2GW3A

Crystal structure of stony coral fluorescent protein kaede, green form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
219
structure length
218
Chain Sequence
PMSLIKPEMKIKLLMEGNVNGHQFVIEGDGKGHPFEGKQSMDLVVKEGAPLPFAYDILTTAFNRVFAKYPDHIPDYFKQSFPKGFSWERSLMFEDGGVCIATNDITLKGDTFFNKVRFDGVNFPPNGPVMQKKTLKWEASTEKMYLRDGVLTGDITMALLLKGDVHYRCDFRTTYKSRQEGVKLPGYHFVDHCISILRHDKDYNEVKLYEHAVAHSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kaede
publication title Crystallographic evidence for water-assisted photo-induced peptide cleavage in the stony coral fluorescent protein Kaede.
pubmed doi rcsb
source organism Trachyphyllia geoffroyi
molecule tags Luminescent protein
total genus 56
structure length 218
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2gw3A00
4JRBA 2G6EA 4GOBA 2QLEA 3V3DA 3SSLA 4W7AA 3DQHA 2PXSA 4HE4A 5EXCI 1EMAA 4W6JA 3H1OA 4ORNA 1S6ZA 4PFEA 3BXAA 2H5QA 2HRSA 3VK1A 5FVGA 1EMKA 2A56B 3G9AA 5FVFA 4W6IA 1XA9A 3SSHA 3DQCA 2QLHA 5LK4A 1ZGPA 1ZGOA 4LJBA 1RM9A 2DDDA 4XVPA 3IR8A 2G5ZB 2A53B 4W7EA 3LF3A 3SVNA 3SG7A 1YJFA 2H6VA 2HJOA 2POXA 1YHHA 2H5OA 1MOVA 4W75A 3DQLA 2O2BA 3SVSA 2ZMWA 5HZTA 1W7TA 1Q4AA 4GF6B 4LJCA 2ZO7A 1QXTA 5KTGA 4W6FA 4GESB 4H3MA 4XOVA 3P28A 5DQMA 4DXOA 2DD7A 4Q7UA 4HVFA 2PXWA 1KYSA 5DPGA 1YFPA 4EN1A 3O78A 2JADA 3NEDA 5HZSA 3SG6A 4Q9XA 3DQNA 4OY4A 2ZMUA 1MYWA 4BDUA 3SVCA 1XQMA 4OQWA 4Z4KA 1W7UA 2QRFA 4U2VA 3E5TA 4LJDC 1EMLA 3EK4A 3EVVA 4W6TA 1Q4EA 4W6RA 3ZUFA 1EMMA 4W76A 2HCGA 4KGFA 4XOWA 2AWJA 1EMGA 1JC0A 4JEOA 1XMZA 2DUHA 2DUEA 3CFAA 4W7XA 4IK1A 2AWMA 4R6DA 3BX9A 1QY3A 2GX0A 4EDSA 2HGYA 1Q4BA 2ARLA 5FVIA 3H1RA 4AR7A 2A48A 2A46A 4ZF3A 2FZUA 5HW9A 5H88A 2A54B 4J89A 3ED8A 4OJ0A 1C4FA 5AQBB 5F9GA 2VVIA 5EXUA 2WIQA 1EMFA 4HQ9A 3ZULA 3RWTA 2HQKA 3LVDA 2QU1A 4KF4A 1EMEA 3DQDA 4N3DA 3WLCA 4DXMA 2BTJA 3KCTA 2Z6YA 4TZGA 5DRFA 1EMCA 2V4EB 5EJUA 2VADA 4ZFSA 5H87A 3DQ5A 4IK5A 5BTTA 1Q73A 3SS0A 2V4EA 4P76A 2WISA 4KF5C 3DPZA 4W74A 1BFPA 3DQOA 2GW3A 2H8QA 2QLIA 3DQ6A 5DTLA 3UG0A 2EMNA 3AI5A 4LQUA 3SSKA 3SSYA 4W6DA 3LSAA 3DQ8A 4IZNA 3SVDA 2HQZA 5DPHA 4ZF5A 4PPJA 3EVRA 3SVRA 1CV7A 3DQEA 2AWLA 2O29A 5HBDA 5BT0A 3LVAA 3S05A 4J8AA 4L13A 4OGSA 4ZBLA 1XSSA 2H9WA 3DQFA 4W6BA 2A52B 1QYQA 4W6LA 3DQUA 3DQAA 3SG3A 2WHSA 4DXPA 3M22A 4RYWA 5DPIA 5HGEA 5DTYA 2QT2A 5DPJA 4LW5A 4L12A 1JC1A 3DQMA 4ANJA 4W6MA 4W6CA 4DKMA 4EDOA 2A50B 3SVEA 4W6PA 3U8PA 3PJ7A 4B30B 2Y0GA 4W69A 3ADFA 1Z1QA 4JFGA 3ST4A 3CB9A 2OTEA 1OXEA 3CFFA 4AS8A 4ZINA 2ZO6A 2RH7A 4EMQA 3PIBA 4W7DA 3GB3A 5HZOA 5EB7A 2DUFA 1HCJA 4EULA 5EBJA 3ST3A 5LTRA 3PJ5A 4DXQA 3TMRA 2QLGB 2DDCA 3LA1A 4RYSA 2YE0A 3U0KA 5DTXA 3E5VA 4W7RA 2VVJA 2QLGA 4UTSA 1Q4CA 4XL5A 3U8AA 3SVUA 2Q57A 3CGLA 1H4UA 5DQBA 2DD9A 3OGOA 4W6GA 3DPWA 4KEXA 1XAEA 4W6AA 4KGEA 4Q7RA 2O24A 3CFHA 3U0MA 3SG2A 3ST0A 3EKJA 3VHTB 3U0LA 1MOUA 3BXBA 4W7CA 1GFLA 2IB5A 5DRGA 3VHTA 4H3NA 2G2SB 2IOVA 3BXCA 5T3IA 5HZUA 1ZGQA 2WSNA 3SG5A 2G3OA 2YDZA 4JGEA 3TMTA 2WSOA 4HQ8A 2OJKA 4LJDA 2FL1A 2P4MA 4I2YA 3SSTA 4HQCA 2VZXA 2Q6PA 5FHVA 4KW4A 3DQ3A 3I19A 1GGXA 2HPWA 3GJ1A 1YHGA 1RRXA 2HFCA 4IK3A 3E5WA 4H48A 4Q9WA 2WHTA 2WURA 3VICA 4Q7TA 4R6BA 2DUGA 3SV5A 3ZTFA 1H6RA 2IB6A 3DQ2A 4H3LA 2HGDA 4ZIOA 1OXDA 4H47A 4W7FA 1RMMA 3AI4A 5J2OA 1HUYA 4DXIA 4XGYA 5DU0A 3P8UA 3ZUJA 1F09A 2QZ0A 1KP5A 2OGRA 3OSRA 3DQJA 1QYFA 1YJ2A 2OKYA 5EB6A 4W73A 3EK8A 3NEZA 4W6SA 4KF5A 2OKWA 4J88A 3LS3A 2ICRA 1OXFA 4W6UA 3DPXA 3SSVA 4DKNA 2C9IA 3DQ4A 3LF4B 3SSPA 3DQKA 3EVUA 3DQ9A 4KPIA 1W7SA 3RWAA 3U0NA 4B30A 4KW8A 4IK9A 2FWQA 5LTQA 2AH8A 2Z1OA 3DQIA 3U8CA 5H89A 3SVBA 2Z6XA 2OTBA 4B5YA 3GL4A 2AWKA 2GW4B 2VVHA 3ST2A 2EMOA 4KW9A 3SG4A 1G7KA 2G6YA 4W6OA 3NT3A 2H5PA 3IP2A 3UFZA 2YE1A 4ZF4A 1EMBA 1B9CA 1Z1PA 5EHUA 4DXNA 3OSQA 4KA9A 4L1IA 3W1DA 3NT9A 4JC2A 2IE2A 4W72A 3GJ2A 4IK8A 3AKOA 2V4EC 2G3DB 2AHAA 4OHSA 2B3PA 3GEXA 3CD9A 1JBZA 5EXBA 3O77A 1YHIA 4W77A 3M24A 1QYOA 5DY6A 3WCKA 1KYRA 3EKHA 1KYPA 5DTZA 4PPLA 2EMDA 2G6XA 3CD1A 2DUIA 1GL4A 3DQ1A 4TZAA 4Z4MA 1YZWA 3LVCA 4LQTA 1RMOA 2G16B 5LTPA 3W1CA 2VAEA 3A8SA 1JBYA 4W6KA 4KAGA 4P1QA 1ZUXA 2B3QA 4RTCA 4NWSA 2H5RA 3EK7A 3SRYA 3PJBA 4W6NA 3MGFA 3KCSA 4PPKA 1UISA 3CBEA 1F0BA 3DQ7A 3SVOA 2A47A 3WLDA 4IK4A 5BTTB 3EVPA 4JF9A 3K1KA 2GX2A 3NF0A 2C9JA 2Z6ZA 5BQLA 2YFPA 2WHUA 4ZB1A 4W6HA 1Q4DA 1RMPA
chains in the Genus database with same CATH superfamily
4JRBA 2G6EA 4GOBA 2QLEA 3V3DA 3SSLA 4W7AA 3DQHA 2PXSA 4HE4A 5EXCI 1EMAA 4W6JA 3H1OA 4ORNA 1S6ZA 4PFEA 3BXAA 2H5QA 2HRSA 3VK1A 5FVGA 1EMKA 2A56B 3G9AA 5FVFA 4W6IA 1XA9A 3SSHA 3DQCA 2QLHA 5LK4A 1ZGPA 1ZGOA 4LJBA 1RM9A 2DDDA 4XVPA 3IR8A 2G5ZB 2A53B 4W7EA 3LF3A 3SVNA 3SG7A 1YJFA 2H6VA 2HJOA 2POXA 1YHHA 2H5OA 1MOVA 4W75A 3DQLA 2O2BA 3SVSA 2ZMWA 5HZTA 1W7TA 1Q4AA 4GF6B 4LJCA 2ZO7A 1QXTA 5KTGA 4W6FA 4GESB 4H3MA 4XOVA 3P28A 5DQMA 4DXOA 2DD7A 4Q7UA 4HVFA 2PXWA 1KYSA 5DPGA 1YFPA 4EN1A 3O78A 2JADA 3NEDA 5HZSA 3SG6A 4Q9XA 3DQNA 4OY4A 2ZMUA 1MYWA 4BDUA 3SVCA 1XQMA 4OQWA 4Z4KA 1W7UA 2QRFA 4U2VA 3E5TA 4LJDC 1EMLA 3EK4A 3EVVA 4W6TA 1Q4EA 4W6RA 3ZUFA 1EMMA 4W76A 2HCGA 4KGFA 4XOWA 2AWJA 1EMGA 1JC0A 4JEOA 1XMZA 2DUHA 2DUEA 3CFAA 4W7XA 4IK1A 2AWMA 4R6DA 3BX9A 1QY3A 2GX0A 4EDSA 2HGYA 1Q4BA 2ARLA 5FVIA 3H1RA 4AR7A 2A48A 2A46A 4ZF3A 2FZUA 5HW9A 5H88A 2A54B 4J89A 3ED8A 4OJ0A 1C4FA 5AQBB 5F9GA 2VVIA 5EXUA 2WIQA 1EMFA 4HQ9A 3ZULA 3RWTA 2HQKA 3LVDA 2QU1A 4KF4A 1EMEA 3DQDA 4N3DA 3WLCA 4DXMA 2BTJA 3KCTA 2Z6YA 4TZGA 5DRFA 1EMCA 2V4EB 5EJUA 2VADA 4ZFSA 5H87A 3DQ5A 4IK5A 5BTTA 1Q73A 3SS0A 2V4EA 4P76A 2WISA 4KF5C 3DPZA 4W74A 1BFPA 3DQOA 2GW3A 2H8QA 2QLIA 3DQ6A 5DTLA 3UG0A 2EMNA 3AI5A 4LQUA 3SSKA 3SSYA 4W6DA 3LSAA 3DQ8A 4IZNA 3SVDA 2HQZA 5DPHA 4ZF5A 4PPJA 3EVRA 3SVRA 1CV7A 3DQEA 2AWLA 2O29A 5HBDA 5BT0A 3LVAA 3S05A 4J8AA 4L13A 4OGSA 4ZBLA 1XSSA 2H9WA 3DQFA 4W6BA 2A52B 1QYQA 4W6LA 3DQUA 3DQAA 3SG3A 2WHSA 4DXPA 3M22A 4RYWA 5DPIA 5HGEA 5DTYA 2QT2A 5DPJA 4LW5A 4L12A 1JC1A 3DQMA 4ANJA 4W6MA 4W6CA 4DKMA 4EDOA 2A50B 3SVEA 4W6PA 3U8PA 3PJ7A 4B30B 2Y0GA 4W69A 3ADFA 1Z1QA 4JFGA 3ST4A 3CB9A 2OTEA 1OXEA 3CFFA 4AS8A 4ZINA 2ZO6A 2RH7A 4EMQA 3PIBA 4W7DA 3GB3A 5HZOA 5EB7A 2DUFA 1HCJA 4EULA 5EBJA 3ST3A 5LTRA 3PJ5A 4DXQA 3TMRA 2QLGB 2DDCA 3LA1A 4RYSA 2YE0A 3U0KA 5DTXA 3E5VA 4W7RA 2VVJA 2QLGA 4UTSA 1Q4CA 4XL5A 3U8AA 3SVUA 2Q57A 3CGLA 1H4UA 5DQBA 2DD9A 3OGOA 4W6GA 3DPWA 4KEXA 1XAEA 4W6AA 4KGEA 4Q7RA 2O24A 3CFHA 3U0MA 3SG2A 3ST0A 3EKJA 3VHTB 3U0LA 1MOUA 3BXBA 4W7CA 1GFLA 2IB5A 5DRGA 3VHTA 4H3NA 2G2SB 2IOVA 3BXCA 5T3IA 5HZUA 1ZGQA 2WSNA 3SG5A 2G3OA 2YDZA 4JGEA 3TMTA 2WSOA 4HQ8A 2OJKA 4LJDA 2FL1A 2P4MA 4I2YA 3SSTA 4HQCA 2VZXA 2Q6PA 5FHVA 4KW4A 3DQ3A 3I19A 1GGXA 2HPWA 3GJ1A 1YHGA 1RRXA 2HFCA 4IK3A 3E5WA 4H48A 4Q9WA 2WHTA 2WURA 3VICA 4Q7TA 4R6BA 2DUGA 3SV5A 3ZTFA 1H6RA 2IB6A 3DQ2A 4H3LA 2HGDA 4ZIOA 1OXDA 4H47A 4W7FA 1RMMA 3AI4A 5J2OA 1HUYA 4DXIA 4XGYA 5DU0A 3P8UA 3ZUJA 1F09A 2QZ0A 1KP5A 2OGRA 3OSRA 3DQJA 1QYFA 1YJ2A 2OKYA 5EB6A 4W73A 3EK8A 3NEZA 4W6SA 4KF5A 2OKWA 4J88A 3LS3A 2ICRA 1OXFA 4W6UA 3DPXA 3SSVA 4DKNA 2C9IA 3DQ4A 3LF4B 3SSPA 3DQKA 3EVUA 3DQ9A 4KPIA 1W7SA 3RWAA 3U0NA 4B30A 4KW8A 4IK9A 2FWQA 5LTQA 2AH8A 2Z1OA 3DQIA 3U8CA 5H89A 3SVBA 2Z6XA 2OTBA 4B5YA 3GL4A 2AWKA 2GW4B 2VVHA 3ST2A 2EMOA 4KW9A 3SG4A 1G7KA 2G6YA 4W6OA 3NT3A 2H5PA 3IP2A 3UFZA 2YE1A 4ZF4A 1EMBA 1B9CA 1Z1PA 5EHUA 4DXNA 3OSQA 4KA9A 4L1IA 3W1DA 3NT9A 4JC2A 2IE2A 4W72A 3GJ2A 4IK8A 3AKOA 2V4EC 2G3DB 2AHAA 4OHSA 2B3PA 3GEXA 3CD9A 1JBZA 5EXBA 3O77A 1YHIA 4W77A 3M24A 1QYOA 5DY6A 3WCKA 1KYRA 3EKHA 1KYPA 5DTZA 4PPLA 2EMDA 2G6XA 3CD1A 2DUIA 1GL4A 3DQ1A 4TZAA 4Z4MA 1YZWA 3LVCA 4LQTA 1RMOA 2G16B 5LTPA 3W1CA 2VAEA 3A8SA 1JBYA 4W6KA 4KAGA 4P1QA 1ZUXA 2B3QA 4RTCA 4NWSA 2H5RA 3EK7A 3SRYA 3PJBA 4W6NA 3MGFA 3KCSA 4PPKA 1UISA 3CBEA 1F0BA 3DQ7A 3SVOA 2A47A 3WLDA 4IK4A 5BTTB 3EVPA 4JF9A 3K1KA 2GX2A 3NF0A 2C9JA 2Z6ZA 5BQLA 2YFPA 2WHUA 4ZB1A 4W6HA 1Q4DA 1RMPA
chains in the Genus database with same CATH topology
4JRBA 2G6EA 4GOBA 2QLEA 3V3DA 3SSLA 4W7AA 3DQHA 2PXSA 4HE4A 5EXCI 1EMAA 4W6JA 3H1OA 4ORNA 1S6ZA 4PFEA 3BXAA 2H5QA 2HRSA 3VK1A 5FVGA 1EMKA 2A56B 3G9AA 5FVFA 4W6IA 1XA9A 3SSHA 3DQCA 2QLHA 5LK4A 1ZGPA 1ZGOA 4LJBA 1RM9A 2DDDA 4XVPA 3IR8A 2G5ZB 2A53B 4W7EA 3LF3A 3SVNA 3SG7A 1YJFA 2H6VA 2HJOA 2POXA 1YHHA 2H5OA 1MOVA 4W75A 3DQLA 2O2BA 3SVSA 2ZMWA 5HZTA 1W7TA 1Q4AA 4GF6B 4LJCA 2ZO7A 1QXTA 5KTGA 4W6FA 4GESB 4H3MA 4XOVA 3P28A 5DQMA 4DXOA 2DD7A 4Q7UA 4HVFA 2PXWA 1KYSA 5DPGA 1YFPA 4EN1A 3O78A 2JADA 3NEDA 5HZSA 3SG6A 4Q9XA 3DQNA 4OY4A 2ZMUA 1MYWA 4BDUA 3SVCA 1XQMA 4OQWA 4Z4KA 1W7UA 2QRFA 4U2VA 3E5TA 4LJDC 1EMLA 3EK4A 3EVVA 4W6TA 1Q4EA 4W6RA 3ZUFA 1EMMA 4W76A 2HCGA 4KGFA 4XOWA 2AWJA 1EMGA 1JC0A 4JEOA 1XMZA 2DUHA 2DUEA 3CFAA 4W7XA 4IK1A 2AWMA 4R6DA 3BX9A 1QY3A 2GX0A 4EDSA 2HGYA 1Q4BA 2ARLA 5FVIA 3H1RA 4AR7A 2A48A 2A46A 4ZF3A 2FZUA 5HW9A 5H88A 2A54B 4J89A 3ED8A 4OJ0A 1C4FA 5AQBB 5F9GA 2VVIA 5EXUA 2WIQA 1EMFA 4HQ9A 3ZULA 3RWTA 2HQKA 3LVDA 2QU1A 4KF4A 1EMEA 3DQDA 4N3DA 3WLCA 4DXMA 2BTJA 3KCTA 2Z6YA 4TZGA 5DRFA 1EMCA 2V4EB 5EJUA 2VADA 4ZFSA 5H87A 3DQ5A 4IK5A 5BTTA 1Q73A 3SS0A 2V4EA 4P76A 2WISA 4KF5C 3DPZA 4W74A 1BFPA 3DQOA 2GW3A 2H8QA 2QLIA 3DQ6A 5DTLA 3UG0A 2EMNA 3AI5A 4LQUA 3SSKA 3SSYA 4W6DA 3LSAA 3DQ8A 4IZNA 3SVDA 2HQZA 5DPHA 4ZF5A 4PPJA 3EVRA 3SVRA 1CV7A 3DQEA 2AWLA 2O29A 5HBDA 5BT0A 3LVAA 3S05A 4J8AA 4L13A 4OGSA 4ZBLA 1XSSA 2H9WA 3DQFA 4W6BA 2A52B 1QYQA 4W6LA 3DQUA 3DQAA 3SG3A 2WHSA 4DXPA 3M22A 4RYWA 5DPIA 5HGEA 5DTYA 2QT2A 5DPJA 4LW5A 4L12A 1JC1A 3DQMA 4ANJA 4W6MA 4W6CA 4DKMA 4EDOA 2A50B 3SVEA 4W6PA 3U8PA 3PJ7A 4B30B 2Y0GA 4W69A 3ADFA 1Z1QA 4JFGA 3ST4A 3CB9A 2OTEA 1OXEA 3CFFA 4AS8A 4ZINA 2ZO6A 2RH7A 4EMQA 3PIBA 4W7DA 3GB3A 5HZOA 5EB7A 2DUFA 1HCJA 4EULA 5EBJA 3ST3A 5LTRA 3PJ5A 4DXQA 3TMRA 2QLGB 2DDCA 3LA1A 4RYSA 2YE0A 3U0KA 5DTXA 3E5VA 4W7RA 2VVJA 2QLGA 4UTSA 1Q4CA 4XL5A 3U8AA 3SVUA 2Q57A 3CGLA 1H4UA 5DQBA 2DD9A 3OGOA 4W6GA 3DPWA 4KEXA 1XAEA 4W6AA 4KGEA 4Q7RA 2O24A 3CFHA 3U0MA 3SG2A 3ST0A 3EKJA 3VHTB 3U0LA 1MOUA 3BXBA 4W7CA 1GFLA 2IB5A 5DRGA 3VHTA 4H3NA 2G2SB 2IOVA 3BXCA 5T3IA 5HZUA 1ZGQA 2WSNA 3SG5A 2G3OA 2YDZA 4JGEA 3TMTA 2WSOA 4HQ8A 2OJKA 4LJDA 2FL1A 2P4MA 4I2YA 3SSTA 4HQCA 2VZXA 2Q6PA 5FHVA 4KW4A 3DQ3A 3I19A 1GGXA 2HPWA 3GJ1A 1YHGA 1RRXA 2HFCA 4IK3A 3E5WA 4H48A 4Q9WA 2WHTA 2WURA 3VICA 4Q7TA 4R6BA 2DUGA 3SV5A 3ZTFA 1H6RA 2IB6A 3DQ2A 4H3LA 2HGDA 4ZIOA 1OXDA 4H47A 4W7FA 1RMMA 3AI4A 5J2OA 1HUYA 4DXIA 4XGYA 5DU0A 3P8UA 3ZUJA 1F09A 2QZ0A 1KP5A 2OGRA 3OSRA 3DQJA 1QYFA 1YJ2A 2OKYA 5EB6A 4W73A 3EK8A 3NEZA 4W6SA 4KF5A 2OKWA 4J88A 3LS3A 2ICRA 1OXFA 4W6UA 3DPXA 3SSVA 4DKNA 2C9IA 3DQ4A 3LF4B 3SSPA 3DQKA 3EVUA 3DQ9A 4KPIA 1W7SA 3RWAA 3U0NA 4B30A 4KW8A 4IK9A 2FWQA 5LTQA 2AH8A 2Z1OA 3DQIA 3U8CA 5H89A 3SVBA 2Z6XA 2OTBA 4B5YA 3GL4A 2AWKA 2GW4B 2VVHA 3ST2A 2EMOA 4KW9A 3SG4A 1G7KA 2G6YA 4W6OA 3NT3A 2H5PA 3IP2A 3UFZA 2YE1A 4ZF4A 1EMBA 1B9CA 1Z1PA 5EHUA 4DXNA 3OSQA 4KA9A 4L1IA 3W1DA 3NT9A 4JC2A 2IE2A 4W72A 3GJ2A 4IK8A 3AKOA 2V4EC 2G3DB 2AHAA 4OHSA 2B3PA 3GEXA 3CD9A 1JBZA 5EXBA 3O77A 1YHIA 4W77A 3M24A 1QYOA 5DY6A 3WCKA 1KYRA 3EKHA 1KYPA 5DTZA 4PPLA 2EMDA 2G6XA 3CD1A 2DUIA 1GL4A 3DQ1A 4TZAA 4Z4MA 1YZWA 3LVCA 4LQTA 1RMOA 2G16B 5LTPA 3W1CA 2VAEA 3A8SA 1JBYA 4W6KA 4KAGA 4P1QA 1ZUXA 2B3QA 4RTCA 4NWSA 2H5RA 3EK7A 3SRYA 3PJBA 4W6NA 3MGFA 3KCSA 4PPKA 1UISA 3CBEA 1F0BA 3DQ7A 3SVOA 2A47A 3WLDA 4IK4A 5BTTB 3EVPA 4JF9A 3K1KA 2GX2A 3NF0A 2C9JA 2Z6ZA 5BQLA 2YFPA 2WHUA 4ZB1A 4W6HA 1Q4DA 1RMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRB A;  2G6E A;  4GOB A;  2QLE A;  3V3D A;  3SSL A;  4W7A A;  3DQH A;  2PXS A;  4HE4 A;  5EXC I;  1EMA A;  4W6J A;  3H1O A;  4ORN A;  1S6Z A;  4PFE A;  3BXA A;  2H5Q A;  2HRS A;  3VK1 A;  5FVG A;  1EMK A;  2A56 B;  3G9A A;  5FVF A;  4W6I A;  1XA9 A;  3SSH A;  3DQC A;  2QLH A;  5LK4 A;  1ZGP A;  1ZGO A;  4LJB A;  1RM9 A;  2DDD A;  4XVP A;  3IR8 A;  2G5Z B;  2A53 B;  4W7E A;  3LF3 A;  3SVN A;  3SG7 A;  1YJF A;  2H6V A;  2HJO A;  2POX A;  1YHH A;  2H5O A;  1MOV A;  4W75 A;  3DQL A;  2O2B A;  3SVS A;  2ZMW A;  5HZT A;  1W7T A;  1Q4A A;  4GF6 B;  4LJC A;  2ZO7 A;  1QXT A;  5KTG A;  4W6F A;  4GES B;  4H3M A;  4XOV A;  3P28 A;  5DQM A;  4DXO A;  2DD7 A;  4Q7U A;  4HVF A;  2PXW A;  1KYS A;  5DPG A;  1YFP A;  4EN1 A;  3O78 A;  2JAD A;  3NED A;  5HZS A;  3SG6 A;  4Q9X A;  3DQN A;  4OY4 A;  2ZMU A;  1MYW A;  4BDU A;  3SVC A;  1XQM A;  4OQW A;  4Z4K A;  1W7U A;  2QRF A;  4U2V A;  3E5T A;  4LJD C;  1EML A;  3EK4 A;  3EVV A;  4W6T A;  1Q4E A;  4W6R A;  3ZUF A;  1EMM A;  4W76 A;  2HCG A;  4KGF A;  4XOW A;  2AWJ A;  1EMG A;  1JC0 A;  4JEO A;  1XMZ A;  2DUH A;  2DUE A;  3CFA A;  4W7X A;  4IK1 A;  2AWM A;  4R6D A;  3BX9 A;  1QY3 A;  2GX0 A;  4EDS A;  2HGY A;  1Q4B A;  2ARL A;  5FVI A;  3H1R A;  4AR7 A;  2A48 A;  2A46 A;  4ZF3 A;  2FZU A;  5HW9 A;  5H88 A;  2A54 B;  4J89 A;  3ED8 A;  4OJ0 A;  1C4F A;  5AQB B;  5F9G A;  2VVI A;  5EXU A;  2WIQ A;  1EMF A;  4HQ9 A;  3ZUL A;  3RWT A;  2HQK A;  3LVD A;  2QU1 A;  4KF4 A;  1EME A;  3DQD A;  4N3D A;  3WLC A;  4DXM A;  2BTJ A;  3KCT A;  2Z6Y A;  4TZG A;  5DRF A;  1EMC A;  2V4E B;  5EJU A;  2VAD A;  4ZFS A;  5H87 A;  3DQ5 A;  4IK5 A;  5BTT A;  1Q73 A;  3SS0 A;  2V4E A;  4P76 A;  2WIS A;  4KF5 C;  3DPZ A;  4W74 A;  1BFP A;  3DQO A;  2GW3 A;  2H8Q A;  2QLI A;  3DQ6 A;  5DTL A;  3UG0 A;  2EMN A;  3AI5 A;  4LQU A;  3SSK A;  3SSY A;  4W6D A;  3LSA A;  3DQ8 A;  4IZN A;  3SVD A;  2HQZ A;  5DPH A;  4ZF5 A;  4PPJ A;  3EVR A;  3SVR A;  1CV7 A;  3DQE A;  2AWL A;  2O29 A;  5HBD A;  5BT0 A;  3LVA A;  3S05 A;  4J8A A;  4L13 A;  4OGS A;  4ZBL A;  1XSS A;  2H9W A;  3DQF A;  4W6B A;  2A52 B;  1QYQ A;  4W6L A;  3DQU A;  3DQA A;  3SG3 A;  2WHS A;  4DXP A;  3M22 A;  4RYW A;  5DPI A;  5HGE A;  5DTY A;  2QT2 A;  5DPJ A;  4LW5 A;  4L12 A;  1JC1 A;  3DQM A;  4ANJ A;  4W6M A;  4W6C A;  4DKM A;  4EDO A;  2A50 B;  3SVE A;  4W6P A;  3U8P A;  3PJ7 A;  4B30 B;  2Y0G A;  4W69 A;  3ADF A;  1Z1Q A;  4JFG A;  3ST4 A;  3CB9 A;  2OTE A;  1OXE A;  3CFF A;  4AS8 A;  4ZIN A;  2ZO6 A;  2RH7 A;  4EMQ A;  3PIB A;  4W7D A;  3GB3 A;  5HZO A;  5EB7 A;  2DUF A;  1HCJ A;  4EUL A;  5EBJ A;  3ST3 A;  5LTR A;  3PJ5 A;  4DXQ A;  3TMR A;  2QLG B;  2DDC A;  3LA1 A;  4RYS A;  2YE0 A;  3U0K A;  5DTX A;  3E5V A;  4W7R A;  2VVJ A;  2QLG A;  4UTS A;  1Q4C A;  4XL5 A;  3U8A A;  3SVU A;  2Q57 A;  3CGL A;  1H4U A;  5DQB A;  2DD9 A;  3OGO A;  4W6G A;  3DPW A;  4KEX A;  1XAE A;  4W6A A;  4KGE A;  4Q7R A;  2O24 A;  3CFH A;  3U0M A;  3SG2 A;  3ST0 A;  3EKJ A;  3VHT B;  3U0L A;  1MOU A;  3BXB A;  4W7C A;  1GFL A;  2IB5 A;  5DRG A;  3VHT A;  4H3N A;  2G2S B;  2IOV A;  3BXC A;  5T3I A;  5HZU A;  1ZGQ A;  2WSN A;  3SG5 A;  2G3O A;  2YDZ A;  4JGE A;  3TMT A;  2WSO A;  4HQ8 A;  2OJK A;  4LJD A;  2FL1 A;  2P4M A;  4I2Y A;  3SST A;  4HQC A;  2VZX A;  2Q6P A;  5FHV A;  4KW4 A;  3DQ3 A;  3I19 A;  1GGX A;  2HPW A;  3GJ1 A;  1YHG A;  1RRX A;  2HFC A;  4IK3 A;  3E5W A;  4H48 A;  4Q9W A;  2WHT A;  2WUR A;  3VIC A;  4Q7T A;  4R6B A;  2DUG A;  3SV5 A;  3ZTF A;  1H6R A;  2IB6 A;  3DQ2 A;  4H3L A;  2HGD A;  4ZIO A;  1OXD A;  4H47 A;  4W7F A;  1RMM A;  3AI4 A;  5J2O A;  1HUY A;  4DXI A;  4XGY A;  5DU0 A;  3P8U A;  3ZUJ A;  1F09 A;  2QZ0 A;  1KP5 A;  2OGR A;  3OSR A;  3DQJ A;  1QYF A;  1YJ2 A;  2OKY A;  5EB6 A;  4W73 A;  3EK8 A;  3NEZ A;  4W6S A;  4KF5 A;  2OKW A;  4J88 A;  3LS3 A;  2ICR A;  1OXF A;  4W6U A;  3DPX A;  3SSV A;  4DKN A;  2C9I A;  3DQ4 A;  3LF4 B;  3SSP A;  3DQK A;  3EVU A;  3DQ9 A;  4KPI A;  1W7S A;  3RWA A;  3U0N A;  4B30 A;  4KW8 A;  4IK9 A;  2FWQ A;  5LTQ A;  2AH8 A;  2Z1O A;  3DQI A;  3U8C A;  5H89 A;  3SVB A;  2Z6X A;  2OTB A;  4B5Y A;  3GL4 A;  2AWK A;  2GW4 B;  2VVH A;  3ST2 A;  2EMO A;  4KW9 A;  3SG4 A;  1G7K A;  2G6Y A;  4W6O A;  3NT3 A;  2H5P A;  3IP2 A;  3UFZ A;  2YE1 A;  4ZF4 A;  1EMB A;  1B9C A;  1Z1P A;  5EHU A;  4DXN A;  3OSQ A;  4KA9 A;  4L1I A;  3W1D A;  3NT9 A;  4JC2 A;  2IE2 A;  4W72 A;  3GJ2 A;  4IK8 A;  3AKO A;  2V4E C;  2G3D B;  2AHA A;  4OHS A;  2B3P A;  3GEX A;  3CD9 A;  1JBZ A;  5EXB A;  3O77 A;  1YHI A;  4W77 A;  3M24 A;  1QYO A;  5DY6 A;  3WCK A;  1KYR A;  3EKH A;  1KYP A;  5DTZ A;  4PPL A;  2EMD A;  2G6X A;  3CD1 A;  2DUI A;  1GL4 A;  3DQ1 A;  4TZA A;  4Z4M A;  1YZW A;  3LVC A;  4LQT A;  1RMO A;  2G16 B;  5LTP A;  3W1C A;  2VAE A;  3A8S A;  1JBY A;  4W6K A;  4KAG A;  4P1Q A;  1ZUX A;  2B3Q A;  4RTC A;  4NWS A;  2H5R A;  3EK7 A;  3SRY A;  3PJB A;  4W6N A;  3MGF A;  3KCS A;  4PPK A;  1UIS A;  3CBE A;  1F0B A;  3DQ7 A;  3SVO A;  2A47 A;  3WLD A;  4IK4 A;  5BTT B;  3EVP A;  4JF9 A;  3K1K A;  2GX2 A;  3NF0 A;  2C9J A;  2Z6Z A;  5BQL A;  2YFP A;  2WHU A;  4ZB1 A;  4W6H A;  1Q4D A;  1RMP A; 
#chains in the Genus database with same CATH topology
 4JRB A;  2G6E A;  4GOB A;  2QLE A;  3V3D A;  3SSL A;  4W7A A;  3DQH A;  2PXS A;  4HE4 A;  5EXC I;  1EMA A;  4W6J A;  3H1O A;  4ORN A;  1S6Z A;  4PFE A;  3BXA A;  2H5Q A;  2HRS A;  3VK1 A;  5FVG A;  1EMK A;  2A56 B;  3G9A A;  5FVF A;  4W6I A;  1XA9 A;  3SSH A;  3DQC A;  2QLH A;  5LK4 A;  1ZGP A;  1ZGO A;  4LJB A;  1RM9 A;  2DDD A;  4XVP A;  3IR8 A;  2G5Z B;  2A53 B;  4W7E A;  3LF3 A;  3SVN A;  3SG7 A;  1YJF A;  2H6V A;  2HJO A;  2POX A;  1YHH A;  2H5O A;  1MOV A;  4W75 A;  3DQL A;  2O2B A;  3SVS A;  2ZMW A;  5HZT A;  1W7T A;  1Q4A A;  4GF6 B;  4LJC A;  2ZO7 A;  1QXT A;  5KTG A;  4W6F A;  4GES B;  4H3M A;  4XOV A;  3P28 A;  5DQM A;  4DXO A;  2DD7 A;  4Q7U A;  4HVF A;  2PXW A;  1KYS A;  5DPG A;  1YFP A;  4EN1 A;  3O78 A;  2JAD A;  3NED A;  5HZS A;  3SG6 A;  4Q9X A;  3DQN A;  4OY4 A;  2ZMU A;  1MYW A;  4BDU A;  3SVC A;  1XQM A;  4OQW A;  4Z4K A;  1W7U A;  2QRF A;  4U2V A;  3E5T A;  4LJD C;  1EML A;  3EK4 A;  3EVV A;  4W6T A;  1Q4E A;  4W6R A;  3ZUF A;  1EMM A;  4W76 A;  2HCG A;  4KGF A;  4XOW A;  2AWJ A;  1EMG A;  1JC0 A;  4JEO A;  1XMZ A;  2DUH A;  2DUE A;  3CFA A;  4W7X A;  4IK1 A;  2AWM A;  4R6D A;  3BX9 A;  1QY3 A;  2GX0 A;  4EDS A;  2HGY A;  1Q4B A;  2ARL A;  5FVI A;  3H1R A;  4AR7 A;  2A48 A;  2A46 A;  4ZF3 A;  2FZU A;  5HW9 A;  5H88 A;  2A54 B;  4J89 A;  3ED8 A;  4OJ0 A;  1C4F A;  5AQB B;  5F9G A;  2VVI A;  5EXU A;  2WIQ A;  1EMF A;  4HQ9 A;  3ZUL A;  3RWT A;  2HQK A;  3LVD A;  2QU1 A;  4KF4 A;  1EME A;  3DQD A;  4N3D A;  3WLC A;  4DXM A;  2BTJ A;  3KCT A;  2Z6Y A;  4TZG A;  5DRF A;  1EMC A;  2V4E B;  5EJU A;  2VAD A;  4ZFS A;  5H87 A;  3DQ5 A;  4IK5 A;  5BTT A;  1Q73 A;  3SS0 A;  2V4E A;  4P76 A;  2WIS A;  4KF5 C;  3DPZ A;  4W74 A;  1BFP A;  3DQO A;  2GW3 A;  2H8Q A;  2QLI A;  3DQ6 A;  5DTL A;  3UG0 A;  2EMN A;  3AI5 A;  4LQU A;  3SSK A;  3SSY A;  4W6D A;  3LSA A;  3DQ8 A;  4IZN A;  3SVD A;  2HQZ A;  5DPH A;  4ZF5 A;  4PPJ A;  3EVR A;  3SVR A;  1CV7 A;  3DQE A;  2AWL A;  2O29 A;  5HBD A;  5BT0 A;  3LVA A;  3S05 A;  4J8A A;  4L13 A;  4OGS A;  4ZBL A;  1XSS A;  2H9W A;  3DQF A;  4W6B A;  2A52 B;  1QYQ A;  4W6L A;  3DQU A;  3DQA A;  3SG3 A;  2WHS A;  4DXP A;  3M22 A;  4RYW A;  5DPI A;  5HGE A;  5DTY A;  2QT2 A;  5DPJ A;  4LW5 A;  4L12 A;  1JC1 A;  3DQM A;  4ANJ A;  4W6M A;  4W6C A;  4DKM A;  4EDO A;  2A50 B;  3SVE A;  4W6P A;  3U8P A;  3PJ7 A;  4B30 B;  2Y0G A;  4W69 A;  3ADF A;  1Z1Q A;  4JFG A;  3ST4 A;  3CB9 A;  2OTE A;  1OXE A;  3CFF A;  4AS8 A;  4ZIN A;  2ZO6 A;  2RH7 A;  4EMQ A;  3PIB A;  4W7D A;  3GB3 A;  5HZO A;  5EB7 A;  2DUF A;  1HCJ A;  4EUL A;  5EBJ A;  3ST3 A;  5LTR A;  3PJ5 A;  4DXQ A;  3TMR A;  2QLG B;  2DDC A;  3LA1 A;  4RYS A;  2YE0 A;  3U0K A;  5DTX A;  3E5V A;  4W7R A;  2VVJ A;  2QLG A;  4UTS A;  1Q4C A;  4XL5 A;  3U8A A;  3SVU A;  2Q57 A;  3CGL A;  1H4U A;  5DQB A;  2DD9 A;  3OGO A;  4W6G A;  3DPW A;  4KEX A;  1XAE A;  4W6A A;  4KGE A;  4Q7R A;  2O24 A;  3CFH A;  3U0M A;  3SG2 A;  3ST0 A;  3EKJ A;  3VHT B;  3U0L A;  1MOU A;  3BXB A;  4W7C A;  1GFL A;  2IB5 A;  5DRG A;  3VHT A;  4H3N A;  2G2S B;  2IOV A;  3BXC A;  5T3I A;  5HZU A;  1ZGQ A;  2WSN A;  3SG5 A;  2G3O A;  2YDZ A;  4JGE A;  3TMT A;  2WSO A;  4HQ8 A;  2OJK A;  4LJD A;  2FL1 A;  2P4M A;  4I2Y A;  3SST A;  4HQC A;  2VZX A;  2Q6P A;  5FHV A;  4KW4 A;  3DQ3 A;  3I19 A;  1GGX A;  2HPW A;  3GJ1 A;  1YHG A;  1RRX A;  2HFC A;  4IK3 A;  3E5W A;  4H48 A;  4Q9W A;  2WHT A;  2WUR A;  3VIC A;  4Q7T A;  4R6B A;  2DUG A;  3SV5 A;  3ZTF A;  1H6R A;  2IB6 A;  3DQ2 A;  4H3L A;  2HGD A;  4ZIO A;  1OXD A;  4H47 A;  4W7F A;  1RMM A;  3AI4 A;  5J2O A;  1HUY A;  4DXI A;  4XGY A;  5DU0 A;  3P8U A;  3ZUJ A;  1F09 A;  2QZ0 A;  1KP5 A;  2OGR A;  3OSR A;  3DQJ A;  1QYF A;  1YJ2 A;  2OKY A;  5EB6 A;  4W73 A;  3EK8 A;  3NEZ A;  4W6S A;  4KF5 A;  2OKW A;  4J88 A;  3LS3 A;  2ICR A;  1OXF A;  4W6U A;  3DPX A;  3SSV A;  4DKN A;  2C9I A;  3DQ4 A;  3LF4 B;  3SSP A;  3DQK A;  3EVU A;  3DQ9 A;  4KPI A;  1W7S A;  3RWA A;  3U0N A;  4B30 A;  4KW8 A;  4IK9 A;  2FWQ A;  5LTQ A;  2AH8 A;  2Z1O A;  3DQI A;  3U8C A;  5H89 A;  3SVB A;  2Z6X A;  2OTB A;  4B5Y A;  3GL4 A;  2AWK A;  2GW4 B;  2VVH A;  3ST2 A;  2EMO A;  4KW9 A;  3SG4 A;  1G7K A;  2G6Y A;  4W6O A;  3NT3 A;  2H5P A;  3IP2 A;  3UFZ A;  2YE1 A;  4ZF4 A;  1EMB A;  1B9C A;  1Z1P A;  5EHU A;  4DXN A;  3OSQ A;  4KA9 A;  4L1I A;  3W1D A;  3NT9 A;  4JC2 A;  2IE2 A;  4W72 A;  3GJ2 A;  4IK8 A;  3AKO A;  2V4E C;  2G3D B;  2AHA A;  4OHS A;  2B3P A;  3GEX A;  3CD9 A;  1JBZ A;  5EXB A;  3O77 A;  1YHI A;  4W77 A;  3M24 A;  1QYO A;  5DY6 A;  3WCK A;  1KYR A;  3EKH A;  1KYP A;  5DTZ A;  4PPL A;  2EMD A;  2G6X A;  3CD1 A;  2DUI A;  1GL4 A;  3DQ1 A;  4TZA A;  4Z4M A;  1YZW A;  3LVC A;  4LQT A;  1RMO A;  2G16 B;  5LTP A;  3W1C A;  2VAE A;  3A8S A;  1JBY A;  4W6K A;  4KAG A;  4P1Q A;  1ZUX A;  2B3Q A;  4RTC A;  4NWS A;  2H5R A;  3EK7 A;  3SRY A;  3PJB A;  4W6N A;  3MGF A;  3KCS A;  4PPK A;  1UIS A;  3CBE A;  1F0B A;  3DQ7 A;  3SVO A;  2A47 A;  3WLD A;  4IK4 A;  5BTT B;  3EVP A;  4JF9 A;  3K1K A;  2GX2 A;  3NF0 A;  2C9J A;  2Z6Z A;  5BQL A;  2YFP A;  2WHU A;  4ZB1 A;  4W6H A;  1Q4D A;  1RMP A; 
#chains in the Genus database with same CATH homology
 4JRB A;  2G6E A;  4GOB A;  2QLE A;  3V3D A;  3SSL A;  4W7A A;  3DQH A;  2PXS A;  4HE4 A;  5EXC I;  1EMA A;  4W6J A;  3H1O A;  4ORN A;  1S6Z A;  4PFE A;  3BXA A;  2H5Q A;  2HRS A;  3VK1 A;  5FVG A;  1EMK A;  2A56 B;  3G9A A;  5FVF A;  4W6I A;  1XA9 A;  3SSH A;  3DQC A;  2QLH A;  5LK4 A;  1ZGP A;  1ZGO A;  4LJB A;  1RM9 A;  2DDD A;  4XVP A;  3IR8 A;  2G5Z B;  2A53 B;  4W7E A;  3LF3 A;  3SVN A;  3SG7 A;  1YJF A;  2H6V A;  2HJO A;  2POX A;  1YHH A;  2H5O A;  1MOV A;  4W75 A;  3DQL A;  2O2B A;  3SVS A;  2ZMW A;  5HZT A;  1W7T A;  1Q4A A;  4GF6 B;  4LJC A;  2ZO7 A;  1QXT A;  5KTG A;  4W6F A;  4GES B;  4H3M A;  4XOV A;  3P28 A;  5DQM A;  4DXO A;  2DD7 A;  4Q7U A;  4HVF A;  2PXW A;  1KYS A;  5DPG A;  1YFP A;  4EN1 A;  3O78 A;  2JAD A;  3NED A;  5HZS A;  3SG6 A;  4Q9X A;  3DQN A;  4OY4 A;  2ZMU A;  1MYW A;  4BDU A;  3SVC A;  1XQM A;  4OQW A;  4Z4K A;  1W7U A;  2QRF A;  4U2V A;  3E5T A;  4LJD C;  1EML A;  3EK4 A;  3EVV A;  4W6T A;  1Q4E A;  4W6R A;  3ZUF A;  1EMM A;  4W76 A;  2HCG A;  4KGF A;  4XOW A;  2AWJ A;  1EMG A;  1JC0 A;  4JEO A;  1XMZ A;  2DUH A;  2DUE A;  3CFA A;  4W7X A;  4IK1 A;  2AWM A;  4R6D A;  3BX9 A;  1QY3 A;  2GX0 A;  4EDS A;  2HGY A;  1Q4B A;  2ARL A;  5FVI A;  3H1R A;  4AR7 A;  2A48 A;  2A46 A;  4ZF3 A;  2FZU A;  5HW9 A;  5H88 A;  2A54 B;  4J89 A;  3ED8 A;  4OJ0 A;  1C4F A;  5AQB B;  5F9G A;  2VVI A;  5EXU A;  2WIQ A;  1EMF A;  4HQ9 A;  3ZUL A;  3RWT A;  2HQK A;  3LVD A;  2QU1 A;  4KF4 A;  1EME A;  3DQD A;  4N3D A;  3WLC A;  4DXM A;  2BTJ A;  3KCT A;  2Z6Y A;  4TZG A;  5DRF A;  1EMC A;  2V4E B;  5EJU A;  2VAD A;  4ZFS A;  5H87 A;  3DQ5 A;  4IK5 A;  5BTT A;  1Q73 A;  3SS0 A;  2V4E A;  4P76 A;  2WIS A;  4KF5 C;  3DPZ A;  4W74 A;  1BFP A;  3DQO A;  2GW3 A;  2H8Q A;  2QLI A;  3DQ6 A;  5DTL A;  3UG0 A;  2EMN A;  3AI5 A;  4LQU A;  3SSK A;  3SSY A;  4W6D A;  3LSA A;  3DQ8 A;  4IZN A;  3SVD A;  2HQZ A;  5DPH A;  4ZF5 A;  4PPJ A;  3EVR A;  3SVR A;  1CV7 A;  3DQE A;  2AWL A;  2O29 A;  5HBD A;  5BT0 A;  3LVA A;  3S05 A;  4J8A A;  4L13 A;  4OGS A;  4ZBL A;  1XSS A;  2H9W A;  3DQF A;  4W6B A;  2A52 B;  1QYQ A;  4W6L A;  3DQU A;  3DQA A;  3SG3 A;  2WHS A;  4DXP A;  3M22 A;  4RYW A;  5DPI A;  5HGE A;  5DTY A;  2QT2 A;  5DPJ A;  4LW5 A;  4L12 A;  1JC1 A;  3DQM A;  4ANJ A;  4W6M A;  4W6C A;  4DKM A;  4EDO A;  2A50 B;  3SVE A;  4W6P A;  3U8P A;  3PJ7 A;  4B30 B;  2Y0G A;  4W69 A;  3ADF A;  1Z1Q A;  4JFG A;  3ST4 A;  3CB9 A;  2OTE A;  1OXE A;  3CFF A;  4AS8 A;  4ZIN A;  2ZO6 A;  2RH7 A;  4EMQ A;  3PIB A;  4W7D A;  3GB3 A;  5HZO A;  5EB7 A;  2DUF A;  1HCJ A;  4EUL A;  5EBJ A;  3ST3 A;  5LTR A;  3PJ5 A;  4DXQ A;  3TMR A;  2QLG B;  2DDC A;  3LA1 A;  4RYS A;  2YE0 A;  3U0K A;  5DTX A;  3E5V A;  4W7R A;  2VVJ A;  2QLG A;  4UTS A;  1Q4C A;  4XL5 A;  3U8A A;  3SVU A;  2Q57 A;  3CGL A;  1H4U A;  5DQB A;  2DD9 A;  3OGO A;  4W6G A;  3DPW A;  4KEX A;  1XAE A;  4W6A A;  4KGE A;  4Q7R A;  2O24 A;  3CFH A;  3U0M A;  3SG2 A;  3ST0 A;  3EKJ A;  3VHT B;  3U0L A;  1MOU A;  3BXB A;  4W7C A;  1GFL A;  2IB5 A;  5DRG A;  3VHT A;  4H3N A;  2G2S B;  2IOV A;  3BXC A;  5T3I A;  5HZU A;  1ZGQ A;  2WSN A;  3SG5 A;  2G3O A;  2YDZ A;  4JGE A;  3TMT A;  2WSO A;  4HQ8 A;  2OJK A;  4LJD A;  2FL1 A;  2P4M A;  4I2Y A;  3SST A;  4HQC A;  2VZX A;  2Q6P A;  5FHV A;  4KW4 A;  3DQ3 A;  3I19 A;  1GGX A;  2HPW A;  3GJ1 A;  1YHG A;  1RRX A;  2HFC A;  4IK3 A;  3E5W A;  4H48 A;  4Q9W A;  2WHT A;  2WUR A;  3VIC A;  4Q7T A;  4R6B A;  2DUG A;  3SV5 A;  3ZTF A;  1H6R A;  2IB6 A;  3DQ2 A;  4H3L A;  2HGD A;  4ZIO A;  1OXD A;  4H47 A;  4W7F A;  1RMM A;  3AI4 A;  5J2O A;  1HUY A;  4DXI A;  4XGY A;  5DU0 A;  3P8U A;  3ZUJ A;  1F09 A;  2QZ0 A;  1KP5 A;  2OGR A;  3OSR A;  3DQJ A;  1QYF A;  1YJ2 A;  2OKY A;  5EB6 A;  4W73 A;  3EK8 A;  3NEZ A;  4W6S A;  4KF5 A;  2OKW A;  4J88 A;  3LS3 A;  2ICR A;  1OXF A;  4W6U A;  3DPX A;  3SSV A;  4DKN A;  2C9I A;  3DQ4 A;  3LF4 B;  3SSP A;  3DQK A;  3EVU A;  3DQ9 A;  4KPI A;  1W7S A;  3RWA A;  3U0N A;  4B30 A;  4KW8 A;  4IK9 A;  2FWQ A;  5LTQ A;  2AH8 A;  2Z1O A;  3DQI A;  3U8C A;  5H89 A;  3SVB A;  2Z6X A;  2OTB A;  4B5Y A;  3GL4 A;  2AWK A;  2GW4 B;  2VVH A;  3ST2 A;  2EMO A;  4KW9 A;  3SG4 A;  1G7K A;  2G6Y A;  4W6O A;  3NT3 A;  2H5P A;  3IP2 A;  3UFZ A;  2YE1 A;  4ZF4 A;  1EMB A;  1B9C A;  1Z1P A;  5EHU A;  4DXN A;  3OSQ A;  4KA9 A;  4L1I A;  3W1D A;  3NT9 A;  4JC2 A;  2IE2 A;  4W72 A;  3GJ2 A;  4IK8 A;  3AKO A;  2V4E C;  2G3D B;  2AHA A;  4OHS A;  2B3P A;  3GEX A;  3CD9 A;  1JBZ A;  5EXB A;  3O77 A;  1YHI A;  4W77 A;  3M24 A;  1QYO A;  5DY6 A;  3WCK A;  1KYR A;  3EKH A;  1KYP A;  5DTZ A;  4PPL A;  2EMD A;  2G6X A;  3CD1 A;  2DUI A;  1GL4 A;  3DQ1 A;  4TZA A;  4Z4M A;  1YZW A;  3LVC A;  4LQT A;  1RMO A;  2G16 B;  5LTP A;  3W1C A;  2VAE A;  3A8S A;  1JBY A;  4W6K A;  4KAG A;  4P1Q A;  1ZUX A;  2B3Q A;  4RTC A;  4NWS A;  2H5R A;  3EK7 A;  3SRY A;  3PJB A;  4W6N A;  3MGF A;  3KCS A;  4PPK A;  1UIS A;  3CBE A;  1F0B A;  3DQ7 A;  3SVO A;  2A47 A;  3WLD A;  4IK4 A;  5BTT B;  3EVP A;  4JF9 A;  3K1K A;  2GX2 A;  3NF0 A;  2C9J A;  2Z6Z A;  5BQL A;  2YFP A;  2WHU A;  4ZB1 A;  4W6H A;  1Q4D A;  1RMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...