3PIPE

Crystal structure of the synergistic antibiotic pair lankamycin and lankacidin in complex with the large ribosomal subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL 23S RNA
publication title Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3pipE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 3pipE01
5MLCH 5H1SI 1VQ8E 3CCVE 3CCQE 3G4SE 1Q81G 2ZJQE 1N8RG 3I55E 3CCSE 1K8AG 1M90G 3J7ZG 1JJ2E 1YJWE 1VQPE 5GADG 1K9MG 1K73G 4WF9E 3CCUE 3CCEE 1W2BE 3CC2E 3CCRE 1VQ9E 4IOCE 1VQOE 5DM7E 1VQ7E 3CXCE 4IOAE 5AN9B 2OTJE 1VQ4E 1VQME 1VQNE 5HL7E 4WFNE 1Q82G 3OW2E 3CC7E 1VQ6E 3CMAE 4WFBE 3PIOE 3CCME 1NJIG 2CQLA 1RL6A 1QVFE 2ZJRE 4U67E 1YJNE 2ZJPE 4IO9E 3CCLE 2QEXE 3CD6E 1Q86G 1KQSE 3G71E 1VQKE 5GAEG 3CF5E 1YITE 1S72E 3CPWE 2QA4E 3PIPE 2OTLE 3G6EE 1YI2E 1YHQE 4WFAE 1VQLE 5DM6E 5GAGG 5GAHG 1VQ5E 3DLLE 3CMEE 4UY8G 3CCJE 1KC8G 1Q7YG 3CC4E 1YJ9E 3I56E 5JVHE 1QVGE 1KD1G 4WCEE 5JVGE 1M1KG 1YIJE
chains in the Genus database with same CATH superfamily
5MLCH 5H1SI 1VQ8E 3CCVE 3CCQE 3G4SE 1Q81G 2ZJQE 1N8RG 3I55E 3CCSE 1K8AG 1M90G 3J7ZG 1JJ2E 1YJWE 1VQPE 5GADG 1K9MG 1K73G 4WF9E 3CCUE 2OYBO 3CCEE 1W2BE 3CC2E 3CCRE 1VQ9E 4IOCE 1VQOE 5DM7E 1VQ7E 3CXCE 2OL8O 4IOAE 2OTJE 5B3MO 1VQ4E 1VQME 2OL6O 1VQNE 5HL7E 4WFNE 1Q82G 5B10O 3OW2E 3CC7E 1VQ6E 2I5ZO 3CMAE 4WFBE 3PIOE 3CCME 2CQLA 1NJIG 1RL6A 1QVFE 2FKGA 3CKGA 2ZJRE 2OY7A 4U67E 2FKJA 1YJNE 2OY5O 3CKFA 3AUMO 2ZJPE 2AF5A 4IO9E 3CCLE 2QEXE 2OY8A 3CD6E 1Q86G 1KQSE 3G71E 3IG9A 5B2AO 5B11O 5GAEG 2OL7A 3CF5E 1YITE 3CPWE 2QA4E 1S72E 2PI3O 2I5VO 3EC5A 3PIPE 2OTLE 3G6EE 1YI2E 2HKDA 1YIJE 1P4PA 1YHQE 4WFAE 2OY1O 1VQLE 5DM6E 5GAGG 5GAHG 1VQ5E 3DLLE 3IGEA 3CMEE 1VQKE 4UY8G 3CCJE 1KC8G 1FJ1E 1Q7YG 3CC4E 1YJ9E 3I56E 5JVHE 1QVGE 1KD1G 1RJLC 4WCEE 5JVGE 2G8CO 1OSPO 1M1KG 5AN9B
chains in the Genus database with same CATH topology
5MLCH 5H1SI 1VQ8E 3CCVE 3CCQE 3G4SE 1Q81G 2ZJQE 1N8RG 3I55E 3CCSE 1K8AG 1M90G 3J7ZG 1JJ2E 1YJWE 1VQPE 5GADG 1K9MG 1K73G 4WF9E 3CCUE 3CCEE 1W2BE 3CC2E 3CCRE 1VQ9E 4IOCE 1VQOE 5DM7E 1VQ7E 3CXCE 4IOAE 5AN9B 2OTJE 1VQ4E 1VQME 1VQNE 5HL7E 4WFNE 1Q82G 3OW2E 3CC7E 1VQ6E 3CMAE 4WFBE 3PIOE 3CCME 1NJIG 2CQLA 1RL6A 1QVFE 2ZJRE 4U67E 1YJNE 2ZJPE 4IO9E 3CCLE 2QEXE 3CD6E 1Q86G 1KQSE 3G71E 1VQKE 5GAEG 3CF5E 1YITE 1S72E 3CPWE 2QA4E 3PIPE 2OTLE 3G6EE 1YI2E 1YHQE 4WFAE 1VQLE 5DM6E 5GAGG 5GAHG 1VQ5E 3DLLE 3CMEE 4UY8G 3CCJE 1KC8G 1Q7YG 3CC4E 1YJ9E 3I56E 5JVHE 1QVGE 1KD1G 4WCEE 5JVGE 1M1KG 1YIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MLC H;  5H1S I;  1VQ8 E;  3CCV E;  3CCQ E;  3G4S E;  1Q81 G;  2ZJQ E;  1N8R G;  3I55 E;  3CCS E;  1K8A G;  1M90 G;  3J7Z G;  1JJ2 E;  1YJW E;  1VQP E;  5GAD G;  1K9M G;  1K73 G;  4WF9 E;  3CCU E;  3CCE E;  1W2B E;  3CC2 E;  3CCR E;  1VQ9 E;  4IOC E;  1VQO E;  5DM7 E;  1VQ7 E;  3CXC E;  4IOA E;  5AN9 B;  2OTJ E;  1VQ4 E;  1VQM E;  1VQN E;  5HL7 E;  4WFN E;  1Q82 G;  3OW2 E;  3CC7 E;  1VQ6 E;  3CMA E;  4WFB E;  3PIO E;  3CCM E;  1NJI G;  2CQL A;  1RL6 A;  1QVF E;  2ZJR E;  4U67 E;  1YJN E;  2ZJP E;  4IO9 E;  3CCL E;  2QEX E;  3CD6 E;  1Q86 G;  1KQS E;  3G71 E;  1VQK E;  5GAE G;  3CF5 E;  1YIT E;  1S72 E;  3CPW E;  2QA4 E;  3PIP E;  2OTL E;  3G6E E;  1YI2 E;  1YHQ E;  4WFA E;  1VQL E;  5DM6 E;  5GAG G;  5GAH G;  1VQ5 E;  3DLL E;  3CME E;  4UY8 G;  3CCJ E;  1KC8 G;  1Q7Y G;  3CC4 E;  1YJ9 E;  3I56 E;  5JVH E;  1QVG E;  1KD1 G;  4WCE E;  5JVG E;  1M1K G;  1YIJ E; 
#chains in the Genus database with same CATH topology
 5MLC H;  5H1S I;  1VQ8 E;  3CCV E;  3CCQ E;  3G4S E;  1Q81 G;  2ZJQ E;  1N8R G;  3I55 E;  3CCS E;  1K8A G;  1M90 G;  3J7Z G;  1JJ2 E;  1YJW E;  1VQP E;  5GAD G;  1K9M G;  1K73 G;  4WF9 E;  3CCU E;  2OYB O;  3CCE E;  1W2B E;  3CC2 E;  3CCR E;  1VQ9 E;  4IOC E;  1VQO E;  5DM7 E;  1VQ7 E;  3CXC E;  2OL8 O;  4IOA E;  2OTJ E;  5B3M O;  1VQ4 E;  1VQM E;  2OL6 O;  1VQN E;  5HL7 E;  4WFN E;  1Q82 G;  5B10 O;  3OW2 E;  3CC7 E;  1VQ6 E;  2I5Z O;  3CMA E;  4WFB E;  3PIO E;  3CCM E;  2CQL A;  1NJI G;  1RL6 A;  1QVF E;  2FKG A;  3CKG A;  2ZJR E;  2OY7 A;  4U67 E;  2FKJ A;  1YJN E;  2OY5 O;  3CKF A;  3AUM O;  2ZJP E;  2AF5 A;  4IO9 E;  3CCL E;  2QEX E;  2OY8 A;  3CD6 E;  1Q86 G;  1KQS E;  3G71 E;  3IG9 A;  5B2A O;  5B11 O;  5GAE G;  2OL7 A;  3CF5 E;  1YIT E;  3CPW E;  2QA4 E;  1S72 E;  2PI3 O;  2I5V O;  3EC5 A;  3PIP E;  2OTL E;  3G6E E;  1YI2 E;  2HKD A;  1YIJ E;  1P4P A;  1YHQ E;  4WFA E;  2OY1 O;  1VQL E;  5DM6 E;  5GAG G;  5GAH G;  1VQ5 E;  3DLL E;  3IGE A;  3CME E;  1VQK E;  4UY8 G;  3CCJ E;  1KC8 G;  1FJ1 E;  1Q7Y G;  3CC4 E;  1YJ9 E;  3I56 E;  5JVH E;  1QVG E;  1KD1 G;  1RJL C;  4WCE E;  5JVG E;  2G8C O;  1OSP O;  1M1K G;  5AN9 B; 
#chains in the Genus database with same CATH homology
 5MLC H;  5H1S I;  1VQ8 E;  3CCV E;  3CCQ E;  3G4S E;  1Q81 G;  2ZJQ E;  1N8R G;  3I55 E;  3CCS E;  1K8A G;  1M90 G;  3J7Z G;  1JJ2 E;  1YJW E;  1VQP E;  5GAD G;  1K9M G;  1K73 G;  4WF9 E;  3CCU E;  3CCE E;  1W2B E;  3CC2 E;  3CCR E;  1VQ9 E;  4IOC E;  1VQO E;  5DM7 E;  1VQ7 E;  3CXC E;  4IOA E;  5AN9 B;  2OTJ E;  1VQ4 E;  1VQM E;  1VQN E;  5HL7 E;  4WFN E;  1Q82 G;  3OW2 E;  3CC7 E;  1VQ6 E;  3CMA E;  4WFB E;  3PIO E;  3CCM E;  1NJI G;  2CQL A;  1RL6 A;  1QVF E;  2ZJR E;  4U67 E;  1YJN E;  2ZJP E;  4IO9 E;  3CCL E;  2QEX E;  3CD6 E;  1Q86 G;  1KQS E;  3G71 E;  1VQK E;  5GAE G;  3CF5 E;  1YIT E;  1S72 E;  3CPW E;  2QA4 E;  3PIP E;  2OTL E;  3G6E E;  1YI2 E;  1YHQ E;  4WFA E;  1VQL E;  5DM6 E;  5GAG G;  5GAH G;  1VQ5 E;  3DLL E;  3CME E;  4UY8 G;  3CCJ E;  1KC8 G;  1Q7Y G;  3CC4 E;  1YJ9 E;  3I56 E;  5JVH E;  1QVG E;  1KD1 G;  4WCE E;  5JVG E;  1M1K G;  1YIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...