3SG7A

Crystal structure of gcamp3-kf(linker 1)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
410
structure length
398
Chain Sequence
b'DSSRRKWNKTGHAVRAIGRLSSKFNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDESKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 132
structure length 398
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg7A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg7A02
2WHTA 3VRQA 3DVMA 3GK4X 3IR8A 2WC8A 3DQJA 1JF0A 2F3YA 1KFUS 2K7BA 1J1DA 1S5GY 4IL1A 3PSRA 3E5VA 4MBEA 3SSLA 1YVHA 3EKJA 4YBHB 2A54B 1CDNA 2AH8A 3M0WA 4N1FA 4ZCUA 1BODA 3CFAA 3ZTFA 4MRYA 1L2OB 2PASA 5DQMA 1F4OA 1CDMA 3VROA 1WLZA 3BX9A 2EC6B 1H8BA 1RJVA 4ICBA 2CNPA 3VICA 4PALA 2Q6PA 3ST0A 1RTP1 4FQOA 5FVGA 2ZO6A 4M2OA 3SVDA 1N65A 1MF8B 3UG0A 2M49B 2ZKMX 3SS0A 4W6SA 5ER4X 4ORNA 3D10A 4E68A 3RWTA 4P5OE 3V3DA 3OX5A 1ALVA 4M2QA 4DRWA 1RMPA 1F55A 3AAKA 3CB9A 3ZULA 1EMGA 2GW4B 4ETOA 3M22A 2GGZA 2L50A 2B1UA 3EK7A 1M45A 1KWOC 2LVKA 3BXCA 2AAOA 2CCMA 1F71A 2BL0B 1BT6A 3DPWA 2OTBA 1A75A 5DPJA 2JADA 1BMOA 3WHUB 2YE0A 5HZTA 3I5IB 1GL4A 4N3DA 2L51A 4PHMA 4JFGA 3U0MA 5FHVA 2G6XA 1Y6WA 1CMFA 1NCYA 2L2EA 3AI5A 3BUWB 4JQ0D 4NWSA 1YX8A 1ODBA 2AMIA 2F8PA 2KHNA 1J7OA 3SVBA 3U0LA 1E8AA 1W7SA 2D8NA 4PHNA 1EMKA 1EG3A 1WRLA 1NPQA 5DPHA 4JPZB 4W6HA 3CZTX 1TIZA 4MZKA 2KAXA 4N5XA 2BECA 2PSRA 4W6FA 1QTXA 2F2OA 1SNLA 3AAJA 1MXEA 4PFEA 4XOVA 1IGVA 1MR8A 3NSIA 2DUIA 1YX7A 1Q73A 1N0YA 1NX3A 3CR5X 1GGXA 1SYMA 1CFCA 3BUXB 1W7JB 1K96A 3GK1A 1IRJA 2K0JA 2IS9A 1CM1A 4KF4A 3CFHA 5KU1A 3P28A 1K2HA 2WNDA 2SASA 2RH7A 3MGFA 2KAVA 3LF3A 3ED8A 2ICRA 1NX2A 2BBMA 2TN4A 5BTTB 1L7ZA 2LE9B 1OSAA 2ZO7A 4UPGA 3ZUJA 5HBDA 3NXAA 3I5GB 1LA3A 1SBJA 2M7LA 2KOTA 2FL1A 5CSIA 2COLB 1DGUA 4JGEA 4NDCA 4GESB 3WNXB 1K94A 2VAEA 2AWKA 4BDUA 4CPVA 2KI6D 3C1VA 4KA9A 4ZFSA 3EVVA 2ISDA 5LTQA 4BY4A 4W73A 1CB1A 5EJUA 2M0RA 5CSFA 1EL4A 1YZWA 3RLZA 4W6CA 3WHTB 3OX6A 5I2LA 2H9WA 2KGBC 1MQ1A 3U0KA 2H61C 1QJTA 3CR2A 2ZMWA 1B1GA 3PFVA 4PCWA 3OSQA 2OJKA 4L1IA 2VVIA 2BE4A 1BF5A 2AHAA 4KAGA 4HE4A 1IQ3A 2LP3A 1KQVA 3I5HC 1NYAA 3NSOA 2OS8B 1UP5A 2M3WA 5HLVA 2QU1A 4PHJA 1EMFA 4BY5A 1KK8B 1KQMC 3AKOA 2KQ6A 2A50B 2E6WA 1YURA 1PVBA 1DJYA 1NX1A 2VADA 4JF9A 2H5OA 2MLFC 1Y0VH 3G9AA 4W7CA 1DMOA 2JWWA 2L0PA 1XSSA 1HQVA 3A8SA 2IOVA 2WIQA 4OVNF 3ST4A 1K93D 1B4CA 1IG5A 2L98A 4USLA 3I5FB 2A53B 3BXBA 1ZGQA 1S6CA 5LK4A 4P76A 1RMMA 2O60A 1YUUA 1SR6C 3A4UB 1QV1A 2FCDA 3DQ4A 4KW8A 2KSPA 1Z1QA 2L5XB 2AWLA 5FYXA 1XVJA 1QIVA 5CSNA 3U8AA 4LQTA 1F0BA 2ZRSA 2EMDA 1F09A 5BT0A 3OP0A 2POXA 3NEDA 4A4CA 4RYWA 2AWMA 2MAZA 2Q4UA 4KW4A 4Q7UA 4LJCA 5KTGA 2LLSA 3GB3A 1XFUO 2JXCA 3DPXA 4R1EA 3NEZA 5BTTA 4W77A 4H48A 2BCBA 4AOMA 1EMCA 4WQ2A 4GGNA 1NP8A 1H4BA 4NDDA 4RYSA 1YHGA 1FI6A 2LV7A 4ZF5A 3WLDA 5AERA 2PXWA 4Q9WA 3DVEA 1UHJA 2QRFA 2A56B 2WURA 3K21A 2F3ZA 2MBXA 2GX2A 5DKRA 1GGWA 4W76A 3TUYC 4OR9B 2PALA 5I2OA 2V4EC 1KK7Y 4DIRA 5LTPA 2CTNA 2ZRTA 2G5ZB 4GOBA 3SVEA 2MHHA 3MSEB 2WORA 3GJ1A 3EVRA 2ZN8A 2Y1MA 3DQ7A 5DU0A 1XQMA 4GF6B 1OXFA 3DF0B 3ZNIA 2F33A 4LJDA 2K7DA 5HYDA 5AANA 4GPLB 4Q7RA 2KAYA 1CNPA 1KCYA 1MOVA 3DQIA 1TNWA 2DUFA 3NT9A 1GGZA 4YGEB 4L12A 4Q7TA 4W6DA 1M31A 2M9GA 3TMTA 2BCAA 2K2AA 2JXLA 3OB1B 4Q04A 1QXTA 1CTRA 4MEWA 1K90D 3DQEA 4OHSA 5T3IA 1M46A 1QYQA 1KFXS 3D0YB 1TNPA 4B5YA 4YGDB 2KFFA 2Q91A 2WSOA 2AUCA 1CFFA 3SG2A 4M2PA 4H3MA 2DDDA 3SSKA 2BE6A 1S1EA 2ZMUA 3H1OA 5BQLA 5J3XA 4MSPA 1R6PA 2K2FA 3SIBA 4CIDA 5EB7A 3SV5A 4KF5C 4HRGA 4TZGA 4YGCB 1AP4A 2BKHB 3A8RA 3HCMA 1K8UA 3SG4A 5G08A 4J89A 3DQ2A 3BOWB 1QXPA 2H2KA 2I94A 1B9AA 3OHMB 5JJGA 4AQIA 2MLEC 4OQWA 1NX0A 5D69A 4A4BA 5DRFA 2H5PA 2FWQA 1Y1UA 3I5IC 1QYOA 4PE0A 4YGAA 3KHEA 2OGRA 1UHHA 3O2PA 2QZ0A 2PVBA 2DDCA 1YJFA 4MRXA 1AUIB 1OQPA 3ADFA 5DKQA 1J1EA 3K1KA 1AVSA 3CGAA 3EK4A 2QT2A 1JC0A 1WDCC 1TTXA 1DT7B 4PE7A 4ORCB 2NXQA 1QX5B 2K7CA 1ZGOA 1UHIA 3DVKA 1UWOA 4XGYA 3GEXA 2LLUA 1KYRA 4PHKA 2G2BA 2SCPA 1V1GA 3DF0A 2HGYA 1W7UA 5HZOA 3LLEA 1QASA 1KSOA 2PRUA 2LCPA 1CKKA 2K61A 1AJ5A 4ZIOA 2C9JA 5FVIA 2KNEA 2JC2A 4YI8A 1XFYO 1XO5A 1W7IB 1FW4A 2Y5IA 4NDBA 5DRGA 4GGFC 3DQMA 1QY3A 2LHIA 2WHSA 1XK4C 1KK7Z 2P4MA 1KWOB 4DXQA 3SSPA 4DKNA 3D0YA 2DD7A 5J2OA 4ZB1A 4I5KA 4JRBA 1TNXA 3BUMB 4W72A 1RRXA 4IK3A 3LVCA 1UISA 2QLIA 3BQ3A 2HF5A 3TZ1A 3CWGA 3DQHA 1JUOA 2M97A 2P6BB 2HJOA 3LS3A 1M39A 2MRDA 3E5TA 3LVAA 4XJKB 3SSVA 4EULA 2I2RE 4OKHA 4XYNA 2QACA 4Z4MA 1S36A 2L4HA 2QPTA 1GFLA 4W6LA 2DUGA 2LANA 1WRZA 3SIAA 4PPKA 4Z4KA 5PALA 4YRUA 3BOWA 3DQ8A 2M1KB 2E30A 4W7FA 5IBWA 1NUBA 4QJ4B 1MOUA 4PPJA 1LINA 3CGLA 4Q9XA 3GK2A 3AKBA 3ST3A 4L9MA 4IK4A 5HGEA 1S5GZ 5JOLA 1J7PA 1SCMC 5D7FA 4OY4A 2JQ6A 1ZOTB 4PDZA 5CPVA 3PALA 5F6TA 2OKYA 3DPZA 1Y1AA 3SSYA 4H3NA 1XFZO 1R2UA 3U8PA 2KI6C 2HQKA 1JFKA 4DXNA 2HQ8A 2CT9A 3DQKA 1DJHA 1RK9A 3F45A 4W6BA 4PE1A 4ZINA 1BLQA 4C0JA 2G3OA 2I7AA 4TNCA 1PK0D 3TMRA 1WLMA 4CLNA 1HUYA 2KFHA 2LVVA 1C07A 4YI9A 4RTCA 1TCFA 2JNXA 5FVFA 3SSTA 1JBYA 4PE4A 3E5WA 3WLCA 5HLOA 2M29A 3PM8A 1IWQA 4OGSA 3FIAA 2YE1A 5ER5A 3W1CA 3DQOA 1OE9B 1CDPA 4LJBA 5AQBB 4L13A 2EHBA 4CFRA 1TRFA 1MYWA 3CTNA 1B7TY 1CLLA 3VRNA 1UHKA 4R6BA 3ICBA 3LL8B 2G6YA 1BJFA 1RECA 1OMVA 3CD9A 5EBJA 2KFGA 3PJBA 4ORAB 3DQFA 2BBNA 4DXPA 2Y1NA 1EMBA 4EDSA 2NLNA 1QX2A 4HQ9A 2V53A 1RMOA 1BR1B 4HQ8A 3I5HB 2Z1OA 1WY9A 3SVSA 1K9KA 4XJKA 3DVJA 1HT9A 3DQ3A 5DTXA 2I18A 3HX4A 4GNKB 1KQMB 2JU0A 3TS5C 3KCTA 4B30B 5HKWA 3M24A 3O4YA 1OMDA 4HSZA 1Q80A 2GX0A 4OV2A 1KFXL 2GGMA 4W69A 5LTRA 3O78A 4EN1A 1UURA 2OTEA 2MA2A 1IQ5A 1SL8A 1JBZA 4W7XA 2Z6ZA 1BOCA 1JBAA 1KFUL 5DPGA 3I19A 1DJIA 4C0KA 5DKNA 4IK9A 1NSHA 3KO0A 2CXJA 2KBMA 1OZOA 2OTGC 1S6JA 3IQOA 1AHRA 2ZFDA 3CLNA 2HFCA 1SR6B 1LKJA 1CV7A 5TNCA 3JTDC 3LF4B 4XL5A 1SL9A 1QX7A 3TDIA 2JULA 3JVTC 3CFFA 4W6MA 1YUTA 1SCVA 4W6OA 1N2DA 3TDZA 1PSRA 2R2IA 1QYFA 2GW3A 3O77A 1TNQA 2K8MB 2WCFA 2IB6A 2AWJA 1RFJA 2LHLA 2K7OA 4DKMA 3PN7C 1YHHA 4ANJA 3IP2A 3NT3A 4JEOA 3IQQA 4IZNA 2F2PA 4KGFA 5BPJA 2Y4QA 4I5NB 2JNFA 5K89A 2A47A 4KPIA 5I8NA 4MZLA 1F8HA 1Q4AA 2JT3A 4FTGA 2HPSA 5HZSA 1KP5A 2OPOA 1B8CA 2G9BA 5H87A 1L2OC 5KSZA 1UUSA 1S6ZA 4ORBB 1YTZC 3KPXA 4IK1A 2EC6C 1JFJA 3CD1A 4W6AA 2JT0A 4HVFA 1KYPA 3TUYB 4TZAA 2G2SB 2V4EB 3EVUA 4IK8A 4W6PA 2H61A 4EDOA 2KI4B 1A03A 1ZGPA 4MN0A 1PVAA 1SK6D 2O2BA 2M8UA 1RM9A 5DTLA 4KEXA 4I2YA 1YUSA 3UFZA 3VHTB 1J7RA 2HCGA 3ZWHA 1XA5A 4W6IA 2L4IA 4XOWA 1FI5A 2Y0GA 2VVHA 1DJZA 2A4JA 3SG3A 4LW5A 1K9PA 1EMMA 5AEQA 1ALWA 1B8RA 3LA1A 3BXAA 3NF0A 4B30A 3SSHA 1OMRA 4OJ0A 4J88A 1B7TZ 3TDUA 1VRKA 1DJXA 2BL0C 4W6GA 3RWAA 1MXLC 2QLGB 3AKAA 1AK8A 1MUXA 4W7RA 3H4SE 1C4FA 4U2VA 1JSAA 1SL7A 1SY9A 1XFVO 2DOQA 5H89A 3FWCA 1OOJA 3VK1A 2H8QA 3SVOA 1OXEA 2WISA 4LQUA 3NSKA 2KYCA 1ZFSA 4NQGA 3DQ9A 3DQLA 4AR7A 5EXCI 3VRRA 3KEVA 4AS8A 4KW9A 2FCEA 3ZUFA 1PULA 1M63B 2LVIA 1QLKA 4GBAA 2JTTA 1F70A 2PMYA 3QRXA 3SG5A 1IJ6A 3BUOB 1EG4A 2EMOA 1UHNA 5B8IB 3OSRA 4ZF3A 2RGIA 1GQMA 1CLBA 4EMQA 1PSBA 1J55A 2G16B 1DJGA 3GJ2A 1Q4DA 4DXOA 2WSNA 3VGOA 1NCXA 1JWDA 1DF0B 1G33A 1CM4A 1EJ3A 2VZXA 1NIWA 1XFXO 2H5RA 1K9UA 1DTLA 3CR4X 2OKWA 3PLFB 1XMZA 3DQNA 2B3PA 4DXIA 2JRFA 2C9IA 2BTJA 2LM5A 2HPWA 1NCZA 4W7DA 3DQUA 5EXUA 2LUCA 3P8UA 4D1EA 2LUXA 1WDCB 3LVDA 4W6TA 2O24A 1ZACA 1ZUZA 2CBLA 4QJ5B 2QLHA 1F4QA 1G4YR 3DQ1A 2VRGA 3BXKA 2V4EA 4R6DA 1X02A 2HGDA 3U8CA 3E3RA 1SRAA 3IF7A 5DY6A 3WCKA 3KF9A 2ARLA 2LVJA 1EXRA 1CMGA 1TOPA 3VHTA 1YFPA 1KYSA 3S05A 2BKIB 1G7KA 2Q57A 4ZF4A 1EMLA 2YFPA 3I5GC 5EHUA 4DCKA 1C7WA 1EMEA 1DGVA 2LP2A 2DUHA 1CDLA 1DJWA 4HREE 3BYAA 1B8LA 2WCEA 4XVPA 5H88A 1CLMA 4P2YB 2A46A 2ZNDA 4DS7A 2WCBA 4HRHA 1G8IA 2KDHA 4WRIA 4W7AA 4JC2A 3SVNA 4YGBB 2H6VA 3NSLA 2DUEA 2QLGA 2JT8A 1H4UA 2HETA 1F54A 5DPIA 3DQ5A 4ZCVA 1J7QA 5DQBA 4LJDC 3FS7A 1Z1PA 2KBIA 2HRSA 2IE2A 3DQ6A 4C0LA 2OS8C 1DVIA 1FPWA 1QS7A 3GOFA 1IJ5A 2O29A 4F0ZB 1KK8C 3SVCA 1XYDA 5HKYA 1NWDA 2A48A 4W7EA 1BR4B 1K95A 5CSJA 1EH2A 1QVIY 4KF5A 1XA9A 2FOTA 1IKUA 1S26D 5EB6A 1YVLA 3RM1A 1QLSA 1MWNA 4W6KA 1OZSA 4P1QA 5F9GA 2M7NA 1Q4EA 1BFPA 4AQJA 3SJSA 5AXIA 3I5FC 2JTZA 1D1OA 1IH0A 2PXSA 4HQCA 1DF0A 2BCXA 1Y1XA 1SCMB 3OB2B 4DUQA 3DQDA 2KYFA 2B3QA 2WHUA 5I2QA 1U5IB 1H6RA 1YRUB 4W74A 1CFDA 1XAEA 3LSAA 4W6UA 3PIBA 2VVJA 5KTYA 2ZNEA 3SVRA 2FJUB 1LXFC 2DD9A 4UTSA 1TCOB 2LLTA 4ZBLA 3SG6A 1C7VA 4W6RA 3LK1A 2M1UA 1RWYA 2LMUA 4GFTA 3DQCA 1JF2A 2NCPA 3FWBA 3PATA 2HQZA 4W6NA 4U8DA 5AFPA 1SPYA 3EKHA 5EXBA 3ST2A 1OXDA 1A2XA 1S6IA 4DXMA 2JPTA 1W7TA 1SKTA 4H47A 1TN4A 2G6EA 4KGEA 3LK0A 3U0NA 2Z6YA 3AI4A 2QLEA 1SW8A 4GGFA 4CFQA 3EK8A 4GAOA 4MLWA 1LA0A 1QATA 4IK5A 1XK4A 1B9CA 3OGOA 1MHOA 1Q4BA 1PALA 1HCJA 3CBEA 3BUNB 2NZ0A 4W6JA 1YJ2A 3GL4A 4J8AA 5HKZA 1A4PA 1EMAA 2JOJA 1S3PA 1CFPA 1KSMA 4N1GA 2KQYA 1YRTB 2EMNA 2NCOA 1V1FA 2LAPA 2FZUA 4GUKA 3LCPC 4I5JA 5DTYA 1RROA 3DD4A 2O5GA 2Z6XA 2H5QA 3W1DA 1FBVA 1GJYA 3KCSA 2LC5A 1AJ4A 3TS5B 5HZUA 4WQ3A 1ZUXA 1LVCD 1JC1A 1QIWA 4PPLA 1YR5A 1A75B 4MZJA 4QJ3B 3SG7A 5HW9A 2EGDA 1Q4CA 1B47A 2KI4C 3PJ5A 2LNKA 2HQWA 3EVPA 2GV5A 1XFWO 1JC2A 2WOSA 3O6BA 4MVFA 2OTGB 2YDZA 3DQAA 3JTDB 1PRWA 3SRYA 3WXAA 1U5IA 3JVTB 1BU3A 3H1RA 4H3LA 1QVIZ 1YHIA 2KGRA 1ZMZA 5DTZA 5GQQC 3CS1A 1FF1A 2A52B 4OCIA 2IB5A 1BG1A 2ZN9A 1SMGA 1QV0A 4JWQA 3SVUA 2LMTA 1A29A 2MJWB 1WRKA 4I5LB 3VRPA 2G3DB 3PN7B 2JZIA 4W75A 2LMVA 3PJ7A
chains in the Genus database with same CATH superfamily
2WHTA 3VRQA 3DVMA 3GK4X 3IR8A 2WC8A 3CZ0A 3DQJA 1JF0A 2F3YA 1KFUS 2K7BA 1J1DA 1S5GY 4IL1A 3PSRA 3E5VA 4MBEA 3SSLA 1YVHA 3EKJA 4YBHB 2A54B 1CDNA 3B88A 2AH8A 3M0WA 4N1FA 4ZCUA 1BODA 3QMEA 3CFAA 3ZTFA 4MRYA 1L2OB 2PASA 5DQMA 3BJHA 1F4OA 1CDMA 3VROA 1WLZA 3BX9A 2EC6B 1H8BA 1RJVA 4ICBA 2CNPA 3VICA 1TWOA 4PALA 2Q6PA 3ST0A 1RTP1 3PJIA 4FQOA 5FVGA 2ZO6A 4M2OA 3SVDA 1N65A 1MF8B 3UG0A 2M49B 2ZKMX 3SS0A 4W6SA 5ER4X 2L5YA 3D10A 4E68A 4ORNA 3RWTA 4P5OE 3V3DA 3OX5A 1OOIX 1ALVA 4M2QA 4DRWA 1RMPA 1F55A 3AAKA 3CB9A 3ZULA 3FE8A 1EMGA 2GW4B 4ETOA 3M22A 2GGZA 2L50A 2B1UA 3L47A 3EK7A 1M45A 3S0BA 4F7FA 1KWOC 2LVKA 3BXCA 2AAOA 2CCMA 1F71A 2BL0B 1BT6A 3DPWA 2OTBA 1A75A 5DPJA 2JADA 1BMOA 3WHUB 2YE0A 5HZTA 3I5IB 1GL4A 4N3DA 2L51A 4PHMA 4JFGA 3U0MA 5FHVA 2G6XA 1Y6WA 1CMFA 1NCYA 2L2EA 3AI5A 3BUWB 4JQ0D 4NWSA 1YX8A 1ODBA 2AMIA 1QWVA 2F8PA 2FJYA 2ERBA 2KHNA 1J7OA 3SVBA 3U0LA 1E8AA 2WC5A 1W7SA 2D8NA 4PHNA 1EMKA 1EG3A 1WRLA 1NPQA 5DPHA 4JPZB 4W6HA 3CZTX 1TIZA 4MZKA 2KAXA 4N5XA 2BECA 2PSRA 4W6FA 1QTXA 2F2OA 1SSEB 1SNLA 3AAJA 1MXEA 4PFEA 4XOVA 1IGVA 1MR8A 3NSIA 2DUIA 1LS8A 1YX7A 1Q73A 1N0YA 1NX3A 3CR5X 1GGXA 5HL1A 1SYMA 1CFCA 3BUXB 1W7JB 1K96A 3GK1A 1IRJA 2K0JA 2IS9A 1CM1A 4KF4A 3CFHA 5KU1A 3P28A 1K2HA 2WNDA 3FE6A 3CABA 2SASA 2RH7A 2L2CA 3DZTA 3MGFA 2KAVA 3LF3A 3ED8A 2ICRA 1NX2A 2BBMA 2TN4A 4KYNA 5BTTB 1L7ZA 2LE9B 1OSAA 2ZO7A 4UPGA 3ZUJA 5HBDA 3NXAA 3I5GB 1LA3A 1SBJA 2M7LA 2KOTA 2FL1A 5CSIA 2COLB 1DGUA 4JGEA 4NDCA 4GESB 3WNXB 1K94A 2VAEA 2AWKA 4BDUA 4CPVA 2KI6D 3C1VA 4KA9A 4ZFSA 3EVVA 2ISDA 5LTQA 4BY4A 4W73A 3NGVA 1CB1A 5EJUA 2GTEA 2M0RA 5CSFA 1EL4A 1YZWA 3RLZA 4W6CA 3WHTB 3OX6A 5I2LA 2H9WA 2KGBC 1MQ1A 3U0KA 2H61C 1QJTA 3CR2A 2ZMWA 1B1GA 3PFVA 2BAPA 4PCWA 3OSQA 2OJKA 4L1IA 2VVIA 2BE4A 1BF5A 2AHAA 4KAGA 4HE4A 1IQ3A 2LP3A 1KQVA 3I5HC 1NYAA 3NSOA 2OS8B 1UP5A 2M3WA 5HLVA 2QU1A 4PHJA 1EMFA 4BY5A 4JD9A 1KK8B 1KQMC 3AKOA 2KQ6A 2A50B 2E6WA 1YURA 1PVBA 1DJYA 1NX1A 2VADA 4JF9A 2H5OA 2MLFC 1Y0VH 3G9AA 4W7CA 1DMOA 2JWWA 2L0PA 1XSSA 1HQVA 3A8SA 2IOVA 2WIQA 4OVNF 3ST4A 1K93D 1B4CA 1IG5A 2L98A 4USLA 3I5FB 2A53B 3BXBA 1Z2CB 1ZGQA 1S6CA 5LK4A 4P76A 1RMMA 3BFBA 2O60A 2WCJA 3Q8IA 1YUUA 1C3YA 1SR6C 3A4UB 1QV1A 2FCDA 3DQ4A 4KW8A 2KSPA 1Z1QA 2L5XB 2AWLA 5FYXA 1XVJA 1QIVA 5CSNA 3U8AA 4LQTA 1F0BA 2ZRSA 3D78A 2EMDA 1F09A 5BT0A 3OP0A 2POXA 3B7AA 3NEDA 4A4CA 4RYWA 2AWMA 2MAZA 2Q4UA 4KW4A 4Q7UA 4LJCA 5KTGA 2LLSA 3GB3A 1XFUO 2JXCA 3DPXA 4R1EA 3NEZA 5BTTA 4W77A 4H48A 2BCBA 4AOMA 1EMCA 4WQ2A 4GGNA 1NP8A 3PM2A 1T14A 1H4BA 4NDDA 4RYSA 1YHGA 1FI6A 2LV7A 4ZF5A 3B87A 3WLDA 5AERA 2PXWA 4Q9WA 3DVEA 3L4LA 1UHJA 2QRFA 3O4XA 2A56B 2WURA 3K21A 2F3ZA 2MBXA 2GX2A 3PJ7A 5DKRA 1GGWA 4W76A 3TUYC 4OR9B 2PALA 5I2OA 2V4EC 1KK7Y 4DIRA 5LTPA 2CTNA 2WCHA 2ZRTA 2G5ZB 4GOBA 3SVEA 2MHHA 1W9ZA 3MSEB 2WORA 3GJ1A 3EVRA 2ZN8A 2Y1MA 3DQ7A 5DU0A 1XQMA 4GF6B 1OXFA 3DF0B 3ZNIA 2F33A 4LJDA 2K7DA 5HYDA 5AANA 4GPLB 4Q7RA 2KAYA 1CNPA 1KCYA 1MOVA 3DQIA 2P70A 1TNWA 2DUFA 3NT9A 1GGZA 4YGEB 4L12A 4Q7TA 4OZDA 4W6DA 1M31A 2M9GA 4INWA 3TMTA 2BCAA 2K2AA 2JXLA 2KLDA 3OB1B 4Q04A 1QXTA 1CTRA 4MEWA 1K90D 3DQEA 4OHSA 5T3IA 1M46A 2QEVA 1DEKA 1QYQA 1KFXS 3D0YB 1TNPA 4B5YA 4YGDB 2KFFA 2Q91A 2WSOA 2AUCA 1CFFA 3SG2A 4M2PA 4H3MA 2DDDA 3SSKA 2BE6A 1S1EA 2ZMUA 2PQLA 3H1OA 5BQLA 5J3XA 1OOFA 3S0GA 4MSPA 1R6PA 2K2FA 3SIBA 4CIDA 5EB7A 3SV5A 4KF5C 4HRGA 4TZGA 4YGCB 1AP4A 2BKHB 3A8RA 3HCMA 3DYEA 3R1VA 1K8UA 3SG4A 5G08A 3BFHA 4J89A 3DQ2A 3BOWB 4FQTA 1QXPA 2H2KA 2I94A 1B9AA 3OHMB 3IVTA 5JJGA 4AQIA 2MLEC 4OQWA 1NX0A 5D69A 4A4BA 5DRFA 2H5PA 2FWQA 1Y1UA 3B6XA 3I5IC 1QYOA 4PE0A 4YGAA 3KHEA 2OGRA 1UHHA 3O2PA 2QZ0A 2PVBA 2DDCA 1YJFA 4MRXA 1AUIB 1OQPA 3D74A 3ADFA 5DKQA 1ORGA 2K60A 1J1EA 3K1KA 1AVSA 3CGAA 3EK4A 2QT2A 1JC0A 1WDCC 1TTXA 1DT7B 4PE7A 4ORCB 2WCLA 2NXQA 1QX5B 2K7CA 3UNWA 1ZGOA 1UHIA 3DVKA 1UWOA 4XGYA 3GEXA 3NHIA 2LLUA 1KYRA 4PHKA 2G2BA 2SCPA 1V1GA 3DF0A 2HGYA 1W7UA 3EG5B 5HZOA 2QDIA 3LLEA 1QASA 1KSOA 2PRUA 2LCPA 1CKKA 2K61A 1AJ5A 4ZIOA 2C9JA 3D76A 5FVIA 2KNEA 2JC2A 4YI8A 1XFYO 1XO5A 1W7IB 1FW4A 2Y5IA 4NDBA 5DRGA 4GGFC 3DQMA 1QY3A 2LHIA 2WHSA 1XK4C 1KK7Z 2P4MA 1KWOB 4DXQA 3SSPA 4DKNA 3D0YA 2DD7A 5J2OA 4ZB1A 4I5KA 4JRBA 1TNXA 3BUMB 4W72A 1RRXA 4IK3A 3LVCA 1UISA 2QLIA 3BQ3A 2HF5A 3TZ1A 3CWGA 3DQHA 1JUOA 2M97A 2P6BB 2HJOA 3LS3A 1M39A 2MRDA 3E5TA 3LVAA 4XJKB 3SSVA 4EULA 2I2RE 4OKHA 4XYNA 2QACA 4Z4MA 1S36A 2L4HA 2QPTA 1GFLA 4W6LA 2DUGA 2LANA 1WRZA 3SIAA 3R1PA 4PPKA 4Z4KA 5PALA 4YRUA 3BOWA 3DQ8A 2M1KB 2E30A 4W7FA 5IBWA 1NUBA 4QJ4B 1MOUA 4PPJA 1LINA 3CGLA 4Q9XA 3GK2A 3AKBA 3ST3A 4L9MA 4IK4A 5HGEA 1S5GZ 5JOLA 1J7PA 1SCMC 1IIOA 5D7FA 2JQ6A 4OY4A 1ZOTB 4PDZA 5CPVA 3PALA 5F6TA 2OKYA 3DPZA 1Y1AA 3SSYA 4H3NA 1XFZO 1R2UA 3U8PA 2KI6C 2HQKA 1JFKA 4DXNA 2HQ8A 2CT9A 1XFRA 3DQKA 1DJHA 1RK9A 3F45A 4W6BA 4PE1A 4ZINA 1BLQA 4C0JA 2G3OA 2I7AA 4TNCA 1PK0D 3TMRA 1WLMA 4CLNA 1HUYA 2KFHA 2LVVA 1C07A 4YI9A 4RTCA 1TCFA 2JNXA 5FVFA 3SSTA 1JBYA 4PE4A 3E5WA 3WLCA 5HLOA 2M29A 3PM8A 1IWQA 4OGSA 3N7HA 3FIAA 2YE1A 5ER5A 3W1CA 3DQOA 1OE9B 1CDPA 4LJBA 5AQBB 4L13A 2EHBA 2KLEA 4CFRA 1TRFA 1MYWA 3CTNA 1B7TY 4INXA 1CLLA 3VRNA 1UHKA 4R6BA 3ICBA 3LL8B 2G6YA 1BJFA 1RECA 1OMVA 3CD9A 5EBJA 2KFGA 3PJBA 4ORAB 3DQFA 2BBNA 4DXPA 2Y1NA 4PT1A 1EMBA 4EDSA 2NLNA 1QX2A 4HQ9A 1P28A 2V53A 1RMOA 1BR1B 3VB1A 4HQ8A 3I5HB 2Z1OA 1WY9A 3SVSA 1K9KA 4XJKA 3DVJA 1HT9A 3DQ3A 5DTXA 2I18A 3HX4A 3D73A 4GNKB 1KQMB 2JU0A 3TS5C 1TUZA 3KCTA 4B30B 5HKWA 3M24A 3O4YA 1OMDA 4HSZA 1Q80A 3UO9A 2GX0A 4OV2A 2PYQA 1KFXL 2GGMA 4W69A 5LTRA 3O78A 4EN1A 1UURA 2OTEA 2MA2A 1IQ5A 1SL8A 1JBZA 4W7XA 2Z6ZA 3SS4A 1BOCA 1JBAA 1KFUL 3S0DA 5DPGA 3I19A 1DJIA 4C0KA 5DKNA 4IK9A 1NSHA 3KO0A 2CXJA 2KBMA 1OZOA 3CZ2A 2OTGC 1S6JA 3IQOA 1AHRA 2ZFDA 3CLNA 2HFCA 1SR6B 1LKJA 1CV7A 5TNCA 3JTDC 3LF4B 4XL5A 1SL9A 1QX7A 3TDIA 2JULA 3JVTC 3CFFA 4W6MA 1YUTA 1SCVA 4W6OA 3S0AA 1N2DA 3L4AA 3TDZA 1PSRA 2R2IA 1QYFA 2GW3A 3O77A 1TNQA 2K8MB 2WCFA 2IB6A 2AWJA 1RFJA 2LHLA 1OOHA 2K7OA 4DKMA 3PN7C 1YHHA 4ANJA 3IP2A 3NT3A 4JEOA 3IQQA 4IZNA 2F2PA 4KGFA 5BPJA 2Y4QA 4I5NB 2JNFA 3R1OA 5K89A 2A47A 4KPIA 5I8NA 4MZLA 1F8HA 1Q4AA 2JT3A 4FTGA 2HPSA 5HZSA 1KP5A 2OPOA 1B8CA 2G9BA 5H87A 1L2OC 1C3ZA 5KSZA 1UUSA 3CZ1A 1S6ZA 4ORBB 1YTZC 3KPXA 4IK1A 2EC6C 1JFJA 3CD1A 4W6AA 2JT0A 4HVFA 1KYPA 3TUYB 4TZAA 2G2SB 1OW4A 2V4EB 3DY9A 3EVUA 4IK8A 4W6PA 2H61A 4EDOA 2KI4B 1A03A 1ZGPA 4MN0A 1PVAA 1SK6D 2O2BA 2M8UA 1RM9A 5DTLA 4KEXA 4I2YA 1YUSA 3UFZA 3VHTB 1J7RA 2HCGA 2QEBA 3ZWHA 1XA5A 4W6IA 2L4IA 4XOWA 1FI5A 2Y0GA 2VVHA 1DJZA 2A4JA 3SG3A 4LW5A 1K9PA 1EMMA 5AEQA 1ALWA 1B8RA 3LA1A 2KPHA 3BXAA 3NF0A 4B30A 3SSHA 1OMRA 4OJ0A 4J88A 1B7TZ 3TDUA 1VRKA 3FE9A 1DJXA 2BL0C 4W6GA 3RWAA 1MXLC 2QLGB 3AKAA 1AK8A 1MUXA 4W7RA 3H4SE 1C4FA 4U2VA 1JSAA 1SL7A 1SY9A 1XFVO 3S0EA 2DOQA 5H89A 3FWCA 1OOJA 3VK1A 2H8QA 3SVOA 1OXEA 2WISA 4LQUA 3NSKA 2KYCA 1ZFSA 4NQGA 3DQ9A 5DICA 3DQLA 4AR7A 5EXCI 3VRRA 3KEVA 4AS8A 4KW9A 2FCEA 3OGNA 1DC1A 1PULA 3ZUFA 1M63B 2LVIA 1QLKA 4GBAA 2JTTA 1F70A 2PMYA 3QRXA 5D3OA 3SG5A 1IJ6A 3BUOB 1DELA 1EG4A 2EMOA 1UHNA 3V2LA 5B8IB 3OSRA 4ZF3A 2RGIA 1GQMA 1CLBA 4EMQA 1PSBA 1J55A 2G16B 1DJGA 3GJ2A 1Q4DA 4DXOA 2WSNA 3VGOA 1NCXA 1JWDA 1DF0B 1G33A 2QEHA 1CM4A 1EJ3A 3NHTA 1NIWA 2VZXA 1XFXO 2H5RA 1K9UA 1DTLA 2P71A 3CR4X 2OKWA 3PLFB 1XMZA 3DQNA 2B3PA 4DXIA 2JRFA 2C9IA 2BTJA 2LM5A 2HPWA 1NCZA 4W7DA 3DQUA 5EXUA 2LUCA 3OBVA 3P8UA 4D1EA 2LUXA 1WDCB 3LVDA 2O24A 4W6TA 1ZACA 1ZUZA 2CBLA 4QJ5B 2JPOA 2QLHA 1F4QA 1G4YR 3DQ1A 2VRGA 3BXKA 2V4EA 4R6DA 1X02A 2HGDA 3U8CA 3E3RA 1SRAA 3IF7A 5DY6A 2YGUA 3WCKA 3KF9A 2ARLA 2LVJA 1EXRA 1TOPA 3VHTA 1YFPA 1KYSA 3S05A 2BKIB 1G7KA 2Q57A 4ZF4A 1EMLA 2YFPA 3I5GC 5EHUA 4DCKA 1C7WA 1EMEA 1DGVA 2LP2A 2DUHA 1CDLA 1DJWA 2BNXA 4HREE 3BYAA 1B8LA 2WCEA 4XVPA 5H88A 1CLMA 4P2YB 2A46A 2ZNDA 4DS7A 2WCBA 4HRHA 1G8IA 2KDHA 4WRIA 4W7AA 4JC2A 3SVNA 4YGBB 2H6VA 3NSLA 2DUEA 2QLGA 2JT8A 1H4UA 2HETA 1F54A 5DPIA 3DQ5A 4ZCVA 1J7QA 5DQBA 1DQEA 4LJDC 3FS7A 1Z1PA 2KBIA 2HRSA 2IE2A 3DQ6A 4C0LA 2OS8C 1DVIA 1FPWA 1QS7A 3GOFA 1IJ5A 2O29A 4F0ZB 1KK8C 3SVCA 1XYDA 5HKYA 1NWDA 2A48A 4W7EA 1BR4B 1K95A 5CSJA 1EH2A 1QVIY 4KF5A 1XA9A 2FOTA 1IKUA 1S26D 3D75A 5EB6A 1YVLA 3RM1A 1QLSA 1MWNA 4W6KA 1OZSA 5FI6A 4P1QA 5F9GA 2M7NA 1Q4EA 1BFPA 4AQJA 3SJSA 5AXIA 3S0FA 3I5FC 2JTZA 1D1OA 1IH0A 2PXSA 4HQCA 1DF0A 2BCXA 1Y1XA 1SCMB 3OB2B 4DUQA 3RZSA 3DQDA 2KYFA 2B3QA 2WHUA 5I2QA 1U5IB 1H6RA 1YRUB 4W74A 1CFDA 1XAEA 2H8VA 3LSAA 4W6UA 3PIBA 2VVJA 3K1EA 5KTYA 2ZNEA 3SVRA 2FJUB 1LXFC 2DD9A 4UTSA 1TCOB 2LLTA 4ZBLA 3SG6A 1C7VA 4W6RA 3LK1A 2M1UA 3D77A 3SS3A 1RWYA 2LMUA 4GFTA 3DQCA 1JF2A 2NCPA 3FWBA 1TUJA 1GM0A 3PATA 2HQZA 4W6NA 4U8DA 5AFPA 1SPYA 3EKHA 5EXBA 3ST2A 1OXDA 1A2XA 1S6IA 4DXMA 2JPTA 1W7TA 1SKTA 3CYZA 4H47A 1TN4A 2G6EA 4KGEA 3LK0A 3U0NA 2Z6YA 3AI4A 2QLEA 3BFAA 1SW8A 4GGFA 4CFQA 3EK8A 4GAOA 4MLWA 1LA0A 2WCKA 3R72A 1QATA 4IK5A 1XK4A 1OOGA 1B9CA 3OGOA 1MHOA 1Q4BA 1PALA 1HCJA 5I94A 3CBEA 3BUNB 3CDNA 2NZ0A 4W6JA 1YJ2A 3GL4A 4J8AA 5HKZA 1A4PA 1EMAA 2JOJA 1S3PA 1CFPA 1KSMA 4N1GA 2KQYA 1YRTB 2EMNA 2NCOA 1V1FA 2LAPA 2FZUA 4GUKA 3LCPC 4I5JA 5DTYA 3B86A 1RROA 3DD4A 2O5GA 2Z6XA 2H5QA 3W1DA 1FBVA 1GJYA 3KCSA 2LC5A 1AJ4A 3TS5B 3SS5A 5HZUA 4WQ3A 1ZUXA 1LVCD 1JC1A 1QIWA 4PPLA 1YR5A 1A75B 4MZJA 4QJ3B 3SG7A 5HW9A 2EGDA 1Q4CA 1B47A 2KI4C 3PJ5A 2LNKA 2WC6A 2HQWA 3EVPA 2GV5A 1XFWO 1JC2A 2WOSA 3O6BA 4MVFA 2OTGB 2YDZA 3DQAA 5FI7A 3JTDB 1PRWA 3SRYA 5FI2A 3WXAA 1U5IA 3JVTB 1BU3A 3H1RA 4H3LA 2WCMA 1QVIZ 1YHIA 2KGRA 1ZMZA 3DXLA 5DTZA 5GQQC 3CS1A 1FF1A 2A52B 4OCIA 2IB5A 1BG1A 2ZN9A 1SMGA 1QV0A 4JWQA 3SVUA 2LMTA 1A29A 2MJWB 1WRKA 1Z4HA 4I5LB 4JKTA 3VRPA 2G3DB 2QEOA 3PN7B 2JZIA 5EL2A 4IJ7A 4W75A 2LMVA 1CMGA
chains in the Genus database with same CATH topology
2WHTA 3VRQA 3DVMA 3GK4X 3IR8A 2WC8A 3DQJA 1JF0A 2F3YA 1KFUS 2K7BA 1J1DA 1S5GY 4IL1A 3PSRA 3E5VA 4MBEA 3SSLA 1YVHA 3EKJA 4YBHB 2A54B 1CDNA 2AH8A 3M0WA 4N1FA 4ZCUA 1BODA 3CFAA 3ZTFA 4MRYA 1L2OB 2PASA 5DQMA 1F4OA 1CDMA 3VROA 1WLZA 3BX9A 2EC6B 1H8BA 1RJVA 4ICBA 2CNPA 3VICA 4PALA 2Q6PA 3ST0A 1RTP1 4FQOA 5FVGA 2ZO6A 4M2OA 3SVDA 1N65A 1MF8B 3UG0A 2M49B 2ZKMX 3SS0A 4W6SA 5ER4X 4ORNA 3D10A 4E68A 3RWTA 4P5OE 3V3DA 3OX5A 1ALVA 4M2QA 4DRWA 1RMPA 1F55A 3AAKA 3CB9A 3ZULA 1EMGA 2GW4B 4ETOA 3M22A 2GGZA 2L50A 2B1UA 3EK7A 1M45A 1KWOC 2LVKA 3BXCA 2AAOA 2CCMA 1F71A 2BL0B 1BT6A 3DPWA 2OTBA 1A75A 5DPJA 2JADA 1BMOA 3WHUB 2YE0A 5HZTA 3I5IB 1GL4A 4N3DA 2L51A 4PHMA 4JFGA 3U0MA 5FHVA 2G6XA 1Y6WA 1CMFA 1NCYA 2L2EA 3AI5A 3BUWB 4JQ0D 4NWSA 1YX8A 1ODBA 2AMIA 2F8PA 2KHNA 1J7OA 3SVBA 3U0LA 1E8AA 1W7SA 2D8NA 4PHNA 1EMKA 1EG3A 1WRLA 1NPQA 5DPHA 4JPZB 4W6HA 3CZTX 1TIZA 4MZKA 2KAXA 4N5XA 2BECA 2PSRA 4W6FA 1QTXA 2F2OA 1SNLA 3AAJA 1MXEA 4PFEA 4XOVA 1IGVA 1MR8A 3NSIA 2DUIA 1YX7A 1Q73A 1N0YA 1NX3A 3CR5X 1GGXA 1SYMA 1CFCA 3BUXB 1W7JB 1K96A 3GK1A 1IRJA 2K0JA 2IS9A 1CM1A 4KF4A 3CFHA 5KU1A 3P28A 1K2HA 2WNDA 2SASA 2RH7A 3MGFA 2KAVA 3LF3A 3ED8A 2ICRA 1NX2A 2BBMA 2TN4A 5BTTB 1L7ZA 2LE9B 1OSAA 2ZO7A 4UPGA 3ZUJA 5HBDA 3NXAA 3I5GB 1LA3A 1SBJA 2M7LA 2KOTA 2FL1A 5CSIA 2COLB 1DGUA 4JGEA 4NDCA 4GESB 3WNXB 1K94A 2VAEA 2AWKA 4BDUA 4CPVA 2KI6D 3C1VA 4KA9A 4ZFSA 3EVVA 2ISDA 5LTQA 4BY4A 4W73A 1CB1A 5EJUA 2M0RA 5CSFA 1EL4A 1YZWA 3RLZA 4W6CA 3WHTB 3OX6A 5I2LA 2H9WA 2KGBC 1MQ1A 3U0KA 2H61C 1QJTA 3CR2A 2ZMWA 1B1GA 3PFVA 4PCWA 3OSQA 2OJKA 4L1IA 2VVIA 2BE4A 1BF5A 2AHAA 4KAGA 4HE4A 1IQ3A 2LP3A 1KQVA 3I5HC 1NYAA 3NSOA 2OS8B 1UP5A 2M3WA 5HLVA 2QU1A 4PHJA 1EMFA 4BY5A 1KK8B 1KQMC 3AKOA 2KQ6A 2A50B 2E6WA 1YURA 1PVBA 1DJYA 1NX1A 2VADA 4JF9A 2H5OA 2MLFC 1Y0VH 3G9AA 4W7CA 1DMOA 2JWWA 2L0PA 1XSSA 1HQVA 3A8SA 2IOVA 2WIQA 4OVNF 3ST4A 1K93D 1B4CA 1IG5A 2L98A 4USLA 3I5FB 2A53B 3BXBA 1ZGQA 1S6CA 5LK4A 4P76A 1RMMA 2O60A 1YUUA 1SR6C 3A4UB 1QV1A 2FCDA 3DQ4A 4KW8A 2KSPA 1Z1QA 2L5XB 2AWLA 5FYXA 1XVJA 1QIVA 5CSNA 3U8AA 4LQTA 1F0BA 2ZRSA 2EMDA 1F09A 5BT0A 3OP0A 2POXA 3NEDA 4A4CA 4RYWA 2AWMA 2MAZA 2Q4UA 4KW4A 4Q7UA 4LJCA 5KTGA 2LLSA 3GB3A 1XFUO 2JXCA 3DPXA 4R1EA 3NEZA 5BTTA 4W77A 4H48A 2BCBA 4AOMA 1EMCA 4WQ2A 4GGNA 1NP8A 1H4BA 4NDDA 4RYSA 1YHGA 1FI6A 2LV7A 4ZF5A 3WLDA 5AERA 2PXWA 4Q9WA 3DVEA 1UHJA 2QRFA 2A56B 2WURA 3K21A 2F3ZA 2MBXA 2GX2A 5DKRA 1GGWA 4W76A 3TUYC 4OR9B 2PALA 5I2OA 2V4EC 1KK7Y 4DIRA 5LTPA 2CTNA 2ZRTA 2G5ZB 4GOBA 3SVEA 2MHHA 3MSEB 2WORA 3GJ1A 3EVRA 2ZN8A 2Y1MA 3DQ7A 5DU0A 1XQMA 4GF6B 1OXFA 3DF0B 3ZNIA 2F33A 4LJDA 2K7DA 5HYDA 5AANA 4GPLB 4Q7RA 2KAYA 1CNPA 1KCYA 1MOVA 3DQIA 1TNWA 2DUFA 3NT9A 1GGZA 4YGEB 4L12A 4Q7TA 4W6DA 1M31A 2M9GA 3TMTA 2BCAA 2K2AA 2JXLA 3OB1B 4Q04A 1QXTA 1CTRA 4MEWA 1K90D 3DQEA 4OHSA 5T3IA 1M46A 1QYQA 1KFXS 3D0YB 1TNPA 4B5YA 4YGDB 2KFFA 2Q91A 2WSOA 2AUCA 1CFFA 3SG2A 4M2PA 4H3MA 2DDDA 3SSKA 2BE6A 1S1EA 2ZMUA 3H1OA 5BQLA 5J3XA 4MSPA 1R6PA 2K2FA 3SIBA 4CIDA 5EB7A 3SV5A 4KF5C 4HRGA 4TZGA 4YGCB 1AP4A 2BKHB 3A8RA 3HCMA 1K8UA 3SG4A 5G08A 4J89A 3DQ2A 3BOWB 1QXPA 2H2KA 2I94A 1B9AA 3OHMB 5JJGA 4AQIA 2MLEC 4OQWA 1NX0A 5D69A 4A4BA 5DRFA 2H5PA 2FWQA 1Y1UA 3I5IC 1QYOA 4PE0A 4YGAA 3KHEA 2OGRA 1UHHA 3O2PA 2QZ0A 2PVBA 2DDCA 1YJFA 4MRXA 1AUIB 1OQPA 3ADFA 5DKQA 1J1EA 3K1KA 1AVSA 3CGAA 3EK4A 2QT2A 1JC0A 1WDCC 1TTXA 1DT7B 4PE7A 4ORCB 2NXQA 1QX5B 2K7CA 1ZGOA 1UHIA 3DVKA 1UWOA 4XGYA 3GEXA 2LLUA 1KYRA 4PHKA 2G2BA 2SCPA 1V1GA 3DF0A 2HGYA 1W7UA 5HZOA 3LLEA 1QASA 1KSOA 2PRUA 2LCPA 1CKKA 2K61A 1AJ5A 4ZIOA 2C9JA 5FVIA 2KNEA 2JC2A 4YI8A 1XFYO 1XO5A 1W7IB 1FW4A 2Y5IA 4NDBA 5DRGA 4GGFC 3DQMA 1QY3A 2LHIA 2WHSA 1XK4C 1KK7Z 2P4MA 1KWOB 4DXQA 3SSPA 4DKNA 3D0YA 2DD7A 5J2OA 4ZB1A 4I5KA 4JRBA 1TNXA 3BUMB 4W72A 1RRXA 4IK3A 3LVCA 1UISA 2QLIA 3BQ3A 2HF5A 3TZ1A 3CWGA 3DQHA 1JUOA 2M97A 2P6BB 2HJOA 3LS3A 1M39A 2MRDA 3E5TA 3LVAA 4XJKB 3SSVA 4EULA 2I2RE 4OKHA 4XYNA 2QACA 4Z4MA 1S36A 2L4HA 2QPTA 1GFLA 4W6LA 2DUGA 2LANA 1WRZA 3SIAA 4PPKA 4Z4KA 5PALA 4YRUA 3BOWA 3DQ8A 2M1KB 2E30A 4W7FA 5IBWA 1NUBA 4QJ4B 1MOUA 4PPJA 1LINA 3CGLA 4Q9XA 3GK2A 3AKBA 3ST3A 4L9MA 4IK4A 5HGEA 1S5GZ 5JOLA 1J7PA 1SCMC 5D7FA 4OY4A 2JQ6A 1ZOTB 4PDZA 5CPVA 3PALA 5F6TA 2OKYA 3DPZA 1Y1AA 3SSYA 4H3NA 1XFZO 1R2UA 3U8PA 2KI6C 2HQKA 1JFKA 4DXNA 2HQ8A 2CT9A 3DQKA 1DJHA 1RK9A 3F45A 4W6BA 4PE1A 4ZINA 1BLQA 4C0JA 2G3OA 2I7AA 4TNCA 1PK0D 3TMRA 1WLMA 4CLNA 1HUYA 2KFHA 2LVVA 1C07A 4YI9A 4RTCA 1TCFA 2JNXA 5FVFA 3SSTA 1JBYA 4PE4A 3E5WA 3WLCA 5HLOA 2M29A 3PM8A 1IWQA 4OGSA 3FIAA 2YE1A 5ER5A 3W1CA 3DQOA 1OE9B 1CDPA 4LJBA 5AQBB 4L13A 2EHBA 4CFRA 1TRFA 1MYWA 3CTNA 1B7TY 1CLLA 3VRNA 1UHKA 4R6BA 3ICBA 3LL8B 2G6YA 1BJFA 1RECA 1OMVA 3CD9A 5EBJA 2KFGA 3PJBA 4ORAB 3DQFA 2BBNA 4DXPA 2Y1NA 1EMBA 4EDSA 2NLNA 1QX2A 4HQ9A 2V53A 1RMOA 1BR1B 4HQ8A 3I5HB 2Z1OA 1WY9A 3SVSA 1K9KA 4XJKA 3DVJA 1HT9A 3DQ3A 5DTXA 2I18A 3HX4A 4GNKB 1KQMB 2JU0A 3TS5C 3KCTA 4B30B 5HKWA 3M24A 3O4YA 1OMDA 4HSZA 1Q80A 2GX0A 4OV2A 1KFXL 2GGMA 4W69A 5LTRA 3O78A 4EN1A 1UURA 2OTEA 2MA2A 1IQ5A 1SL8A 1JBZA 4W7XA 2Z6ZA 1BOCA 1JBAA 1KFUL 5DPGA 3I19A 1DJIA 4C0KA 5DKNA 4IK9A 1NSHA 3KO0A 2CXJA 2KBMA 1OZOA 2OTGC 1S6JA 3IQOA 1AHRA 2ZFDA 3CLNA 2HFCA 1SR6B 1LKJA 1CV7A 5TNCA 3JTDC 3LF4B 4XL5A 1SL9A 1QX7A 3TDIA 2JULA 3JVTC 3CFFA 4W6MA 1YUTA 1SCVA 4W6OA 1N2DA 3TDZA 1PSRA 2R2IA 1QYFA 2GW3A 3O77A 1TNQA 2K8MB 2WCFA 2IB6A 2AWJA 1RFJA 2LHLA 2K7OA 4DKMA 3PN7C 1YHHA 4ANJA 3IP2A 3NT3A 4JEOA 3IQQA 4IZNA 2F2PA 4KGFA 5BPJA 2Y4QA 4I5NB 2JNFA 5K89A 2A47A 4KPIA 5I8NA 4MZLA 1F8HA 1Q4AA 2JT3A 4FTGA 2HPSA 5HZSA 1KP5A 2OPOA 1B8CA 2G9BA 5H87A 1L2OC 5KSZA 1UUSA 1S6ZA 4ORBB 1YTZC 3KPXA 4IK1A 2EC6C 1JFJA 3CD1A 4W6AA 2JT0A 4HVFA 1KYPA 3TUYB 4TZAA 2G2SB 2V4EB 3EVUA 4IK8A 4W6PA 2H61A 4EDOA 2KI4B 1A03A 1ZGPA 4MN0A 1PVAA 1SK6D 2O2BA 2M8UA 1RM9A 5DTLA 4KEXA 4I2YA 1YUSA 3UFZA 3VHTB 1J7RA 2HCGA 3ZWHA 1XA5A 4W6IA 2L4IA 4XOWA 1FI5A 2Y0GA 2VVHA 1DJZA 2A4JA 3SG3A 4LW5A 1K9PA 1EMMA 5AEQA 1ALWA 1B8RA 3LA1A 3BXAA 3NF0A 4B30A 3SSHA 1OMRA 4OJ0A 4J88A 1B7TZ 3TDUA 1VRKA 1DJXA 2BL0C 4W6GA 3RWAA 1MXLC 2QLGB 3AKAA 1AK8A 1MUXA 4W7RA 3H4SE 1C4FA 4U2VA 1JSAA 1SL7A 1SY9A 1XFVO 2DOQA 5H89A 3FWCA 1OOJA 3VK1A 2H8QA 3SVOA 1OXEA 2WISA 4LQUA 3NSKA 2KYCA 1ZFSA 4NQGA 3DQ9A 3DQLA 4AR7A 5EXCI 3VRRA 3KEVA 4AS8A 4KW9A 2FCEA 3ZUFA 1PULA 1M63B 2LVIA 1QLKA 4GBAA 2JTTA 1F70A 2PMYA 3QRXA 3SG5A 1IJ6A 3BUOB 1EG4A 2EMOA 1UHNA 5B8IB 3OSRA 4ZF3A 2RGIA 1GQMA 1CLBA 4EMQA 1PSBA 1J55A 2G16B 1DJGA 3GJ2A 1Q4DA 4DXOA 2WSNA 3VGOA 1NCXA 1JWDA 1DF0B 1G33A 1CM4A 1EJ3A 2VZXA 1NIWA 1XFXO 2H5RA 1K9UA 1DTLA 3CR4X 2OKWA 3PLFB 1XMZA 3DQNA 2B3PA 4DXIA 2JRFA 2C9IA 2BTJA 2LM5A 2HPWA 1NCZA 4W7DA 3DQUA 5EXUA 2LUCA 3P8UA 4D1EA 2LUXA 1WDCB 3LVDA 4W6TA 2O24A 1ZACA 1ZUZA 2CBLA 4QJ5B 2QLHA 1F4QA 1G4YR 3DQ1A 2VRGA 3BXKA 2V4EA 4R6DA 1X02A 2HGDA 3U8CA 3E3RA 1SRAA 3IF7A 5DY6A 3WCKA 3KF9A 2ARLA 2LVJA 1EXRA 1CMGA 1TOPA 3VHTA 1YFPA 1KYSA 3S05A 2BKIB 1G7KA 2Q57A 4ZF4A 1EMLA 2YFPA 3I5GC 5EHUA 4DCKA 1C7WA 1EMEA 1DGVA 2LP2A 2DUHA 1CDLA 1DJWA 4HREE 3BYAA 1B8LA 2WCEA 4XVPA 5H88A 1CLMA 4P2YB 2A46A 2ZNDA 4DS7A 2WCBA 4HRHA 1G8IA 2KDHA 4WRIA 4W7AA 4JC2A 3SVNA 4YGBB 2H6VA 3NSLA 2DUEA 2QLGA 2JT8A 1H4UA 2HETA 1F54A 5DPIA 3DQ5A 4ZCVA 1J7QA 5DQBA 4LJDC 3FS7A 1Z1PA 2KBIA 2HRSA 2IE2A 3DQ6A 4C0LA 2OS8C 1DVIA 1FPWA 1QS7A 3GOFA 1IJ5A 2O29A 4F0ZB 1KK8C 3SVCA 1XYDA 5HKYA 1NWDA 2A48A 4W7EA 1BR4B 1K95A 5CSJA 1EH2A 1QVIY 4KF5A 1XA9A 2FOTA 1IKUA 1S26D 5EB6A 1YVLA 3RM1A 1QLSA 1MWNA 4W6KA 1OZSA 4P1QA 5F9GA 2M7NA 1Q4EA 1BFPA 4AQJA 3SJSA 5AXIA 3I5FC 2JTZA 1D1OA 1IH0A 2PXSA 4HQCA 1DF0A 2BCXA 1Y1XA 1SCMB 3OB2B 4DUQA 3DQDA 2KYFA 2B3QA 2WHUA 5I2QA 1U5IB 1H6RA 1YRUB 4W74A 1CFDA 1XAEA 3LSAA 4W6UA 3PIBA 2VVJA 5KTYA 2ZNEA 3SVRA 2FJUB 1LXFC 2DD9A 4UTSA 1TCOB 2LLTA 4ZBLA 3SG6A 1C7VA 4W6RA 3LK1A 2M1UA 1RWYA 2LMUA 4GFTA 3DQCA 1JF2A 2NCPA 3FWBA 3PATA 2HQZA 4W6NA 4U8DA 5AFPA 1SPYA 3EKHA 5EXBA 3ST2A 1OXDA 1A2XA 1S6IA 4DXMA 2JPTA 1W7TA 1SKTA 4H47A 1TN4A 2G6EA 4KGEA 3LK0A 3U0NA 2Z6YA 3AI4A 2QLEA 1SW8A 4GGFA 4CFQA 3EK8A 4GAOA 4MLWA 1LA0A 1QATA 4IK5A 1XK4A 1B9CA 3OGOA 1MHOA 1Q4BA 1PALA 1HCJA 3CBEA 3BUNB 2NZ0A 4W6JA 1YJ2A 3GL4A 4J8AA 5HKZA 1A4PA 1EMAA 2JOJA 1S3PA 1CFPA 1KSMA 4N1GA 2KQYA 1YRTB 2EMNA 2NCOA 1V1FA 2LAPA 2FZUA 4GUKA 3LCPC 4I5JA 5DTYA 1RROA 3DD4A 2O5GA 2Z6XA 2H5QA 3W1DA 1FBVA 1GJYA 3KCSA 2LC5A 1AJ4A 3TS5B 5HZUA 4WQ3A 1ZUXA 1LVCD 1JC1A 1QIWA 4PPLA 1YR5A 1A75B 4MZJA 4QJ3B 3SG7A 5HW9A 2EGDA 1Q4CA 1B47A 2KI4C 3PJ5A 2LNKA 2HQWA 3EVPA 2GV5A 1XFWO 1JC2A 2WOSA 3O6BA 4MVFA 2OTGB 2YDZA 3DQAA 3JTDB 1PRWA 3SRYA 3WXAA 1U5IA 3JVTB 1BU3A 3H1RA 4H3LA 1QVIZ 1YHIA 2KGRA 1ZMZA 5DTZA 5GQQC 3CS1A 1FF1A 2A52B 4OCIA 2IB5A 1BG1A 2ZN9A 1SMGA 1QV0A 4JWQA 3SVUA 2LMTA 1A29A 2MJWB 1WRKA 4I5LB 3VRPA 2G3DB 3PN7B 2JZIA 4W75A 2LMVA 3PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHT A;  3VRQ A;  3DVM A;  3GK4 X;  3IR8 A;  2WC8 A;  3DQJ A;  1JF0 A;  2F3Y A;  1KFU S;  2K7B A;  1J1D A;  1S5G Y;  4IL1 A;  3PSR A;  3E5V A;  4MBE A;  3SSL A;  1YVH A;  3EKJ A;  4YBH B;  2A54 B;  1CDN A;  2AH8 A;  3M0W A;  4N1F A;  4ZCU A;  1BOD A;  3CFA A;  3ZTF A;  4MRY A;  1L2O B;  2PAS A;  5DQM A;  1F4O A;  1CDM A;  3VRO A;  1WLZ A;  3BX9 A;  2EC6 B;  1H8B A;  1RJV A;  4ICB A;  2CNP A;  3VIC A;  4PAL A;  2Q6P A;  3ST0 A;  1RTP 1;  4FQO A;  5FVG A;  2ZO6 A;  4M2O A;  3SVD A;  1N65 A;  1MF8 B;  3UG0 A;  2M49 B;  2ZKM X;  3SS0 A;  4W6S A;  5ER4 X;  4ORN A;  3D10 A;  4E68 A;  3RWT A;  4P5O E;  3V3D A;  3OX5 A;  1ALV A;  4M2Q A;  4DRW A;  1RMP A;  1F55 A;  3AAK A;  3CB9 A;  3ZUL A;  1EMG A;  2GW4 B;  4ETO A;  3M22 A;  2GGZ A;  2L50 A;  2B1U A;  3EK7 A;  1M45 A;  1KWO C;  2LVK A;  3BXC A;  2AAO A;  2CCM A;  1F71 A;  2BL0 B;  1BT6 A;  3DPW A;  2OTB A;  1A75 A;  5DPJ A;  2JAD A;  1BMO A;  3WHU B;  2YE0 A;  5HZT A;  3I5I B;  1GL4 A;  4N3D A;  2L51 A;  4PHM A;  4JFG A;  3U0M A;  5FHV A;  2G6X A;  1Y6W A;  1CMF A;  1NCY A;  2L2E A;  3AI5 A;  3BUW B;  4JQ0 D;  4NWS A;  1YX8 A;  1ODB A;  2AMI A;  2F8P A;  2KHN A;  1J7O A;  3SVB A;  3U0L A;  1E8A A;  1W7S A;  2D8N A;  4PHN A;  1EMK A;  1EG3 A;  1WRL A;  1NPQ A;  5DPH A;  4JPZ B;  4W6H A;  3CZT X;  1TIZ A;  4MZK A;  2KAX A;  4N5X A;  2BEC A;  2PSR A;  4W6F A;  1QTX A;  2F2O A;  1SNL A;  3AAJ A;  1MXE A;  4PFE A;  4XOV A;  1IGV A;  1MR8 A;  3NSI A;  2DUI A;  1YX7 A;  1Q73 A;  1N0Y A;  1NX3 A;  3CR5 X;  1GGX A;  1SYM A;  1CFC A;  3BUX B;  1W7J B;  1K96 A;  3GK1 A;  1IRJ A;  2K0J A;  2IS9 A;  1CM1 A;  4KF4 A;  3CFH A;  5KU1 A;  3P28 A;  1K2H A;  2WND A;  2SAS A;  2RH7 A;  3MGF A;  2KAV A;  3LF3 A;  3ED8 A;  2ICR A;  1NX2 A;  2BBM A;  2TN4 A;  5BTT B;  1L7Z A;  2LE9 B;  1OSA A;  2ZO7 A;  4UPG A;  3ZUJ A;  5HBD A;  3NXA A;  3I5G B;  1LA3 A;  1SBJ A;  2M7L A;  2KOT A;  2FL1 A;  5CSI A;  2COL B;  1DGU A;  4JGE A;  4NDC A;  4GES B;  3WNX B;  1K94 A;  2VAE A;  2AWK A;  4BDU A;  4CPV A;  2KI6 D;  3C1V A;  4KA9 A;  4ZFS A;  3EVV A;  2ISD A;  5LTQ A;  4BY4 A;  4W73 A;  1CB1 A;  5EJU A;  2M0R A;  5CSF A;  1EL4 A;  1YZW A;  3RLZ A;  4W6C A;  3WHT B;  3OX6 A;  5I2L A;  2H9W A;  2KGB C;  1MQ1 A;  3U0K A;  2H61 C;  1QJT A;  3CR2 A;  2ZMW A;  1B1G A;  3PFV A;  4PCW A;  3OSQ A;  2OJK A;  4L1I A;  2VVI A;  2BE4 A;  1BF5 A;  2AHA A;  4KAG A;  4HE4 A;  1IQ3 A;  2LP3 A;  1KQV A;  3I5H C;  1NYA A;  3NSO A;  2OS8 B;  1UP5 A;  2M3W A;  5HLV A;  2QU1 A;  4PHJ A;  1EMF A;  4BY5 A;  1KK8 B;  1KQM C;  3AKO A;  2KQ6 A;  2A50 B;  2E6W A;  1YUR A;  1PVB A;  1DJY A;  1NX1 A;  2VAD A;  4JF9 A;  2H5O A;  2MLF C;  1Y0V H;  3G9A A;  4W7C A;  1DMO A;  2JWW A;  2L0P A;  1XSS A;  1HQV A;  3A8S A;  2IOV A;  2WIQ A;  4OVN F;  3ST4 A;  1K93 D;  1B4C A;  1IG5 A;  2L98 A;  4USL A;  3I5F B;  2A53 B;  3BXB A;  1ZGQ A;  1S6C A;  5LK4 A;  4P76 A;  1RMM A;  2O60 A;  1YUU A;  1SR6 C;  3A4U B;  1QV1 A;  2FCD A;  3DQ4 A;  4KW8 A;  2KSP A;  1Z1Q A;  2L5X B;  2AWL A;  5FYX A;  1XVJ A;  1QIV A;  5CSN A;  3U8A A;  4LQT A;  1F0B A;  2ZRS A;  2EMD A;  1F09 A;  5BT0 A;  3OP0 A;  2POX A;  3NED A;  4A4C A;  4RYW A;  2AWM A;  2MAZ A;  2Q4U A;  4KW4 A;  4Q7U A;  4LJC A;  5KTG A;  2LLS A;  3GB3 A;  1XFU O;  2JXC A;  3DPX A;  4R1E A;  3NEZ A;  5BTT A;  4W77 A;  4H48 A;  2BCB A;  4AOM A;  1EMC A;  4WQ2 A;  4GGN A;  1NP8 A;  1H4B A;  4NDD A;  4RYS A;  1YHG A;  1FI6 A;  2LV7 A;  4ZF5 A;  3WLD A;  5AER A;  2PXW A;  4Q9W A;  3DVE A;  1UHJ A;  2QRF A;  2A56 B;  2WUR A;  3K21 A;  2F3Z A;  2MBX A;  2GX2 A;  5DKR A;  1GGW A;  4W76 A;  3TUY C;  4OR9 B;  2PAL A;  5I2O A;  2V4E C;  1KK7 Y;  4DIR A;  5LTP A;  2CTN A;  2ZRT A;  2G5Z B;  4GOB A;  3SVE A;  2MHH A;  3MSE B;  2WOR A;  3GJ1 A;  3EVR A;  2ZN8 A;  2Y1M A;  3DQ7 A;  5DU0 A;  1XQM A;  4GF6 B;  1OXF A;  3DF0 B;  3ZNI A;  2F33 A;  4LJD A;  2K7D A;  5HYD A;  5AAN A;  4GPL B;  4Q7R A;  2KAY A;  1CNP A;  1KCY A;  1MOV A;  3DQI A;  1TNW A;  2DUF A;  3NT9 A;  1GGZ A;  4YGE B;  4L12 A;  4Q7T A;  4W6D A;  1M31 A;  2M9G A;  3TMT A;  2BCA A;  2K2A A;  2JXL A;  3OB1 B;  4Q04 A;  1QXT A;  1CTR A;  4MEW A;  1K90 D;  3DQE A;  4OHS A;  5T3I A;  1M46 A;  1QYQ A;  1KFX S;  3D0Y B;  1TNP A;  4B5Y A;  4YGD B;  2KFF A;  2Q91 A;  2WSO A;  2AUC A;  1CFF A;  3SG2 A;  4M2P A;  4H3M A;  2DDD A;  3SSK A;  2BE6 A;  1S1E A;  2ZMU A;  3H1O A;  5BQL A;  5J3X A;  4MSP A;  1R6P A;  2K2F A;  3SIB A;  4CID A;  5EB7 A;  3SV5 A;  4KF5 C;  4HRG A;  4TZG A;  4YGC B;  1AP4 A;  2BKH B;  3A8R A;  3HCM A;  1K8U A;  3SG4 A;  5G08 A;  4J89 A;  3DQ2 A;  3BOW B;  1QXP A;  2H2K A;  2I94 A;  1B9A A;  3OHM B;  5JJG A;  4AQI A;  2MLE C;  4OQW A;  1NX0 A;  5D69 A;  4A4B A;  5DRF A;  2H5P A;  2FWQ A;  1Y1U A;  3I5I C;  1QYO A;  4PE0 A;  4YGA A;  3KHE A;  2OGR A;  1UHH A;  3O2P A;  2QZ0 A;  2PVB A;  2DDC A;  1YJF A;  4MRX A;  1AUI B;  1OQP A;  3ADF A;  5DKQ A;  1J1E A;  3K1K A;  1AVS A;  3CGA A;  3EK4 A;  2QT2 A;  1JC0 A;  1WDC C;  1TTX A;  1DT7 B;  4PE7 A;  4ORC B;  2NXQ A;  1QX5 B;  2K7C A;  1ZGO A;  1UHI A;  3DVK A;  1UWO A;  4XGY A;  3GEX A;  2LLU A;  1KYR A;  4PHK A;  2G2B A;  2SCP A;  1V1G A;  3DF0 A;  2HGY A;  1W7U A;  5HZO A;  3LLE A;  1QAS A;  1KSO A;  2PRU A;  2LCP A;  1CKK A;  2K61 A;  1AJ5 A;  4ZIO A;  2C9J A;  5FVI A;  2KNE A;  2JC2 A;  4YI8 A;  1XFY O;  1XO5 A;  1W7I B;  1FW4 A;  2Y5I A;  4NDB A;  5DRG A;  4GGF C;  3DQM A;  1QY3 A;  2LHI A;  2WHS A;  1XK4 C;  1KK7 Z;  2P4M A;  1KWO B;  4DXQ A;  3SSP A;  4DKN A;  3D0Y A;  2DD7 A;  5J2O A;  4ZB1 A;  4I5K A;  4JRB A;  1TNX A;  3BUM B;  4W72 A;  1RRX A;  4IK3 A;  3LVC A;  1UIS A;  2QLI A;  3BQ3 A;  2HF5 A;  3TZ1 A;  3CWG A;  3DQH A;  1JUO A;  2M97 A;  2P6B B;  2HJO A;  3LS3 A;  1M39 A;  2MRD A;  3E5T A;  3LVA A;  4XJK B;  3SSV A;  4EUL A;  2I2R E;  4OKH A;  4XYN A;  2QAC A;  4Z4M A;  1S36 A;  2L4H A;  2QPT A;  1GFL A;  4W6L A;  2DUG A;  2LAN A;  1WRZ A;  3SIA A;  4PPK A;  4Z4K A;  5PAL A;  4YRU A;  3BOW A;  3DQ8 A;  2M1K B;  2E30 A;  4W7F A;  5IBW A;  1NUB A;  4QJ4 B;  1MOU A;  4PPJ A;  1LIN A;  3CGL A;  4Q9X A;  3GK2 A;  3AKB A;  3ST3 A;  4L9M A;  4IK4 A;  5HGE A;  1S5G Z;  5JOL A;  1J7P A;  1SCM C;  5D7F A;  4OY4 A;  2JQ6 A;  1ZOT B;  4PDZ A;  5CPV A;  3PAL A;  5F6T A;  2OKY A;  3DPZ A;  1Y1A A;  3SSY A;  4H3N A;  1XFZ O;  1R2U A;  3U8P A;  2KI6 C;  2HQK A;  1JFK A;  4DXN A;  2HQ8 A;  2CT9 A;  3DQK A;  1DJH A;  1RK9 A;  3F45 A;  4W6B A;  4PE1 A;  4ZIN A;  1BLQ A;  4C0J A;  2G3O A;  2I7A A;  4TNC A;  1PK0 D;  3TMR A;  1WLM A;  4CLN A;  1HUY A;  2KFH A;  2LVV A;  1C07 A;  4YI9 A;  4RTC A;  1TCF A;  2JNX A;  5FVF A;  3SST A;  1JBY A;  4PE4 A;  3E5W A;  3WLC A;  5HLO A;  2M29 A;  3PM8 A;  1IWQ A;  4OGS A;  3FIA A;  2YE1 A;  5ER5 A;  3W1C A;  3DQO A;  1OE9 B;  1CDP A;  4LJB A;  5AQB B;  4L13 A;  2EHB A;  4CFR A;  1TRF A;  1MYW A;  3CTN A;  1B7T Y;  1CLL A;  3VRN A;  1UHK A;  4R6B A;  3ICB A;  3LL8 B;  2G6Y A;  1BJF A;  1REC A;  1OMV A;  3CD9 A;  5EBJ A;  2KFG A;  3PJB A;  4ORA B;  3DQF A;  2BBN A;  4DXP A;  2Y1N A;  1EMB A;  4EDS A;  2NLN A;  1QX2 A;  4HQ9 A;  2V53 A;  1RMO A;  1BR1 B;  4HQ8 A;  3I5H B;  2Z1O A;  1WY9 A;  3SVS A;  1K9K A;  4XJK A;  3DVJ A;  1HT9 A;  3DQ3 A;  5DTX A;  2I18 A;  3HX4 A;  4GNK B;  1KQM B;  2JU0 A;  3TS5 C;  3KCT A;  4B30 B;  5HKW A;  3M24 A;  3O4Y A;  1OMD A;  4HSZ A;  1Q80 A;  2GX0 A;  4OV2 A;  1KFX L;  2GGM A;  4W69 A;  5LTR A;  3O78 A;  4EN1 A;  1UUR A;  2OTE A;  2MA2 A;  1IQ5 A;  1SL8 A;  1JBZ A;  4W7X A;  2Z6Z A;  1BOC A;  1JBA A;  1KFU L;  5DPG A;  3I19 A;  1DJI A;  4C0K A;  5DKN A;  4IK9 A;  1NSH A;  3KO0 A;  2CXJ A;  2KBM A;  1OZO A;  2OTG C;  1S6J A;  3IQO A;  1AHR A;  2ZFD A;  3CLN A;  2HFC A;  1SR6 B;  1LKJ A;  1CV7 A;  5TNC A;  3JTD C;  3LF4 B;  4XL5 A;  1SL9 A;  1QX7 A;  3TDI A;  2JUL A;  3JVT C;  3CFF A;  4W6M A;  1YUT A;  1SCV A;  4W6O A;  1N2D A;  3TDZ A;  1PSR A;  2R2I A;  1QYF A;  2GW3 A;  3O77 A;  1TNQ A;  2K8M B;  2WCF A;  2IB6 A;  2AWJ A;  1RFJ A;  2LHL A;  2K7O A;  4DKM A;  3PN7 C;  1YHH A;  4ANJ A;  3IP2 A;  3NT3 A;  4JEO A;  3IQQ A;  4IZN A;  2F2P A;  4KGF A;  5BPJ A;  2Y4Q A;  4I5N B;  2JNF A;  5K89 A;  2A47 A;  4KPI A;  5I8N A;  4MZL A;  1F8H A;  1Q4A A;  2JT3 A;  4FTG A;  2HPS A;  5HZS A;  1KP5 A;  2OPO A;  1B8C A;  2G9B A;  5H87 A;  1L2O C;  5KSZ A;  1UUS A;  1S6Z A;  4ORB B;  1YTZ C;  3KPX A;  4IK1 A;  2EC6 C;  1JFJ A;  3CD1 A;  4W6A A;  2JT0 A;  4HVF A;  1KYP A;  3TUY B;  4TZA A;  2G2S B;  2V4E B;  3EVU A;  4IK8 A;  4W6P A;  2H61 A;  4EDO A;  2KI4 B;  1A03 A;  1ZGP A;  4MN0 A;  1PVA A;  1SK6 D;  2O2B A;  2M8U A;  1RM9 A;  5DTL A;  4KEX A;  4I2Y A;  1YUS A;  3UFZ A;  3VHT B;  1J7R A;  2HCG A;  3ZWH A;  1XA5 A;  4W6I A;  2L4I A;  4XOW A;  1FI5 A;  2Y0G A;  2VVH A;  1DJZ A;  2A4J A;  3SG3 A;  4LW5 A;  1K9P A;  1EMM A;  5AEQ A;  1ALW A;  1B8R A;  3LA1 A;  3BXA A;  3NF0 A;  4B30 A;  3SSH A;  1OMR A;  4OJ0 A;  4J88 A;  1B7T Z;  3TDU A;  1VRK A;  1DJX A;  2BL0 C;  4W6G A;  3RWA A;  1MXL C;  2QLG B;  3AKA A;  1AK8 A;  1MUX A;  4W7R A;  3H4S E;  1C4F A;  4U2V A;  1JSA A;  1SL7 A;  1SY9 A;  1XFV O;  2DOQ A;  5H89 A;  3FWC A;  1OOJ A;  3VK1 A;  2H8Q A;  3SVO A;  1OXE A;  2WIS A;  4LQU A;  3NSK A;  2KYC A;  1ZFS A;  4NQG A;  3DQ9 A;  3DQL A;  4AR7 A;  5EXC I;  3VRR A;  3KEV A;  4AS8 A;  4KW9 A;  2FCE A;  3ZUF A;  1PUL A;  1M63 B;  2LVI A;  1QLK A;  4GBA A;  2JTT A;  1F70 A;  2PMY A;  3QRX A;  3SG5 A;  1IJ6 A;  3BUO B;  1EG4 A;  2EMO A;  1UHN A;  5B8I B;  3OSR A;  4ZF3 A;  2RGI A;  1GQM A;  1CLB A;  4EMQ A;  1PSB A;  1J55 A;  2G16 B;  1DJG A;  3GJ2 A;  1Q4D A;  4DXO A;  2WSN A;  3VGO A;  1NCX A;  1JWD A;  1DF0 B;  1G33 A;  1CM4 A;  1EJ3 A;  2VZX A;  1NIW A;  1XFX O;  2H5R A;  1K9U A;  1DTL A;  3CR4 X;  2OKW A;  3PLF B;  1XMZ A;  3DQN A;  2B3P A;  4DXI A;  2JRF A;  2C9I A;  2BTJ A;  2LM5 A;  2HPW A;  1NCZ A;  4W7D A;  3DQU A;  5EXU A;  2LUC A;  3P8U A;  4D1E A;  2LUX A;  1WDC B;  3LVD A;  4W6T A;  2O24 A;  1ZAC A;  1ZUZ A;  2CBL A;  4QJ5 B;  2QLH A;  1F4Q A;  1G4Y R;  3DQ1 A;  2VRG A;  3BXK A;  2V4E A;  4R6D A;  1X02 A;  2HGD A;  3U8C A;  3E3R A;  1SRA A;  3IF7 A;  5DY6 A;  3WCK A;  3KF9 A;  2ARL A;  2LVJ A;  1EXR A;  1CMG A;  1TOP A;  3VHT A;  1YFP A;  1KYS A;  3S05 A;  2BKI B;  1G7K A;  2Q57 A;  4ZF4 A;  1EML A;  2YFP A;  3I5G C;  5EHU A;  4DCK A;  1C7W A;  1EME A;  1DGV A;  2LP2 A;  2DUH A;  1CDL A;  1DJW A;  4HRE E;  3BYA A;  1B8L A;  2WCE A;  4XVP A;  5H88 A;  1CLM A;  4P2Y B;  2A46 A;  2ZND A;  4DS7 A;  2WCB A;  4HRH A;  1G8I A;  2KDH A;  4WRI A;  4W7A A;  4JC2 A;  3SVN A;  4YGB B;  2H6V A;  3NSL A;  2DUE A;  2QLG A;  2JT8 A;  1H4U A;  2HET A;  1F54 A;  5DPI A;  3DQ5 A;  4ZCV A;  1J7Q A;  5DQB A;  4LJD C;  3FS7 A;  1Z1P A;  2KBI A;  2HRS A;  2IE2 A;  3DQ6 A;  4C0L A;  2OS8 C;  1DVI A;  1FPW A;  1QS7 A;  3GOF A;  1IJ5 A;  2O29 A;  4F0Z B;  1KK8 C;  3SVC A;  1XYD A;  5HKY A;  1NWD A;  2A48 A;  4W7E A;  1BR4 B;  1K95 A;  5CSJ A;  1EH2 A;  1QVI Y;  4KF5 A;  1XA9 A;  2FOT A;  1IKU A;  1S26 D;  5EB6 A;  1YVL A;  3RM1 A;  1QLS A;  1MWN A;  4W6K A;  1OZS A;  4P1Q A;  5F9G A;  2M7N A;  1Q4E A;  1BFP A;  4AQJ A;  3SJS A;  5AXI A;  3I5F C;  2JTZ A;  1D1O A;  1IH0 A;  2PXS A;  4HQC A;  1DF0 A;  2BCX A;  1Y1X A;  1SCM B;  3OB2 B;  4DUQ A;  3DQD A;  2KYF A;  2B3Q A;  2WHU A;  5I2Q A;  1U5I B;  1H6R A;  1YRU B;  4W74 A;  1CFD A;  1XAE A;  3LSA A;  4W6U A;  3PIB A;  2VVJ A;  5KTY A;  2ZNE A;  3SVR A;  2FJU B;  1LXF C;  2DD9 A;  4UTS A;  1TCO B;  2LLT A;  4ZBL A;  3SG6 A;  1C7V A;  4W6R A;  3LK1 A;  2M1U A;  1RWY A;  2LMU A;  4GFT A;  3DQC A;  1JF2 A;  2NCP A;  3FWB A;  3PAT A;  2HQZ A;  4W6N A;  4U8D A;  5AFP A;  1SPY A;  3EKH A;  5EXB A;  3ST2 A;  1OXD A;  1A2X A;  1S6I A;  4DXM A;  2JPT A;  1W7T A;  1SKT A;  4H47 A;  1TN4 A;  2G6E A;  4KGE A;  3LK0 A;  3U0N A;  2Z6Y A;  3AI4 A;  2QLE A;  1SW8 A;  4GGF A;  4CFQ A;  3EK8 A;  4GAO A;  4MLW A;  1LA0 A;  1QAT A;  4IK5 A;  1XK4 A;  1B9C A;  3OGO A;  1MHO A;  1Q4B A;  1PAL A;  1HCJ A;  3CBE A;  3BUN B;  2NZ0 A;  4W6J A;  1YJ2 A;  3GL4 A;  4J8A A;  5HKZ A;  1A4P A;  1EMA A;  2JOJ A;  1S3P A;  1CFP A;  1KSM A;  4N1G A;  2KQY A;  1YRT B;  2EMN A;  2NCO A;  1V1F A;  2LAP A;  2FZU A;  4GUK A;  3LCP C;  4I5J A;  5DTY A;  1RRO A;  3DD4 A;  2O5G A;  2Z6X A;  2H5Q A;  3W1D A;  1FBV A;  1GJY A;  3KCS A;  2LC5 A;  1AJ4 A;  3TS5 B;  5HZU A;  4WQ3 A;  1ZUX A;  1LVC D;  1JC1 A;  1QIW A;  4PPL A;  1YR5 A;  1A75 B;  4MZJ A;  4QJ3 B;  3SG7 A;  5HW9 A;  2EGD A;  1Q4C A;  1B47 A;  2KI4 C;  3PJ5 A;  2LNK A;  2HQW A;  3EVP A;  2GV5 A;  1XFW O;  1JC2 A;  2WOS A;  3O6B A;  4MVF A;  2OTG B;  2YDZ A;  3DQA A;  3JTD B;  1PRW A;  3SRY A;  3WXA A;  1U5I A;  3JVT B;  1BU3 A;  3H1R A;  4H3L A;  1QVI Z;  1YHI A;  2KGR A;  1ZMZ A;  5DTZ A;  5GQQ C;  3CS1 A;  1FF1 A;  2A52 B;  4OCI A;  2IB5 A;  1BG1 A;  2ZN9 A;  1SMG A;  1QV0 A;  4JWQ A;  3SVU A;  2LMT A;  1A29 A;  2MJW B;  1WRK A;  4I5L B;  3VRP A;  2G3D B;  3PN7 B;  2JZI A;  4W75 A;  2LMV A;  3PJ7 A; 
#chains in the Genus database with same CATH topology
 2WHT A;  3VRQ A;  3DVM A;  3GK4 X;  3IR8 A;  2WC8 A;  3CZ0 A;  3DQJ A;  1JF0 A;  2F3Y A;  1KFU S;  2K7B A;  1J1D A;  1S5G Y;  4IL1 A;  3PSR A;  3E5V A;  4MBE A;  3SSL A;  1YVH A;  3EKJ A;  4YBH B;  2A54 B;  1CDN A;  3B88 A;  2AH8 A;  3M0W A;  4N1F A;  4ZCU A;  1BOD A;  3QME A;  3CFA A;  3ZTF A;  4MRY A;  1L2O B;  2PAS A;  5DQM A;  3BJH A;  1F4O A;  1CDM A;  3VRO A;  1WLZ A;  3BX9 A;  2EC6 B;  1H8B A;  1RJV A;  4ICB A;  2CNP A;  3VIC A;  1TWO A;  4PAL A;  2Q6P A;  3ST0 A;  1RTP 1;  3PJI A;  4FQO A;  5FVG A;  2ZO6 A;  4M2O A;  3SVD A;  1N65 A;  1MF8 B;  3UG0 A;  2M49 B;  2ZKM X;  3SS0 A;  4W6S A;  5ER4 X;  2L5Y A;  3D10 A;  4E68 A;  4ORN A;  3RWT A;  4P5O E;  3V3D A;  3OX5 A;  1OOI X;  1ALV A;  4M2Q A;  4DRW A;  1RMP A;  1F55 A;  3AAK A;  3CB9 A;  3ZUL A;  3FE8 A;  1EMG A;  2GW4 B;  4ETO A;  3M22 A;  2GGZ A;  2L50 A;  2B1U A;  3L47 A;  3EK7 A;  1M45 A;  3S0B A;  4F7F A;  1KWO C;  2LVK A;  3BXC A;  2AAO A;  2CCM A;  1F71 A;  2BL0 B;  1BT6 A;  3DPW A;  2OTB A;  1A75 A;  5DPJ A;  2JAD A;  1BMO A;  3WHU B;  2YE0 A;  5HZT A;  3I5I B;  1GL4 A;  4N3D A;  2L51 A;  4PHM A;  4JFG A;  3U0M A;  5FHV A;  2G6X A;  1Y6W A;  1CMF A;  1NCY A;  2L2E A;  3AI5 A;  3BUW B;  4JQ0 D;  4NWS A;  1YX8 A;  1ODB A;  2AMI A;  1QWV A;  2F8P A;  2FJY A;  2ERB A;  2KHN A;  1J7O A;  3SVB A;  3U0L A;  1E8A A;  2WC5 A;  1W7S A;  2D8N A;  4PHN A;  1EMK A;  1EG3 A;  1WRL A;  1NPQ A;  5DPH A;  4JPZ B;  4W6H A;  3CZT X;  1TIZ A;  4MZK A;  2KAX A;  4N5X A;  2BEC A;  2PSR A;  4W6F A;  1QTX A;  2F2O A;  1SSE B;  1SNL A;  3AAJ A;  1MXE A;  4PFE A;  4XOV A;  1IGV A;  1MR8 A;  3NSI A;  2DUI A;  1LS8 A;  1YX7 A;  1Q73 A;  1N0Y A;  1NX3 A;  3CR5 X;  1GGX A;  5HL1 A;  1SYM A;  1CFC A;  3BUX B;  1W7J B;  1K96 A;  3GK1 A;  1IRJ A;  2K0J A;  2IS9 A;  1CM1 A;  4KF4 A;  3CFH A;  5KU1 A;  3P28 A;  1K2H A;  2WND A;  3FE6 A;  3CAB A;  2SAS A;  2RH7 A;  2L2C A;  3DZT A;  3MGF A;  2KAV A;  3LF3 A;  3ED8 A;  2ICR A;  1NX2 A;  2BBM A;  2TN4 A;  4KYN A;  5BTT B;  1L7Z A;  2LE9 B;  1OSA A;  2ZO7 A;  4UPG A;  3ZUJ A;  5HBD A;  3NXA A;  3I5G B;  1LA3 A;  1SBJ A;  2M7L A;  2KOT A;  2FL1 A;  5CSI A;  2COL B;  1DGU A;  4JGE A;  4NDC A;  4GES B;  3WNX B;  1K94 A;  2VAE A;  2AWK A;  4BDU A;  4CPV A;  2KI6 D;  3C1V A;  4KA9 A;  4ZFS A;  3EVV A;  2ISD A;  5LTQ A;  4BY4 A;  4W73 A;  3NGV A;  1CB1 A;  5EJU A;  2GTE A;  2M0R A;  5CSF A;  1EL4 A;  1YZW A;  3RLZ A;  4W6C A;  3WHT B;  3OX6 A;  5I2L A;  2H9W A;  2KGB C;  1MQ1 A;  3U0K A;  2H61 C;  1QJT A;  3CR2 A;  2ZMW A;  1B1G A;  3PFV A;  2BAP A;  4PCW A;  3OSQ A;  2OJK A;  4L1I A;  2VVI A;  2BE4 A;  1BF5 A;  2AHA A;  4KAG A;  4HE4 A;  1IQ3 A;  2LP3 A;  1KQV A;  3I5H C;  1NYA A;  3NSO A;  2OS8 B;  1UP5 A;  2M3W A;  5HLV A;  2QU1 A;  4PHJ A;  1EMF A;  4BY5 A;  4JD9 A;  1KK8 B;  1KQM C;  3AKO A;  2KQ6 A;  2A50 B;  2E6W A;  1YUR A;  1PVB A;  1DJY A;  1NX1 A;  2VAD A;  4JF9 A;  2H5O A;  2MLF C;  1Y0V H;  3G9A A;  4W7C A;  1DMO A;  2JWW A;  2L0P A;  1XSS A;  1HQV A;  3A8S A;  2IOV A;  2WIQ A;  4OVN F;  3ST4 A;  1K93 D;  1B4C A;  1IG5 A;  2L98 A;  4USL A;  3I5F B;  2A53 B;  3BXB A;  1Z2C B;  1ZGQ A;  1S6C A;  5LK4 A;  4P76 A;  1RMM A;  3BFB A;  2O60 A;  2WCJ A;  3Q8I A;  1YUU A;  1C3Y A;  1SR6 C;  3A4U B;  1QV1 A;  2FCD A;  3DQ4 A;  4KW8 A;  2KSP A;  1Z1Q A;  2L5X B;  2AWL A;  5FYX A;  1XVJ A;  1QIV A;  5CSN A;  3U8A A;  4LQT A;  1F0B A;  2ZRS A;  3D78 A;  2EMD A;  1F09 A;  5BT0 A;  3OP0 A;  2POX A;  3B7A A;  3NED A;  4A4C A;  4RYW A;  2AWM A;  2MAZ A;  2Q4U A;  4KW4 A;  4Q7U A;  4LJC A;  5KTG A;  2LLS A;  3GB3 A;  1XFU O;  2JXC A;  3DPX A;  4R1E A;  3NEZ A;  5BTT A;  4W77 A;  4H48 A;  2BCB A;  4AOM A;  1EMC A;  4WQ2 A;  4GGN A;  1NP8 A;  3PM2 A;  1T14 A;  1H4B A;  4NDD A;  4RYS A;  1YHG A;  1FI6 A;  2LV7 A;  4ZF5 A;  3B87 A;  3WLD A;  5AER A;  2PXW A;  4Q9W A;  3DVE A;  3L4L A;  1UHJ A;  2QRF A;  3O4X A;  2A56 B;  2WUR A;  3K21 A;  2F3Z A;  2MBX A;  2GX2 A;  3PJ7 A;  5DKR A;  1GGW A;  4W76 A;  3TUY C;  4OR9 B;  2PAL A;  5I2O A;  2V4E C;  1KK7 Y;  4DIR A;  5LTP A;  2CTN A;  2WCH A;  2ZRT A;  2G5Z B;  4GOB A;  3SVE A;  2MHH A;  1W9Z A;  3MSE B;  2WOR A;  3GJ1 A;  3EVR A;  2ZN8 A;  2Y1M A;  3DQ7 A;  5DU0 A;  1XQM A;  4GF6 B;  1OXF A;  3DF0 B;  3ZNI A;  2F33 A;  4LJD A;  2K7D A;  5HYD A;  5AAN A;  4GPL B;  4Q7R A;  2KAY A;  1CNP A;  1KCY A;  1MOV A;  3DQI A;  2P70 A;  1TNW A;  2DUF A;  3NT9 A;  1GGZ A;  4YGE B;  4L12 A;  4Q7T A;  4OZD A;  4W6D A;  1M31 A;  2M9G A;  4INW A;  3TMT A;  2BCA A;  2K2A A;  2JXL A;  2KLD A;  3OB1 B;  4Q04 A;  1QXT A;  1CTR A;  4MEW A;  1K90 D;  3DQE A;  4OHS A;  5T3I A;  1M46 A;  2QEV A;  1DEK A;  1QYQ A;  1KFX S;  3D0Y B;  1TNP A;  4B5Y A;  4YGD B;  2KFF A;  2Q91 A;  2WSO A;  2AUC A;  1CFF A;  3SG2 A;  4M2P A;  4H3M A;  2DDD A;  3SSK A;  2BE6 A;  1S1E A;  2ZMU A;  2PQL A;  3H1O A;  5BQL A;  5J3X A;  1OOF A;  3S0G A;  4MSP A;  1R6P A;  2K2F A;  3SIB A;  4CID A;  5EB7 A;  3SV5 A;  4KF5 C;  4HRG A;  4TZG A;  4YGC B;  1AP4 A;  2BKH B;  3A8R A;  3HCM A;  3DYE A;  3R1V A;  1K8U A;  3SG4 A;  5G08 A;  3BFH A;  4J89 A;  3DQ2 A;  3BOW B;  4FQT A;  1QXP A;  2H2K A;  2I94 A;  1B9A A;  3OHM B;  3IVT A;  5JJG A;  4AQI A;  2MLE C;  4OQW A;  1NX0 A;  5D69 A;  4A4B A;  5DRF A;  2H5P A;  2FWQ A;  1Y1U A;  3B6X A;  3I5I C;  1QYO A;  4PE0 A;  4YGA A;  3KHE A;  2OGR A;  1UHH A;  3O2P A;  2QZ0 A;  2PVB A;  2DDC A;  1YJF A;  4MRX A;  1AUI B;  1OQP A;  3D74 A;  3ADF A;  5DKQ A;  1ORG A;  2K60 A;  1J1E A;  3K1K A;  1AVS A;  3CGA A;  3EK4 A;  2QT2 A;  1JC0 A;  1WDC C;  1TTX A;  1DT7 B;  4PE7 A;  4ORC B;  2WCL A;  2NXQ A;  1QX5 B;  2K7C A;  3UNW A;  1ZGO A;  1UHI A;  3DVK A;  1UWO A;  4XGY A;  3GEX A;  3NHI A;  2LLU A;  1KYR A;  4PHK A;  2G2B A;  2SCP A;  1V1G A;  3DF0 A;  2HGY A;  1W7U A;  3EG5 B;  5HZO A;  2QDI A;  3LLE A;  1QAS A;  1KSO A;  2PRU A;  2LCP A;  1CKK A;  2K61 A;  1AJ5 A;  4ZIO A;  2C9J A;  3D76 A;  5FVI A;  2KNE A;  2JC2 A;  4YI8 A;  1XFY O;  1XO5 A;  1W7I B;  1FW4 A;  2Y5I A;  4NDB A;  5DRG A;  4GGF C;  3DQM A;  1QY3 A;  2LHI A;  2WHS A;  1XK4 C;  1KK7 Z;  2P4M A;  1KWO B;  4DXQ A;  3SSP A;  4DKN A;  3D0Y A;  2DD7 A;  5J2O A;  4ZB1 A;  4I5K A;  4JRB A;  1TNX A;  3BUM B;  4W72 A;  1RRX A;  4IK3 A;  3LVC A;  1UIS A;  2QLI A;  3BQ3 A;  2HF5 A;  3TZ1 A;  3CWG A;  3DQH A;  1JUO A;  2M97 A;  2P6B B;  2HJO A;  3LS3 A;  1M39 A;  2MRD A;  3E5T A;  3LVA A;  4XJK B;  3SSV A;  4EUL A;  2I2R E;  4OKH A;  4XYN A;  2QAC A;  4Z4M A;  1S36 A;  2L4H A;  2QPT A;  1GFL A;  4W6L A;  2DUG A;  2LAN A;  1WRZ A;  3SIA A;  3R1P A;  4PPK A;  4Z4K A;  5PAL A;  4YRU A;  3BOW A;  3DQ8 A;  2M1K B;  2E30 A;  4W7F A;  5IBW A;  1NUB A;  4QJ4 B;  1MOU A;  4PPJ A;  1LIN A;  3CGL A;  4Q9X A;  3GK2 A;  3AKB A;  3ST3 A;  4L9M A;  4IK4 A;  5HGE A;  1S5G Z;  5JOL A;  1J7P A;  1SCM C;  1IIO A;  5D7F A;  2JQ6 A;  4OY4 A;  1ZOT B;  4PDZ A;  5CPV A;  3PAL A;  5F6T A;  2OKY A;  3DPZ A;  1Y1A A;  3SSY A;  4H3N A;  1XFZ O;  1R2U A;  3U8P A;  2KI6 C;  2HQK A;  1JFK A;  4DXN A;  2HQ8 A;  2CT9 A;  1XFR A;  3DQK A;  1DJH A;  1RK9 A;  3F45 A;  4W6B A;  4PE1 A;  4ZIN A;  1BLQ A;  4C0J A;  2G3O A;  2I7A A;  4TNC A;  1PK0 D;  3TMR A;  1WLM A;  4CLN A;  1HUY A;  2KFH A;  2LVV A;  1C07 A;  4YI9 A;  4RTC A;  1TCF A;  2JNX A;  5FVF A;  3SST A;  1JBY A;  4PE4 A;  3E5W A;  3WLC A;  5HLO A;  2M29 A;  3PM8 A;  1IWQ A;  4OGS A;  3N7H A;  3FIA A;  2YE1 A;  5ER5 A;  3W1C A;  3DQO A;  1OE9 B;  1CDP A;  4LJB A;  5AQB B;  4L13 A;  2EHB A;  2KLE A;  4CFR A;  1TRF A;  1MYW A;  3CTN A;  1B7T Y;  4INX A;  1CLL A;  3VRN A;  1UHK A;  4R6B A;  3ICB A;  3LL8 B;  2G6Y A;  1BJF A;  1REC A;  1OMV A;  3CD9 A;  5EBJ A;  2KFG A;  3PJB A;  4ORA B;  3DQF A;  2BBN A;  4DXP A;  2Y1N A;  4PT1 A;  1EMB A;  4EDS A;  2NLN A;  1QX2 A;  4HQ9 A;  1P28 A;  2V53 A;  1RMO A;  1BR1 B;  3VB1 A;  4HQ8 A;  3I5H B;  2Z1O A;  1WY9 A;  3SVS A;  1K9K A;  4XJK A;  3DVJ A;  1HT9 A;  3DQ3 A;  5DTX A;  2I18 A;  3HX4 A;  3D73 A;  4GNK B;  1KQM B;  2JU0 A;  3TS5 C;  1TUZ A;  3KCT A;  4B30 B;  5HKW A;  3M24 A;  3O4Y A;  1OMD A;  4HSZ A;  1Q80 A;  3UO9 A;  2GX0 A;  4OV2 A;  2PYQ A;  1KFX L;  2GGM A;  4W69 A;  5LTR A;  3O78 A;  4EN1 A;  1UUR A;  2OTE A;  2MA2 A;  1IQ5 A;  1SL8 A;  1JBZ A;  4W7X A;  2Z6Z A;  3SS4 A;  1BOC A;  1JBA A;  1KFU L;  3S0D A;  5DPG A;  3I19 A;  1DJI A;  4C0K A;  5DKN A;  4IK9 A;  1NSH A;  3KO0 A;  2CXJ A;  2KBM A;  1OZO A;  3CZ2 A;  2OTG C;  1S6J A;  3IQO A;  1AHR A;  2ZFD A;  3CLN A;  2HFC A;  1SR6 B;  1LKJ A;  1CV7 A;  5TNC A;  3JTD C;  3LF4 B;  4XL5 A;  1SL9 A;  1QX7 A;  3TDI A;  2JUL A;  3JVT C;  3CFF A;  4W6M A;  1YUT A;  1SCV A;  4W6O A;  3S0A A;  1N2D A;  3L4A A;  3TDZ A;  1PSR A;  2R2I A;  1QYF A;  2GW3 A;  3O77 A;  1TNQ A;  2K8M B;  2WCF A;  2IB6 A;  2AWJ A;  1RFJ A;  2LHL A;  1OOH A;  2K7O A;  4DKM A;  3PN7 C;  1YHH A;  4ANJ A;  3IP2 A;  3NT3 A;  4JEO A;  3IQQ A;  4IZN A;  2F2P A;  4KGF A;  5BPJ A;  2Y4Q A;  4I5N B;  2JNF A;  3R1O A;  5K89 A;  2A47 A;  4KPI A;  5I8N A;  4MZL A;  1F8H A;  1Q4A A;  2JT3 A;  4FTG A;  2HPS A;  5HZS A;  1KP5 A;  2OPO A;  1B8C A;  2G9B A;  5H87 A;  1L2O C;  1C3Z A;  5KSZ A;  1UUS A;  3CZ1 A;  1S6Z A;  4ORB B;  1YTZ C;  3KPX A;  4IK1 A;  2EC6 C;  1JFJ A;  3CD1 A;  4W6A A;  2JT0 A;  4HVF A;  1KYP A;  3TUY B;  4TZA A;  2G2S B;  1OW4 A;  2V4E B;  3DY9 A;  3EVU A;  4IK8 A;  4W6P A;  2H61 A;  4EDO A;  2KI4 B;  1A03 A;  1ZGP A;  4MN0 A;  1PVA A;  1SK6 D;  2O2B A;  2M8U A;  1RM9 A;  5DTL A;  4KEX A;  4I2Y A;  1YUS A;  3UFZ A;  3VHT B;  1J7R A;  2HCG A;  2QEB A;  3ZWH A;  1XA5 A;  4W6I A;  2L4I A;  4XOW A;  1FI5 A;  2Y0G A;  2VVH A;  1DJZ A;  2A4J A;  3SG3 A;  4LW5 A;  1K9P A;  1EMM A;  5AEQ A;  1ALW A;  1B8R A;  3LA1 A;  2KPH A;  3BXA A;  3NF0 A;  4B30 A;  3SSH A;  1OMR A;  4OJ0 A;  4J88 A;  1B7T Z;  3TDU A;  1VRK A;  3FE9 A;  1DJX A;  2BL0 C;  4W6G A;  3RWA A;  1MXL C;  2QLG B;  3AKA A;  1AK8 A;  1MUX A;  4W7R A;  3H4S E;  1C4F A;  4U2V A;  1JSA A;  1SL7 A;  1SY9 A;  1XFV O;  3S0E A;  2DOQ A;  5H89 A;  3FWC A;  1OOJ A;  3VK1 A;  2H8Q A;  3SVO A;  1OXE A;  2WIS A;  4LQU A;  3NSK A;  2KYC A;  1ZFS A;  4NQG A;  3DQ9 A;  5DIC A;  3DQL A;  4AR7 A;  5EXC I;  3VRR A;  3KEV A;  4AS8 A;  4KW9 A;  2FCE A;  3OGN A;  1DC1 A;  1PUL A;  3ZUF A;  1M63 B;  2LVI A;  1QLK A;  4GBA A;  2JTT A;  1F70 A;  2PMY A;  3QRX A;  5D3O A;  3SG5 A;  1IJ6 A;  3BUO B;  1DEL A;  1EG4 A;  2EMO A;  1UHN A;  3V2L A;  5B8I B;  3OSR A;  4ZF3 A;  2RGI A;  1GQM A;  1CLB A;  4EMQ A;  1PSB A;  1J55 A;  2G16 B;  1DJG A;  3GJ2 A;  1Q4D A;  4DXO A;  2WSN A;  3VGO A;  1NCX A;  1JWD A;  1DF0 B;  1G33 A;  2QEH A;  1CM4 A;  1EJ3 A;  3NHT A;  1NIW A;  2VZX A;  1XFX O;  2H5R A;  1K9U A;  1DTL A;  2P71 A;  3CR4 X;  2OKW A;  3PLF B;  1XMZ A;  3DQN A;  2B3P A;  4DXI A;  2JRF A;  2C9I A;  2BTJ A;  2LM5 A;  2HPW A;  1NCZ A;  4W7D A;  3DQU A;  5EXU A;  2LUC A;  3OBV A;  3P8U A;  4D1E A;  2LUX A;  1WDC B;  3LVD A;  2O24 A;  4W6T A;  1ZAC A;  1ZUZ A;  2CBL A;  4QJ5 B;  2JPO A;  2QLH A;  1F4Q A;  1G4Y R;  3DQ1 A;  2VRG A;  3BXK A;  2V4E A;  4R6D A;  1X02 A;  2HGD A;  3U8C A;  3E3R A;  1SRA A;  3IF7 A;  5DY6 A;  2YGU A;  3WCK A;  3KF9 A;  2ARL A;  2LVJ A;  1EXR A;  1TOP A;  3VHT A;  1YFP A;  1KYS A;  3S05 A;  2BKI B;  1G7K A;  2Q57 A;  4ZF4 A;  1EML A;  2YFP A;  3I5G C;  5EHU A;  4DCK A;  1C7W A;  1EME A;  1DGV A;  2LP2 A;  2DUH A;  1CDL A;  1DJW A;  2BNX A;  4HRE E;  3BYA A;  1B8L A;  2WCE A;  4XVP A;  5H88 A;  1CLM A;  4P2Y B;  2A46 A;  2ZND A;  4DS7 A;  2WCB A;  4HRH A;  1G8I A;  2KDH A;  4WRI A;  4W7A A;  4JC2 A;  3SVN A;  4YGB B;  2H6V A;  3NSL A;  2DUE A;  2QLG A;  2JT8 A;  1H4U A;  2HET A;  1F54 A;  5DPI A;  3DQ5 A;  4ZCV A;  1J7Q A;  5DQB A;  1DQE A;  4LJD C;  3FS7 A;  1Z1P A;  2KBI A;  2HRS A;  2IE2 A;  3DQ6 A;  4C0L A;  2OS8 C;  1DVI A;  1FPW A;  1QS7 A;  3GOF A;  1IJ5 A;  2O29 A;  4F0Z B;  1KK8 C;  3SVC A;  1XYD A;  5HKY A;  1NWD A;  2A48 A;  4W7E A;  1BR4 B;  1K95 A;  5CSJ A;  1EH2 A;  1QVI Y;  4KF5 A;  1XA9 A;  2FOT A;  1IKU A;  1S26 D;  3D75 A;  5EB6 A;  1YVL A;  3RM1 A;  1QLS A;  1MWN A;  4W6K A;  1OZS A;  5FI6 A;  4P1Q A;  5F9G A;  2M7N A;  1Q4E A;  1BFP A;  4AQJ A;  3SJS A;  5AXI A;  3S0F A;  3I5F C;  2JTZ A;  1D1O A;  1IH0 A;  2PXS A;  4HQC A;  1DF0 A;  2BCX A;  1Y1X A;  1SCM B;  3OB2 B;  4DUQ A;  3RZS A;  3DQD A;  2KYF A;  2B3Q A;  2WHU A;  5I2Q A;  1U5I B;  1H6R A;  1YRU B;  4W74 A;  1CFD A;  1XAE A;  2H8V A;  3LSA A;  4W6U A;  3PIB A;  2VVJ A;  3K1E A;  5KTY A;  2ZNE A;  3SVR A;  2FJU B;  1LXF C;  2DD9 A;  4UTS A;  1TCO B;  2LLT A;  4ZBL A;  3SG6 A;  1C7V A;  4W6R A;  3LK1 A;  2M1U A;  3D77 A;  3SS3 A;  1RWY A;  2LMU A;  4GFT A;  3DQC A;  1JF2 A;  2NCP A;  3FWB A;  1TUJ A;  1GM0 A;  3PAT A;  2HQZ A;  4W6N A;  4U8D A;  5AFP A;  1SPY A;  3EKH A;  5EXB A;  3ST2 A;  1OXD A;  1A2X A;  1S6I A;  4DXM A;  2JPT A;  1W7T A;  1SKT A;  3CYZ A;  4H47 A;  1TN4 A;  2G6E A;  4KGE A;  3LK0 A;  3U0N A;  2Z6Y A;  3AI4 A;  2QLE A;  3BFA A;  1SW8 A;  4GGF A;  4CFQ A;  3EK8 A;  4GAO A;  4MLW A;  1LA0 A;  2WCK A;  3R72 A;  1QAT A;  4IK5 A;  1XK4 A;  1OOG A;  1B9C A;  3OGO A;  1MHO A;  1Q4B A;  1PAL A;  1HCJ A;  5I94 A;  3CBE A;  3BUN B;  3CDN A;  2NZ0 A;  4W6J A;  1YJ2 A;  3GL4 A;  4J8A A;  5HKZ A;  1A4P A;  1EMA A;  2JOJ A;  1S3P A;  1CFP A;  1KSM A;  4N1G A;  2KQY A;  1YRT B;  2EMN A;  2NCO A;  1V1F A;  2LAP A;  2FZU A;  4GUK A;  3LCP C;  4I5J A;  5DTY A;  3B86 A;  1RRO A;  3DD4 A;  2O5G A;  2Z6X A;  2H5Q A;  3W1D A;  1FBV A;  1GJY A;  3KCS A;  2LC5 A;  1AJ4 A;  3TS5 B;  3SS5 A;  5HZU A;  4WQ3 A;  1ZUX A;  1LVC D;  1JC1 A;  1QIW A;  4PPL A;  1YR5 A;  1A75 B;  4MZJ A;  4QJ3 B;  3SG7 A;  5HW9 A;  2EGD A;  1Q4C A;  1B47 A;  2KI4 C;  3PJ5 A;  2LNK A;  2WC6 A;  2HQW A;  3EVP A;  2GV5 A;  1XFW O;  1JC2 A;  2WOS A;  3O6B A;  4MVF A;  2OTG B;  2YDZ A;  3DQA A;  5FI7 A;  3JTD B;  1PRW A;  3SRY A;  5FI2 A;  3WXA A;  1U5I A;  3JVT B;  1BU3 A;  3H1R A;  4H3L A;  2WCM A;  1QVI Z;  1YHI A;  2KGR A;  1ZMZ A;  3DXL A;  5DTZ A;  5GQQ C;  3CS1 A;  1FF1 A;  2A52 B;  4OCI A;  2IB5 A;  1BG1 A;  2ZN9 A;  1SMG A;  1QV0 A;  4JWQ A;  3SVU A;  2LMT A;  1A29 A;  2MJW B;  1WRK A;  1Z4H A;  4I5L B;  4JKT A;  3VRP A;  2G3D B;  2QEO A;  3PN7 B;  2JZI A;  5EL2 A;  4IJ7 A;  4W75 A;  2LMV A;  1CMG A; 
#chains in the Genus database with same CATH homology
 2WHT A;  3VRQ A;  3DVM A;  3GK4 X;  3IR8 A;  2WC8 A;  3DQJ A;  1JF0 A;  2F3Y A;  1KFU S;  2K7B A;  1J1D A;  1S5G Y;  4IL1 A;  3PSR A;  3E5V A;  4MBE A;  3SSL A;  1YVH A;  3EKJ A;  4YBH B;  2A54 B;  1CDN A;  2AH8 A;  3M0W A;  4N1F A;  4ZCU A;  1BOD A;  3CFA A;  3ZTF A;  4MRY A;  1L2O B;  2PAS A;  5DQM A;  1F4O A;  1CDM A;  3VRO A;  1WLZ A;  3BX9 A;  2EC6 B;  1H8B A;  1RJV A;  4ICB A;  2CNP A;  3VIC A;  4PAL A;  2Q6P A;  3ST0 A;  1RTP 1;  4FQO A;  5FVG A;  2ZO6 A;  4M2O A;  3SVD A;  1N65 A;  1MF8 B;  3UG0 A;  2M49 B;  2ZKM X;  3SS0 A;  4W6S A;  5ER4 X;  4ORN A;  3D10 A;  4E68 A;  3RWT A;  4P5O E;  3V3D A;  3OX5 A;  1ALV A;  4M2Q A;  4DRW A;  1RMP A;  1F55 A;  3AAK A;  3CB9 A;  3ZUL A;  1EMG A;  2GW4 B;  4ETO A;  3M22 A;  2GGZ A;  2L50 A;  2B1U A;  3EK7 A;  1M45 A;  1KWO C;  2LVK A;  3BXC A;  2AAO A;  2CCM A;  1F71 A;  2BL0 B;  1BT6 A;  3DPW A;  2OTB A;  1A75 A;  5DPJ A;  2JAD A;  1BMO A;  3WHU B;  2YE0 A;  5HZT A;  3I5I B;  1GL4 A;  4N3D A;  2L51 A;  4PHM A;  4JFG A;  3U0M A;  5FHV A;  2G6X A;  1Y6W A;  1CMF A;  1NCY A;  2L2E A;  3AI5 A;  3BUW B;  4JQ0 D;  4NWS A;  1YX8 A;  1ODB A;  2AMI A;  2F8P A;  2KHN A;  1J7O A;  3SVB A;  3U0L A;  1E8A A;  1W7S A;  2D8N A;  4PHN A;  1EMK A;  1EG3 A;  1WRL A;  1NPQ A;  5DPH A;  4JPZ B;  4W6H A;  3CZT X;  1TIZ A;  4MZK A;  2KAX A;  4N5X A;  2BEC A;  2PSR A;  4W6F A;  1QTX A;  2F2O A;  1SNL A;  3AAJ A;  1MXE A;  4PFE A;  4XOV A;  1IGV A;  1MR8 A;  3NSI A;  2DUI A;  1YX7 A;  1Q73 A;  1N0Y A;  1NX3 A;  3CR5 X;  1GGX A;  1SYM A;  1CFC A;  3BUX B;  1W7J B;  1K96 A;  3GK1 A;  1IRJ A;  2K0J A;  2IS9 A;  1CM1 A;  4KF4 A;  3CFH A;  5KU1 A;  3P28 A;  1K2H A;  2WND A;  2SAS A;  2RH7 A;  3MGF A;  2KAV A;  3LF3 A;  3ED8 A;  2ICR A;  1NX2 A;  2BBM A;  2TN4 A;  5BTT B;  1L7Z A;  2LE9 B;  1OSA A;  2ZO7 A;  4UPG A;  3ZUJ A;  5HBD A;  3NXA A;  3I5G B;  1LA3 A;  1SBJ A;  2M7L A;  2KOT A;  2FL1 A;  5CSI A;  2COL B;  1DGU A;  4JGE A;  4NDC A;  4GES B;  3WNX B;  1K94 A;  2VAE A;  2AWK A;  4BDU A;  4CPV A;  2KI6 D;  3C1V A;  4KA9 A;  4ZFS A;  3EVV A;  2ISD A;  5LTQ A;  4BY4 A;  4W73 A;  1CB1 A;  5EJU A;  2M0R A;  5CSF A;  1EL4 A;  1YZW A;  3RLZ A;  4W6C A;  3WHT B;  3OX6 A;  5I2L A;  2H9W A;  2KGB C;  1MQ1 A;  3U0K A;  2H61 C;  1QJT A;  3CR2 A;  2ZMW A;  1B1G A;  3PFV A;  4PCW A;  3OSQ A;  2OJK A;  4L1I A;  2VVI A;  2BE4 A;  1BF5 A;  2AHA A;  4KAG A;  4HE4 A;  1IQ3 A;  2LP3 A;  1KQV A;  3I5H C;  1NYA A;  3NSO A;  2OS8 B;  1UP5 A;  2M3W A;  5HLV A;  2QU1 A;  4PHJ A;  1EMF A;  4BY5 A;  1KK8 B;  1KQM C;  3AKO A;  2KQ6 A;  2A50 B;  2E6W A;  1YUR A;  1PVB A;  1DJY A;  1NX1 A;  2VAD A;  4JF9 A;  2H5O A;  2MLF C;  1Y0V H;  3G9A A;  4W7C A;  1DMO A;  2JWW A;  2L0P A;  1XSS A;  1HQV A;  3A8S A;  2IOV A;  2WIQ A;  4OVN F;  3ST4 A;  1K93 D;  1B4C A;  1IG5 A;  2L98 A;  4USL A;  3I5F B;  2A53 B;  3BXB A;  1ZGQ A;  1S6C A;  5LK4 A;  4P76 A;  1RMM A;  2O60 A;  1YUU A;  1SR6 C;  3A4U B;  1QV1 A;  2FCD A;  3DQ4 A;  4KW8 A;  2KSP A;  1Z1Q A;  2L5X B;  2AWL A;  5FYX A;  1XVJ A;  1QIV A;  5CSN A;  3U8A A;  4LQT A;  1F0B A;  2ZRS A;  2EMD A;  1F09 A;  5BT0 A;  3OP0 A;  2POX A;  3NED A;  4A4C A;  4RYW A;  2AWM A;  2MAZ A;  2Q4U A;  4KW4 A;  4Q7U A;  4LJC A;  5KTG A;  2LLS A;  3GB3 A;  1XFU O;  2JXC A;  3DPX A;  4R1E A;  3NEZ A;  5BTT A;  4W77 A;  4H48 A;  2BCB A;  4AOM A;  1EMC A;  4WQ2 A;  4GGN A;  1NP8 A;  1H4B A;  4NDD A;  4RYS A;  1YHG A;  1FI6 A;  2LV7 A;  4ZF5 A;  3WLD A;  5AER A;  2PXW A;  4Q9W A;  3DVE A;  1UHJ A;  2QRF A;  2A56 B;  2WUR A;  3K21 A;  2F3Z A;  2MBX A;  2GX2 A;  5DKR A;  1GGW A;  4W76 A;  3TUY C;  4OR9 B;  2PAL A;  5I2O A;  2V4E C;  1KK7 Y;  4DIR A;  5LTP A;  2CTN A;  2ZRT A;  2G5Z B;  4GOB A;  3SVE A;  2MHH A;  3MSE B;  2WOR A;  3GJ1 A;  3EVR A;  2ZN8 A;  2Y1M A;  3DQ7 A;  5DU0 A;  1XQM A;  4GF6 B;  1OXF A;  3DF0 B;  3ZNI A;  2F33 A;  4LJD A;  2K7D A;  5HYD A;  5AAN A;  4GPL B;  4Q7R A;  2KAY A;  1CNP A;  1KCY A;  1MOV A;  3DQI A;  1TNW A;  2DUF A;  3NT9 A;  1GGZ A;  4YGE B;  4L12 A;  4Q7T A;  4W6D A;  1M31 A;  2M9G A;  3TMT A;  2BCA A;  2K2A A;  2JXL A;  3OB1 B;  4Q04 A;  1QXT A;  1CTR A;  4MEW A;  1K90 D;  3DQE A;  4OHS A;  5T3I A;  1M46 A;  1QYQ A;  1KFX S;  3D0Y B;  1TNP A;  4B5Y A;  4YGD B;  2KFF A;  2Q91 A;  2WSO A;  2AUC A;  1CFF A;  3SG2 A;  4M2P A;  4H3M A;  2DDD A;  3SSK A;  2BE6 A;  1S1E A;  2ZMU A;  3H1O A;  5BQL A;  5J3X A;  4MSP A;  1R6P A;  2K2F A;  3SIB A;  4CID A;  5EB7 A;  3SV5 A;  4KF5 C;  4HRG A;  4TZG A;  4YGC B;  1AP4 A;  2BKH B;  3A8R A;  3HCM A;  1K8U A;  3SG4 A;  5G08 A;  4J89 A;  3DQ2 A;  3BOW B;  1QXP A;  2H2K A;  2I94 A;  1B9A A;  3OHM B;  5JJG A;  4AQI A;  2MLE C;  4OQW A;  1NX0 A;  5D69 A;  4A4B A;  5DRF A;  2H5P A;  2FWQ A;  1Y1U A;  3I5I C;  1QYO A;  4PE0 A;  4YGA A;  3KHE A;  2OGR A;  1UHH A;  3O2P A;  2QZ0 A;  2PVB A;  2DDC A;  1YJF A;  4MRX A;  1AUI B;  1OQP A;  3ADF A;  5DKQ A;  1J1E A;  3K1K A;  1AVS A;  3CGA A;  3EK4 A;  2QT2 A;  1JC0 A;  1WDC C;  1TTX A;  1DT7 B;  4PE7 A;  4ORC B;  2NXQ A;  1QX5 B;  2K7C A;  1ZGO A;  1UHI A;  3DVK A;  1UWO A;  4XGY A;  3GEX A;  2LLU A;  1KYR A;  4PHK A;  2G2B A;  2SCP A;  1V1G A;  3DF0 A;  2HGY A;  1W7U A;  5HZO A;  3LLE A;  1QAS A;  1KSO A;  2PRU A;  2LCP A;  1CKK A;  2K61 A;  1AJ5 A;  4ZIO A;  2C9J A;  5FVI A;  2KNE A;  2JC2 A;  4YI8 A;  1XFY O;  1XO5 A;  1W7I B;  1FW4 A;  2Y5I A;  4NDB A;  5DRG A;  4GGF C;  3DQM A;  1QY3 A;  2LHI A;  2WHS A;  1XK4 C;  1KK7 Z;  2P4M A;  1KWO B;  4DXQ A;  3SSP A;  4DKN A;  3D0Y A;  2DD7 A;  5J2O A;  4ZB1 A;  4I5K A;  4JRB A;  1TNX A;  3BUM B;  4W72 A;  1RRX A;  4IK3 A;  3LVC A;  1UIS A;  2QLI A;  3BQ3 A;  2HF5 A;  3TZ1 A;  3CWG A;  3DQH A;  1JUO A;  2M97 A;  2P6B B;  2HJO A;  3LS3 A;  1M39 A;  2MRD A;  3E5T A;  3LVA A;  4XJK B;  3SSV A;  4EUL A;  2I2R E;  4OKH A;  4XYN A;  2QAC A;  4Z4M A;  1S36 A;  2L4H A;  2QPT A;  1GFL A;  4W6L A;  2DUG A;  2LAN A;  1WRZ A;  3SIA A;  4PPK A;  4Z4K A;  5PAL A;  4YRU A;  3BOW A;  3DQ8 A;  2M1K B;  2E30 A;  4W7F A;  5IBW A;  1NUB A;  4QJ4 B;  1MOU A;  4PPJ A;  1LIN A;  3CGL A;  4Q9X A;  3GK2 A;  3AKB A;  3ST3 A;  4L9M A;  4IK4 A;  5HGE A;  1S5G Z;  5JOL A;  1J7P A;  1SCM C;  5D7F A;  4OY4 A;  2JQ6 A;  1ZOT B;  4PDZ A;  5CPV A;  3PAL A;  5F6T A;  2OKY A;  3DPZ A;  1Y1A A;  3SSY A;  4H3N A;  1XFZ O;  1R2U A;  3U8P A;  2KI6 C;  2HQK A;  1JFK A;  4DXN A;  2HQ8 A;  2CT9 A;  3DQK A;  1DJH A;  1RK9 A;  3F45 A;  4W6B A;  4PE1 A;  4ZIN A;  1BLQ A;  4C0J A;  2G3O A;  2I7A A;  4TNC A;  1PK0 D;  3TMR A;  1WLM A;  4CLN A;  1HUY A;  2KFH A;  2LVV A;  1C07 A;  4YI9 A;  4RTC A;  1TCF A;  2JNX A;  5FVF A;  3SST A;  1JBY A;  4PE4 A;  3E5W A;  3WLC A;  5HLO A;  2M29 A;  3PM8 A;  1IWQ A;  4OGS A;  3FIA A;  2YE1 A;  5ER5 A;  3W1C A;  3DQO A;  1OE9 B;  1CDP A;  4LJB A;  5AQB B;  4L13 A;  2EHB A;  4CFR A;  1TRF A;  1MYW A;  3CTN A;  1B7T Y;  1CLL A;  3VRN A;  1UHK A;  4R6B A;  3ICB A;  3LL8 B;  2G6Y A;  1BJF A;  1REC A;  1OMV A;  3CD9 A;  5EBJ A;  2KFG A;  3PJB A;  4ORA B;  3DQF A;  2BBN A;  4DXP A;  2Y1N A;  1EMB A;  4EDS A;  2NLN A;  1QX2 A;  4HQ9 A;  2V53 A;  1RMO A;  1BR1 B;  4HQ8 A;  3I5H B;  2Z1O A;  1WY9 A;  3SVS A;  1K9K A;  4XJK A;  3DVJ A;  1HT9 A;  3DQ3 A;  5DTX A;  2I18 A;  3HX4 A;  4GNK B;  1KQM B;  2JU0 A;  3TS5 C;  3KCT A;  4B30 B;  5HKW A;  3M24 A;  3O4Y A;  1OMD A;  4HSZ A;  1Q80 A;  2GX0 A;  4OV2 A;  1KFX L;  2GGM A;  4W69 A;  5LTR A;  3O78 A;  4EN1 A;  1UUR A;  2OTE A;  2MA2 A;  1IQ5 A;  1SL8 A;  1JBZ A;  4W7X A;  2Z6Z A;  1BOC A;  1JBA A;  1KFU L;  5DPG A;  3I19 A;  1DJI A;  4C0K A;  5DKN A;  4IK9 A;  1NSH A;  3KO0 A;  2CXJ A;  2KBM A;  1OZO A;  2OTG C;  1S6J A;  3IQO A;  1AHR A;  2ZFD A;  3CLN A;  2HFC A;  1SR6 B;  1LKJ A;  1CV7 A;  5TNC A;  3JTD C;  3LF4 B;  4XL5 A;  1SL9 A;  1QX7 A;  3TDI A;  2JUL A;  3JVT C;  3CFF A;  4W6M A;  1YUT A;  1SCV A;  4W6O A;  1N2D A;  3TDZ A;  1PSR A;  2R2I A;  1QYF A;  2GW3 A;  3O77 A;  1TNQ A;  2K8M B;  2WCF A;  2IB6 A;  2AWJ A;  1RFJ A;  2LHL A;  2K7O A;  4DKM A;  3PN7 C;  1YHH A;  4ANJ A;  3IP2 A;  3NT3 A;  4JEO A;  3IQQ A;  4IZN A;  2F2P A;  4KGF A;  5BPJ A;  2Y4Q A;  4I5N B;  2JNF A;  5K89 A;  2A47 A;  4KPI A;  5I8N A;  4MZL A;  1F8H A;  1Q4A A;  2JT3 A;  4FTG A;  2HPS A;  5HZS A;  1KP5 A;  2OPO A;  1B8C A;  2G9B A;  5H87 A;  1L2O C;  5KSZ A;  1UUS A;  1S6Z A;  4ORB B;  1YTZ C;  3KPX A;  4IK1 A;  2EC6 C;  1JFJ A;  3CD1 A;  4W6A A;  2JT0 A;  4HVF A;  1KYP A;  3TUY B;  4TZA A;  2G2S B;  2V4E B;  3EVU A;  4IK8 A;  4W6P A;  2H61 A;  4EDO A;  2KI4 B;  1A03 A;  1ZGP A;  4MN0 A;  1PVA A;  1SK6 D;  2O2B A;  2M8U A;  1RM9 A;  5DTL A;  4KEX A;  4I2Y A;  1YUS A;  3UFZ A;  3VHT B;  1J7R A;  2HCG A;  3ZWH A;  1XA5 A;  4W6I A;  2L4I A;  4XOW A;  1FI5 A;  2Y0G A;  2VVH A;  1DJZ A;  2A4J A;  3SG3 A;  4LW5 A;  1K9P A;  1EMM A;  5AEQ A;  1ALW A;  1B8R A;  3LA1 A;  3BXA A;  3NF0 A;  4B30 A;  3SSH A;  1OMR A;  4OJ0 A;  4J88 A;  1B7T Z;  3TDU A;  1VRK A;  1DJX A;  2BL0 C;  4W6G A;  3RWA A;  1MXL C;  2QLG B;  3AKA A;  1AK8 A;  1MUX A;  4W7R A;  3H4S E;  1C4F A;  4U2V A;  1JSA A;  1SL7 A;  1SY9 A;  1XFV O;  2DOQ A;  5H89 A;  3FWC A;  1OOJ A;  3VK1 A;  2H8Q A;  3SVO A;  1OXE A;  2WIS A;  4LQU A;  3NSK A;  2KYC A;  1ZFS A;  4NQG A;  3DQ9 A;  3DQL A;  4AR7 A;  5EXC I;  3VRR A;  3KEV A;  4AS8 A;  4KW9 A;  2FCE A;  3ZUF A;  1PUL A;  1M63 B;  2LVI A;  1QLK A;  4GBA A;  2JTT A;  1F70 A;  2PMY A;  3QRX A;  3SG5 A;  1IJ6 A;  3BUO B;  1EG4 A;  2EMO A;  1UHN A;  5B8I B;  3OSR A;  4ZF3 A;  2RGI A;  1GQM A;  1CLB A;  4EMQ A;  1PSB A;  1J55 A;  2G16 B;  1DJG A;  3GJ2 A;  1Q4D A;  4DXO A;  2WSN A;  3VGO A;  1NCX A;  1JWD A;  1DF0 B;  1G33 A;  1CM4 A;  1EJ3 A;  2VZX A;  1NIW A;  1XFX O;  2H5R A;  1K9U A;  1DTL A;  3CR4 X;  2OKW A;  3PLF B;  1XMZ A;  3DQN A;  2B3P A;  4DXI A;  2JRF A;  2C9I A;  2BTJ A;  2LM5 A;  2HPW A;  1NCZ A;  4W7D A;  3DQU A;  5EXU A;  2LUC A;  3P8U A;  4D1E A;  2LUX A;  1WDC B;  3LVD A;  4W6T A;  2O24 A;  1ZAC A;  1ZUZ A;  2CBL A;  4QJ5 B;  2QLH A;  1F4Q A;  1G4Y R;  3DQ1 A;  2VRG A;  3BXK A;  2V4E A;  4R6D A;  1X02 A;  2HGD A;  3U8C A;  3E3R A;  1SRA A;  3IF7 A;  5DY6 A;  3WCK A;  3KF9 A;  2ARL A;  2LVJ A;  1EXR A;  1CMG A;  1TOP A;  3VHT A;  1YFP A;  1KYS A;  3S05 A;  2BKI B;  1G7K A;  2Q57 A;  4ZF4 A;  1EML A;  2YFP A;  3I5G C;  5EHU A;  4DCK A;  1C7W A;  1EME A;  1DGV A;  2LP2 A;  2DUH A;  1CDL A;  1DJW A;  4HRE E;  3BYA A;  1B8L A;  2WCE A;  4XVP A;  5H88 A;  1CLM A;  4P2Y B;  2A46 A;  2ZND A;  4DS7 A;  2WCB A;  4HRH A;  1G8I A;  2KDH A;  4WRI A;  4W7A A;  4JC2 A;  3SVN A;  4YGB B;  2H6V A;  3NSL A;  2DUE A;  2QLG A;  2JT8 A;  1H4U A;  2HET A;  1F54 A;  5DPI A;  3DQ5 A;  4ZCV A;  1J7Q A;  5DQB A;  4LJD C;  3FS7 A;  1Z1P A;  2KBI A;  2HRS A;  2IE2 A;  3DQ6 A;  4C0L A;  2OS8 C;  1DVI A;  1FPW A;  1QS7 A;  3GOF A;  1IJ5 A;  2O29 A;  4F0Z B;  1KK8 C;  3SVC A;  1XYD A;  5HKY A;  1NWD A;  2A48 A;  4W7E A;  1BR4 B;  1K95 A;  5CSJ A;  1EH2 A;  1QVI Y;  4KF5 A;  1XA9 A;  2FOT A;  1IKU A;  1S26 D;  5EB6 A;  1YVL A;  3RM1 A;  1QLS A;  1MWN A;  4W6K A;  1OZS A;  4P1Q A;  5F9G A;  2M7N A;  1Q4E A;  1BFP A;  4AQJ A;  3SJS A;  5AXI A;  3I5F C;  2JTZ A;  1D1O A;  1IH0 A;  2PXS A;  4HQC A;  1DF0 A;  2BCX A;  1Y1X A;  1SCM B;  3OB2 B;  4DUQ A;  3DQD A;  2KYF A;  2B3Q A;  2WHU A;  5I2Q A;  1U5I B;  1H6R A;  1YRU B;  4W74 A;  1CFD A;  1XAE A;  3LSA A;  4W6U A;  3PIB A;  2VVJ A;  5KTY A;  2ZNE A;  3SVR A;  2FJU B;  1LXF C;  2DD9 A;  4UTS A;  1TCO B;  2LLT A;  4ZBL A;  3SG6 A;  1C7V A;  4W6R A;  3LK1 A;  2M1U A;  1RWY A;  2LMU A;  4GFT A;  3DQC A;  1JF2 A;  2NCP A;  3FWB A;  3PAT A;  2HQZ A;  4W6N A;  4U8D A;  5AFP A;  1SPY A;  3EKH A;  5EXB A;  3ST2 A;  1OXD A;  1A2X A;  1S6I A;  4DXM A;  2JPT A;  1W7T A;  1SKT A;  4H47 A;  1TN4 A;  2G6E A;  4KGE A;  3LK0 A;  3U0N A;  2Z6Y A;  3AI4 A;  2QLE A;  1SW8 A;  4GGF A;  4CFQ A;  3EK8 A;  4GAO A;  4MLW A;  1LA0 A;  1QAT A;  4IK5 A;  1XK4 A;  1B9C A;  3OGO A;  1MHO A;  1Q4B A;  1PAL A;  1HCJ A;  3CBE A;  3BUN B;  2NZ0 A;  4W6J A;  1YJ2 A;  3GL4 A;  4J8A A;  5HKZ A;  1A4P A;  1EMA A;  2JOJ A;  1S3P A;  1CFP A;  1KSM A;  4N1G A;  2KQY A;  1YRT B;  2EMN A;  2NCO A;  1V1F A;  2LAP A;  2FZU A;  4GUK A;  3LCP C;  4I5J A;  5DTY A;  1RRO A;  3DD4 A;  2O5G A;  2Z6X A;  2H5Q A;  3W1D A;  1FBV A;  1GJY A;  3KCS A;  2LC5 A;  1AJ4 A;  3TS5 B;  5HZU A;  4WQ3 A;  1ZUX A;  1LVC D;  1JC1 A;  1QIW A;  4PPL A;  1YR5 A;  1A75 B;  4MZJ A;  4QJ3 B;  3SG7 A;  5HW9 A;  2EGD A;  1Q4C A;  1B47 A;  2KI4 C;  3PJ5 A;  2LNK A;  2HQW A;  3EVP A;  2GV5 A;  1XFW O;  1JC2 A;  2WOS A;  3O6B A;  4MVF A;  2OTG B;  2YDZ A;  3DQA A;  3JTD B;  1PRW A;  3SRY A;  3WXA A;  1U5I A;  3JVT B;  1BU3 A;  3H1R A;  4H3L A;  1QVI Z;  1YHI A;  2KGR A;  1ZMZ A;  5DTZ A;  5GQQ C;  3CS1 A;  1FF1 A;  2A52 B;  4OCI A;  2IB5 A;  1BG1 A;  2ZN9 A;  1SMG A;  1QV0 A;  4JWQ A;  3SVU A;  2LMT A;  1A29 A;  2MJW B;  1WRK A;  4I5L B;  3VRP A;  2G3D B;  3PN7 B;  2JZI A;  4W75 A;  2LMV A;  3PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...