3SG7A

Crystal structure of gcamp3-kf(linker 1)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
410
structure length
398
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSKFNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDESKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 132
structure length 398
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg7A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg7A02
4W7EA 1OSAA 2FCDA 1JSAA 4IK3A 2JOJA 4IK9A 4PPJA 3TDUA 3AKAA 1XMZA 2M1KB 2VADA 4ORAB 2L4HA 1S6CA 1IJ5A 2WSNA 1Y0VH 1OMRA 1XK4A 3OGOA 1GL4A 4Z4KA 1BR4B 4W6FA 2JZIA 3A8RA 1IJ6A 4A4CA 1F0BA 1NCZA 1GGXA 4W6HA 2LVIA 4L12A 5CSNA 1SR6B 1SCMB 3EK7A 2QZ0A 3PLFB 1NIWA 2ZO6A 1H4BA 3FWCA 3GK4X 2BTJA 2ZNDA 4W6LA 2M7NA 3SSTA 1MR8A 4ZF4A 3MGFA 4QJ4B 1RWYA 2G9BA 3I5FC 3ZWHA 3CLNA 2LMUA 3E5VA 1JC2A 2KI6C 2OTGB 3GOFA 4KF5C 1QYOA 1PULA 2ARLA 4TNCA 5FVIA 4R6DA 3DQ5A 1NPQA 2I18A 2HETA 3TMRA 1ZGOA 4W6OA 3PJBA 1KYPA 1F54A 4PE4A 2ICRA 1K96A 1V1GA 4CPVA 1GJYA 1K9UA 4U8DA 3HCMA 1WDCB 3WHUB 1NYAA 3EK4A 4ZF5A 4KW8A 3WLDA 2Q6PA 1CDMA 1QVIY 5JJGA 2L98A 2JNFA 1BF5A 2KAXA 4YGDB 2PXWA 5FHVA 4MZKA 2IB6A 2JADA 2HPWA 3NT3A 2AH8A 1BU3A 4PPLA 4PALA 1B4CA 2OKWA 5KU1A 1QYFA 3EVVA 2B3QA 1RJVA 2P6BB 4W75A 3TUYB 2E6WA 3GB3A 4OR9B 4N3DA 5BTTA 1OXFA 1YUTA 2H61C 1NX3A 3LK0A 2A46A 1DJGA 1EG4A 2PMYA 2ZKMX 3DQMA 2R2IA 4MSPA 2DUHA 5HKWA 3BXBA 4W6JA 1DTLA 5LK4A 4ZBLA 4AQIA 1DT7B 1CKKA 2O29A 2AUCA 2OGRA 2HFCA 4H48A 2FJUB 2K61A 3NEDA 3KCTA 2K7BA 3I5HB 4ZIOA 1F4OA 2G16B 1LA3A 3GL4A 1N65A 5DQBA 1EL4A 5DPGA 3CS1A 4H3LA 4W7FA 4PDZA 4HRHA 1QS7A 1DJZA 4J89A 3SSYA 3SIBA 2L0PA 1F70A 1GGZA 3TS5B 1UHIA 5HZTA 3VHTB 3EVPA 1QXPA 1OE9B 1G4YR 3CD9A 3EK8A 4W6KA 1SPYA 5F9GA 4I5NB 1KFXL 1H6RA 4DXOA 4Q7RA 4JRBA 2AAOA 3SIAA 1A29A 1RMPA 3VK1A 2Q91A 4W6PA 2LMTA 1M45A 5ER4X 1C4FA 2JC2A 1J7QA 2FL1A 2K8MB 3VROA 4QJ3B 3W1DA 5EXCI 4JPZB 4AQJA 4DXNA 2LM5A 4I5KA 3SG5A 2SASA 2BCAA 3A8SA 4MZLA 1UP5A 1YUSA 1Q80A 1XFZO 2JPTA 1YHGA 4J8AA 1YX7A 3LL8B 1KSMA 1MOUA 4W74A 4YGAA 4OQWA 3SG3A 2KGBC 4MEWA 3I5FB 3I5IC 1VRKA 2Y4QA 2BE6A 3CFAA 1NCYA 1TCFA 1WRZA 1CB1A 2BE4A 3GJ2A 4W6TA 3D0YA 1M46A 1DGUA 2DUGA 1K9KA 4DKMA 2A56B 2SCPA 4XYNA 4I5JA 1CDNA 3KEVA 3DQKA 3WCKA 5EXUA 2CCMA 1RK9A 4W69A 4HRGA 2H8QA 2O2BA 3DQJA 1CLMA 3BOWA 4KW4A 3H1RA 4DS7A 4N1GA 4RYSA 2Z6ZA 1Q4BA 4ZFSA 2AHAA 4PE1A 2D8NA 3KO0A 5TNCA 1MOVA 1ZUXA 1V1FA 1RECA 1KQMC 4NDCA 2H5PA 4KF5A 1B9CA 4AR7A 1CFCA 4NWSA 1QXTA 4C0KA 4MLWA 3SG7A 3LCPC 2P4MA 4M2QA 3DQUA 1EMCA 1HQVA 1UUSA 2BL0C 3HX4A 1SCMC 1F09A 2ZN8A 1IKUA 4W6CA 1XVJA 4LQUA 3NEZA 1RMOA 4JEOA 1FI6A 4LJDC 2HQKA 1QIWA 2WORA 3CR4X 1KYSA 3EVRA 1OZOA 5CSJA 1TTXA 2LCPA 1B8RA 2KYCA 3JTDC 4W6BA 2POXA 1NSHA 1JFKA 1A75B 3DVJA 2WURA 3DQLA 1BFPA 3JVTC 3DQAA 2KI6D 5DRGA 4JWQA 4HREE 3DQ6A 3H1OA 2PXSA 2KFGA 3DQ9A 2JULA 4GESB 2L50A 5IBWA 1SNLA 3GK2A 2CT9A 4PHJA 2MJWB 3SSPA 2VVIA 2QACA 1KP5A 1S36A 2LLSA 2YE0A 3LVDA 4GAOA 3RLZA 3CB9A 1GGWA 2PVBA 1Y1XA 1YHHA 3DQDA 4KGFA 1NCXA 1QV0A 4M2OA 2GW3A 3VRRA 4W73A 1M31A 1IWQA 5BQLA 5AEQA 2KQYA 1SL7A 3I5IB 5EB6A 1AP4A 5D69A 3DPXA 1YURA 3QRXA 1XFUO 3E3RA 1XFXO 1R6PA 2VAEA 3NF0A 1YRUB 1S1EA 2NXQA 2B3PA 1J7PA 1OOJA 1HT9A 2MLEC 3LVCA 2QLGB 2O60A 3DF0A 5EXBA 3E5TA 2HGYA 2L4IA 4KEXA 1HCJA 1UHKA 2K2AA 2NCOA 2JXLA 1WRKA 3OP0A 1KQMB 5I2LA 2KQ6A 3PN7C 3AI4A 1Q4CA 1QV1A 4W6AA 1S6ZA 1B47A 2KBIA 2JNXA 1LINA 5DKQA 1U5IB 1BG1A 2QRFA 3NT9A 4OJ0A 3OX6A 2BL0B 1XFWO 1CM4A 3BUXB 2L2EA 1JC1A 4HVFA 1CDPA 4CFRA 1Z1QA 4KF4A 4B30B 1Q73A 3O4YA 2EMNA 2DDCA 2CXJA 2K7DA 3BUMB 1XAEA 1PK0D 3JTDB 1ZFSA 4XVPA 3SG2A 1SY9A 2LC5A 5LTRA 3SVRA 1EG3A 1QTXA 1CMFA 2G6EA 1H8BA 1QX7A 3O6BA 3JVTB 4HQ9A 4UTSA 3GK1A 1BLQA 4YI8A 3TDIA 4YRUA 3NSIA 1NX1A 1ZUZA 5J3XA 4CIDA 1DJHA 2DDDA 4GPLB 2K2FA 2DUIA 2Y0GA 1OXDA 5HYDA 4N1FA 2L51A 1QASA 1MF8B 4W6NA 4UPGA 5LTPA 1YZWA 1Y1UA 5DTYA 3ZNIA 5HZSA 4B5YA 1EJ3A 2WOSA 2L5XB 4YGEB 4DXIA 3M22A 4W6SA 2H6VA 2Y1NA 4FQOA 4WQ3A 3U8CA 4IK1A 1RROA 3IQQA 3IF7A 4AS8A 4GUKA 2KDHA 2KNEA 3AKOA 3CGLA 3CBEA 4DUQA 1H4UA 1K93D 1JBYA 1UISA 4PE0A 4PPKA 3H4SE 2WHTA 3PJ7A 5HGEA 2CBLA 1FPWA 2BCXA 1BR1B 3SVEA 3A4UB 1XQMA 3WNXB 5DTZA 1EMMA 3E5WA 3VRQA 3DQEA 3BXCA 2GX2A 1EXRA 1CNPA 1AJ5A 3I5GC 1UHNA 1B9AA 3FS7A 4IL1A 1XO5A 1AVSA 2HRSA 3RWTA 3OSQA 2H2KA 2KI4C 4GF6B 3CGAA 1F4QA 1KQVA 2OS8C 4A4BA 4ZCVA 3RWAA 1UWOA 5CPVA 2NCPA 1S6JA 1UHJA 1AHRA 2WC8A 1HUYA 1KK7Y 4C0LA 3PN7B 1QX5B 1DMOA 5K89A 5EHUA 2KOTA 4GGFC 4I5LB 2F2PA 2H9WA 3CTNA 2JXCA 4OCIA 1YR5A 3G9AA 3DQ1A 5DPIA 2LVKA 1W7TA 2WISA 4GFTA 5PALA 5AXIA 3VHTA 1PVBA 2AWMA 1ALWA 4ETOA 2G3OA 2A53B 3SVDA 1EMFA 2BBMA 2RGIA 4W76A 1TNQA 5HZUA 2ISDA 4KGEA 2YFPA 2KAYA 4GOBA 2TN4A 1EMEA 2FOTA 4XJKA 3M24A 3DPZA 4W7CA 3LS3A 3AKBA 2KFHA 2QLEA 3VGOA 5DY6A 1BJFA 1XK4C 1NX2A 5I2OA 2V4EB 1B7TY 3PFVA 5FVGA 5FVFA 2OPOA 3SRYA 3DQ8A 4H3MA 5DKRA 1E8AA 1S5GZ 1CMGA 2ZRTA 2F8PA 4TZGA 1RM9A 1FBVA 1ZGPA 2JTZA 5I2QA 1AJ4A 1CV7A 1SCVA 4ORCB 2WIQA 2WCBA 2O24A 4PHKA 2JT0A 5LTQA 2DUFA 4CFQA 1B1GA 2KFFA 4CLNA 3DQ2A 1Y6WA 2HQWA 2H5RA 2NLNA 1D1OA 2PRUA 1XSSA 5HKYA 2F3ZA 1SK6D 1A4PA 1MQ1A 1F55A 3K21A 3WHTB 3BUWB 2G3DB 3DQ3A 1KYRA 4EDOA 3PATA 3U0MA 2LP2A 4XGYA 1Q4EA 4E68A 3DQ7A 3U0KA 3NSKA 1ALVA 3WXAA 4P76A 3BX9A 1K8UA 4EDSA 1JF2A 1QY3A 3I5GB 4HE4A 1C7WA 4IZNA 4W6GA 4ZCUA 4Q7UA 3SG6A 1N0YA 2LANA 4P5OE 5I8NA 3IQOA 2H61A 2KI4B 1YFPA 5H87A 2IE2A 2OS8B 2M29A 3ZULA 2G2SB 3DQCA 5F6TA 5HZOA 2O5GA 1ZOTB 1FI5A 3SVOA 1OZSA 1GFLA 2QLHA 1DGVA 1IRJA 2AWKA 3TDZA 1XFYO 1DF0B 4GNKB 1JC0A 2NZ0A 3IP2A 4PCWA 2AWJA 4JF9A 4N5XA 1J7RA 2M3WA 2LNKA 4L9MA 4ZF3A 2VRGA 5CSIA 2LHIA 4OY4A 4MN0A 2M1UA 1A75A 2IB5A 1KSOA 1K90D 5CSFA 4FTGA 1S3PA 3KHEA 3C1VA 3FIAA 1K9PA 2HJOA 1KWOC 3BXKA 4W7AA 4TZAA 2VVJA 2LUCA 1YUUA 3D10A 3O2PA 3VICA 4W6IA 1CM1A 3ZTFA 2BKIB 5AQBB 2BCBA 1G7KA 4L1IA 3ZUFA 1WRLA 4W77A 1M39A 1K94A 2M9GA 1IG5A 4KPIA 4OGSA 4J88A 4IK4A 1QVIZ 4QJ5B 1B8LA 2K7CA 2M49B 1DJXA 1QIVA 1FF1A 2F2OA 4RTCA 1GQMA 2K0JA 2Y1MA 3ST4A 2FCEA 2COLB 5DRFA 4W6RA 1YVLA 3VRNA 2CTNA 4PHNA 1TNPA 2HCGA 3U8PA 5BPJA 3ED8A 3CFHA 4MBEA 3LSAA 3CWGA 3BXAA 4XL5A 4LW5A 1OQPA 2G2BA 1TRFA 1R2UA 2LLTA 2VVHA 3DQNA 1RRXA 2WHUA 1UHHA 1KK8C 3SSVA 1NWDA 3SSLA 2ZFDA 4DKNA 2GX0A 1SW8A 4JC2A 4GBAA 4H47A 2GGZA 3P8UA 5DTXA 3LK1A 3CR2A 2E30A 2Y5IA 3MSEB 2IOVA 2QLGA 1CLLA 2KBMA 1OMVA 2A47A 2AMIA 3NSOA 4XOWA 2A52B 3PJ5A 3DVMA 5HKZA 2OTEA 1ZACA 3OHMB 3ST0A 3SVSA 1OMDA 1ZGQA 3DD4A 3U0LA 4USLA 1BMOA 1EMGA 2BKHB 2WCFA 3LLEA 2H5QA 2B1UA 3KPXA 1LA0A 1J55A 2LHLA 3CZTX 4YGCB 3AI5A 3BQ3A 1CTRA 2V4EC 2QPTA 1KK7Z 5AANA 1BOCA 4C0JA 5BTTB 3ST3A 1U5IA 3AAKA 1DVIA 3DQFA 1S6IA 1JUOA 1NP8A 3DQHA 1L7ZA 2LAPA 2AWLA 3OX5A 2KHNA 2FZUA 2PASA 2I94A 1CLBA 4B30A 4LJDA 1IGVA 1RTP1 5DPJA 1KCYA 1Y1AA 3CR5X 1RFJA 4DCKA 4EULA 2A4JA 1TN4A 4W6UA 4LJBA 4ZINA 1XYDA 3AAJA 2M7LA 1RMMA 2MA2A 1JFJA 2Q57A 5ER5A 3WLCA 4PE7A 4Q7TA 5EJUA 2G5ZB 1WY9A 5J2OA 3GEXA 2VZXA 1KWOB 3SJSA 3LA1A 4Q9XA 3W1CA 3PSRA 1G8IA 1N2DA 3LVAA 3DVEA 1EMAA 5KTYA 3KCSA 1B7TZ 3EKHA 2I2RE 2JRFA 4IK8A 4DXQA 4LJCA 2FWQA 5DQMA 2BBNA 4DRWA 1WLMA 3CFFA 2H5OA 1QJTA 3ICBA 1MWNA 4DIRA 1JBAA 1X02A 4BY5A 5D7FA 3LF4B 1PVAA 3BYAA 2HPSA 4JQ0D 4M2PA 4Z4MA 4YI9A 4EN1A 1J1EA 1TNXA 5HLOA 2QLIA 1EMKA 4YBHB 1YX8A 4ICBA 3RM1A 1QYQA 3SVNA 4P1QA 4IK5A 1ODBA 4OHSA 1SL8A 3U0NA 4LQTA 2JWWA 2I7AA 4KW9A 4W72A 5T3IA 1PSRA 3IR8A 1CFFA 2F3YA 1CFDA 5GQQC 2C9JA 3BUOB 4DXMA 1KK8B 1J1DA 2A50B 1YJ2A 3SSHA 1KFUL 1TCOB 2MBXA 2WNDA 2V53A 1AK8A 2DD9A 2YE1A 2GV5A 5AFPA 2LVJA 2Z6YA 2EC6C 4BY4A 2EGDA 3U8AA 4XJKB 3D0YB 4HSZA 1G33A 1MXEA 2ZMWA 5JOLA 3OB2B 2ZNEA 1MXLC 2ZMUA 2HGDA 2EHBA 1QLKA 4R6BA 3PALA 5BT0A 2LMVA 3DPWA 2OKYA 2Z1OA 2WCEA 3OB1B 4ZB1A 1SBJA 1YRTB 2Z6XA 2ZN9A 4R1EA 3LF3A 2OTBA 4HQCA 2G6YA 1WLZA 2ZO7A 3BOWB 4OKHA 5KTGA 4H3NA 1QATA 3SSKA 4PFEA 2MLFC 3CD1A 3DQIA 2MRDA 2K7OA 1JWDA 3I19A 4U2VA 3O78A 1TNWA 2JTTA 3NSLA 3TZ1A 3UFZA 1IQ3A 4RYWA 5DPHA 5FYXA 2A48A 1SKTA 3SVUA 2EMDA 1B8CA 2M8UA 4ANJA 3ZUJA 4OVNF 4W7DA 2EMOA 4MVFA 1SYMA 5EBJA 1LXFC 1L2OC 2ZRSA 1A2XA 2WHSA 1CFPA 1BT6A 2M0RA 3NXAA 4MRYA 3SVBA 1JBZA 1YTZC 2A54B 3M0WA 1MHOA 4MRXA 2HQZA 2LP3A 3DQ4A 4NQGA 4F0ZB 2LVVA 2KGRA 1UURA 4BDUA 1SL9A 2KSPA 3FWBA 5DU0A 2LV7A 2V4EA 2HF5A 4D1EA 4GGNA 1XA5A 1MUXA 1XA9A 3VRPA 1IH0A 3EVUA 1YJFA 4KA9A 5H89A 4AOMA 3ADFA 4W6DA 4NDDA 3ST2A 1Q4DA 2Q4UA 2DOQA 3F45A 1SR6C 1F8HA 2LE9B 1NX0A 5H88A 1TOPA 1NUBA 3SS0A 1JF0A 1W7JB 1EMLA 1MYWA 1OXEA 2OJKA 1TIZA 2OTGC 4HQ8A 1LVCD 4XOVA 1KFXS 2JT8A 2CNPA 1KFUS 1AUIB 1DJIA 3DQOA 1K2HA 3O77A 1W7UA 2JT3A 1Z1PA 2M97A 1IQ5A 5DTLA 4JGEA 3DVKA 1WDCC 1YHIA 2DUEA 3SVCA 1PSBA 2IS9A 4I2YA 1PRWA 4WRIA 5HLVA 1YVHA 2LUXA 4WQ2A 1BODA 4Q9WA 4Q04A 4DXPA 4MZJA 1F71A 2EC6B 1XFVO 4ORNA 1S5GY 1FW4A 2MAZA 3EKJA 2KAVA 4KAGA 1DJWA 4ORBB 3P28A 4EMQA 1W7SA 1J7OA 4L13A 3K1KA 3TMTA 4NDBA 3S05A 3SG4A 2G6XA 5EB7A 1CDLA 1SMGA 2QT2A 3TUYC 1W7IB 1C7VA 1Q4AA 4PHMA 1SRAA 1LKJA 3OSRA 1EH2A 4OV2A 3DF0B 4P2YB 1A03A 2PALA 3PM8A 4W7XA 2JQ6A 2YDZA 3BUNB 2HQ8A 5AERA 5G08A 1ZMZA 1DF0A 1DJYA 1M63B 3PIBA 1QX2A 4YGBB 4GGFA 4W7RA 3I5HC 2BECA 3GJ1A 3V3DA 1PALA 2KYFA 2JU0A 2RH7A 2C9IA 1EMBA 5DKNA 2PSRA 1QLSA 5B8IB 2MHHA 1L2OB 2WSOA 2F33A 2GW4B 2LLUA 4W6MA 1S26D 3UG0A 4JFGA 5HW9A 2GGMA 2DD7A 1K95A 3SV5A 1C07A 5KSZA 3KF9A 3TS5C 2QU1A 5HBDA
chains in the Genus database with same CATH superfamily
4W7EA 1OSAA 2FCDA 1JSAA 4IK3A 2JOJA 4IK9A 4PPJA 3TDUA 3AKAA 1XMZA 2M1KB 2VADA 4ORAB 2L4HA 1S6CA 1IJ5A 2WSNA 1Y0VH 1OMRA 2QEOA 1XK4A 3OGOA 1GL4A 4Z4KA 1BR4B 4W6FA 2JZIA 3A8RA 1IJ6A 4A4CA 1F0BA 1NCZA 1GGXA 4W6HA 2LVIA 2QEBA 4L12A 5CSNA 1SR6B 1SCMB 3EK7A 2QZ0A 3PLFB 1NIWA 2ZO6A 1H4BA 3FWCA 3GK4X 2BTJA 2ZNDA 4W6LA 2M7NA 3SSTA 1MR8A 4ZF4A 3MGFA 4QJ4B 1RWYA 4IJ7A 2G9BA 3I5FC 3ZWHA 3CLNA 2LMUA 3E5VA 1JC2A 2KI6C 2OTGB 3GOFA 4KF5C 1QYOA 1PULA 2ARLA 4TNCA 5FVIA 4R6DA 3DQ5A 1NPQA 2I18A 4INWA 2HETA 3TMRA 1ZGOA 4W6OA 3PJBA 1KYPA 1F54A 4PE4A 2ICRA 1K96A 1V1GA 4CPVA 1GJYA 1K9UA 4U8DA 3HCMA 1WDCB 3WHUB 1NYAA 3EK4A 4ZF5A 3SS5A 4KW8A 3WLDA 2Q6PA 1CDMA 1QVIY 5JJGA 2L98A 2JNFA 1BF5A 2KAXA 4YGDB 2PXWA 5FHVA 4MZKA 2IB6A 2JADA 2HPWA 1XFRA 3NT3A 2AH8A 1BU3A 4PALA 4PPLA 1B4CA 2OKWA 5KU1A 1QYFA 2KLEA 3EVVA 2B3QA 1RJVA 2P6BB 4W75A 3TUYB 2E6WA 3GB3A 4OR9B 4N3DA 5BTTA 1OXFA 1YUTA 2H61C 1NX3A 3LK0A 2A46A 1DJGA 1EG4A 2PMYA 2ZKMX 2WCLA 2R2IA 3DQMA 4MSPA 2DUHA 5HKWA 3BXBA 4W6JA 1DTLA 5LK4A 4ZBLA 4AQIA 1DT7B 1CKKA 2O29A 2AUCA 2OGRA 2HFCA 1C3YA 4H48A 2FJUB 2K61A 3NEDA 3KCTA 2K7BA 3I5HB 4ZIOA 1F4OA 2G16B 1LA3A 3GL4A 1N65A 5DQBA 1EL4A 5DPGA 3CS1A 4H3LA 4W7FA 4PDZA 4HRHA 1QS7A 1DJZA 4J89A 3SSYA 3SIBA 2L0PA 1F70A 1GGZA 3TS5B 1UHIA 5HZTA 2FJYA 3VHTB 3EVPA 1QXPA 1OE9B 1G4YR 3CD9A 3EK8A 4W6KA 1SPYA 5F9GA 3N7HA 4I5NB 1KFXL 1H6RA 1TWOA 4DXOA 1GM0A 4Q7RA 4JRBA 2AAOA 3SIAA 1A29A 1RMPA 3VK1A 2Q91A 4W6PA 2LMTA 1M45A 5ER4X 2ERBA 1C4FA 2JC2A 1J7QA 2FL1A 2K8MB 3OBVA 3VB1A 3VROA 4QJ3B 3W1DA 5EXCI 4JPZB 4AQJA 4DXNA 2LM5A 4I5KA 3SG5A 2SASA 2BCAA 3A8SA 1DQEA 4MZLA 1ORGA 1UP5A 1YUSA 1Q80A 1XFZO 2JPTA 1IIOA 1YHGA 4J8AA 1TUJA 1YX7A 3LL8B 1KSMA 1MOUA 3PJIA 4W74A 4YGAA 2WCMA 4OQWA 3SG3A 2KGBC 4MEWA 3I5FB 3I5IC 1VRKA 2Y4QA 2BE6A 2PYQA 3CFAA 1NCYA 3V2LA 1TCFA 1WRZA 1CB1A 2BE4A 3GJ2A 4W6TA 3D0YA 1M46A 1DGUA 3BFAA 2DUGA 1K9KA 4DKMA 2A56B 2SCPA 4XYNA 2QDIA 4I5JA 1CDNA 3KEVA 3DQKA 3WCKA 5EXUA 2CCMA 1RK9A 3DZTA 3CZ0A 4W69A 1Z2CB 4HRGA 2H8QA 2O2BA 3DQJA 1CLMA 3BOWA 4KW4A 3H1RA 4DS7A 4N1GA 4RYSA 2Z6ZA 1Q4BA 4ZFSA 2AHAA 4PE1A 2D8NA 3KO0A 5TNCA 1MOVA 1ZUXA 1V1FA 1RECA 5FI7A 1KQMC 4NDCA 3BFHA 2H5PA 4KF5A 1B9CA 4AR7A 1CFCA 3S0BA 4NWSA 1QXTA 4C0KA 4MLWA 3SG7A 3LCPC 2P4MA 4M2QA 3DQUA 2PQLA 1EMCA 1HQVA 1UUSA 2BL0C 2WC6A 3HX4A 1SCMC 1F09A 2ZN8A 1IKUA 4W6CA 1XVJA 3SS4A 4LQUA 3NEZA 1RMOA 4JEOA 1FI6A 4LJDC 2HQKA 1QIWA 2WORA 3CR4X 3BFBA 1KYSA 3EVRA 2KLDA 1OZOA 5CSJA 1TTXA 2LCPA 1B8RA 2KYCA 3JTDC 4W6BA 2POXA 1NSHA 1JFKA 1A75B 3DVJA 2WURA 3DQLA 1BFPA 3JVTC 3DQAA 2KI6D 5DRGA 4JWQA 1OOGA 4HREE 3DQ6A 3H1OA 2PXSA 2KFGA 3DQ9A 2JULA 4GESB 2L50A 3R72A 1SNLA 5IBWA 3GK2A 2CT9A 4PHJA 2MJWB 3SSPA 3D76A 2VVIA 2QACA 1KP5A 1S36A 2LLSA 2YE0A 3LVDA 4GAOA 3RLZA 3CB9A 1GGWA 2PVBA 1Y1XA 3DXLA 1YHHA 3DQDA 4KGFA 1NCXA 1QV0A 4M2OA 2GW3A 3VRRA 3B7AA 4W73A 1M31A 1IWQA 5BQLA 5AEQA 2KQYA 1SL7A 3I5IB 5EB6A 1AP4A 5D69A 3DPXA 1YURA 3QRXA 1XFUO 3E3RA 1XFXO 1R6PA 2VAEA 3NF0A 1YRUB 1S1EA 2NXQA 2B3PA 1J7PA 1OOJA 1HT9A 4PT1A 2MLEC 3LVCA 2QLGB 2O60A 3DF0A 5EXBA 3E5TA 2HGYA 2L4IA 4KEXA 1HCJA 1UHKA 2K2AA 2NCOA 2QEVA 2JXLA 1WRKA 3OP0A 4JKTA 1KQMB 5I2LA 2KQ6A 3L47A 3PN7C 3AI4A 1Q4CA 1QV1A 4W6AA 1S6ZA 1B47A 2KBIA 2JNXA 1LINA 5DKQA 1U5IB 1BG1A 2QRFA 3NT9A 4OJ0A 3OX6A 2BL0B 1XFWO 1CM4A 3BUXB 2L2EA 1JC1A 4HVFA 1CDPA 4CFRA 1Z1QA 4KF4A 4B30B 1Q73A 3O4YA 2EMNA 2DDCA 2CXJA 2K7DA 3BUMB 1XAEA 1PK0D 2WCJA 3JTDB 3NGVA 3CZ1A 1ZFSA 4XVPA 3SG2A 1SY9A 2LC5A 5LTRA 2WC5A 3SVRA 1EG3A 1QTXA 1CMFA 2G6EA 1H8BA 1QX7A 3O6BA 3JVTB 4HQ9A 3GK1A 4UTSA 1BLQA 4YI8A 3TDIA 4YRUA 3NSIA 1NX1A 1ZUZA 5J3XA 4CIDA 1DJHA 2DDDA 4GPLB 2K2FA 2DUIA 2Y0GA 4KYNA 1OXDA 3D77A 4N1FA 5HYDA 2L51A 1QASA 1MF8B 4W6NA 4UPGA 5LTPA 1YZWA 1Y1UA 5DTYA 3ZNIA 5HZSA 4B5YA 3K1EA 1EJ3A 2WOSA 2L5XB 4YGEB 4DXIA 3M22A 4W6SA 2H6VA 2Y1NA 4FQOA 4WQ3A 3U8CA 4IK1A 1RROA 3IQQA 3IF7A 4AS8A 4GUKA 2KDHA 2KNEA 3AKOA 3CGLA 3NHTA 3CBEA 4DUQA 1H4UA 1K93D 1JBYA 1UISA 4PE0A 4PPKA 3H4SE 1DC1A 2WHTA 3PJ7A 5HGEA 2CBLA 1FPWA 2BCXA 1BR1B 3SVEA 3A4UB 1XQMA 3WNXB 5DTZA 1EMMA 3E5WA 3VRQA 3DQEA 3BXCA 3B87A 2BAPA 2GX2A 1EXRA 1CNPA 1AJ5A 3I5GC 1UHNA 1B9AA 3FS7A 4IL1A 3DY9A 1XO5A 1AVSA 2HRSA 3RWTA 3OSQA 2H2KA 2KI4C 4GF6B 3CGAA 1F4QA 1KQVA 2OS8C 4A4BA 4ZCVA 2QEHA 3RWAA 1UWOA 5CPVA 2NCPA 3BJHA 1S6JA 1UHJA 1AHRA 2WC8A 5EL2A 1HUYA 2H8VA 3UO9A 1KK7Y 2P71A 4C0LA 3PN7B 1QX5B 1DMOA 5K89A 5EHUA 2KOTA 4GGFC 4I5LB 3RZSA 3OGNA 2F2PA 2H9WA 3CTNA 2JXCA 4OCIA 1YR5A 3G9AA 3DQ1A 5DPIA 2LVKA 1W7TA 2WISA 4GFTA 1TUZA 5PALA 5AXIA 2GTEA 3VHTA 1PVBA 2AWMA 1ALWA 3SS3A 4ETOA 2G3OA 2A53B 3SVDA 1EMFA 2BBMA 2RGIA 2WCKA 4W76A 1TNQA 5HZUA 2ISDA 4KGEA 2YFPA 2KAYA 3FE6A 4GOBA 2TN4A 1EMEA 2FOTA 4XJKA 3M24A 3CYZA 3DPZA 4W7CA 3LS3A 3AKBA 2KFHA 2QLEA 3VGOA 5DY6A 1BJFA 1XK4C 1NX2A 5I2OA 2V4EB 1B7TY 3PFVA 5FVGA 3NHIA 5FVFA 2OPOA 3SRYA 3DQ8A 4H3MA 5DKRA 1E8AA 1S5GZ 4OZDA 1CMGA 2ZRTA 2F8PA 4TZGA 1RM9A 1OOIX 1FBVA 1ZGPA 2JTZA 5I2QA 1AJ4A 1CV7A 3B88A 4FQTA 1SCVA 4ORCB 2WIQA 2WCBA 2O24A 3S0AA 4PHKA 2JT0A 5LTQA 2DUFA 3D74A 4CFQA 1B1GA 2KFFA 4CLNA 3DQ2A 1Y6WA 2HQWA 2H5RA 2NLNA 1D1OA 2PRUA 1XSSA 5HKYA 2F3ZA 1SK6D 1A4PA 1MQ1A 1F55A 3K21A 3WHTB 3BUWB 1W9ZA 2G3DB 3DQ3A 1KYRA 4EDOA 3PATA 3U0MA 2LP2A 4XGYA 1Q4EA 5HL1A 4E68A 3DQ7A 3U0KA 3NSKA 4JD9A 1ALVA 3WXAA 4P76A 3BX9A 1K8UA 4EDSA 1JF2A 1QY3A 2L5YA 3I5GB 4HE4A 1C7WA 4IZNA 4W6GA 4ZCUA 4Q7UA 3SG6A 1N0YA 2LANA 4P5OE 5I8NA 3IQOA 2H61A 2KI4B 1YFPA 1OOHA 2BNXA 5H87A 2IE2A 3R1VA 2OS8B 2M29A 3ZULA 2G2SB 3DQCA 5F6TA 5HZOA 2O5GA 1ZOTB 1FI5A 3SVOA 1OZSA 1GFLA 2QLHA 1DGVA 1IRJA 2AWKA 3TDZA 1XFYO 1DF0B 3L4LA 4GNKB 1JC0A 2NZ0A 3IP2A 4PCWA 2AWJA 1C3ZA 4JF9A 4N5XA 1J7RA 2M3WA 2LNKA 4L9MA 4ZF3A 2VRGA 5FI6A 5CSIA 2LHIA 4OY4A 4MN0A 2M1UA 1A75A 2IB5A 1KSOA 1K90D 5CSFA 4FTGA 3CZ2A 1S3PA 3KHEA 3FE9A 3C1VA 3FIAA 1K9PA 2HJOA 1KWOC 3BXKA 4W7AA 4TZAA 2VVJA 2LUCA 1YUUA 3D10A 3O2PA 3VICA 4W6IA 1CM1A 3ZTFA 2BKIB 5AQBB 2BCBA 5FI2A 1G7KA 4L1IA 3ZUFA 1WRLA 4W77A 1M39A 1K94A 2M9GA 1IG5A 4KPIA 4OGSA 4J88A 4IK4A 1QVIZ 5I94A 4QJ5B 3L4AA 1B8LA 2K7CA 2M49B 1DJXA 5DICA 1QIVA 1FF1A 2F2OA 4RTCA 1GQMA 2K0JA 2Y1MA 3ST4A 1DELA 2FCEA 2COLB 5DRFA 4W6RA 1YVLA 3VRNA 2CTNA 4PHNA 1TNPA 2HCGA 3U8PA 5BPJA 3ED8A 3CFHA 4MBEA 3LSAA 3CWGA 3BXAA 4XL5A 4LW5A 1OQPA 2G2BA 1TRFA 1R2UA 2LLTA 2VVHA 3DQNA 1RRXA 2WHUA 1UHHA 1KK8C 3SSVA 1NWDA 3SSLA 2ZFDA 4DKNA 3CABA 2GX0A 1SW8A 4JC2A 4GBAA 4H47A 3S0FA 2GGZA 3IVTA 3P8UA 5DTXA 3LK1A 3CR2A 2E30A 2Y5IA 3EG5B 3MSEB 2IOVA 2QLGA 3R1OA 1CLLA 2KBMA 1OMVA 2A47A 2AMIA 3NSOA 4XOWA 2A52B 3PJ5A 3DVMA 5HKZA 2OTEA 1ZACA 3OHMB 3ST0A 3SVSA 1OMDA 1ZGQA 3DD4A 3U0LA 4USLA 1BMOA 1EMGA 2BKHB 2WCFA 4F7FA 3LLEA 1DEKA 2H5QA 2B1UA 3KPXA 1LA0A 1J55A 2LHLA 3CZTX 4YGCB 3B86A 3S0GA 3AI5A 3BQ3A 1CTRA 2V4EC 2QPTA 1KK7Z 5AANA 1BOCA 4C0JA 5BTTB 3ST3A 1U5IA 3AAKA 1DVIA 3DQFA 1S6IA 1JUOA 1NP8A 3DQHA 1L7ZA 2LAPA 2AWLA 3OX5A 1P28A 2KHNA 2FZUA 2PASA 2I94A 1CLBA 4B30A 4LJDA 1IGVA 1RTP1 5DPJA 1KCYA 1Y1AA 3CR5X 1RFJA 4DCKA 4EULA 2A4JA 1TN4A 4W6UA 4LJBA 4ZINA 1XYDA 3AAJA 2M7LA 1RMMA 2MA2A 1JFJA 2Q57A 1LS8A 5ER5A 3WLCA 4PE7A 4Q7TA 5EJUA 2G5ZB 1WY9A 5J2OA 2KPHA 3GEXA 3D75A 2VZXA 1KWOB 3SJSA 3LA1A 4Q9XA 3W1CA 3PSRA 1G8IA 3R1PA 1N2DA 3LVAA 3DVEA 2K60A 3B6XA 1EMAA 5KTYA 3KCSA 1B7TZ 3EKHA 2I2RE 2JRFA 4IK8A 4DXQA 4LJCA 2FWQA 5DQMA 2BBNA 4DRWA 1WLMA 3CFFA 2H5OA 1QJTA 3ICBA 1MWNA 4DIRA 1JBAA 1X02A 4BY5A 5D7FA 3LF4B 1PVAA 3BYAA 2HPSA 4JQ0D 4M2PA 4Z4MA 3FE8A 4YI9A 4EN1A 1J1EA 1TNXA 5HLOA 2QLIA 1EMKA 4YBHB 1YX8A 4ICBA 3RM1A 1QYQA 3SVNA 4P1QA 4IK5A 1ODBA 4OHSA 1SL8A 3U0NA 4LQTA 2JWWA 2I7AA 4KW9A 4W72A 5T3IA 1PSRA 3IR8A 1CFFA 2F3YA 1CFDA 5GQQC 2C9JA 3BUOB 3Q8IA 1KK8B 4DXMA 1J1DA 2A50B 1YJ2A 3SSHA 1KFUL 1TCOB 2MBXA 2WNDA 2V53A 1AK8A 2DD9A 2YE1A 2GV5A 5AFPA 2LVJA 2Z6YA 2EC6C 4BY4A 2EGDA 3U8AA 4XJKB 3D0YB 4HSZA 1G33A 1MXEA 2ZMWA 5JOLA 3PM2A 3OB2B 2ZNEA 1MXLC 2ZMUA 2HGDA 2EHBA 1QLKA 4R6BA 3PALA 5BT0A 1QWVA 2LMVA 3DPWA 2OKYA 2Z1OA 2WCEA 3OB1B 4ZB1A 1SBJA 1YRTB 2Z6XA 2ZN9A 4R1EA 3LF3A 2OTBA 2L2CA 4HQCA 2G6YA 1WLZA 2ZO7A 3BOWB 4OKHA 5KTGA 4H3NA 1QATA 3SSKA 4PFEA 2MLFC 3CD1A 3DQIA 2MRDA 2K7OA 1JWDA 3I19A 4U2VA 3O78A 1TNWA 2JTTA 3NSLA 2WCHA 3TZ1A 3UFZA 1IQ3A 4RYWA 1OW4A 5DPHA 5FYXA 2A48A 1SKTA 3SVUA 2EMDA 2P70A 1B8CA 2M8UA 4ANJA 3ZUJA 3CDNA 4OVNF 2YGUA 4W7DA 2EMOA 4MVFA 1SYMA 5EBJA 1LXFC 1L2OC 2ZRSA 1A2XA 2WHSA 1CFPA 1BT6A 2M0RA 3NXAA 4MRYA 3SVBA 1JBZA 1YTZC 2A54B 3M0WA 1MHOA 4MRXA 2HQZA 2LP3A 3DQ4A 4NQGA 4F0ZB 2LVVA 1T14A 2KGRA 1UURA 4BDUA 1SSEB 1SL9A 2KSPA 3FWBA 5DU0A 2LV7A 2V4EA 2HF5A 4D1EA 4GGNA 1XA5A 1IH0A 1XA9A 1MUXA 3VRPA 3EVUA 1YJFA 4KA9A 5H89A 4AOMA 3ADFA 4W6DA 4NDDA 3ST2A 1Q4DA 2Q4UA 2DOQA 3F45A 1SR6C 1F8HA 2LE9B 1NX0A 5H88A 3S0DA 1TOPA 1NUBA 3SS0A 1JF0A 3QMEA 1W7JB 1EMLA 1MYWA 1OXEA 2OJKA 1TIZA 2OTGC 4HQ8A 1LVCD 4XOVA 1KFXS 2JT8A 2CNPA 1KFUS 1AUIB 1DJIA 3DQOA 1K2HA 3O77A 5D3OA 1W7UA 2JT3A 1Z1PA 2M97A 1IQ5A 5DTLA 4JGEA 3DVKA 1WDCC 1YHIA 1Z4HA 2DUEA 3SVCA 1PSBA 2IS9A 4I2YA 1PRWA 4WRIA 5HLVA 1YVHA 2LUXA 4WQ2A 1BODA 4Q9WA 4Q04A 4DXPA 3DYEA 4MZJA 1F71A 2EC6B 3S0EA 1XFVO 4ORNA 1S5GY 1FW4A 2MAZA 3EKJA 2KAVA 3O4XA 1DJWA 4KAGA 4ORBB 3P28A 4EMQA 1W7SA 1J7OA 4L13A 3D73A 3K1KA 3TMTA 4NDBA 3S05A 3SG4A 2G6XA 5EB7A 1CDLA 1SMGA 2QT2A 3TUYC 1W7IB 2JPOA 3D78A 1C7VA 1Q4AA 4PHMA 1SRAA 1LKJA 3OSRA 1EH2A 4INXA 4OV2A 3DF0B 4P2YB 1A03A 2PALA 3PM8A 4W7XA 2JQ6A 2YDZA 3BUNB 2HQ8A 5AERA 5G08A 1ZMZA 1DF0A 1DJYA 1M63B 3PIBA 1QX2A 4YGBB 4GGFA 3UNWA 4W7RA 3I5HC 2BECA 3GJ1A 3V3DA 1PALA 2KYFA 2JU0A 2RH7A 2C9IA 1OOFA 1EMBA 5DKNA 2PSRA 1QLSA 5B8IB 2MHHA 1L2OB 2WSOA 2F33A 2GW4B 2LLUA 4W6MA 1S26D 3UG0A 4JFGA 5HW9A 2GGMA 2DD7A 1K95A 3SV5A 1C07A 5KSZA 3KF9A 3TS5C 2QU1A 5HBDA
chains in the Genus database with same CATH topology
4W7EA 1OSAA 2FCDA 1JSAA 4IK3A 2JOJA 4IK9A 4PPJA 3TDUA 3AKAA 1XMZA 2M1KB 2VADA 4ORAB 2L4HA 1S6CA 1IJ5A 2WSNA 1Y0VH 1OMRA 1XK4A 3OGOA 1GL4A 4Z4KA 1BR4B 4W6FA 2JZIA 3A8RA 1IJ6A 4A4CA 1F0BA 1NCZA 1GGXA 4W6HA 2LVIA 4L12A 5CSNA 1SR6B 1SCMB 3EK7A 2QZ0A 3PLFB 1NIWA 2ZO6A 1H4BA 3FWCA 3GK4X 2BTJA 2ZNDA 4W6LA 2M7NA 3SSTA 1MR8A 4ZF4A 3MGFA 4QJ4B 1RWYA 2G9BA 3I5FC 3ZWHA 3CLNA 2LMUA 3E5VA 1JC2A 2KI6C 2OTGB 3GOFA 4KF5C 1QYOA 1PULA 2ARLA 4TNCA 5FVIA 4R6DA 3DQ5A 1NPQA 2I18A 2HETA 3TMRA 1ZGOA 4W6OA 3PJBA 1KYPA 1F54A 4PE4A 2ICRA 1K96A 1V1GA 4CPVA 1GJYA 1K9UA 4U8DA 3HCMA 1WDCB 3WHUB 1NYAA 3EK4A 4ZF5A 4KW8A 3WLDA 2Q6PA 1CDMA 1QVIY 5JJGA 2L98A 2JNFA 1BF5A 2KAXA 4YGDB 2PXWA 5FHVA 4MZKA 2IB6A 2JADA 2HPWA 3NT3A 2AH8A 1BU3A 4PPLA 4PALA 1B4CA 2OKWA 5KU1A 1QYFA 3EVVA 2B3QA 1RJVA 2P6BB 4W75A 3TUYB 2E6WA 3GB3A 4OR9B 4N3DA 5BTTA 1OXFA 1YUTA 2H61C 1NX3A 3LK0A 2A46A 1DJGA 1EG4A 2PMYA 2ZKMX 3DQMA 2R2IA 4MSPA 2DUHA 5HKWA 3BXBA 4W6JA 1DTLA 5LK4A 4ZBLA 4AQIA 1DT7B 1CKKA 2O29A 2AUCA 2OGRA 2HFCA 4H48A 2FJUB 2K61A 3NEDA 3KCTA 2K7BA 3I5HB 4ZIOA 1F4OA 2G16B 1LA3A 3GL4A 1N65A 5DQBA 1EL4A 5DPGA 3CS1A 4H3LA 4W7FA 4PDZA 4HRHA 1QS7A 1DJZA 4J89A 3SSYA 3SIBA 2L0PA 1F70A 1GGZA 3TS5B 1UHIA 5HZTA 3VHTB 3EVPA 1QXPA 1OE9B 1G4YR 3CD9A 3EK8A 4W6KA 1SPYA 5F9GA 4I5NB 1KFXL 1H6RA 4DXOA 4Q7RA 4JRBA 2AAOA 3SIAA 1A29A 1RMPA 3VK1A 2Q91A 4W6PA 2LMTA 1M45A 5ER4X 1C4FA 2JC2A 1J7QA 2FL1A 2K8MB 3VROA 4QJ3B 3W1DA 5EXCI 4JPZB 4AQJA 4DXNA 2LM5A 4I5KA 3SG5A 2SASA 2BCAA 3A8SA 4MZLA 1UP5A 1YUSA 1Q80A 1XFZO 2JPTA 1YHGA 4J8AA 1YX7A 3LL8B 1KSMA 1MOUA 4W74A 4YGAA 4OQWA 3SG3A 2KGBC 4MEWA 3I5FB 3I5IC 1VRKA 2Y4QA 2BE6A 3CFAA 1NCYA 1TCFA 1WRZA 1CB1A 2BE4A 3GJ2A 4W6TA 3D0YA 1M46A 1DGUA 2DUGA 1K9KA 4DKMA 2A56B 2SCPA 4XYNA 4I5JA 1CDNA 3KEVA 3DQKA 3WCKA 5EXUA 2CCMA 1RK9A 4W69A 4HRGA 2H8QA 2O2BA 3DQJA 1CLMA 3BOWA 4KW4A 3H1RA 4DS7A 4N1GA 4RYSA 2Z6ZA 1Q4BA 4ZFSA 2AHAA 4PE1A 2D8NA 3KO0A 5TNCA 1MOVA 1ZUXA 1V1FA 1RECA 1KQMC 4NDCA 2H5PA 4KF5A 1B9CA 4AR7A 1CFCA 4NWSA 1QXTA 4C0KA 4MLWA 3SG7A 3LCPC 2P4MA 4M2QA 3DQUA 1EMCA 1HQVA 1UUSA 2BL0C 3HX4A 1SCMC 1F09A 2ZN8A 1IKUA 4W6CA 1XVJA 4LQUA 3NEZA 1RMOA 4JEOA 1FI6A 4LJDC 2HQKA 1QIWA 2WORA 3CR4X 1KYSA 3EVRA 1OZOA 5CSJA 1TTXA 2LCPA 1B8RA 2KYCA 3JTDC 4W6BA 2POXA 1NSHA 1JFKA 1A75B 3DVJA 2WURA 3DQLA 1BFPA 3JVTC 3DQAA 2KI6D 5DRGA 4JWQA 4HREE 3DQ6A 3H1OA 2PXSA 2KFGA 3DQ9A 2JULA 4GESB 2L50A 5IBWA 1SNLA 3GK2A 2CT9A 4PHJA 2MJWB 3SSPA 2VVIA 2QACA 1KP5A 1S36A 2LLSA 2YE0A 3LVDA 4GAOA 3RLZA 3CB9A 1GGWA 2PVBA 1Y1XA 1YHHA 3DQDA 4KGFA 1NCXA 1QV0A 4M2OA 2GW3A 3VRRA 4W73A 1M31A 1IWQA 5BQLA 5AEQA 2KQYA 1SL7A 3I5IB 5EB6A 1AP4A 5D69A 3DPXA 1YURA 3QRXA 1XFUO 3E3RA 1XFXO 1R6PA 2VAEA 3NF0A 1YRUB 1S1EA 2NXQA 2B3PA 1J7PA 1OOJA 1HT9A 2MLEC 3LVCA 2QLGB 2O60A 3DF0A 5EXBA 3E5TA 2HGYA 2L4IA 4KEXA 1HCJA 1UHKA 2K2AA 2NCOA 2JXLA 1WRKA 3OP0A 1KQMB 5I2LA 2KQ6A 3PN7C 3AI4A 1Q4CA 1QV1A 4W6AA 1S6ZA 1B47A 2KBIA 2JNXA 1LINA 5DKQA 1U5IB 1BG1A 2QRFA 3NT9A 4OJ0A 3OX6A 2BL0B 1XFWO 1CM4A 3BUXB 2L2EA 1JC1A 4HVFA 1CDPA 4CFRA 1Z1QA 4KF4A 4B30B 1Q73A 3O4YA 2EMNA 2DDCA 2CXJA 2K7DA 3BUMB 1XAEA 1PK0D 3JTDB 1ZFSA 4XVPA 3SG2A 1SY9A 2LC5A 5LTRA 3SVRA 1EG3A 1QTXA 1CMFA 2G6EA 1H8BA 1QX7A 3O6BA 3JVTB 4HQ9A 4UTSA 3GK1A 1BLQA 4YI8A 3TDIA 4YRUA 3NSIA 1NX1A 1ZUZA 5J3XA 4CIDA 1DJHA 2DDDA 4GPLB 2K2FA 2DUIA 2Y0GA 1OXDA 5HYDA 4N1FA 2L51A 1QASA 1MF8B 4W6NA 4UPGA 5LTPA 1YZWA 1Y1UA 5DTYA 3ZNIA 5HZSA 4B5YA 1EJ3A 2WOSA 2L5XB 4YGEB 4DXIA 3M22A 4W6SA 2H6VA 2Y1NA 4FQOA 4WQ3A 3U8CA 4IK1A 1RROA 3IQQA 3IF7A 4AS8A 4GUKA 2KDHA 2KNEA 3AKOA 3CGLA 3CBEA 4DUQA 1H4UA 1K93D 1JBYA 1UISA 4PE0A 4PPKA 3H4SE 2WHTA 3PJ7A 5HGEA 2CBLA 1FPWA 2BCXA 1BR1B 3SVEA 3A4UB 1XQMA 3WNXB 5DTZA 1EMMA 3E5WA 3VRQA 3DQEA 3BXCA 2GX2A 1EXRA 1CNPA 1AJ5A 3I5GC 1UHNA 1B9AA 3FS7A 4IL1A 1XO5A 1AVSA 2HRSA 3RWTA 3OSQA 2H2KA 2KI4C 4GF6B 3CGAA 1F4QA 1KQVA 2OS8C 4A4BA 4ZCVA 3RWAA 1UWOA 5CPVA 2NCPA 1S6JA 1UHJA 1AHRA 2WC8A 1HUYA 1KK7Y 4C0LA 3PN7B 1QX5B 1DMOA 5K89A 5EHUA 2KOTA 4GGFC 4I5LB 2F2PA 2H9WA 3CTNA 2JXCA 4OCIA 1YR5A 3G9AA 3DQ1A 5DPIA 2LVKA 1W7TA 2WISA 4GFTA 5PALA 5AXIA 3VHTA 1PVBA 2AWMA 1ALWA 4ETOA 2G3OA 2A53B 3SVDA 1EMFA 2BBMA 2RGIA 4W76A 1TNQA 5HZUA 2ISDA 4KGEA 2YFPA 2KAYA 4GOBA 2TN4A 1EMEA 2FOTA 4XJKA 3M24A 3DPZA 4W7CA 3LS3A 3AKBA 2KFHA 2QLEA 3VGOA 5DY6A 1BJFA 1XK4C 1NX2A 5I2OA 2V4EB 1B7TY 3PFVA 5FVGA 5FVFA 2OPOA 3SRYA 3DQ8A 4H3MA 5DKRA 1E8AA 1S5GZ 1CMGA 2ZRTA 2F8PA 4TZGA 1RM9A 1FBVA 1ZGPA 2JTZA 5I2QA 1AJ4A 1CV7A 1SCVA 4ORCB 2WIQA 2WCBA 2O24A 4PHKA 2JT0A 5LTQA 2DUFA 4CFQA 1B1GA 2KFFA 4CLNA 3DQ2A 1Y6WA 2HQWA 2H5RA 2NLNA 1D1OA 2PRUA 1XSSA 5HKYA 2F3ZA 1SK6D 1A4PA 1MQ1A 1F55A 3K21A 3WHTB 3BUWB 2G3DB 3DQ3A 1KYRA 4EDOA 3PATA 3U0MA 2LP2A 4XGYA 1Q4EA 4E68A 3DQ7A 3U0KA 3NSKA 1ALVA 3WXAA 4P76A 3BX9A 1K8UA 4EDSA 1JF2A 1QY3A 3I5GB 4HE4A 1C7WA 4IZNA 4W6GA 4ZCUA 4Q7UA 3SG6A 1N0YA 2LANA 4P5OE 5I8NA 3IQOA 2H61A 2KI4B 1YFPA 5H87A 2IE2A 2OS8B 2M29A 3ZULA 2G2SB 3DQCA 5F6TA 5HZOA 2O5GA 1ZOTB 1FI5A 3SVOA 1OZSA 1GFLA 2QLHA 1DGVA 1IRJA 2AWKA 3TDZA 1XFYO 1DF0B 4GNKB 1JC0A 2NZ0A 3IP2A 4PCWA 2AWJA 4JF9A 4N5XA 1J7RA 2M3WA 2LNKA 4L9MA 4ZF3A 2VRGA 5CSIA 2LHIA 4OY4A 4MN0A 2M1UA 1A75A 2IB5A 1KSOA 1K90D 5CSFA 4FTGA 1S3PA 3KHEA 3C1VA 3FIAA 1K9PA 2HJOA 1KWOC 3BXKA 4W7AA 4TZAA 2VVJA 2LUCA 1YUUA 3D10A 3O2PA 3VICA 4W6IA 1CM1A 3ZTFA 2BKIB 5AQBB 2BCBA 1G7KA 4L1IA 3ZUFA 1WRLA 4W77A 1M39A 1K94A 2M9GA 1IG5A 4KPIA 4OGSA 4J88A 4IK4A 1QVIZ 4QJ5B 1B8LA 2K7CA 2M49B 1DJXA 1QIVA 1FF1A 2F2OA 4RTCA 1GQMA 2K0JA 2Y1MA 3ST4A 2FCEA 2COLB 5DRFA 4W6RA 1YVLA 3VRNA 2CTNA 4PHNA 1TNPA 2HCGA 3U8PA 5BPJA 3ED8A 3CFHA 4MBEA 3LSAA 3CWGA 3BXAA 4XL5A 4LW5A 1OQPA 2G2BA 1TRFA 1R2UA 2LLTA 2VVHA 3DQNA 1RRXA 2WHUA 1UHHA 1KK8C 3SSVA 1NWDA 3SSLA 2ZFDA 4DKNA 2GX0A 1SW8A 4JC2A 4GBAA 4H47A 2GGZA 3P8UA 5DTXA 3LK1A 3CR2A 2E30A 2Y5IA 3MSEB 2IOVA 2QLGA 1CLLA 2KBMA 1OMVA 2A47A 2AMIA 3NSOA 4XOWA 2A52B 3PJ5A 3DVMA 5HKZA 2OTEA 1ZACA 3OHMB 3ST0A 3SVSA 1OMDA 1ZGQA 3DD4A 3U0LA 4USLA 1BMOA 1EMGA 2BKHB 2WCFA 3LLEA 2H5QA 2B1UA 3KPXA 1LA0A 1J55A 2LHLA 3CZTX 4YGCB 3AI5A 3BQ3A 1CTRA 2V4EC 2QPTA 1KK7Z 5AANA 1BOCA 4C0JA 5BTTB 3ST3A 1U5IA 3AAKA 1DVIA 3DQFA 1S6IA 1JUOA 1NP8A 3DQHA 1L7ZA 2LAPA 2AWLA 3OX5A 2KHNA 2FZUA 2PASA 2I94A 1CLBA 4B30A 4LJDA 1IGVA 1RTP1 5DPJA 1KCYA 1Y1AA 3CR5X 1RFJA 4DCKA 4EULA 2A4JA 1TN4A 4W6UA 4LJBA 4ZINA 1XYDA 3AAJA 2M7LA 1RMMA 2MA2A 1JFJA 2Q57A 5ER5A 3WLCA 4PE7A 4Q7TA 5EJUA 2G5ZB 1WY9A 5J2OA 3GEXA 2VZXA 1KWOB 3SJSA 3LA1A 4Q9XA 3W1CA 3PSRA 1G8IA 1N2DA 3LVAA 3DVEA 1EMAA 5KTYA 3KCSA 1B7TZ 3EKHA 2I2RE 2JRFA 4IK8A 4DXQA 4LJCA 2FWQA 5DQMA 2BBNA 4DRWA 1WLMA 3CFFA 2H5OA 1QJTA 3ICBA 1MWNA 4DIRA 1JBAA 1X02A 4BY5A 5D7FA 3LF4B 1PVAA 3BYAA 2HPSA 4JQ0D 4M2PA 4Z4MA 4YI9A 4EN1A 1J1EA 1TNXA 5HLOA 2QLIA 1EMKA 4YBHB 1YX8A 4ICBA 3RM1A 1QYQA 3SVNA 4P1QA 4IK5A 1ODBA 4OHSA 1SL8A 3U0NA 4LQTA 2JWWA 2I7AA 4KW9A 4W72A 5T3IA 1PSRA 3IR8A 1CFFA 2F3YA 1CFDA 5GQQC 2C9JA 3BUOB 4DXMA 1KK8B 1J1DA 2A50B 1YJ2A 3SSHA 1KFUL 1TCOB 2MBXA 2WNDA 2V53A 1AK8A 2DD9A 2YE1A 2GV5A 5AFPA 2LVJA 2Z6YA 2EC6C 4BY4A 2EGDA 3U8AA 4XJKB 3D0YB 4HSZA 1G33A 1MXEA 2ZMWA 5JOLA 3OB2B 2ZNEA 1MXLC 2ZMUA 2HGDA 2EHBA 1QLKA 4R6BA 3PALA 5BT0A 2LMVA 3DPWA 2OKYA 2Z1OA 2WCEA 3OB1B 4ZB1A 1SBJA 1YRTB 2Z6XA 2ZN9A 4R1EA 3LF3A 2OTBA 4HQCA 2G6YA 1WLZA 2ZO7A 3BOWB 4OKHA 5KTGA 4H3NA 1QATA 3SSKA 4PFEA 2MLFC 3CD1A 3DQIA 2MRDA 2K7OA 1JWDA 3I19A 4U2VA 3O78A 1TNWA 2JTTA 3NSLA 3TZ1A 3UFZA 1IQ3A 4RYWA 5DPHA 5FYXA 2A48A 1SKTA 3SVUA 2EMDA 1B8CA 2M8UA 4ANJA 3ZUJA 4OVNF 4W7DA 2EMOA 4MVFA 1SYMA 5EBJA 1LXFC 1L2OC 2ZRSA 1A2XA 2WHSA 1CFPA 1BT6A 2M0RA 3NXAA 4MRYA 3SVBA 1JBZA 1YTZC 2A54B 3M0WA 1MHOA 4MRXA 2HQZA 2LP3A 3DQ4A 4NQGA 4F0ZB 2LVVA 2KGRA 1UURA 4BDUA 1SL9A 2KSPA 3FWBA 5DU0A 2LV7A 2V4EA 2HF5A 4D1EA 4GGNA 1XA5A 1MUXA 1XA9A 3VRPA 1IH0A 3EVUA 1YJFA 4KA9A 5H89A 4AOMA 3ADFA 4W6DA 4NDDA 3ST2A 1Q4DA 2Q4UA 2DOQA 3F45A 1SR6C 1F8HA 2LE9B 1NX0A 5H88A 1TOPA 1NUBA 3SS0A 1JF0A 1W7JB 1EMLA 1MYWA 1OXEA 2OJKA 1TIZA 2OTGC 4HQ8A 1LVCD 4XOVA 1KFXS 2JT8A 2CNPA 1KFUS 1AUIB 1DJIA 3DQOA 1K2HA 3O77A 1W7UA 2JT3A 1Z1PA 2M97A 1IQ5A 5DTLA 4JGEA 3DVKA 1WDCC 1YHIA 2DUEA 3SVCA 1PSBA 2IS9A 4I2YA 1PRWA 4WRIA 5HLVA 1YVHA 2LUXA 4WQ2A 1BODA 4Q9WA 4Q04A 4DXPA 4MZJA 1F71A 2EC6B 1XFVO 4ORNA 1S5GY 1FW4A 2MAZA 3EKJA 2KAVA 4KAGA 1DJWA 4ORBB 3P28A 4EMQA 1W7SA 1J7OA 4L13A 3K1KA 3TMTA 4NDBA 3S05A 3SG4A 2G6XA 5EB7A 1CDLA 1SMGA 2QT2A 3TUYC 1W7IB 1C7VA 1Q4AA 4PHMA 1SRAA 1LKJA 3OSRA 1EH2A 4OV2A 3DF0B 4P2YB 1A03A 2PALA 3PM8A 4W7XA 2JQ6A 2YDZA 3BUNB 2HQ8A 5AERA 5G08A 1ZMZA 1DF0A 1DJYA 1M63B 3PIBA 1QX2A 4YGBB 4GGFA 4W7RA 3I5HC 2BECA 3GJ1A 3V3DA 1PALA 2KYFA 2JU0A 2RH7A 2C9IA 1EMBA 5DKNA 2PSRA 1QLSA 5B8IB 2MHHA 1L2OB 2WSOA 2F33A 2GW4B 2LLUA 4W6MA 1S26D 3UG0A 4JFGA 5HW9A 2GGMA 2DD7A 1K95A 3SV5A 1C07A 5KSZA 3KF9A 3TS5C 2QU1A 5HBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W7E A;  1OSA A;  2FCD A;  1JSA A;  4IK3 A;  2JOJ A;  4IK9 A;  4PPJ A;  3TDU A;  3AKA A;  1XMZ A;  2M1K B;  2VAD A;  4ORA B;  2L4H A;  1S6C A;  1IJ5 A;  2WSN A;  1Y0V H;  1OMR A;  1XK4 A;  3OGO A;  1GL4 A;  4Z4K A;  1BR4 B;  4W6F A;  2JZI A;  3A8R A;  1IJ6 A;  4A4C A;  1F0B A;  1NCZ A;  1GGX A;  4W6H A;  2LVI A;  4L12 A;  5CSN A;  1SR6 B;  1SCM B;  3EK7 A;  2QZ0 A;  3PLF B;  1NIW A;  2ZO6 A;  1H4B A;  3FWC A;  3GK4 X;  2BTJ A;  2ZND A;  4W6L A;  2M7N A;  3SST A;  1MR8 A;  4ZF4 A;  3MGF A;  4QJ4 B;  1RWY A;  2G9B A;  3I5F C;  3ZWH A;  3CLN A;  2LMU A;  3E5V A;  1JC2 A;  2KI6 C;  2OTG B;  3GOF A;  4KF5 C;  1QYO A;  1PUL A;  2ARL A;  4TNC A;  5FVI A;  4R6D A;  3DQ5 A;  1NPQ A;  2I18 A;  2HET A;  3TMR A;  1ZGO A;  4W6O A;  3PJB A;  1KYP A;  1F54 A;  4PE4 A;  2ICR A;  1K96 A;  1V1G A;  4CPV A;  1GJY A;  1K9U A;  4U8D A;  3HCM A;  1WDC B;  3WHU B;  1NYA A;  3EK4 A;  4ZF5 A;  4KW8 A;  3WLD A;  2Q6P A;  1CDM A;  1QVI Y;  5JJG A;  2L98 A;  2JNF A;  1BF5 A;  2KAX A;  4YGD B;  2PXW A;  5FHV A;  4MZK A;  2IB6 A;  2JAD A;  2HPW A;  3NT3 A;  2AH8 A;  1BU3 A;  4PPL A;  4PAL A;  1B4C A;  2OKW A;  5KU1 A;  1QYF A;  3EVV A;  2B3Q A;  1RJV A;  2P6B B;  4W75 A;  3TUY B;  2E6W A;  3GB3 A;  4OR9 B;  4N3D A;  5BTT A;  1OXF A;  1YUT A;  2H61 C;  1NX3 A;  3LK0 A;  2A46 A;  1DJG A;  1EG4 A;  2PMY A;  2ZKM X;  3DQM A;  2R2I A;  4MSP A;  2DUH A;  5HKW A;  3BXB A;  4W6J A;  1DTL A;  5LK4 A;  4ZBL A;  4AQI A;  1DT7 B;  1CKK A;  2O29 A;  2AUC A;  2OGR A;  2HFC A;  4H48 A;  2FJU B;  2K61 A;  3NED A;  3KCT A;  2K7B A;  3I5H B;  4ZIO A;  1F4O A;  2G16 B;  1LA3 A;  3GL4 A;  1N65 A;  5DQB A;  1EL4 A;  5DPG A;  3CS1 A;  4H3L A;  4W7F A;  4PDZ A;  4HRH A;  1QS7 A;  1DJZ A;  4J89 A;  3SSY A;  3SIB A;  2L0P A;  1F70 A;  1GGZ A;  3TS5 B;  1UHI A;  5HZT A;  3VHT B;  3EVP A;  1QXP A;  1OE9 B;  1G4Y R;  3CD9 A;  3EK8 A;  4W6K A;  1SPY A;  5F9G A;  4I5N B;  1KFX L;  1H6R A;  4DXO A;  4Q7R A;  4JRB A;  2AAO A;  3SIA A;  1A29 A;  1RMP A;  3VK1 A;  2Q91 A;  4W6P A;  2LMT A;  1M45 A;  5ER4 X;  1C4F A;  2JC2 A;  1J7Q A;  2FL1 A;  2K8M B;  3VRO A;  4QJ3 B;  3W1D A;  5EXC I;  4JPZ B;  4AQJ A;  4DXN A;  2LM5 A;  4I5K A;  3SG5 A;  2SAS A;  2BCA A;  3A8S A;  4MZL A;  1UP5 A;  1YUS A;  1Q80 A;  1XFZ O;  2JPT A;  1YHG A;  4J8A A;  1YX7 A;  3LL8 B;  1KSM A;  1MOU A;  4W74 A;  4YGA A;  4OQW A;  3SG3 A;  2KGB C;  4MEW A;  3I5F B;  3I5I C;  1VRK A;  2Y4Q A;  2BE6 A;  3CFA A;  1NCY A;  1TCF A;  1WRZ A;  1CB1 A;  2BE4 A;  3GJ2 A;  4W6T A;  3D0Y A;  1M46 A;  1DGU A;  2DUG A;  1K9K A;  4DKM A;  2A56 B;  2SCP A;  4XYN A;  4I5J A;  1CDN A;  3KEV A;  3DQK A;  3WCK A;  5EXU A;  2CCM A;  1RK9 A;  4W69 A;  4HRG A;  2H8Q A;  2O2B A;  3DQJ A;  1CLM A;  3BOW A;  4KW4 A;  3H1R A;  4DS7 A;  4N1G A;  4RYS A;  2Z6Z A;  1Q4B A;  4ZFS A;  2AHA A;  4PE1 A;  2D8N A;  3KO0 A;  5TNC A;  1MOV A;  1ZUX A;  1V1F A;  1REC A;  1KQM C;  4NDC A;  2H5P A;  4KF5 A;  1B9C A;  4AR7 A;  1CFC A;  4NWS A;  1QXT A;  4C0K A;  4MLW A;  3SG7 A;  3LCP C;  2P4M A;  4M2Q A;  3DQU A;  1EMC A;  1HQV A;  1UUS A;  2BL0 C;  3HX4 A;  1SCM C;  1F09 A;  2ZN8 A;  1IKU A;  4W6C A;  1XVJ A;  4LQU A;  3NEZ A;  1RMO A;  4JEO A;  1FI6 A;  4LJD C;  2HQK A;  1QIW A;  2WOR A;  3CR4 X;  1KYS A;  3EVR A;  1OZO A;  5CSJ A;  1TTX A;  2LCP A;  1B8R A;  2KYC A;  3JTD C;  4W6B A;  2POX A;  1NSH A;  1JFK A;  1A75 B;  3DVJ A;  2WUR A;  3DQL A;  1BFP A;  3JVT C;  3DQA A;  2KI6 D;  5DRG A;  4JWQ A;  4HRE E;  3DQ6 A;  3H1O A;  2PXS A;  2KFG A;  3DQ9 A;  2JUL A;  4GES B;  2L50 A;  5IBW A;  1SNL A;  3GK2 A;  2CT9 A;  4PHJ A;  2MJW B;  3SSP A;  2VVI A;  2QAC A;  1KP5 A;  1S36 A;  2LLS A;  2YE0 A;  3LVD A;  4GAO A;  3RLZ A;  3CB9 A;  1GGW A;  2PVB A;  1Y1X A;  1YHH A;  3DQD A;  4KGF A;  1NCX A;  1QV0 A;  4M2O A;  2GW3 A;  3VRR A;  4W73 A;  1M31 A;  1IWQ A;  5BQL A;  5AEQ A;  2KQY A;  1SL7 A;  3I5I B;  5EB6 A;  1AP4 A;  5D69 A;  3DPX A;  1YUR A;  3QRX A;  1XFU O;  3E3R A;  1XFX O;  1R6P A;  2VAE A;  3NF0 A;  1YRU B;  1S1E A;  2NXQ A;  2B3P A;  1J7P A;  1OOJ A;  1HT9 A;  2MLE C;  3LVC A;  2QLG B;  2O60 A;  3DF0 A;  5EXB A;  3E5T A;  2HGY A;  2L4I A;  4KEX A;  1HCJ A;  1UHK A;  2K2A A;  2NCO A;  2JXL A;  1WRK A;  3OP0 A;  1KQM B;  5I2L A;  2KQ6 A;  3PN7 C;  3AI4 A;  1Q4C A;  1QV1 A;  4W6A A;  1S6Z A;  1B47 A;  2KBI A;  2JNX A;  1LIN A;  5DKQ A;  1U5I B;  1BG1 A;  2QRF A;  3NT9 A;  4OJ0 A;  3OX6 A;  2BL0 B;  1XFW O;  1CM4 A;  3BUX B;  2L2E A;  1JC1 A;  4HVF A;  1CDP A;  4CFR A;  1Z1Q A;  4KF4 A;  4B30 B;  1Q73 A;  3O4Y A;  2EMN A;  2DDC A;  2CXJ A;  2K7D A;  3BUM B;  1XAE A;  1PK0 D;  3JTD B;  1ZFS A;  4XVP A;  3SG2 A;  1SY9 A;  2LC5 A;  5LTR A;  3SVR A;  1EG3 A;  1QTX A;  1CMF A;  2G6E A;  1H8B A;  1QX7 A;  3O6B A;  3JVT B;  4HQ9 A;  4UTS A;  3GK1 A;  1BLQ A;  4YI8 A;  3TDI A;  4YRU A;  3NSI A;  1NX1 A;  1ZUZ A;  5J3X A;  4CID A;  1DJH A;  2DDD A;  4GPL B;  2K2F A;  2DUI A;  2Y0G A;  1OXD A;  5HYD A;  4N1F A;  2L51 A;  1QAS A;  1MF8 B;  4W6N A;  4UPG A;  5LTP A;  1YZW A;  1Y1U A;  5DTY A;  3ZNI A;  5HZS A;  4B5Y A;  1EJ3 A;  2WOS A;  2L5X B;  4YGE B;  4DXI A;  3M22 A;  4W6S A;  2H6V A;  2Y1N A;  4FQO A;  4WQ3 A;  3U8C A;  4IK1 A;  1RRO A;  3IQQ A;  3IF7 A;  4AS8 A;  4GUK A;  2KDH A;  2KNE A;  3AKO A;  3CGL A;  3CBE A;  4DUQ A;  1H4U A;  1K93 D;  1JBY A;  1UIS A;  4PE0 A;  4PPK A;  3H4S E;  2WHT A;  3PJ7 A;  5HGE A;  2CBL A;  1FPW A;  2BCX A;  1BR1 B;  3SVE A;  3A4U B;  1XQM A;  3WNX B;  5DTZ A;  1EMM A;  3E5W A;  3VRQ A;  3DQE A;  3BXC A;  2GX2 A;  1EXR A;  1CNP A;  1AJ5 A;  3I5G C;  1UHN A;  1B9A A;  3FS7 A;  4IL1 A;  1XO5 A;  1AVS A;  2HRS A;  3RWT A;  3OSQ A;  2H2K A;  2KI4 C;  4GF6 B;  3CGA A;  1F4Q A;  1KQV A;  2OS8 C;  4A4B A;  4ZCV A;  3RWA A;  1UWO A;  5CPV A;  2NCP A;  1S6J A;  1UHJ A;  1AHR A;  2WC8 A;  1HUY A;  1KK7 Y;  4C0L A;  3PN7 B;  1QX5 B;  1DMO A;  5K89 A;  5EHU A;  2KOT A;  4GGF C;  4I5L B;  2F2P A;  2H9W A;  3CTN A;  2JXC A;  4OCI A;  1YR5 A;  3G9A A;  3DQ1 A;  5DPI A;  2LVK A;  1W7T A;  2WIS A;  4GFT A;  5PAL A;  5AXI A;  3VHT A;  1PVB A;  2AWM A;  1ALW A;  4ETO A;  2G3O A;  2A53 B;  3SVD A;  1EMF A;  2BBM A;  2RGI A;  4W76 A;  1TNQ A;  5HZU A;  2ISD A;  4KGE A;  2YFP A;  2KAY A;  4GOB A;  2TN4 A;  1EME A;  2FOT A;  4XJK A;  3M24 A;  3DPZ A;  4W7C A;  3LS3 A;  3AKB A;  2KFH A;  2QLE A;  3VGO A;  5DY6 A;  1BJF A;  1XK4 C;  1NX2 A;  5I2O A;  2V4E B;  1B7T Y;  3PFV A;  5FVG A;  5FVF A;  2OPO A;  3SRY A;  3DQ8 A;  4H3M A;  5DKR A;  1E8A A;  1S5G Z;  1CMG A;  2ZRT A;  2F8P A;  4TZG A;  1RM9 A;  1FBV A;  1ZGP A;  2JTZ A;  5I2Q A;  1AJ4 A;  1CV7 A;  1SCV A;  4ORC B;  2WIQ A;  2WCB A;  2O24 A;  4PHK A;  2JT0 A;  5LTQ A;  2DUF A;  4CFQ A;  1B1G A;  2KFF A;  4CLN A;  3DQ2 A;  1Y6W A;  2HQW A;  2H5R A;  2NLN A;  1D1O A;  2PRU A;  1XSS A;  5HKY A;  2F3Z A;  1SK6 D;  1A4P A;  1MQ1 A;  1F55 A;  3K21 A;  3WHT B;  3BUW B;  2G3D B;  3DQ3 A;  1KYR A;  4EDO A;  3PAT A;  3U0M A;  2LP2 A;  4XGY A;  1Q4E A;  4E68 A;  3DQ7 A;  3U0K A;  3NSK A;  1ALV A;  3WXA A;  4P76 A;  3BX9 A;  1K8U A;  4EDS A;  1JF2 A;  1QY3 A;  3I5G B;  4HE4 A;  1C7W A;  4IZN A;  4W6G A;  4ZCU A;  4Q7U A;  3SG6 A;  1N0Y A;  2LAN A;  4P5O E;  5I8N A;  3IQO A;  2H61 A;  2KI4 B;  1YFP A;  5H87 A;  2IE2 A;  2OS8 B;  2M29 A;  3ZUL A;  2G2S B;  3DQC A;  5F6T A;  5HZO A;  2O5G A;  1ZOT B;  1FI5 A;  3SVO A;  1OZS A;  1GFL A;  2QLH A;  1DGV A;  1IRJ A;  2AWK A;  3TDZ A;  1XFY O;  1DF0 B;  4GNK B;  1JC0 A;  2NZ0 A;  3IP2 A;  4PCW A;  2AWJ A;  4JF9 A;  4N5X A;  1J7R A;  2M3W A;  2LNK A;  4L9M A;  4ZF3 A;  2VRG A;  5CSI A;  2LHI A;  4OY4 A;  4MN0 A;  2M1U A;  1A75 A;  2IB5 A;  1KSO A;  1K90 D;  5CSF A;  4FTG A;  1S3P A;  3KHE A;  3C1V A;  3FIA A;  1K9P A;  2HJO A;  1KWO C;  3BXK A;  4W7A A;  4TZA A;  2VVJ A;  2LUC A;  1YUU A;  3D10 A;  3O2P A;  3VIC A;  4W6I A;  1CM1 A;  3ZTF A;  2BKI B;  5AQB B;  2BCB A;  1G7K A;  4L1I A;  3ZUF A;  1WRL A;  4W77 A;  1M39 A;  1K94 A;  2M9G A;  1IG5 A;  4KPI A;  4OGS A;  4J88 A;  4IK4 A;  1QVI Z;  4QJ5 B;  1B8L A;  2K7C A;  2M49 B;  1DJX A;  1QIV A;  1FF1 A;  2F2O A;  4RTC A;  1GQM A;  2K0J A;  2Y1M A;  3ST4 A;  2FCE A;  2COL B;  5DRF A;  4W6R A;  1YVL A;  3VRN A;  2CTN A;  4PHN A;  1TNP A;  2HCG A;  3U8P A;  5BPJ A;  3ED8 A;  3CFH A;  4MBE A;  3LSA A;  3CWG A;  3BXA A;  4XL5 A;  4LW5 A;  1OQP A;  2G2B A;  1TRF A;  1R2U A;  2LLT A;  2VVH A;  3DQN A;  1RRX A;  2WHU A;  1UHH A;  1KK8 C;  3SSV A;  1NWD A;  3SSL A;  2ZFD A;  4DKN A;  2GX0 A;  1SW8 A;  4JC2 A;  4GBA A;  4H47 A;  2GGZ A;  3P8U A;  5DTX A;  3LK1 A;  3CR2 A;  2E30 A;  2Y5I A;  3MSE B;  2IOV A;  2QLG A;  1CLL A;  2KBM A;  1OMV A;  2A47 A;  2AMI A;  3NSO A;  4XOW A;  2A52 B;  3PJ5 A;  3DVM A;  5HKZ A;  2OTE A;  1ZAC A;  3OHM B;  3ST0 A;  3SVS A;  1OMD A;  1ZGQ A;  3DD4 A;  3U0L A;  4USL A;  1BMO A;  1EMG A;  2BKH B;  2WCF A;  3LLE A;  2H5Q A;  2B1U A;  3KPX A;  1LA0 A;  1J55 A;  2LHL A;  3CZT X;  4YGC B;  3AI5 A;  3BQ3 A;  1CTR A;  2V4E C;  2QPT A;  1KK7 Z;  5AAN A;  1BOC A;  4C0J A;  5BTT B;  3ST3 A;  1U5I A;  3AAK A;  1DVI A;  3DQF A;  1S6I A;  1JUO A;  1NP8 A;  3DQH A;  1L7Z A;  2LAP A;  2AWL A;  3OX5 A;  2KHN A;  2FZU A;  2PAS A;  2I94 A;  1CLB A;  4B30 A;  4LJD A;  1IGV A;  1RTP 1;  5DPJ A;  1KCY A;  1Y1A A;  3CR5 X;  1RFJ A;  4DCK A;  4EUL A;  2A4J A;  1TN4 A;  4W6U A;  4LJB A;  4ZIN A;  1XYD A;  3AAJ A;  2M7L A;  1RMM A;  2MA2 A;  1JFJ A;  2Q57 A;  5ER5 A;  3WLC A;  4PE7 A;  4Q7T A;  5EJU A;  2G5Z B;  1WY9 A;  5J2O A;  3GEX A;  2VZX A;  1KWO B;  3SJS A;  3LA1 A;  4Q9X A;  3W1C A;  3PSR A;  1G8I A;  1N2D A;  3LVA A;  3DVE A;  1EMA A;  5KTY A;  3KCS A;  1B7T Z;  3EKH A;  2I2R E;  2JRF A;  4IK8 A;  4DXQ A;  4LJC A;  2FWQ A;  5DQM A;  2BBN A;  4DRW A;  1WLM A;  3CFF A;  2H5O A;  1QJT A;  3ICB A;  1MWN A;  4DIR A;  1JBA A;  1X02 A;  4BY5 A;  5D7F A;  3LF4 B;  1PVA A;  3BYA A;  2HPS A;  4JQ0 D;  4M2P A;  4Z4M A;  4YI9 A;  4EN1 A;  1J1E A;  1TNX A;  5HLO A;  2QLI A;  1EMK A;  4YBH B;  1YX8 A;  4ICB A;  3RM1 A;  1QYQ A;  3SVN A;  4P1Q A;  4IK5 A;  1ODB A;  4OHS A;  1SL8 A;  3U0N A;  4LQT A;  2JWW A;  2I7A A;  4KW9 A;  4W72 A;  5T3I A;  1PSR A;  3IR8 A;  1CFF A;  2F3Y A;  1CFD A;  5GQQ C;  2C9J A;  3BUO B;  4DXM A;  1KK8 B;  1J1D A;  2A50 B;  1YJ2 A;  3SSH A;  1KFU L;  1TCO B;  2MBX A;  2WND A;  2V53 A;  1AK8 A;  2DD9 A;  2YE1 A;  2GV5 A;  5AFP A;  2LVJ A;  2Z6Y A;  2EC6 C;  4BY4 A;  2EGD A;  3U8A A;  4XJK B;  3D0Y B;  4HSZ A;  1G33 A;  1MXE A;  2ZMW A;  5JOL A;  3OB2 B;  2ZNE A;  1MXL C;  2ZMU A;  2HGD A;  2EHB A;  1QLK A;  4R6B A;  3PAL A;  5BT0 A;  2LMV A;  3DPW A;  2OKY A;  2Z1O A;  2WCE A;  3OB1 B;  4ZB1 A;  1SBJ A;  1YRT B;  2Z6X A;  2ZN9 A;  4R1E A;  3LF3 A;  2OTB A;  4HQC A;  2G6Y A;  1WLZ A;  2ZO7 A;  3BOW B;  4OKH A;  5KTG A;  4H3N A;  1QAT A;  3SSK A;  4PFE A;  2MLF C;  3CD1 A;  3DQI A;  2MRD A;  2K7O A;  1JWD A;  3I19 A;  4U2V A;  3O78 A;  1TNW A;  2JTT A;  3NSL A;  3TZ1 A;  3UFZ A;  1IQ3 A;  4RYW A;  5DPH A;  5FYX A;  2A48 A;  1SKT A;  3SVU A;  2EMD A;  1B8C A;  2M8U A;  4ANJ A;  3ZUJ A;  4OVN F;  4W7D A;  2EMO A;  4MVF A;  1SYM A;  5EBJ A;  1LXF C;  1L2O C;  2ZRS A;  1A2X A;  2WHS A;  1CFP A;  1BT6 A;  2M0R A;  3NXA A;  4MRY A;  3SVB A;  1JBZ A;  1YTZ C;  2A54 B;  3M0W A;  1MHO A;  4MRX A;  2HQZ A;  2LP3 A;  3DQ4 A;  4NQG A;  4F0Z B;  2LVV A;  2KGR A;  1UUR A;  4BDU A;  1SL9 A;  2KSP A;  3FWB A;  5DU0 A;  2LV7 A;  2V4E A;  2HF5 A;  4D1E A;  4GGN A;  1XA5 A;  1MUX A;  1XA9 A;  3VRP A;  1IH0 A;  3EVU A;  1YJF A;  4KA9 A;  5H89 A;  4AOM A;  3ADF A;  4W6D A;  4NDD A;  3ST2 A;  1Q4D A;  2Q4U A;  2DOQ A;  3F45 A;  1SR6 C;  1F8H A;  2LE9 B;  1NX0 A;  5H88 A;  1TOP A;  1NUB A;  3SS0 A;  1JF0 A;  1W7J B;  1EML A;  1MYW A;  1OXE A;  2OJK A;  1TIZ A;  2OTG C;  4HQ8 A;  1LVC D;  4XOV A;  1KFX S;  2JT8 A;  2CNP A;  1KFU S;  1AUI B;  1DJI A;  3DQO A;  1K2H A;  3O77 A;  1W7U A;  2JT3 A;  1Z1P A;  2M97 A;  1IQ5 A;  5DTL A;  4JGE A;  3DVK A;  1WDC C;  1YHI A;  2DUE A;  3SVC A;  1PSB A;  2IS9 A;  4I2Y A;  1PRW A;  4WRI A;  5HLV A;  1YVH A;  2LUX A;  4WQ2 A;  1BOD A;  4Q9W A;  4Q04 A;  4DXP A;  4MZJ A;  1F71 A;  2EC6 B;  1XFV O;  4ORN A;  1S5G Y;  1FW4 A;  2MAZ A;  3EKJ A;  2KAV A;  4KAG A;  1DJW A;  4ORB B;  3P28 A;  4EMQ A;  1W7S A;  1J7O A;  4L13 A;  3K1K A;  3TMT A;  4NDB A;  3S05 A;  3SG4 A;  2G6X A;  5EB7 A;  1CDL A;  1SMG A;  2QT2 A;  3TUY C;  1W7I B;  1C7V A;  1Q4A A;  4PHM A;  1SRA A;  1LKJ A;  3OSR A;  1EH2 A;  4OV2 A;  3DF0 B;  4P2Y B;  1A03 A;  2PAL A;  3PM8 A;  4W7X A;  2JQ6 A;  2YDZ A;  3BUN B;  2HQ8 A;  5AER A;  5G08 A;  1ZMZ A;  1DF0 A;  1DJY A;  1M63 B;  3PIB A;  1QX2 A;  4YGB B;  4GGF A;  4W7R A;  3I5H C;  2BEC A;  3GJ1 A;  3V3D A;  1PAL A;  2KYF A;  2JU0 A;  2RH7 A;  2C9I A;  1EMB A;  5DKN A;  2PSR A;  1QLS A;  5B8I B;  2MHH A;  1L2O B;  2WSO A;  2F33 A;  2GW4 B;  2LLU A;  4W6M A;  1S26 D;  3UG0 A;  4JFG A;  5HW9 A;  2GGM A;  2DD7 A;  1K95 A;  3SV5 A;  1C07 A;  5KSZ A;  3KF9 A;  3TS5 C;  2QU1 A;  5HBD A; 
#chains in the Genus database with same CATH topology
 4W7E A;  1OSA A;  2FCD A;  1JSA A;  4IK3 A;  2JOJ A;  4IK9 A;  4PPJ A;  3TDU A;  3AKA A;  1XMZ A;  2M1K B;  2VAD A;  4ORA B;  2L4H A;  1S6C A;  1IJ5 A;  2WSN A;  1Y0V H;  1OMR A;  2QEO A;  1XK4 A;  3OGO A;  1GL4 A;  4Z4K A;  1BR4 B;  4W6F A;  2JZI A;  3A8R A;  1IJ6 A;  4A4C A;  1F0B A;  1NCZ A;  1GGX A;  4W6H A;  2LVI A;  2QEB A;  4L12 A;  5CSN A;  1SR6 B;  1SCM B;  3EK7 A;  2QZ0 A;  3PLF B;  1NIW A;  2ZO6 A;  1H4B A;  3FWC A;  3GK4 X;  2BTJ A;  2ZND A;  4W6L A;  2M7N A;  3SST A;  1MR8 A;  4ZF4 A;  3MGF A;  4QJ4 B;  1RWY A;  4IJ7 A;  2G9B A;  3I5F C;  3ZWH A;  3CLN A;  2LMU A;  3E5V A;  1JC2 A;  2KI6 C;  2OTG B;  3GOF A;  4KF5 C;  1QYO A;  1PUL A;  2ARL A;  4TNC A;  5FVI A;  4R6D A;  3DQ5 A;  1NPQ A;  2I18 A;  4INW A;  2HET A;  3TMR A;  1ZGO A;  4W6O A;  3PJB A;  1KYP A;  1F54 A;  4PE4 A;  2ICR A;  1K96 A;  1V1G A;  4CPV A;  1GJY A;  1K9U A;  4U8D A;  3HCM A;  1WDC B;  3WHU B;  1NYA A;  3EK4 A;  4ZF5 A;  3SS5 A;  4KW8 A;  3WLD A;  2Q6P A;  1CDM A;  1QVI Y;  5JJG A;  2L98 A;  2JNF A;  1BF5 A;  2KAX A;  4YGD B;  2PXW A;  5FHV A;  4MZK A;  2IB6 A;  2JAD A;  2HPW A;  1XFR A;  3NT3 A;  2AH8 A;  1BU3 A;  4PAL A;  4PPL A;  1B4C A;  2OKW A;  5KU1 A;  1QYF A;  2KLE A;  3EVV A;  2B3Q A;  1RJV A;  2P6B B;  4W75 A;  3TUY B;  2E6W A;  3GB3 A;  4OR9 B;  4N3D A;  5BTT A;  1OXF A;  1YUT A;  2H61 C;  1NX3 A;  3LK0 A;  2A46 A;  1DJG A;  1EG4 A;  2PMY A;  2ZKM X;  2WCL A;  2R2I A;  3DQM A;  4MSP A;  2DUH A;  5HKW A;  3BXB A;  4W6J A;  1DTL A;  5LK4 A;  4ZBL A;  4AQI A;  1DT7 B;  1CKK A;  2O29 A;  2AUC A;  2OGR A;  2HFC A;  1C3Y A;  4H48 A;  2FJU B;  2K61 A;  3NED A;  3KCT A;  2K7B A;  3I5H B;  4ZIO A;  1F4O A;  2G16 B;  1LA3 A;  3GL4 A;  1N65 A;  5DQB A;  1EL4 A;  5DPG A;  3CS1 A;  4H3L A;  4W7F A;  4PDZ A;  4HRH A;  1QS7 A;  1DJZ A;  4J89 A;  3SSY A;  3SIB A;  2L0P A;  1F70 A;  1GGZ A;  3TS5 B;  1UHI A;  5HZT A;  2FJY A;  3VHT B;  3EVP A;  1QXP A;  1OE9 B;  1G4Y R;  3CD9 A;  3EK8 A;  4W6K A;  1SPY A;  5F9G A;  3N7H A;  4I5N B;  1KFX L;  1H6R A;  1TWO A;  4DXO A;  1GM0 A;  4Q7R A;  4JRB A;  2AAO A;  3SIA A;  1A29 A;  1RMP A;  3VK1 A;  2Q91 A;  4W6P A;  2LMT A;  1M45 A;  5ER4 X;  2ERB A;  1C4F A;  2JC2 A;  1J7Q A;  2FL1 A;  2K8M B;  3OBV A;  3VB1 A;  3VRO A;  4QJ3 B;  3W1D A;  5EXC I;  4JPZ B;  4AQJ A;  4DXN A;  2LM5 A;  4I5K A;  3SG5 A;  2SAS A;  2BCA A;  3A8S A;  1DQE A;  4MZL A;  1ORG A;  1UP5 A;  1YUS A;  1Q80 A;  1XFZ O;  2JPT A;  1IIO A;  1YHG A;  4J8A A;  1TUJ A;  1YX7 A;  3LL8 B;  1KSM A;  1MOU A;  3PJI A;  4W74 A;  4YGA A;  2WCM A;  4OQW A;  3SG3 A;  2KGB C;  4MEW A;  3I5F B;  3I5I C;  1VRK A;  2Y4Q A;  2BE6 A;  2PYQ A;  3CFA A;  1NCY A;  3V2L A;  1TCF A;  1WRZ A;  1CB1 A;  2BE4 A;  3GJ2 A;  4W6T A;  3D0Y A;  1M46 A;  1DGU A;  3BFA A;  2DUG A;  1K9K A;  4DKM A;  2A56 B;  2SCP A;  4XYN A;  2QDI A;  4I5J A;  1CDN A;  3KEV A;  3DQK A;  3WCK A;  5EXU A;  2CCM A;  1RK9 A;  3DZT A;  3CZ0 A;  4W69 A;  1Z2C B;  4HRG A;  2H8Q A;  2O2B A;  3DQJ A;  1CLM A;  3BOW A;  4KW4 A;  3H1R A;  4DS7 A;  4N1G A;  4RYS A;  2Z6Z A;  1Q4B A;  4ZFS A;  2AHA A;  4PE1 A;  2D8N A;  3KO0 A;  5TNC A;  1MOV A;  1ZUX A;  1V1F A;  1REC A;  5FI7 A;  1KQM C;  4NDC A;  3BFH A;  2H5P A;  4KF5 A;  1B9C A;  4AR7 A;  1CFC A;  3S0B A;  4NWS A;  1QXT A;  4C0K A;  4MLW A;  3SG7 A;  3LCP C;  2P4M A;  4M2Q A;  3DQU A;  2PQL A;  1EMC A;  1HQV A;  1UUS A;  2BL0 C;  2WC6 A;  3HX4 A;  1SCM C;  1F09 A;  2ZN8 A;  1IKU A;  4W6C A;  1XVJ A;  3SS4 A;  4LQU A;  3NEZ A;  1RMO A;  4JEO A;  1FI6 A;  4LJD C;  2HQK A;  1QIW A;  2WOR A;  3CR4 X;  3BFB A;  1KYS A;  3EVR A;  2KLD A;  1OZO A;  5CSJ A;  1TTX A;  2LCP A;  1B8R A;  2KYC A;  3JTD C;  4W6B A;  2POX A;  1NSH A;  1JFK A;  1A75 B;  3DVJ A;  2WUR A;  3DQL A;  1BFP A;  3JVT C;  3DQA A;  2KI6 D;  5DRG A;  4JWQ A;  1OOG A;  4HRE E;  3DQ6 A;  3H1O A;  2PXS A;  2KFG A;  3DQ9 A;  2JUL A;  4GES B;  2L50 A;  3R72 A;  1SNL A;  5IBW A;  3GK2 A;  2CT9 A;  4PHJ A;  2MJW B;  3SSP A;  3D76 A;  2VVI A;  2QAC A;  1KP5 A;  1S36 A;  2LLS A;  2YE0 A;  3LVD A;  4GAO A;  3RLZ A;  3CB9 A;  1GGW A;  2PVB A;  1Y1X A;  3DXL A;  1YHH A;  3DQD A;  4KGF A;  1NCX A;  1QV0 A;  4M2O A;  2GW3 A;  3VRR A;  3B7A A;  4W73 A;  1M31 A;  1IWQ A;  5BQL A;  5AEQ A;  2KQY A;  1SL7 A;  3I5I B;  5EB6 A;  1AP4 A;  5D69 A;  3DPX A;  1YUR A;  3QRX A;  1XFU O;  3E3R A;  1XFX O;  1R6P A;  2VAE A;  3NF0 A;  1YRU B;  1S1E A;  2NXQ A;  2B3P A;  1J7P A;  1OOJ A;  1HT9 A;  4PT1 A;  2MLE C;  3LVC A;  2QLG B;  2O60 A;  3DF0 A;  5EXB A;  3E5T A;  2HGY A;  2L4I A;  4KEX A;  1HCJ A;  1UHK A;  2K2A A;  2NCO A;  2QEV A;  2JXL A;  1WRK A;  3OP0 A;  4JKT A;  1KQM B;  5I2L A;  2KQ6 A;  3L47 A;  3PN7 C;  3AI4 A;  1Q4C A;  1QV1 A;  4W6A A;  1S6Z A;  1B47 A;  2KBI A;  2JNX A;  1LIN A;  5DKQ A;  1U5I B;  1BG1 A;  2QRF A;  3NT9 A;  4OJ0 A;  3OX6 A;  2BL0 B;  1XFW O;  1CM4 A;  3BUX B;  2L2E A;  1JC1 A;  4HVF A;  1CDP A;  4CFR A;  1Z1Q A;  4KF4 A;  4B30 B;  1Q73 A;  3O4Y A;  2EMN A;  2DDC A;  2CXJ A;  2K7D A;  3BUM B;  1XAE A;  1PK0 D;  2WCJ A;  3JTD B;  3NGV A;  3CZ1 A;  1ZFS A;  4XVP A;  3SG2 A;  1SY9 A;  2LC5 A;  5LTR A;  2WC5 A;  3SVR A;  1EG3 A;  1QTX A;  1CMF A;  2G6E A;  1H8B A;  1QX7 A;  3O6B A;  3JVT B;  4HQ9 A;  3GK1 A;  4UTS A;  1BLQ A;  4YI8 A;  3TDI A;  4YRU A;  3NSI A;  1NX1 A;  1ZUZ A;  5J3X A;  4CID A;  1DJH A;  2DDD A;  4GPL B;  2K2F A;  2DUI A;  2Y0G A;  4KYN A;  1OXD A;  3D77 A;  4N1F A;  5HYD A;  2L51 A;  1QAS A;  1MF8 B;  4W6N A;  4UPG A;  5LTP A;  1YZW A;  1Y1U A;  5DTY A;  3ZNI A;  5HZS A;  4B5Y A;  3K1E A;  1EJ3 A;  2WOS A;  2L5X B;  4YGE B;  4DXI A;  3M22 A;  4W6S A;  2H6V A;  2Y1N A;  4FQO A;  4WQ3 A;  3U8C A;  4IK1 A;  1RRO A;  3IQQ A;  3IF7 A;  4AS8 A;  4GUK A;  2KDH A;  2KNE A;  3AKO A;  3CGL A;  3NHT A;  3CBE A;  4DUQ A;  1H4U A;  1K93 D;  1JBY A;  1UIS A;  4PE0 A;  4PPK A;  3H4S E;  1DC1 A;  2WHT A;  3PJ7 A;  5HGE A;  2CBL A;  1FPW A;  2BCX A;  1BR1 B;  3SVE A;  3A4U B;  1XQM A;  3WNX B;  5DTZ A;  1EMM A;  3E5W A;  3VRQ A;  3DQE A;  3BXC A;  3B87 A;  2BAP A;  2GX2 A;  1EXR A;  1CNP A;  1AJ5 A;  3I5G C;  1UHN A;  1B9A A;  3FS7 A;  4IL1 A;  3DY9 A;  1XO5 A;  1AVS A;  2HRS A;  3RWT A;  3OSQ A;  2H2K A;  2KI4 C;  4GF6 B;  3CGA A;  1F4Q A;  1KQV A;  2OS8 C;  4A4B A;  4ZCV A;  2QEH A;  3RWA A;  1UWO A;  5CPV A;  2NCP A;  3BJH A;  1S6J A;  1UHJ A;  1AHR A;  2WC8 A;  5EL2 A;  1HUY A;  2H8V A;  3UO9 A;  1KK7 Y;  2P71 A;  4C0L A;  3PN7 B;  1QX5 B;  1DMO A;  5K89 A;  5EHU A;  2KOT A;  4GGF C;  4I5L B;  3RZS A;  3OGN A;  2F2P A;  2H9W A;  3CTN A;  2JXC A;  4OCI A;  1YR5 A;  3G9A A;  3DQ1 A;  5DPI A;  2LVK A;  1W7T A;  2WIS A;  4GFT A;  1TUZ A;  5PAL A;  5AXI A;  2GTE A;  3VHT A;  1PVB A;  2AWM A;  1ALW A;  3SS3 A;  4ETO A;  2G3O A;  2A53 B;  3SVD A;  1EMF A;  2BBM A;  2RGI A;  2WCK A;  4W76 A;  1TNQ A;  5HZU A;  2ISD A;  4KGE A;  2YFP A;  2KAY A;  3FE6 A;  4GOB A;  2TN4 A;  1EME A;  2FOT A;  4XJK A;  3M24 A;  3CYZ A;  3DPZ A;  4W7C A;  3LS3 A;  3AKB A;  2KFH A;  2QLE A;  3VGO A;  5DY6 A;  1BJF A;  1XK4 C;  1NX2 A;  5I2O A;  2V4E B;  1B7T Y;  3PFV A;  5FVG A;  3NHI A;  5FVF A;  2OPO A;  3SRY A;  3DQ8 A;  4H3M A;  5DKR A;  1E8A A;  1S5G Z;  4OZD A;  1CMG A;  2ZRT A;  2F8P A;  4TZG A;  1RM9 A;  1OOI X;  1FBV A;  1ZGP A;  2JTZ A;  5I2Q A;  1AJ4 A;  1CV7 A;  3B88 A;  4FQT A;  1SCV A;  4ORC B;  2WIQ A;  2WCB A;  2O24 A;  3S0A A;  4PHK A;  2JT0 A;  5LTQ A;  2DUF A;  3D74 A;  4CFQ A;  1B1G A;  2KFF A;  4CLN A;  3DQ2 A;  1Y6W A;  2HQW A;  2H5R A;  2NLN A;  1D1O A;  2PRU A;  1XSS A;  5HKY A;  2F3Z A;  1SK6 D;  1A4P A;  1MQ1 A;  1F55 A;  3K21 A;  3WHT B;  3BUW B;  1W9Z A;  2G3D B;  3DQ3 A;  1KYR A;  4EDO A;  3PAT A;  3U0M A;  2LP2 A;  4XGY A;  1Q4E A;  5HL1 A;  4E68 A;  3DQ7 A;  3U0K A;  3NSK A;  4JD9 A;  1ALV A;  3WXA A;  4P76 A;  3BX9 A;  1K8U A;  4EDS A;  1JF2 A;  1QY3 A;  2L5Y A;  3I5G B;  4HE4 A;  1C7W A;  4IZN A;  4W6G A;  4ZCU A;  4Q7U A;  3SG6 A;  1N0Y A;  2LAN A;  4P5O E;  5I8N A;  3IQO A;  2H61 A;  2KI4 B;  1YFP A;  1OOH A;  2BNX A;  5H87 A;  2IE2 A;  3R1V A;  2OS8 B;  2M29 A;  3ZUL A;  2G2S B;  3DQC A;  5F6T A;  5HZO A;  2O5G A;  1ZOT B;  1FI5 A;  3SVO A;  1OZS A;  1GFL A;  2QLH A;  1DGV A;  1IRJ A;  2AWK A;  3TDZ A;  1XFY O;  1DF0 B;  3L4L A;  4GNK B;  1JC0 A;  2NZ0 A;  3IP2 A;  4PCW A;  2AWJ A;  1C3Z A;  4JF9 A;  4N5X A;  1J7R A;  2M3W A;  2LNK A;  4L9M A;  4ZF3 A;  2VRG A;  5FI6 A;  5CSI A;  2LHI A;  4OY4 A;  4MN0 A;  2M1U A;  1A75 A;  2IB5 A;  1KSO A;  1K90 D;  5CSF A;  4FTG A;  3CZ2 A;  1S3P A;  3KHE A;  3FE9 A;  3C1V A;  3FIA A;  1K9P A;  2HJO A;  1KWO C;  3BXK A;  4W7A A;  4TZA A;  2VVJ A;  2LUC A;  1YUU A;  3D10 A;  3O2P A;  3VIC A;  4W6I A;  1CM1 A;  3ZTF A;  2BKI B;  5AQB B;  2BCB A;  5FI2 A;  1G7K A;  4L1I A;  3ZUF A;  1WRL A;  4W77 A;  1M39 A;  1K94 A;  2M9G A;  1IG5 A;  4KPI A;  4OGS A;  4J88 A;  4IK4 A;  1QVI Z;  5I94 A;  4QJ5 B;  3L4A A;  1B8L A;  2K7C A;  2M49 B;  1DJX A;  5DIC A;  1QIV A;  1FF1 A;  2F2O A;  4RTC A;  1GQM A;  2K0J A;  2Y1M A;  3ST4 A;  1DEL A;  2FCE A;  2COL B;  5DRF A;  4W6R A;  1YVL A;  3VRN A;  2CTN A;  4PHN A;  1TNP A;  2HCG A;  3U8P A;  5BPJ A;  3ED8 A;  3CFH A;  4MBE A;  3LSA A;  3CWG A;  3BXA A;  4XL5 A;  4LW5 A;  1OQP A;  2G2B A;  1TRF A;  1R2U A;  2LLT A;  2VVH A;  3DQN A;  1RRX A;  2WHU A;  1UHH A;  1KK8 C;  3SSV A;  1NWD A;  3SSL A;  2ZFD A;  4DKN A;  3CAB A;  2GX0 A;  1SW8 A;  4JC2 A;  4GBA A;  4H47 A;  3S0F A;  2GGZ A;  3IVT A;  3P8U A;  5DTX A;  3LK1 A;  3CR2 A;  2E30 A;  2Y5I A;  3EG5 B;  3MSE B;  2IOV A;  2QLG A;  3R1O A;  1CLL A;  2KBM A;  1OMV A;  2A47 A;  2AMI A;  3NSO A;  4XOW A;  2A52 B;  3PJ5 A;  3DVM A;  5HKZ A;  2OTE A;  1ZAC A;  3OHM B;  3ST0 A;  3SVS A;  1OMD A;  1ZGQ A;  3DD4 A;  3U0L A;  4USL A;  1BMO A;  1EMG A;  2BKH B;  2WCF A;  4F7F A;  3LLE A;  1DEK A;  2H5Q A;  2B1U A;  3KPX A;  1LA0 A;  1J55 A;  2LHL A;  3CZT X;  4YGC B;  3B86 A;  3S0G A;  3AI5 A;  3BQ3 A;  1CTR A;  2V4E C;  2QPT A;  1KK7 Z;  5AAN A;  1BOC A;  4C0J A;  5BTT B;  3ST3 A;  1U5I A;  3AAK A;  1DVI A;  3DQF A;  1S6I A;  1JUO A;  1NP8 A;  3DQH A;  1L7Z A;  2LAP A;  2AWL A;  3OX5 A;  1P28 A;  2KHN A;  2FZU A;  2PAS A;  2I94 A;  1CLB A;  4B30 A;  4LJD A;  1IGV A;  1RTP 1;  5DPJ A;  1KCY A;  1Y1A A;  3CR5 X;  1RFJ A;  4DCK A;  4EUL A;  2A4J A;  1TN4 A;  4W6U A;  4LJB A;  4ZIN A;  1XYD A;  3AAJ A;  2M7L A;  1RMM A;  2MA2 A;  1JFJ A;  2Q57 A;  1LS8 A;  5ER5 A;  3WLC A;  4PE7 A;  4Q7T A;  5EJU A;  2G5Z B;  1WY9 A;  5J2O A;  2KPH A;  3GEX A;  3D75 A;  2VZX A;  1KWO B;  3SJS A;  3LA1 A;  4Q9X A;  3W1C A;  3PSR A;  1G8I A;  3R1P A;  1N2D A;  3LVA A;  3DVE A;  2K60 A;  3B6X A;  1EMA A;  5KTY A;  3KCS A;  1B7T Z;  3EKH A;  2I2R E;  2JRF A;  4IK8 A;  4DXQ A;  4LJC A;  2FWQ A;  5DQM A;  2BBN A;  4DRW A;  1WLM A;  3CFF A;  2H5O A;  1QJT A;  3ICB A;  1MWN A;  4DIR A;  1JBA A;  1X02 A;  4BY5 A;  5D7F A;  3LF4 B;  1PVA A;  3BYA A;  2HPS A;  4JQ0 D;  4M2P A;  4Z4M A;  3FE8 A;  4YI9 A;  4EN1 A;  1J1E A;  1TNX A;  5HLO A;  2QLI A;  1EMK A;  4YBH B;  1YX8 A;  4ICB A;  3RM1 A;  1QYQ A;  3SVN A;  4P1Q A;  4IK5 A;  1ODB A;  4OHS A;  1SL8 A;  3U0N A;  4LQT A;  2JWW A;  2I7A A;  4KW9 A;  4W72 A;  5T3I A;  1PSR A;  3IR8 A;  1CFF A;  2F3Y A;  1CFD A;  5GQQ C;  2C9J A;  3BUO B;  3Q8I A;  1KK8 B;  4DXM A;  1J1D A;  2A50 B;  1YJ2 A;  3SSH A;  1KFU L;  1TCO B;  2MBX A;  2WND A;  2V53 A;  1AK8 A;  2DD9 A;  2YE1 A;  2GV5 A;  5AFP A;  2LVJ A;  2Z6Y A;  2EC6 C;  4BY4 A;  2EGD A;  3U8A A;  4XJK B;  3D0Y B;  4HSZ A;  1G33 A;  1MXE A;  2ZMW A;  5JOL A;  3PM2 A;  3OB2 B;  2ZNE A;  1MXL C;  2ZMU A;  2HGD A;  2EHB A;  1QLK A;  4R6B A;  3PAL A;  5BT0 A;  1QWV A;  2LMV A;  3DPW A;  2OKY A;  2Z1O A;  2WCE A;  3OB1 B;  4ZB1 A;  1SBJ A;  1YRT B;  2Z6X A;  2ZN9 A;  4R1E A;  3LF3 A;  2OTB A;  2L2C A;  4HQC A;  2G6Y A;  1WLZ A;  2ZO7 A;  3BOW B;  4OKH A;  5KTG A;  4H3N A;  1QAT A;  3SSK A;  4PFE A;  2MLF C;  3CD1 A;  3DQI A;  2MRD A;  2K7O A;  1JWD A;  3I19 A;  4U2V A;  3O78 A;  1TNW A;  2JTT A;  3NSL A;  2WCH A;  3TZ1 A;  3UFZ A;  1IQ3 A;  4RYW A;  1OW4 A;  5DPH A;  5FYX A;  2A48 A;  1SKT A;  3SVU A;  2EMD A;  2P70 A;  1B8C A;  2M8U A;  4ANJ A;  3ZUJ A;  3CDN A;  4OVN F;  2YGU A;  4W7D A;  2EMO A;  4MVF A;  1SYM A;  5EBJ A;  1LXF C;  1L2O C;  2ZRS A;  1A2X A;  2WHS A;  1CFP A;  1BT6 A;  2M0R A;  3NXA A;  4MRY A;  3SVB A;  1JBZ A;  1YTZ C;  2A54 B;  3M0W A;  1MHO A;  4MRX A;  2HQZ A;  2LP3 A;  3DQ4 A;  4NQG A;  4F0Z B;  2LVV A;  1T14 A;  2KGR A;  1UUR A;  4BDU A;  1SSE B;  1SL9 A;  2KSP A;  3FWB A;  5DU0 A;  2LV7 A;  2V4E A;  2HF5 A;  4D1E A;  4GGN A;  1XA5 A;  1IH0 A;  1XA9 A;  1MUX A;  3VRP A;  3EVU A;  1YJF A;  4KA9 A;  5H89 A;  4AOM A;  3ADF A;  4W6D A;  4NDD A;  3ST2 A;  1Q4D A;  2Q4U A;  2DOQ A;  3F45 A;  1SR6 C;  1F8H A;  2LE9 B;  1NX0 A;  5H88 A;  3S0D A;  1TOP A;  1NUB A;  3SS0 A;  1JF0 A;  3QME A;  1W7J B;  1EML A;  1MYW A;  1OXE A;  2OJK A;  1TIZ A;  2OTG C;  4HQ8 A;  1LVC D;  4XOV A;  1KFX S;  2JT8 A;  2CNP A;  1KFU S;  1AUI B;  1DJI A;  3DQO A;  1K2H A;  3O77 A;  5D3O A;  1W7U A;  2JT3 A;  1Z1P A;  2M97 A;  1IQ5 A;  5DTL A;  4JGE A;  3DVK A;  1WDC C;  1YHI A;  1Z4H A;  2DUE A;  3SVC A;  1PSB A;  2IS9 A;  4I2Y A;  1PRW A;  4WRI A;  5HLV A;  1YVH A;  2LUX A;  4WQ2 A;  1BOD A;  4Q9W A;  4Q04 A;  4DXP A;  3DYE A;  4MZJ A;  1F71 A;  2EC6 B;  3S0E A;  1XFV O;  4ORN A;  1S5G Y;  1FW4 A;  2MAZ A;  3EKJ A;  2KAV A;  3O4X A;  1DJW A;  4KAG A;  4ORB B;  3P28 A;  4EMQ A;  1W7S A;  1J7O A;  4L13 A;  3D73 A;  3K1K A;  3TMT A;  4NDB A;  3S05 A;  3SG4 A;  2G6X A;  5EB7 A;  1CDL A;  1SMG A;  2QT2 A;  3TUY C;  1W7I B;  2JPO A;  3D78 A;  1C7V A;  1Q4A A;  4PHM A;  1SRA A;  1LKJ A;  3OSR A;  1EH2 A;  4INX A;  4OV2 A;  3DF0 B;  4P2Y B;  1A03 A;  2PAL A;  3PM8 A;  4W7X A;  2JQ6 A;  2YDZ A;  3BUN B;  2HQ8 A;  5AER A;  5G08 A;  1ZMZ A;  1DF0 A;  1DJY A;  1M63 B;  3PIB A;  1QX2 A;  4YGB B;  4GGF A;  3UNW A;  4W7R A;  3I5H C;  2BEC A;  3GJ1 A;  3V3D A;  1PAL A;  2KYF A;  2JU0 A;  2RH7 A;  2C9I A;  1OOF A;  1EMB A;  5DKN A;  2PSR A;  1QLS A;  5B8I B;  2MHH A;  1L2O B;  2WSO A;  2F33 A;  2GW4 B;  2LLU A;  4W6M A;  1S26 D;  3UG0 A;  4JFG A;  5HW9 A;  2GGM A;  2DD7 A;  1K95 A;  3SV5 A;  1C07 A;  5KSZ A;  3KF9 A;  3TS5 C;  2QU1 A;  5HBD A; 
#chains in the Genus database with same CATH homology
 4W7E A;  1OSA A;  2FCD A;  1JSA A;  4IK3 A;  2JOJ A;  4IK9 A;  4PPJ A;  3TDU A;  3AKA A;  1XMZ A;  2M1K B;  2VAD A;  4ORA B;  2L4H A;  1S6C A;  1IJ5 A;  2WSN A;  1Y0V H;  1OMR A;  1XK4 A;  3OGO A;  1GL4 A;  4Z4K A;  1BR4 B;  4W6F A;  2JZI A;  3A8R A;  1IJ6 A;  4A4C A;  1F0B A;  1NCZ A;  1GGX A;  4W6H A;  2LVI A;  4L12 A;  5CSN A;  1SR6 B;  1SCM B;  3EK7 A;  2QZ0 A;  3PLF B;  1NIW A;  2ZO6 A;  1H4B A;  3FWC A;  3GK4 X;  2BTJ A;  2ZND A;  4W6L A;  2M7N A;  3SST A;  1MR8 A;  4ZF4 A;  3MGF A;  4QJ4 B;  1RWY A;  2G9B A;  3I5F C;  3ZWH A;  3CLN A;  2LMU A;  3E5V A;  1JC2 A;  2KI6 C;  2OTG B;  3GOF A;  4KF5 C;  1QYO A;  1PUL A;  2ARL A;  4TNC A;  5FVI A;  4R6D A;  3DQ5 A;  1NPQ A;  2I18 A;  2HET A;  3TMR A;  1ZGO A;  4W6O A;  3PJB A;  1KYP A;  1F54 A;  4PE4 A;  2ICR A;  1K96 A;  1V1G A;  4CPV A;  1GJY A;  1K9U A;  4U8D A;  3HCM A;  1WDC B;  3WHU B;  1NYA A;  3EK4 A;  4ZF5 A;  4KW8 A;  3WLD A;  2Q6P A;  1CDM A;  1QVI Y;  5JJG A;  2L98 A;  2JNF A;  1BF5 A;  2KAX A;  4YGD B;  2PXW A;  5FHV A;  4MZK A;  2IB6 A;  2JAD A;  2HPW A;  3NT3 A;  2AH8 A;  1BU3 A;  4PPL A;  4PAL A;  1B4C A;  2OKW A;  5KU1 A;  1QYF A;  3EVV A;  2B3Q A;  1RJV A;  2P6B B;  4W75 A;  3TUY B;  2E6W A;  3GB3 A;  4OR9 B;  4N3D A;  5BTT A;  1OXF A;  1YUT A;  2H61 C;  1NX3 A;  3LK0 A;  2A46 A;  1DJG A;  1EG4 A;  2PMY A;  2ZKM X;  3DQM A;  2R2I A;  4MSP A;  2DUH A;  5HKW A;  3BXB A;  4W6J A;  1DTL A;  5LK4 A;  4ZBL A;  4AQI A;  1DT7 B;  1CKK A;  2O29 A;  2AUC A;  2OGR A;  2HFC A;  4H48 A;  2FJU B;  2K61 A;  3NED A;  3KCT A;  2K7B A;  3I5H B;  4ZIO A;  1F4O A;  2G16 B;  1LA3 A;  3GL4 A;  1N65 A;  5DQB A;  1EL4 A;  5DPG A;  3CS1 A;  4H3L A;  4W7F A;  4PDZ A;  4HRH A;  1QS7 A;  1DJZ A;  4J89 A;  3SSY A;  3SIB A;  2L0P A;  1F70 A;  1GGZ A;  3TS5 B;  1UHI A;  5HZT A;  3VHT B;  3EVP A;  1QXP A;  1OE9 B;  1G4Y R;  3CD9 A;  3EK8 A;  4W6K A;  1SPY A;  5F9G A;  4I5N B;  1KFX L;  1H6R A;  4DXO A;  4Q7R A;  4JRB A;  2AAO A;  3SIA A;  1A29 A;  1RMP A;  3VK1 A;  2Q91 A;  4W6P A;  2LMT A;  1M45 A;  5ER4 X;  1C4F A;  2JC2 A;  1J7Q A;  2FL1 A;  2K8M B;  3VRO A;  4QJ3 B;  3W1D A;  5EXC I;  4JPZ B;  4AQJ A;  4DXN A;  2LM5 A;  4I5K A;  3SG5 A;  2SAS A;  2BCA A;  3A8S A;  4MZL A;  1UP5 A;  1YUS A;  1Q80 A;  1XFZ O;  2JPT A;  1YHG A;  4J8A A;  1YX7 A;  3LL8 B;  1KSM A;  1MOU A;  4W74 A;  4YGA A;  4OQW A;  3SG3 A;  2KGB C;  4MEW A;  3I5F B;  3I5I C;  1VRK A;  2Y4Q A;  2BE6 A;  3CFA A;  1NCY A;  1TCF A;  1WRZ A;  1CB1 A;  2BE4 A;  3GJ2 A;  4W6T A;  3D0Y A;  1M46 A;  1DGU A;  2DUG A;  1K9K A;  4DKM A;  2A56 B;  2SCP A;  4XYN A;  4I5J A;  1CDN A;  3KEV A;  3DQK A;  3WCK A;  5EXU A;  2CCM A;  1RK9 A;  4W69 A;  4HRG A;  2H8Q A;  2O2B A;  3DQJ A;  1CLM A;  3BOW A;  4KW4 A;  3H1R A;  4DS7 A;  4N1G A;  4RYS A;  2Z6Z A;  1Q4B A;  4ZFS A;  2AHA A;  4PE1 A;  2D8N A;  3KO0 A;  5TNC A;  1MOV A;  1ZUX A;  1V1F A;  1REC A;  1KQM C;  4NDC A;  2H5P A;  4KF5 A;  1B9C A;  4AR7 A;  1CFC A;  4NWS A;  1QXT A;  4C0K A;  4MLW A;  3SG7 A;  3LCP C;  2P4M A;  4M2Q A;  3DQU A;  1EMC A;  1HQV A;  1UUS A;  2BL0 C;  3HX4 A;  1SCM C;  1F09 A;  2ZN8 A;  1IKU A;  4W6C A;  1XVJ A;  4LQU A;  3NEZ A;  1RMO A;  4JEO A;  1FI6 A;  4LJD C;  2HQK A;  1QIW A;  2WOR A;  3CR4 X;  1KYS A;  3EVR A;  1OZO A;  5CSJ A;  1TTX A;  2LCP A;  1B8R A;  2KYC A;  3JTD C;  4W6B A;  2POX A;  1NSH A;  1JFK A;  1A75 B;  3DVJ A;  2WUR A;  3DQL A;  1BFP A;  3JVT C;  3DQA A;  2KI6 D;  5DRG A;  4JWQ A;  4HRE E;  3DQ6 A;  3H1O A;  2PXS A;  2KFG A;  3DQ9 A;  2JUL A;  4GES B;  2L50 A;  5IBW A;  1SNL A;  3GK2 A;  2CT9 A;  4PHJ A;  2MJW B;  3SSP A;  2VVI A;  2QAC A;  1KP5 A;  1S36 A;  2LLS A;  2YE0 A;  3LVD A;  4GAO A;  3RLZ A;  3CB9 A;  1GGW A;  2PVB A;  1Y1X A;  1YHH A;  3DQD A;  4KGF A;  1NCX A;  1QV0 A;  4M2O A;  2GW3 A;  3VRR A;  4W73 A;  1M31 A;  1IWQ A;  5BQL A;  5AEQ A;  2KQY A;  1SL7 A;  3I5I B;  5EB6 A;  1AP4 A;  5D69 A;  3DPX A;  1YUR A;  3QRX A;  1XFU O;  3E3R A;  1XFX O;  1R6P A;  2VAE A;  3NF0 A;  1YRU B;  1S1E A;  2NXQ A;  2B3P A;  1J7P A;  1OOJ A;  1HT9 A;  2MLE C;  3LVC A;  2QLG B;  2O60 A;  3DF0 A;  5EXB A;  3E5T A;  2HGY A;  2L4I A;  4KEX A;  1HCJ A;  1UHK A;  2K2A A;  2NCO A;  2JXL A;  1WRK A;  3OP0 A;  1KQM B;  5I2L A;  2KQ6 A;  3PN7 C;  3AI4 A;  1Q4C A;  1QV1 A;  4W6A A;  1S6Z A;  1B47 A;  2KBI A;  2JNX A;  1LIN A;  5DKQ A;  1U5I B;  1BG1 A;  2QRF A;  3NT9 A;  4OJ0 A;  3OX6 A;  2BL0 B;  1XFW O;  1CM4 A;  3BUX B;  2L2E A;  1JC1 A;  4HVF A;  1CDP A;  4CFR A;  1Z1Q A;  4KF4 A;  4B30 B;  1Q73 A;  3O4Y A;  2EMN A;  2DDC A;  2CXJ A;  2K7D A;  3BUM B;  1XAE A;  1PK0 D;  3JTD B;  1ZFS A;  4XVP A;  3SG2 A;  1SY9 A;  2LC5 A;  5LTR A;  3SVR A;  1EG3 A;  1QTX A;  1CMF A;  2G6E A;  1H8B A;  1QX7 A;  3O6B A;  3JVT B;  4HQ9 A;  4UTS A;  3GK1 A;  1BLQ A;  4YI8 A;  3TDI A;  4YRU A;  3NSI A;  1NX1 A;  1ZUZ A;  5J3X A;  4CID A;  1DJH A;  2DDD A;  4GPL B;  2K2F A;  2DUI A;  2Y0G A;  1OXD A;  5HYD A;  4N1F A;  2L51 A;  1QAS A;  1MF8 B;  4W6N A;  4UPG A;  5LTP A;  1YZW A;  1Y1U A;  5DTY A;  3ZNI A;  5HZS A;  4B5Y A;  1EJ3 A;  2WOS A;  2L5X B;  4YGE B;  4DXI A;  3M22 A;  4W6S A;  2H6V A;  2Y1N A;  4FQO A;  4WQ3 A;  3U8C A;  4IK1 A;  1RRO A;  3IQQ A;  3IF7 A;  4AS8 A;  4GUK A;  2KDH A;  2KNE A;  3AKO A;  3CGL A;  3CBE A;  4DUQ A;  1H4U A;  1K93 D;  1JBY A;  1UIS A;  4PE0 A;  4PPK A;  3H4S E;  2WHT A;  3PJ7 A;  5HGE A;  2CBL A;  1FPW A;  2BCX A;  1BR1 B;  3SVE A;  3A4U B;  1XQM A;  3WNX B;  5DTZ A;  1EMM A;  3E5W A;  3VRQ A;  3DQE A;  3BXC A;  2GX2 A;  1EXR A;  1CNP A;  1AJ5 A;  3I5G C;  1UHN A;  1B9A A;  3FS7 A;  4IL1 A;  1XO5 A;  1AVS A;  2HRS A;  3RWT A;  3OSQ A;  2H2K A;  2KI4 C;  4GF6 B;  3CGA A;  1F4Q A;  1KQV A;  2OS8 C;  4A4B A;  4ZCV A;  3RWA A;  1UWO A;  5CPV A;  2NCP A;  1S6J A;  1UHJ A;  1AHR A;  2WC8 A;  1HUY A;  1KK7 Y;  4C0L A;  3PN7 B;  1QX5 B;  1DMO A;  5K89 A;  5EHU A;  2KOT A;  4GGF C;  4I5L B;  2F2P A;  2H9W A;  3CTN A;  2JXC A;  4OCI A;  1YR5 A;  3G9A A;  3DQ1 A;  5DPI A;  2LVK A;  1W7T A;  2WIS A;  4GFT A;  5PAL A;  5AXI A;  3VHT A;  1PVB A;  2AWM A;  1ALW A;  4ETO A;  2G3O A;  2A53 B;  3SVD A;  1EMF A;  2BBM A;  2RGI A;  4W76 A;  1TNQ A;  5HZU A;  2ISD A;  4KGE A;  2YFP A;  2KAY A;  4GOB A;  2TN4 A;  1EME A;  2FOT A;  4XJK A;  3M24 A;  3DPZ A;  4W7C A;  3LS3 A;  3AKB A;  2KFH A;  2QLE A;  3VGO A;  5DY6 A;  1BJF A;  1XK4 C;  1NX2 A;  5I2O A;  2V4E B;  1B7T Y;  3PFV A;  5FVG A;  5FVF A;  2OPO A;  3SRY A;  3DQ8 A;  4H3M A;  5DKR A;  1E8A A;  1S5G Z;  1CMG A;  2ZRT A;  2F8P A;  4TZG A;  1RM9 A;  1FBV A;  1ZGP A;  2JTZ A;  5I2Q A;  1AJ4 A;  1CV7 A;  1SCV A;  4ORC B;  2WIQ A;  2WCB A;  2O24 A;  4PHK A;  2JT0 A;  5LTQ A;  2DUF A;  4CFQ A;  1B1G A;  2KFF A;  4CLN A;  3DQ2 A;  1Y6W A;  2HQW A;  2H5R A;  2NLN A;  1D1O A;  2PRU A;  1XSS A;  5HKY A;  2F3Z A;  1SK6 D;  1A4P A;  1MQ1 A;  1F55 A;  3K21 A;  3WHT B;  3BUW B;  2G3D B;  3DQ3 A;  1KYR A;  4EDO A;  3PAT A;  3U0M A;  2LP2 A;  4XGY A;  1Q4E A;  4E68 A;  3DQ7 A;  3U0K A;  3NSK A;  1ALV A;  3WXA A;  4P76 A;  3BX9 A;  1K8U A;  4EDS A;  1JF2 A;  1QY3 A;  3I5G B;  4HE4 A;  1C7W A;  4IZN A;  4W6G A;  4ZCU A;  4Q7U A;  3SG6 A;  1N0Y A;  2LAN A;  4P5O E;  5I8N A;  3IQO A;  2H61 A;  2KI4 B;  1YFP A;  5H87 A;  2IE2 A;  2OS8 B;  2M29 A;  3ZUL A;  2G2S B;  3DQC A;  5F6T A;  5HZO A;  2O5G A;  1ZOT B;  1FI5 A;  3SVO A;  1OZS A;  1GFL A;  2QLH A;  1DGV A;  1IRJ A;  2AWK A;  3TDZ A;  1XFY O;  1DF0 B;  4GNK B;  1JC0 A;  2NZ0 A;  3IP2 A;  4PCW A;  2AWJ A;  4JF9 A;  4N5X A;  1J7R A;  2M3W A;  2LNK A;  4L9M A;  4ZF3 A;  2VRG A;  5CSI A;  2LHI A;  4OY4 A;  4MN0 A;  2M1U A;  1A75 A;  2IB5 A;  1KSO A;  1K90 D;  5CSF A;  4FTG A;  1S3P A;  3KHE A;  3C1V A;  3FIA A;  1K9P A;  2HJO A;  1KWO C;  3BXK A;  4W7A A;  4TZA A;  2VVJ A;  2LUC A;  1YUU A;  3D10 A;  3O2P A;  3VIC A;  4W6I A;  1CM1 A;  3ZTF A;  2BKI B;  5AQB B;  2BCB A;  1G7K A;  4L1I A;  3ZUF A;  1WRL A;  4W77 A;  1M39 A;  1K94 A;  2M9G A;  1IG5 A;  4KPI A;  4OGS A;  4J88 A;  4IK4 A;  1QVI Z;  4QJ5 B;  1B8L A;  2K7C A;  2M49 B;  1DJX A;  1QIV A;  1FF1 A;  2F2O A;  4RTC A;  1GQM A;  2K0J A;  2Y1M A;  3ST4 A;  2FCE A;  2COL B;  5DRF A;  4W6R A;  1YVL A;  3VRN A;  2CTN A;  4PHN A;  1TNP A;  2HCG A;  3U8P A;  5BPJ A;  3ED8 A;  3CFH A;  4MBE A;  3LSA A;  3CWG A;  3BXA A;  4XL5 A;  4LW5 A;  1OQP A;  2G2B A;  1TRF A;  1R2U A;  2LLT A;  2VVH A;  3DQN A;  1RRX A;  2WHU A;  1UHH A;  1KK8 C;  3SSV A;  1NWD A;  3SSL A;  2ZFD A;  4DKN A;  2GX0 A;  1SW8 A;  4JC2 A;  4GBA A;  4H47 A;  2GGZ A;  3P8U A;  5DTX A;  3LK1 A;  3CR2 A;  2E30 A;  2Y5I A;  3MSE B;  2IOV A;  2QLG A;  1CLL A;  2KBM A;  1OMV A;  2A47 A;  2AMI A;  3NSO A;  4XOW A;  2A52 B;  3PJ5 A;  3DVM A;  5HKZ A;  2OTE A;  1ZAC A;  3OHM B;  3ST0 A;  3SVS A;  1OMD A;  1ZGQ A;  3DD4 A;  3U0L A;  4USL A;  1BMO A;  1EMG A;  2BKH B;  2WCF A;  3LLE A;  2H5Q A;  2B1U A;  3KPX A;  1LA0 A;  1J55 A;  2LHL A;  3CZT X;  4YGC B;  3AI5 A;  3BQ3 A;  1CTR A;  2V4E C;  2QPT A;  1KK7 Z;  5AAN A;  1BOC A;  4C0J A;  5BTT B;  3ST3 A;  1U5I A;  3AAK A;  1DVI A;  3DQF A;  1S6I A;  1JUO A;  1NP8 A;  3DQH A;  1L7Z A;  2LAP A;  2AWL A;  3OX5 A;  2KHN A;  2FZU A;  2PAS A;  2I94 A;  1CLB A;  4B30 A;  4LJD A;  1IGV A;  1RTP 1;  5DPJ A;  1KCY A;  1Y1A A;  3CR5 X;  1RFJ A;  4DCK A;  4EUL A;  2A4J A;  1TN4 A;  4W6U A;  4LJB A;  4ZIN A;  1XYD A;  3AAJ A;  2M7L A;  1RMM A;  2MA2 A;  1JFJ A;  2Q57 A;  5ER5 A;  3WLC A;  4PE7 A;  4Q7T A;  5EJU A;  2G5Z B;  1WY9 A;  5J2O A;  3GEX A;  2VZX A;  1KWO B;  3SJS A;  3LA1 A;  4Q9X A;  3W1C A;  3PSR A;  1G8I A;  1N2D A;  3LVA A;  3DVE A;  1EMA A;  5KTY A;  3KCS A;  1B7T Z;  3EKH A;  2I2R E;  2JRF A;  4IK8 A;  4DXQ A;  4LJC A;  2FWQ A;  5DQM A;  2BBN A;  4DRW A;  1WLM A;  3CFF A;  2H5O A;  1QJT A;  3ICB A;  1MWN A;  4DIR A;  1JBA A;  1X02 A;  4BY5 A;  5D7F A;  3LF4 B;  1PVA A;  3BYA A;  2HPS A;  4JQ0 D;  4M2P A;  4Z4M A;  4YI9 A;  4EN1 A;  1J1E A;  1TNX A;  5HLO A;  2QLI A;  1EMK A;  4YBH B;  1YX8 A;  4ICB A;  3RM1 A;  1QYQ A;  3SVN A;  4P1Q A;  4IK5 A;  1ODB A;  4OHS A;  1SL8 A;  3U0N A;  4LQT A;  2JWW A;  2I7A A;  4KW9 A;  4W72 A;  5T3I A;  1PSR A;  3IR8 A;  1CFF A;  2F3Y A;  1CFD A;  5GQQ C;  2C9J A;  3BUO B;  4DXM A;  1KK8 B;  1J1D A;  2A50 B;  1YJ2 A;  3SSH A;  1KFU L;  1TCO B;  2MBX A;  2WND A;  2V53 A;  1AK8 A;  2DD9 A;  2YE1 A;  2GV5 A;  5AFP A;  2LVJ A;  2Z6Y A;  2EC6 C;  4BY4 A;  2EGD A;  3U8A A;  4XJK B;  3D0Y B;  4HSZ A;  1G33 A;  1MXE A;  2ZMW A;  5JOL A;  3OB2 B;  2ZNE A;  1MXL C;  2ZMU A;  2HGD A;  2EHB A;  1QLK A;  4R6B A;  3PAL A;  5BT0 A;  2LMV A;  3DPW A;  2OKY A;  2Z1O A;  2WCE A;  3OB1 B;  4ZB1 A;  1SBJ A;  1YRT B;  2Z6X A;  2ZN9 A;  4R1E A;  3LF3 A;  2OTB A;  4HQC A;  2G6Y A;  1WLZ A;  2ZO7 A;  3BOW B;  4OKH A;  5KTG A;  4H3N A;  1QAT A;  3SSK A;  4PFE A;  2MLF C;  3CD1 A;  3DQI A;  2MRD A;  2K7O A;  1JWD A;  3I19 A;  4U2V A;  3O78 A;  1TNW A;  2JTT A;  3NSL A;  3TZ1 A;  3UFZ A;  1IQ3 A;  4RYW A;  5DPH A;  5FYX A;  2A48 A;  1SKT A;  3SVU A;  2EMD A;  1B8C A;  2M8U A;  4ANJ A;  3ZUJ A;  4OVN F;  4W7D A;  2EMO A;  4MVF A;  1SYM A;  5EBJ A;  1LXF C;  1L2O C;  2ZRS A;  1A2X A;  2WHS A;  1CFP A;  1BT6 A;  2M0R A;  3NXA A;  4MRY A;  3SVB A;  1JBZ A;  1YTZ C;  2A54 B;  3M0W A;  1MHO A;  4MRX A;  2HQZ A;  2LP3 A;  3DQ4 A;  4NQG A;  4F0Z B;  2LVV A;  2KGR A;  1UUR A;  4BDU A;  1SL9 A;  2KSP A;  3FWB A;  5DU0 A;  2LV7 A;  2V4E A;  2HF5 A;  4D1E A;  4GGN A;  1XA5 A;  1MUX A;  1XA9 A;  3VRP A;  1IH0 A;  3EVU A;  1YJF A;  4KA9 A;  5H89 A;  4AOM A;  3ADF A;  4W6D A;  4NDD A;  3ST2 A;  1Q4D A;  2Q4U A;  2DOQ A;  3F45 A;  1SR6 C;  1F8H A;  2LE9 B;  1NX0 A;  5H88 A;  1TOP A;  1NUB A;  3SS0 A;  1JF0 A;  1W7J B;  1EML A;  1MYW A;  1OXE A;  2OJK A;  1TIZ A;  2OTG C;  4HQ8 A;  1LVC D;  4XOV A;  1KFX S;  2JT8 A;  2CNP A;  1KFU S;  1AUI B;  1DJI A;  3DQO A;  1K2H A;  3O77 A;  1W7U A;  2JT3 A;  1Z1P A;  2M97 A;  1IQ5 A;  5DTL A;  4JGE A;  3DVK A;  1WDC C;  1YHI A;  2DUE A;  3SVC A;  1PSB A;  2IS9 A;  4I2Y A;  1PRW A;  4WRI A;  5HLV A;  1YVH A;  2LUX A;  4WQ2 A;  1BOD A;  4Q9W A;  4Q04 A;  4DXP A;  4MZJ A;  1F71 A;  2EC6 B;  1XFV O;  4ORN A;  1S5G Y;  1FW4 A;  2MAZ A;  3EKJ A;  2KAV A;  4KAG A;  1DJW A;  4ORB B;  3P28 A;  4EMQ A;  1W7S A;  1J7O A;  4L13 A;  3K1K A;  3TMT A;  4NDB A;  3S05 A;  3SG4 A;  2G6X A;  5EB7 A;  1CDL A;  1SMG A;  2QT2 A;  3TUY C;  1W7I B;  1C7V A;  1Q4A A;  4PHM A;  1SRA A;  1LKJ A;  3OSR A;  1EH2 A;  4OV2 A;  3DF0 B;  4P2Y B;  1A03 A;  2PAL A;  3PM8 A;  4W7X A;  2JQ6 A;  2YDZ A;  3BUN B;  2HQ8 A;  5AER A;  5G08 A;  1ZMZ A;  1DF0 A;  1DJY A;  1M63 B;  3PIB A;  1QX2 A;  4YGB B;  4GGF A;  4W7R A;  3I5H C;  2BEC A;  3GJ1 A;  3V3D A;  1PAL A;  2KYF A;  2JU0 A;  2RH7 A;  2C9I A;  1EMB A;  5DKN A;  2PSR A;  1QLS A;  5B8I B;  2MHH A;  1L2O B;  2WSO A;  2F33 A;  2GW4 B;  2LLU A;  4W6M A;  1S26 D;  3UG0 A;  4JFG A;  5HW9 A;  2GGM A;  2DD7 A;  1K95 A;  3SV5 A;  1C07 A;  5KSZ A;  3KF9 A;  3TS5 C;  2QU1 A;  5HBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...