3APVA 1N8RG 4AYHA 1SXWA 1DF3A 3OE3A 4AZQA 2OF8A 1A2DA 1HQPA 1OBUA 4EKVA 5FQ7E 4C5PA 3NQ9A 3RY1A 3IFBA 3MM0A 4CDCA 3K3LA 2OFRX 1A3YA 1JYDA 3B2KA 2FHLA 1HXLA 3VU1A 1PBYA 4OELA 3STNA 1W4TA 1SRJA 5H9NA 4XMGA 4BX5A 5B5GA 2FR2A 4MVEA 3ZW0A 4TNNA 3ZZVA 1UYNX 2FKJA 1YWAA 4MVKA 4IMNA 3FW4A 4GNYA 1BM5A 1NC9A 1I4UA 2G5LA 3WYQA 1ML7A 1X89A 5AEOA 2ZJQE 3KVNA 3VG7A 3PEDA 3HPEA 3NX1A 4CPHA 3FR2A 4YKMA 4A1HA 5HCCC 1VQ7E 3CWKA 4L3RA 3KFHA 3CF5E 1FELA 1YWCA 1MDCA 4IB7A 1YITE 5H8TA 2WQ9A 3KFIA 3VHIA 1VYFA 2OF9A 1QFVA 2KD2A 2CZUA 4Y0RA 1Y9TA 3P6EA 1SLEB 1AQBA 3NADA 5CHKA 4ZHGA 4O4SA 1YIVA 1DZJA 3EC5A 3WZQA 3UEUA 2GTLM 5LJGA 5HA1A 3O22A 4ZH6A 2W2AA 2X34A 2QO5A 1S72E 1GT3A 5IRAA 1CBRA 2VFBA 4O3WA 4ORUA 2RTHB 4I3BA 3BU9A 3WZPA 5AN9B 4D6BA 1VWRB 3EM0A 1Q86G 4YBPA 3G71E 4I9SA 2L5PA 2X56A 1SXXA 1BLRA 4O3ZA 5B2AO 4BQUA 2RTGB 2FHNX 5K06A 2MHDA 5JVGE 1BEBA 2Q39A 4EQAC 3U0DA 1OEEA 4XMHA 5C0NA 3CC4E 1PTSA 3D95A 3WJFA 5IXGA 4U8UM 3B2IA 5GAEG 1A18A 3SLTA 2LB6A 2A2GA 2RQ0A 1STSB 4HPAA 3TGBA 2WR6A 1STPA 1MVGA 2OVDA 2X4MA 2BT9A 3TGCA 1YJNE 1IIUA 4WFUA 1SWQA 5F6ZA 4GGTA 2GTLO 3JS1A 2Q9SA 2AL0X 1PBOA 4Z2PA 1Q82G 1KL5A 4YDAA 4CV7A 1SMPI 2FR3A 4Y0QA 4TJZA 2OZQA 1JJXA 2LFOA 2DM5A 1VQLE 2A13A 2MM3A 5LJHA 2A8GA 1HN2A 3SLJA 2OL8O 5L8NA 5DPQA 2OY7A 4XMDA 1SXYA 4BX5B 1VWIB 3NX2A 3RDUA 1OBQA 1RAVA 1S44A 1KL4A 3CR6A 4YFRA 3APWA 2AT3X 2X45A 2KW1A 1B56A 3BX8A 2I5ZO 1EQDA 3WBGA 5HAEA 1ICMA 4Z27A 1G7NA 3N91A 5GAHG 4IRWA 1RSTB 1Q81G 2G79A 1DV9A 5B5FA 3F9DA 2QCBA 4ORWA 3D97A 1KFFA 1QVFE 1ZNGA 1QQSA 2X55A 3I0AA 1I04A 3PH6A 1SWLA 2Z4IA 2OFAA 4O4OA 1KQWA 4NYRA 1T68X 1BSQA 1O8VA 2RTCB 2C1SA 5H9AA 3EBKA 2PY1A 2IFBA 1H91A 2MWHA 3CD6E 2ANSA 5B27A 2VFCA 4I3DA 3CCSE 3UEWA 4YGZA 4M7MA 1YHQE 1KT6A 3VE2A 3C78X 3CBCA 3VG4A 3KQ0A 1VWEB 5L3YA 5AJCA 1BSYA 1YWDA 1S2PA 4KC8A 3VE1A 1PEEA 3HWEA 1MUPA 1K73G 5JD2A 4ALBA 4ARHA 3E3CA 1LNMA 3S5VA 4KT5A 2KTDA 3FEKA 4GRJA 2OTJE 4EFGA 5HWZA 1XKIA 3ZW1A 2HNXA 1GT5A 2X8TA 2IZGB 1KGLA 1SRFA 3IA8A 3CC7E 3CCVE 2LKKA 1NDJA 4AZOA 3RDQA 5F7GA 5KICA 2GJ5A 4ORRA 1N9MA 3APUA 1U0XA 3FDCA 5BVSA 1MM9A 4YDBA 4NNSA 3FENA 2MF6A 3D9WA 2WPUA 1QG5A 2HKDA 1SWBA 4GJSA 1CBIA 1AVDA 4ZR2A 5EDCA 2EU7X 3KZAA 4BX6B 3P6HA 5BVTA 1SWOA 1VWDB 3CCRE 3NQKA 1P4PA 3BX7A 3CCEE 2RTBB 4YFPA 1GX8A 4PSQA 1MEPA 2JGSA 1BSOA 3EYCA 3DTQA 5HZ9A 3TGAA 2A2UA 1BBPA 1KOIA 3FW5A 1VQME 3PECA 1BRQA 3Q6LA 4DQ4A 1DZMA 1GGLA 1P6PA 2YMSA 3FA8A 2FKGA 1E00A 4NW4A 1AB0A 5HTDA 3FIDA 4NNTA 3OW2E 2XKLA 3BLGA 1KD1G 2OY5O 3FR4A 2ALLX 1OSPO 3CBSA 1LKEA 4CDEA 1I06A 4WCEE 4LQZA 3C77X 3L4RA 3BY0A 4QGWA 1ADLA 4ZHDA 2OL7A 1L6MA 4O9SA 1LCVA 3PP6A 3TZSA 1DZKA 4ZHCA 4B55A 1SY2A 1MX8A 4YVBA 3WZOA 3S26A 1G74A 1I9HA 2RTDB 2RTOB 4TQ2A 5HTEA 1QY0A 3FIQA 4EEJA 4GDAA 1YJWE 3PQSA 2A5CA 5LJBA 3WJBA 1SWAA 2NNDA 1LIBA 4CPIA 1LFOA 3WYPA 2L9CA 1IKJA 1QABE 3RDMA 2QM9A 2JU8A 5EPQA 2RTLA 3TF6A 3P6CA 3OJYC 4I60A 1DF8A 1GX3A 3D4RA 5L8IA 3UEXA 1SY1A 3SOTA 5GAGG 4A60A 4WBKA 1K9MG 4QZTA 1KXOA 3VG3A 3MG5A 4N7CA 2BC3A 4Y0SA 1IKEA 1EI5A 4CSBA 2GTFX 4U9CA 1HMTA 3RDOA 3AKNA 1T8VA 1KT7A 1S7DA 4HFOA 1GT1A 1YIJE 1SWTA 4ZGUA 2K23A 4QQ1A 5BYPA 2POAA 1I05A 1RSUB 3NQ3A 5B29A 5EEDA 4GUZA 2JN3A 1ICNA 5DM7E 1VWBB 2GC9A 2FGSA 1IFCA 3F8AA 1QWDA 5F2BA 2ZAIA 3P02A 1ZNDA 4HPBA 4O49A 2AMMX 1VQPE 1SXUA 4ZH9A 2JOZA 2QOSC 1FDQA 1W5RA 3SZHA 5K68A 1VQ9E 2BHVA 5IO6A 5D4AA 4QGXA 5BVQA 2IZBA 3HOLA 3ZI8A 3F6ZB 2OY8A 1LPJA 3CQNA 4MVIA 1VQ5E 2R56A 1NP4A 2RTNB 1U17A 3VHHA 1UREA 4TKJA 1SWDA 1TOWA 1VQKE 2BS6A 3JSQA 1RXKA 4GGRA 3FA6A 4GKCA 2I5VO 2UZ2A 1CRBA 1LIDA 2OVSA 5DM6E 4FBOA 1CBQA 4NYQA 2RTIB 3B2HA 3DLLE 3NR3A 4GK9A 4MIRA 4CPEA 1VQ6E 1EW3A 2FLJA 5IO5A 4WFAE 4AZRA 3HTYA 3BS2A 2DJGA 2IZIA 1VQ8E 2WEWA 1E06A 1LIFA 4QAEA 4YGGA 2FS6A 1NQNA 2AT8X 3ELZA 3RDXA 4INNA 3STKA 4NV7A 1OPAA 3NPOA 1B8EA 2AF5A 3CC2E 4KH8A 4GH7A 1EUOA 1FTPA 2OY1O 1E02A 1Y0GA 5B10O 2CBRA 1EALA 2IZAA 1SWCA 3T6FA 1Y53X 2HMBA 5F58A 1OBPA 3WJEA 1NJIG 4OKAA 5AQ6A 4YMYA 2FT9A 1N0SA 1SLGB 2L67A 4BX7A 4OEMA 4YKOA 2IZLB 1LUQA 2AH7X 1O1VA 2WEXA 4EDEA 3IGEA 4KCAA 4CDFA 3I55E 4KIIA 4ORSA 2CM9A 2A3FX 3T1DA 1RBPA 4RUUA 3ZW0B 2FS7A 3HWFA 4YFQA 2Q2PA 4ALOA 1JMZA 1VWCB 4O3YA 4R0BA 1ZRYA 5FQ8E 5HBSA 4IAXA 5LKFA 1YJ9E 1SWSA 4O4XA 4YBUA 3CMPA 4L1NA 4Y0PA 1IFBA 3G7XA 5B3MO 4DCBA 4KC7A 3HOEA 3PPTA 2QO4A 2HZRA 4AZNA 4CPHB 1LELA 4GE1A 1EIIA 4COTA 4ZHFA 1VWGB 2QOMA 2RN4A 2JU3A 1SWEA 1SREA 4YCEA 1DZPA 4QGVA 4ES7A 4GDZA 4XMEA 4TKBA 2KTSA 1Y9LA 5FQ6E 3PDFA 1ZNKA 1YP7A 5JR8A 1X71A 1X8QA 2JMBA 1VPRA 4IO9E 5CE4A 2ZJRE 1JQPA 1WUBA 1U18A 4OS3A 1SRIA 5HCDC 1SY3A 4MISA 2XSTA 1YP6A 2GTLN 1DFVA 3EW1A 1RL6A 4RUNA 2Y3FA 1Z24A 4NV8A 1HXZA 4LZVA 1SLDB 3FA9A 4MEEA 5FAZA 3WOVA 4I95A 4O3XB 4IB8A 4LZUA 4ZFXA 3RWXA 1OEKA 2PI3O 3H3IA 4TLJA 1VWOB 3BRNA 1NBXA 2JW1A 4JO6A 2DJFA 4IBAA 4BCSA 1JIWI 4CDDA 4ON1A 1VQOE 4JNJA 3PK2A 4IB9A 2X8SA 3AEHA 5L8OA 2NP1A 4GJVA 5F1EA 4IB6A 3SLOA 2C1QA 1EXSA 4U8UN 1KT5A 3VHMA 1JZUA 4IMOA 3LV4A 1MK5A 2RA6A 1IJ8A 2OYBO 4I6SA 1K24A 1CJ5A 1VYOA 2WSJA 3DSZA 2W2FA 3UEVA 2FRSA 2BLGA 1B4MA 3ZQ3A 1G5WA 1UYOX 1T0VA 3WJGA 3SZIA 1MX7A 2CBSA 1QFTA 2WUTA 1YI2E 3VG5A 2G8CO 3FYFA 4BJ8A 3CCME 4GETA 2Z4HA 2QEXE 4BOEA 2E4JA 4YGHA 5F6BA 5D8JA 2A5BA 2AT6X 1SWRA 1IW2A 2ZJPE 4AZMA 2QA4E 3EW2A 2LBVA 1SY0A 3RDSA 5IRWA 1BJ7A 3ZW2A 3FELA 1LCWA 3RBYA 3T2WA 1GT4A 3MVFA 3GAQA 3QKGA 3O19A 5HL7E 1LICA 3WJDA 3ELXA 1SWHA 1HMRA 2QO6A 4JGLA 2RTKA 3CCQE 1B0OA 2RTEB 3JQOA 1KC8G 1N7YA 1BRPA 3IG9A 4HWMA 4ZGFA 3STMX 2CAMA 3CKGA 4Z6JA 2IZFB 3VG2A 3PIPE 4FBRA 1Y55X 3B2JA 3VPJE 2ACOA 3P6GA 2N93A 4ORXA 5HZ5A 4QYNA 5HCEC 2Q4NA 2NNEA 1Q7YG 1LF7A 2K62A 1X8OA 5HZ8A 3T2XA 1RXJA 4WF9E 2AT0X 4ZCBA 4ID2A 4GZVA 2QMIA 4QRLA 5IO7A 4GGZA 5B11O 2RTPB 3RE5A 1LIEA 4FQBB 3Q34A 1TW4A 4OMXA 2X46A 3RY2A 4QYPA 1ERXA 5LKEA 1X8NA 2RCQA 1ERBA 2FTBA 3BU1A 2A0AA 3I56E 2GH7A 2R73A 4IABA 3S60A 3MBTA 4NP1A 1FE3A 2C4IA 2F73A 3HWDA 1M90G 2W2BA 1VWQB 1NGLA 4HPCA 1LDOA 4UU2A 1PMPA 1EPBA 3QQ2A 4NLIA 5LJKA 2P8GA 1KZWA 5D47A 2G7BA 3ZW1B 4M6SA 4WFVA 1N43A 2RTMA 1K3BA 1HBQA 2AT5X 2YG2A 2VDFA 1TVQA 4Z28A 4NLJA 3WZNA 1OPBA 2BS5A 2CQLA 5HA0A 3BDRA 5IRUA 4QZUA 1ZNLA 3CPWE 1JMXA 1D2UA 4ML7B 1A57A 1VWJB 3APXA 4BVMA 1PM1X 4LKPA 3MX7A 2LA7A 4HPDA 5EEEA 4YCHA 4LKTA 3U03A 1RJLC 1RLBE 1GM6A 4I9RA 3GE2A 3P6FA 4Y59A 2HZQA 5H1SI 3O2YA 3WXQA 1YUPA 2MO5A 4GU8A
chains in the Genus database with same CATH topology
3AUMO 3CKGA 2OYBO 2OL7A 3IGEA 2AF5A 5B3MO 2I5ZO 1P4PA 1RJLC 2FKJA 2OY5O 2HKDA 1OSPO 2OL8O 2OY8A 2OY1O 5B2AO 2OY7A 3CKFA 2PI3O 2I5VO 3EC5A 5B10O 2OL6O 2FKGA 5B11O 2G8CO 3IG9A 1FJ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUM O;  3CKG A;  2OYB O;  2OL7 A;  2AF5 A;  5B3M O;  2I5Z O;  1P4P A;  2FKJ A;  2OY5 O;  2HKD A;  1OSP O;  2OL8 O;  2OY8 A;  2OY1 O;  5B2A O;  2OY7 A;  3CKF A;  2PI3 O;  2I5V O;  3EC5 A;  5B10 O;  2OL6 O;  2FKG A;  5B11 O;  2G8C O;  1FJ1 E; 
#chains in the Genus database with same CATH topology
 3AUM O;  4WHI A;  4WFN E;  1DC9 A;  4AZP A;  1VWK B;  5H9L A;  1MOY A;  3OBL A;  1SWU A;  2IZK A;  4BX6 A;  4DNE A;  4AW8 A;  4Y5D A;  4QNI A;  4CPF A;  4O4U A;  2AVI A;  5HZ6 A;  2RD7 C;  1GKA A;  3P24 A;  3V8U A;  1I78 A;  1W2B E;  1VQN E;  5K67 A;  1KQX A;  1VWL B;  1X8U A;  3X00 A;  2LBA A;  1KT3 A;  4ZJ0 A;  2O62 A;  3NP1 A;  4OS0 A;  1N4J A;  3RE6 A;  2HYS A;  3G6E E;  1KL3 A;  1FJ1 E;  1QVG E;  1QY2 A;  4FBV A;  2L68 A;  5JVH E;  3I17 A;  3PIO E;  1LDQ A;  3BSZ E;  1JV4 A;  4UY8 G;  3CME E;  2R74 A;  5D48 A;  2X32 A;  1SWF A;  1HQQ A;  2ACP X;  3HWG A;  4FGI B;  2IZD B;  1JJU A;  1OEJ A;  3ZUI A;  4BGF A;  3CQR A;  2WQA E;  1KT4 A;  1ZNE A;  2KT4 B;  2RTQ B;  4UU3 A;  1E2T A;  4IAW A;  2M4L A;  1SWN A;  1ACD A;  4Z2O A;  1LCZ A;  4A8Z A;  3EMM A;  5MLC H;  3CCU E;  1BWY A;  1AVG I;  2Y32 A;  4ODD A;  2IZJ A;  1KQS E;  3FMZ A;  1FEN A;  3FA7 A;  4U8U O;  1EIO A;  1SWP A;  2F09 A;  1STR B;  2OVA A;  4XMF A;  1JJ2 E;  1JYJ A;  1VWA B;  1EPA A;  1FEM A;  3FEP A;  3RSW A;  1AEL A;  2RTF B;  4ZHH A;  1SWK A;  3T6L A;  3AKM A;  4CK4 A;  3FLL A;  1KZX A;  2F01 A;  1UZ2 X;  2JU7 A;  2MJI A;  1ALB A;  1HY2 A;  1YWB A;  2NNQ A;  3VGW A;  1VWN B;  4Z2V A;  3LTW A;  2Y3E A;  3D96 A;  1NQM A;  4GD9 A;  3J7Z G;  1M1K G;  3S5X A;  5LJE A;  1G85 A;  1VWM B;  4JHQ A;  5KHP A;  2BSZ A;  1K8A G;  4A1Y A;  1W6F A;  5LJC A;  2X8F A;  2IZE B;  5CSE A;  1VQ4 E;  3HK1 A;  1SWJ A;  2CZT A;  3VG6 A;  5KID A;  1SA8 A;  5DG4 A;  2AKQ A;  2OFM X;  5LJD A;  4ORY A;  5H9K A;  2RCT A;  1ZNH A;  3WJC A;  3G4S E;  2HLV A;  2WWP A;  1N9Y A;  3LHN A;  1GX9 A;  4U3Q A;  2OVE A;  1HBP A;  3CXC E;  4GNW A;  2ZSC A;  2UYW A;  3SAO A;  1VWP B;  4BBO A;  4WFB E;  1R0U A;  2ASN X;  3OD9 A;  4EXZ A;  1GXA A;  1D3S A;  5EDB A;  1SLF B;  3SZJ A;  4K19 A;  1VYG A;  3CCL E;  2OTL E;  4YH0 A;  5D45 A;  4D6A A;  2OFB A;  3C76 X;  1AVE A;  2IZC B;  1XCA A;  4MVL A;  3PQU A;  1SWG A;  1SRG A;  1E5P A;  1Y52 X;  3B2L A;  1HMS A;  1O1U A;  3NBX X;  2CM4 A;  3EBW A;  5HZQ A;  4PJ2 A;  3UAQ A;  2G78 A;  3ZWE A;  3P6D A;  3CCJ E;  2FWV A;  4XMC A;  3U9P C;  4U46 A;  1CBS A;  1SRH A;  1TOU A;  4IOC E;  1GKA B;  3WVM A;  3PH5 A;  4N7D A;  1TXL A;  5GAD G;  1WBI A;  3CKF A;  2OL6 O;  4IOA E;  5CYB A;  1JJJ A;  1RXH A;  4TKH A;  2RTR B;  1VWH B;  3KFF A;  5EZ2 A;  3KFG A;  4BX7 B;  4OMW A;  2ZAG A;  2RTA A;  3FR5 A;  1QY1 A;  3ZUO A;  5AJB A;  4DQ3 A;  3CMA E;  4I3C A;  2IZH B;  1X8P A;  1JBH A;  3RKG A;  5FFH A;  2Q2M A;  1NP1 A;  4OS8 A;  1VWF B;  5FEN A;  4U67 E;  3RZY A;  2RTJ A;  3APV A;  1N8R G;  4AYH A;  1SXW A;  1DF3 A;  3OE3 A;  4AZQ A;  2OF8 A;  1A2D A;  1HQP A;  1OBU A;  4EKV A;  5FQ7 E;  4C5P A;  3NQ9 A;  3RY1 A;  3IFB A;  3MM0 A;  4CDC A;  3K3L A;  2OFR X;  1A3Y A;  1JYD A;  3B2K A;  2FHL A;  1HXL A;  3VU1 A;  1PBY A;  4OEL A;  3STN A;  1W4T A;  1SRJ A;  5H9N A;  4XMG A;  4BX5 A;  5B5G A;  2FR2 A;  4MVE A;  3ZW0 A;  4TNN A;  3ZZV A;  1UYN X;  2FKJ A;  1YWA A;  4MVK A;  4IMN A;  3FW4 A;  4GNY A;  1BM5 A;  1NC9 A;  1I4U A;  2G5L A;  3WYQ A;  1ML7 A;  1X89 A;  5AEO A;  2ZJQ E;  3KVN A;  3VG7 A;  3PED A;  3HPE A;  3NX1 A;  4CPH A;  3FR2 A;  4YKM A;  4A1H A;  5HCC C;  1VQ7 E;  3CWK A;  4L3R A;  3KFH A;  3CF5 E;  1FEL A;  1YWC A;  1MDC A;  4IB7 A;  1YIT E;  5H8T A;  2WQ9 A;  3KFI A;  3VHI A;  1VYF A;  2OF9 A;  1QFV A;  2KD2 A;  2CZU A;  4Y0R A;  1Y9T A;  3P6E A;  1SLE B;  1AQB A;  3NAD A;  5CHK A;  4ZHG A;  4O4S A;  1YIV A;  1DZJ A;  3EC5 A;  3WZQ A;  3UEU A;  2GTL M;  5LJG A;  5HA1 A;  3O22 A;  4ZH6 A;  2W2A A;  2X34 A;  2QO5 A;  1S72 E;  1GT3 A;  5IRA A;  1CBR A;  2VFB A;  4O3W A;  4ORU A;  2RTH B;  4I3B A;  3BU9 A;  3WZP A;  5AN9 B;  4D6B A;  1VWR B;  3EM0 A;  1Q86 G;  4YBP A;  3G71 E;  4I9S A;  2L5P A;  2X56 A;  1SXX A;  1BLR A;  4O3Z A;  5B2A O;  4BQU A;  2RTG B;  2FHN X;  5K06 A;  2MHD A;  5JVG E;  1BEB A;  2Q39 A;  4EQA C;  3U0D A;  1OEE A;  4XMH A;  5C0N A;  3CC4 E;  1PTS A;  3D95 A;  3WJF A;  5IXG A;  4U8U M;  3B2I A;  5GAE G;  1A18 A;  3SLT A;  2LB6 A;  2A2G A;  2RQ0 A;  1STS B;  4HPA A;  3TGB A;  2WR6 A;  1STP A;  1MVG A;  2OVD A;  2X4M A;  2BT9 A;  3TGC A;  1YJN E;  1IIU A;  4WFU A;  1SWQ A;  5F6Z A;  4GGT A;  2GTL O;  3JS1 A;  2Q9S A;  2AL0 X;  1PBO A;  4Z2P A;  1Q82 G;  1KL5 A;  4YDA A;  4CV7 A;  1SMP I;  2FR3 A;  4Y0Q A;  4TJZ A;  2OZQ A;  1JJX A;  2LFO A;  2DM5 A;  1VQL E;  2A13 A;  2MM3 A;  5LJH A;  2A8G A;  1HN2 A;  3SLJ A;  2OL8 O;  5L8N A;  5DPQ A;  2OY7 A;  4XMD A;  1SXY A;  4BX5 B;  1VWI B;  3NX2 A;  3RDU A;  1OBQ A;  1RAV A;  1S44 A;  1KL4 A;  3CR6 A;  4YFR A;  3APW A;  2AT3 X;  2X45 A;  2KW1 A;  1B56 A;  3BX8 A;  2I5Z O;  1EQD A;  3WBG A;  5HAE A;  1ICM A;  4Z27 A;  1G7N A;  3N91 A;  5GAH G;  4IRW A;  1RST B;  1Q81 G;  2G79 A;  1DV9 A;  5B5F A;  3F9D A;  2QCB A;  4ORW A;  3D97 A;  1KFF A;  1QVF E;  1ZNG A;  1QQS A;  2X55 A;  3I0A A;  1I04 A;  3PH6 A;  1SWL A;  2Z4I A;  2OFA A;  4O4O A;  1KQW A;  4NYR A;  1T68 X;  1BSQ A;  1O8V A;  2RTC B;  2C1S A;  5H9A A;  3EBK A;  2PY1 A;  2IFB A;  1H91 A;  2MWH A;  3CD6 E;  2ANS A;  5B27 A;  2VFC A;  4I3D A;  3CCS E;  3UEW A;  4YGZ A;  4M7M A;  1YHQ E;  1KT6 A;  3VE2 A;  3C78 X;  3CBC A;  3VG4 A;  3KQ0 A;  1VWE B;  5L3Y A;  5AJC A;  1BSY A;  1YWD A;  1S2P A;  4KC8 A;  3VE1 A;  1PEE A;  3HWE A;  1MUP A;  1K73 G;  5JD2 A;  4ALB A;  4ARH A;  3E3C A;  1LNM A;  3S5V A;  4KT5 A;  2KTD A;  3FEK A;  4GRJ A;  2OTJ E;  4EFG A;  5HWZ A;  1XKI A;  3ZW1 A;  2HNX A;  1GT5 A;  2X8T A;  2IZG B;  1KGL A;  1SRF A;  3IA8 A;  3CC7 E;  3CCV E;  2LKK A;  1NDJ A;  4AZO A;  3RDQ A;  5F7G A;  5KIC A;  2GJ5 A;  4ORR A;  1N9M A;  3APU A;  1U0X A;  3FDC A;  5BVS A;  1MM9 A;  4YDB A;  4NNS A;  3FEN A;  2MF6 A;  3D9W A;  2WPU A;  1QG5 A;  2HKD A;  1SWB A;  4GJS A;  1CBI A;  1AVD A;  4ZR2 A;  5EDC A;  2EU7 X;  3KZA A;  4BX6 B;  3P6H A;  5BVT A;  1SWO A;  1VWD B;  3CCR E;  3NQK A;  1P4P A;  3BX7 A;  3CCE E;  2RTB B;  4YFP A;  1GX8 A;  4PSQ A;  1MEP A;  2JGS A;  1BSO A;  3EYC A;  3DTQ A;  5HZ9 A;  3TGA A;  2A2U A;  1BBP A;  1KOI A;  3FW5 A;  1VQM E;  3PEC A;  1BRQ A;  3Q6L A;  4DQ4 A;  1DZM A;  1GGL A;  1P6P A;  2YMS A;  3FA8 A;  2FKG A;  1E00 A;  4NW4 A;  1AB0 A;  5HTD A;  3FID A;  4NNT A;  3OW2 E;  2XKL A;  3BLG A;  1KD1 G;  2OY5 O;  3FR4 A;  2ALL X;  1OSP O;  3CBS A;  1LKE A;  4CDE A;  1I06 A;  4WCE E;  4LQZ A;  3C77 X;  3L4R A;  3BY0 A;  4QGW A;  1ADL A;  4ZHD A;  2OL7 A;  1L6M A;  4O9S A;  1LCV A;  3PP6 A;  3TZS A;  1DZK A;  4ZHC A;  4B55 A;  1SY2 A;  1MX8 A;  4YVB A;  3WZO A;  3S26 A;  1G74 A;  1I9H A;  2RTD B;  2RTO B;  4TQ2 A;  5HTE A;  1QY0 A;  3FIQ A;  4EEJ A;  4GDA A;  1YJW E;  3PQS A;  2A5C A;  5LJB A;  3WJB A;  1SWA A;  2NND A;  1LIB A;  4CPI A;  1LFO A;  3WYP A;  2L9C A;  1IKJ A;  1QAB E;  3RDM A;  2QM9 A;  2JU8 A;  5EPQ A;  2RTL A;  3TF6 A;  3P6C A;  3OJY C;  4I60 A;  1DF8 A;  1GX3 A;  3D4R A;  5L8I A;  3UEX A;  1SY1 A;  3SOT A;  5GAG G;  4A60 A;  4WBK A;  1K9M G;  4QZT A;  1KXO A;  3VG3 A;  3MG5 A;  4N7C A;  2BC3 A;  4Y0S A;  1IKE A;  1EI5 A;  4CSB A;  2GTF X;  4U9C A;  1HMT A;  3RDO A;  3AKN A;  1T8V A;  1KT7 A;  1S7D A;  4HFO A;  1GT1 A;  1YIJ E;  1SWT A;  4ZGU A;  2K23 A;  4QQ1 A;  5BYP A;  2POA A;  1I05 A;  1RSU B;  3NQ3 A;  5B29 A;  5EED A;  4GUZ A;  2JN3 A;  1ICN A;  5DM7 E;  1VWB B;  2GC9 A;  2FGS A;  1IFC A;  3F8A A;  1QWD A;  5F2B A;  2ZAI A;  3P02 A;  1ZND A;  4HPB A;  4O49 A;  2AMM X;  1VQP E;  1SXU A;  4ZH9 A;  2JOZ A;  2QOS C;  1FDQ A;  1W5R A;  3SZH A;  5K68 A;  1VQ9 E;  2BHV A;  5IO6 A;  5D4A A;  4QGX A;  5BVQ A;  2IZB A;  3HOL A;  3ZI8 A;  3F6Z B;  2OY8 A;  1LPJ A;  3CQN A;  4MVI A;  1VQ5 E;  2R56 A;  1NP4 A;  2RTN B;  1U17 A;  3VHH A;  1URE A;  4TKJ A;  1SWD A;  1TOW A;  1VQK E;  2BS6 A;  3JSQ A;  1RXK A;  4GGR A;  3FA6 A;  4GKC A;  2I5V O;  2UZ2 A;  1CRB A;  1LID A;  2OVS A;  5DM6 E;  4FBO A;  1CBQ A;  4NYQ A;  2RTI B;  3B2H A;  3DLL E;  3NR3 A;  4GK9 A;  4MIR A;  4CPE A;  1VQ6 E;  1EW3 A;  2FLJ A;  5IO5 A;  4WFA E;  4AZR A;  3HTY A;  3BS2 A;  2DJG A;  2IZI A;  1VQ8 E;  2WEW A;  1E06 A;  1LIF A;  4QAE A;  4YGG A;  2FS6 A;  1NQN A;  2AT8 X;  3ELZ A;  3RDX A;  4INN A;  3STK A;  4NV7 A;  1OPA A;  3NPO A;  1B8E A;  2AF5 A;  3CC2 E;  4KH8 A;  4GH7 A;  1EUO A;  1FTP A;  2OY1 O;  1E02 A;  1Y0G A;  5B10 O;  2CBR A;  1EAL A;  2IZA A;  1SWC A;  3T6F A;  1Y53 X;  2HMB A;  5F58 A;  1OBP A;  3WJE A;  1NJI G;  4OKA A;  5AQ6 A;  4YMY A;  2FT9 A;  1N0S A;  1SLG B;  2L67 A;  4BX7 A;  4OEM A;  4YKO A;  2IZL B;  1LUQ A;  2AH7 X;  1O1V A;  2WEX A;  4EDE A;  3IGE A;  4KCA A;  4CDF A;  3I55 E;  4KII A;  4ORS A;  2CM9 A;  2A3F X;  3T1D A;  1RBP A;  4RUU A;  3ZW0 B;  2FS7 A;  3HWF A;  4YFQ A;  2Q2P A;  4ALO A;  1JMZ A;  1VWC B;  4O3Y A;  4R0B A;  1ZRY A;  5FQ8 E;  5HBS A;  4IAX A;  5LKF A;  1YJ9 E;  1SWS A;  4O4X A;  4YBU A;  3CMP A;  4L1N A;  4Y0P A;  1IFB A;  3G7X A;  5B3M O;  4DCB A;  4KC7 A;  3HOE A;  3PPT A;  2QO4 A;  2HZR A;  4AZN A;  4CPH B;  1LEL A;  4GE1 A;  1EII A;  4COT A;  4ZHF A;  1VWG B;  2QOM A;  2RN4 A;  2JU3 A;  1SWE A;  1SRE A;  4YCE A;  1DZP A;  4QGV A;  4ES7 A;  4GDZ A;  4XME A;  4TKB A;  2KTS A;  1Y9L A;  5FQ6 E;  3PDF A;  1ZNK A;  1YP7 A;  5JR8 A;  1X71 A;  1X8Q A;  2JMB A;  1VPR A;  4IO9 E;  5CE4 A;  2ZJR E;  1JQP A;  1WUB A;  1U18 A;  4OS3 A;  1SRI A;  5HCD C;  1SY3 A;  4MIS A;  2XST A;  1YP6 A;  2GTL N;  1DFV A;  3EW1 A;  1RL6 A;  4RUN A;  2Y3F A;  1Z24 A;  4NV8 A;  1HXZ A;  4LZV A;  1SLD B;  3FA9 A;  4MEE A;  5FAZ A;  3WOV A;  4I95 A;  4O3X B;  4IB8 A;  4LZU A;  4ZFX A;  3RWX A;  1OEK A;  2PI3 O;  3H3I A;  4TLJ A;  1VWO B;  3BRN A;  1NBX A;  2JW1 A;  4JO6 A;  2DJF A;  4IBA A;  4BCS A;  1JIW I;  4CDD A;  4ON1 A;  1VQO E;  4JNJ A;  3PK2 A;  4IB9 A;  2X8S A;  3AEH A;  5L8O A;  2NP1 A;  4GJV A;  5F1E A;  4IB6 A;  3SLO A;  2C1Q A;  1EXS A;  4U8U N;  1KT5 A;  3VHM A;  1JZU A;  4IMO A;  3LV4 A;  1MK5 A;  2RA6 A;  1IJ8 A;  2OYB O;  4I6S A;  1K24 A;  1CJ5 A;  1VYO A;  2WSJ A;  3DSZ A;  2W2F A;  3UEV A;  2FRS A;  2BLG A;  1B4M A;  3ZQ3 A;  1G5W A;  1UYO X;  1T0V A;  3WJG A;  3SZI A;  1MX7 A;  2CBS A;  1QFT A;  2WUT A;  1YI2 E;  3VG5 A;  2G8C O;  3FYF A;  4BJ8 A;  3CCM E;  4GET A;  2Z4H A;  2QEX E;  4BOE A;  2E4J A;  4YGH A;  5F6B A;  5D8J A;  2A5B A;  2AT6 X;  1SWR A;  1IW2 A;  2ZJP E;  4AZM A;  2QA4 E;  3EW2 A;  2LBV A;  1SY0 A;  3RDS A;  5IRW A;  1BJ7 A;  3ZW2 A;  3FEL A;  1LCW A;  3RBY A;  3T2W A;  1GT4 A;  3MVF A;  3GAQ A;  3QKG A;  3O19 A;  5HL7 E;  1LIC A;  3WJD A;  3ELX A;  1SWH A;  1HMR A;  2QO6 A;  4JGL A;  2RTK A;  3CCQ E;  1B0O A;  2RTE B;  3JQO A;  1KC8 G;  1N7Y A;  1BRP A;  3IG9 A;  4HWM A;  4ZGF A;  3STM X;  2CAM A;  3CKG A;  4Z6J A;  2IZF B;  3VG2 A;  3PIP E;  4FBR A;  1Y55 X;  3B2J A;  3VPJ E;  2ACO A;  3P6G A;  2N93 A;  4ORX A;  5HZ5 A;  4QYN A;  5HCE C;  2Q4N A;  2NNE A;  1Q7Y G;  1LF7 A;  2K62 A;  1X8O A;  5HZ8 A;  3T2X A;  1RXJ A;  4WF9 E;  2AT0 X;  4ZCB A;  4ID2 A;  4GZV A;  2QMI A;  4QRL A;  5IO7 A;  4GGZ A;  5B11 O;  2RTP B;  3RE5 A;  1LIE A;  4FQB B;  3Q34 A;  1TW4 A;  4OMX A;  2X46 A;  3RY2 A;  4QYP A;  1ERX A;  5LKE A;  1X8N A;  2RCQ A;  1ERB A;  2FTB A;  3BU1 A;  2A0A A;  3I56 E;  2GH7 A;  2R73 A;  4IAB A;  3S60 A;  3MBT A;  4NP1 A;  1FE3 A;  2C4I A;  2F73 A;  3HWD A;  1M90 G;  2W2B A;  1VWQ B;  1NGL A;  4HPC A;  1LDO A;  4UU2 A;  1PMP A;  1EPB A;  3QQ2 A;  4NLI A;  5LJK A;  2P8G A;  1KZW A;  5D47 A;  2G7B A;  3ZW1 B;  4M6S A;  4WFV A;  1N43 A;  2RTM A;  1K3B A;  1HBQ A;  2AT5 X;  2YG2 A;  2VDF A;  1TVQ A;  4Z28 A;  4NLJ A;  3WZN A;  1OPB A;  2BS5 A;  2CQL A;  5HA0 A;  3BDR A;  5IRU A;  4QZU A;  1ZNL A;  3CPW E;  1JMX A;  1D2U A;  4ML7 B;  1A57 A;  1VWJ B;  3APX A;  4BVM A;  1PM1 X;  4LKP A;  3MX7 A;  2LA7 A;  4HPD A;  5EEE A;  4YCH A;  4LKT A;  3U03 A;  1RJL C;  1RLB E;  1GM6 A;  4I9R A;  3GE2 A;  3P6F A;  4Y59 A;  2HZQ A;  5H1S I;  3O2Y A;  3WXQ A;  1YUP A;  2MO5 A;  4GU8 A; 
#chains in the Genus database with same CATH homology
 3AUM O;  3CKG A;  2OYB O;  2OL7 A;  3IGE A;  2AF5 A;  5B3M O;  2I5Z O;  1P4P A;  1RJL C;  2FKJ A;  2OY5 O;  2HKD A;  1OSP O;  2OL8 O;  2OY8 A;  2OY1 O;  5B2A O;  2OY7 A;  3CKF A;  2PI3 O;  2I5V O;  3EC5 A;  5B10 O;  2OL6 O;  2FKG A;  5B11 O;  2G8C O;  3IG9 A;  1FJ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...