1YI2E

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1yi2E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1yi2E01
3CCUE 5H1SI 5DM7E 3I55E 1VQ7E 3CC7E 4WF9E 3PIPE 1Q86G 1VQ4E 3CPWE 4IOAE 5JVHE 1VQNE 3G4SE 2QEXE 1VQOE 1KQSE 1QVFE 4WFAE 1YI2E 3CMAE 4U67E 3CD6E 2OTJE 3CCSE 2ZJQE 1RL6A 1K8AG 2QA4E 3CCME 1JJ2E 3CCVE 3CCQE 4WCEE 1VQME 3CMEE 3CCEE 5MLCH 1VQ5E 1YJNE 4UY8G 2CQLA 5DM6E 1VQ8E 3CCRE 1Q82G 1QVGE 3G71E 1YIJE 1VQ6E 1W2BE 5JVGE 2OTLE 2ZJRE 5GAGG 1N8RG 1M90G 3CF5E 1KD1G 1YJWE 1VQKE 5AN9B 3PIOE 4IO9E 3OW2E 3CXCE 1S72E 1KC8G 1VQ9E 3DLLE 1YJ9E 1VQLE 4WFNE 1NJIG 4IOCE 3J7ZG 3CCJE 5GADG 5GAEG 4WFBE 1K73G 1M1KG 3CC4E 1Q7YG 1K9MG 3G6EE 5HL7E 5GAHG 3CCLE 1Q81G 3I56E 1YITE 2ZJPE 1YHQE 1VQPE 3CC2E
chains in the Genus database with same CATH superfamily
2OY5O 3CCUE 5H1SI 5DM7E 3I55E 1VQ7E 3CC7E 4WF9E 3PIPE 1Q86G 1VQ4E 3CPWE 2AF5A 2I5ZO 3EC5A 5JVHE 4IOAE 1VQNE 3G4SE 2QEXE 1VQOE 2OL7A 1KQSE 1QVFE 4WFAE 1YI2E 3CMAE 4U67E 3CD6E 2G8CO 2OTJE 3CCSE 2ZJQE 1RL6A 3IG9A 1K8AG 2QA4E 1OSPO 3CCME 1JJ2E 3CCVE 3CCQE 4WCEE 1VQME 3CMEE 3CCEE 2OL6O 5B3MO 5MLCH 1RJLC 2HKDA 1VQ5E 1YJNE 4UY8G 2CQLA 5DM6E 1VQ8E 3CCRE 5B11O 1Q82G 5B10O 3CKFA 1QVGE 3G71E 2OY8A 1YIJE 1VQ6E 1FJ1E 1W2BE 5JVGE 2OTLE 2ZJRE 5GAGG 1N8RG 1M90G 3CF5E 1KD1G 1YJWE 1VQKE 2PI3O 2OY7A 5AN9B 2I5VO 3PIOE 4IO9E 3OW2E 2FKJA 3CXCE 1S72E 1P4PA 1KC8G 1VQ9E 3DLLE 3AUMO 1YJ9E 1VQLE 2OY1O 4WFNE 1NJIG 2FKGA 2OL8O 5B2AO 4IOCE 3IGEA 3CKGA 3J7ZG 3CCJE 5GADG 5GAEG 4WFBE 1K73G 1M1KG 3CC4E 1Q7YG 1K9MG 3G6EE 5HL7E 5GAHG 3CCLE 1Q81G 3I56E 1YITE 2OYBO 2ZJPE 1YHQE 1VQPE 3CC2E
chains in the Genus database with same CATH topology
3CCUE 5H1SI 5DM7E 3I55E 1VQ7E 3CC7E 4WF9E 3PIPE 1Q86G 1VQ4E 3CPWE 4IOAE 5JVHE 1VQNE 3G4SE 2QEXE 1VQOE 1KQSE 1QVFE 4WFAE 1YI2E 3CMAE 4U67E 3CD6E 2OTJE 3CCSE 2ZJQE 1RL6A 1K8AG 2QA4E 3CCME 1JJ2E 3CCVE 3CCQE 4WCEE 1VQME 3CMEE 3CCEE 5MLCH 1VQ5E 1YJNE 4UY8G 2CQLA 5DM6E 1VQ8E 3CCRE 1Q82G 1QVGE 3G71E 1YIJE 1VQ6E 1W2BE 5JVGE 2OTLE 2ZJRE 5GAGG 1N8RG 1M90G 3CF5E 1KD1G 1YJWE 1VQKE 5AN9B 3PIOE 4IO9E 3OW2E 3CXCE 1S72E 1KC8G 1VQ9E 3DLLE 1YJ9E 1VQLE 4WFNE 1NJIG 4IOCE 3J7ZG 3CCJE 5GADG 5GAEG 4WFBE 1K73G 1M1KG 3CC4E 1Q7YG 1K9MG 3G6EE 5HL7E 5GAHG 3CCLE 1Q81G 3I56E 1YITE 2ZJPE 1YHQE 1VQPE 3CC2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU E;  5H1S I;  5DM7 E;  3I55 E;  1VQ7 E;  3CC7 E;  4WF9 E;  3PIP E;  1Q86 G;  1VQ4 E;  3CPW E;  4IOA E;  5JVH E;  1VQN E;  3G4S E;  2QEX E;  1VQO E;  1KQS E;  1QVF E;  4WFA E;  1YI2 E;  3CMA E;  4U67 E;  3CD6 E;  2OTJ E;  3CCS E;  2ZJQ E;  1RL6 A;  1K8A G;  2QA4 E;  3CCM E;  1JJ2 E;  3CCV E;  3CCQ E;  4WCE E;  1VQM E;  3CME E;  3CCE E;  5MLC H;  1VQ5 E;  1YJN E;  4UY8 G;  2CQL A;  5DM6 E;  1VQ8 E;  3CCR E;  1Q82 G;  1QVG E;  3G71 E;  1YIJ E;  1VQ6 E;  1W2B E;  5JVG E;  2OTL E;  2ZJR E;  5GAG G;  1N8R G;  1M90 G;  3CF5 E;  1KD1 G;  1YJW E;  1VQK E;  5AN9 B;  3PIO E;  4IO9 E;  3OW2 E;  3CXC E;  1S72 E;  1KC8 G;  1VQ9 E;  3DLL E;  1YJ9 E;  1VQL E;  4WFN E;  1NJI G;  4IOC E;  3J7Z G;  3CCJ E;  5GAD G;  5GAE G;  4WFB E;  1K73 G;  1M1K G;  3CC4 E;  1Q7Y G;  1K9M G;  3G6E E;  5HL7 E;  5GAH G;  3CCL E;  1Q81 G;  3I56 E;  1YIT E;  2ZJP E;  1YHQ E;  1VQP E;  3CC2 E; 
#chains in the Genus database with same CATH topology
 2OY5 O;  3CCU E;  5H1S I;  5DM7 E;  3I55 E;  1VQ7 E;  3CC7 E;  4WF9 E;  3PIP E;  1Q86 G;  1VQ4 E;  3CPW E;  2AF5 A;  2I5Z O;  3EC5 A;  5JVH E;  4IOA E;  1VQN E;  3G4S E;  2QEX E;  1VQO E;  2OL7 A;  1KQS E;  1QVF E;  4WFA E;  1YI2 E;  3CMA E;  4U67 E;  3CD6 E;  2G8C O;  2OTJ E;  3CCS E;  2ZJQ E;  1RL6 A;  3IG9 A;  1K8A G;  2QA4 E;  1OSP O;  3CCM E;  1JJ2 E;  3CCV E;  3CCQ E;  4WCE E;  1VQM E;  3CME E;  3CCE E;  2OL6 O;  5B3M O;  5MLC H;  1RJL C;  2HKD A;  1VQ5 E;  1YJN E;  4UY8 G;  2CQL A;  5DM6 E;  1VQ8 E;  3CCR E;  5B11 O;  1Q82 G;  5B10 O;  3CKF A;  1QVG E;  3G71 E;  2OY8 A;  1YIJ E;  1VQ6 E;  1FJ1 E;  1W2B E;  5JVG E;  2OTL E;  2ZJR E;  5GAG G;  1N8R G;  1M90 G;  3CF5 E;  1KD1 G;  1YJW E;  1VQK E;  2PI3 O;  2OY7 A;  5AN9 B;  2I5V O;  3PIO E;  4IO9 E;  3OW2 E;  2FKJ A;  3CXC E;  1S72 E;  1P4P A;  1KC8 G;  1VQ9 E;  3DLL E;  3AUM O;  1YJ9 E;  1VQL E;  2OY1 O;  4WFN E;  1NJI G;  2FKG A;  2OL8 O;  5B2A O;  4IOC E;  3IGE A;  3CKG A;  3J7Z G;  3CCJ E;  5GAD G;  5GAE G;  4WFB E;  1K73 G;  1M1K G;  3CC4 E;  1Q7Y G;  1K9M G;  3G6E E;  5HL7 E;  5GAH G;  3CCL E;  1Q81 G;  3I56 E;  1YIT E;  2OYB O;  2ZJP E;  1YHQ E;  1VQP E;  3CC2 E; 
#chains in the Genus database with same CATH homology
 3CCU E;  5H1S I;  5DM7 E;  3I55 E;  1VQ7 E;  3CC7 E;  4WF9 E;  3PIP E;  1Q86 G;  1VQ4 E;  3CPW E;  4IOA E;  5JVH E;  1VQN E;  3G4S E;  2QEX E;  1VQO E;  1KQS E;  1QVF E;  4WFA E;  1YI2 E;  3CMA E;  4U67 E;  3CD6 E;  2OTJ E;  3CCS E;  2ZJQ E;  1RL6 A;  1K8A G;  2QA4 E;  3CCM E;  1JJ2 E;  3CCV E;  3CCQ E;  4WCE E;  1VQM E;  3CME E;  3CCE E;  5MLC H;  1VQ5 E;  1YJN E;  4UY8 G;  2CQL A;  5DM6 E;  1VQ8 E;  3CCR E;  1Q82 G;  1QVG E;  3G71 E;  1YIJ E;  1VQ6 E;  1W2B E;  5JVG E;  2OTL E;  2ZJR E;  5GAG G;  1N8R G;  1M90 G;  3CF5 E;  1KD1 G;  1YJW E;  1VQK E;  5AN9 B;  3PIO E;  4IO9 E;  3OW2 E;  3CXC E;  1S72 E;  1KC8 G;  1VQ9 E;  3DLL E;  1YJ9 E;  1VQL E;  4WFN E;  1NJI G;  4IOC E;  3J7Z G;  3CCJ E;  5GAD G;  5GAE G;  4WFB E;  1K73 G;  1M1K G;  3CC4 E;  1Q7Y G;  1K9M G;  3G6E E;  5HL7 E;  5GAH G;  3CCL E;  1Q81 G;  3I56 E;  1YIT E;  2ZJP E;  1YHQ E;  1VQP E;  3CC2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...