3SG7A

Crystal structure of gcamp3-kf(linker 1)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
410
structure length
398
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSKFNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDESKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
total genus 132
structure length 398
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg7A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg7A02
4OQWA 1KWOC 2NCPA 1NP8A 1QYQA 1N0YA 3PLFB 2HQ8A 4L1IA 2ICRA 4PHMA 1TNXA 2LLTA 3SV5A 3SG5A 1Q80A 2MA2A 4IZNA 2WIQA 5HBDA 3KPXA 3TDIA 3E5WA 1XMZA 4YGDB 5DTXA 3SVOA 1KFUL 4GNKB 2FCDA 1G7KA 4I5LB 2G3DB 1QV0A 4W75A 4GGNA 1BMOA 2BTJA 2DDCA 3U0MA 3M22A 1GGZA 3VRNA 1KK7Y 1YUSA 5DTYA 1Q4CA 3NSOA 4FQOA 3BXBA 1DF0A 3SG7A 4LW5A 5EXCI 3MSEB 1EMGA 1DF0B 2BL0C 2OJKA 3CR5X 1AJ5A 2WC8A 1DJZA 2WCBA 3NXAA 3KF9A 2KOTA 2GX2A 2LUCA 4Q9XA 2CBLA 1SPYA 1KFXL 2QLEA 1DMOA 2V4EA 3K21A 4HRHA 3LSAA 2V4EB 2L5XB 3O78A 4B30A 2A56B 3BXAA 3BUWB 5FVIA 4B30B 1TNPA 2H8QA 1A4PA 1M31A 2LP2A 2JRFA 1KWOB 1NUBA 4WRIA 4N1FA 4GFTA 3O2PA 1YX7A 1BOCA 1OZSA 1ALVA 2Y4QA 2IB5A 1WLMA 1R2UA 1AJ4A 2HQWA 2A53B 5HKWA 5KTGA 1QASA 4L9MA 2E6WA 3PN7C 4LJDA 5CSNA 2KI4C 2IE2A 3TMTA 4IK5A 1BJFA 3A8RA 2VVIA 2I18A 4PCWA 1QYOA 2VVHA 4MN0A 1WRLA 4XL5A 1MXEA 2BL0B 2Y5IA 2QU1A 1JFKA 3I5FC 5HW9A 1EMLA 4JF9A 3SVDA 2SASA 4HREE 3EK8A 1DJHA 1V1FA 1R6PA 4XOVA 3SS0A 2K0JA 2Z1OA 2JTZA 1YHIA 2AHAA 4KAGA 5D69A 1W7TA 3VRPA 3PATA 1SL7A 3EVUA 2BKHB 3DQUA 3LA1A 4IK3A 5DPIA 2A48A 1CDLA 2KBIA 2K7CA 2IS9A 2MRDA 4I2YA 2A46A 3W1CA 2JT8A 1KSOA 3PN7B 1F70A 1DJXA 2HPSA 1BR1B 1LVCD 2HRSA 2ZMWA 2EMDA 4H48A 4ZF4A 4P1QA 1B1GA 5DPJA 1J7QA 5AERA 2EHBA 1Y1UA 1DGVA 3VK1A 4P76A 1NWDA 4W6OA 5FYXA 1NCYA 1UURA 3CFHA 3LCPC 2LHLA 1YUTA 1ZUXA 4KW9A 3LS3A 2M0RA 3AI5A 3BUMB 1KQMB 2JNFA 5DTZA 3CD1A 2DD9A 2G6XA 2PXSA 4H3MA 4U2VA 2KQ6A 4F0ZB 4XJKA 2WOSA 1F71A 4XJKB 3G9AA 2WHTA 2DDDA 1UWOA 1SKTA 1YRUB 3DQ6A 4Q7TA 2G16B 3U8CA 2LMUA 1A03A 2AWJA 1BG1A 3PM8A 2JWWA 4ORCB 4YGBB 5CSFA 1QYFA 4HSZA 4NDBA 5CSIA 2F3ZA 1B7TZ 4AOMA 2VAEA 2E30A 2YE1A 3EVPA 2Z6ZA 1EG3A 4H3LA 2WISA 2V53A 1C7WA 3AAJA 3CFFA 5EBJA 2GV5A 2M8UA 3BOWA 3NEDA 4DXNA 3BOWB 3DVJA 4XVPA 2PALA 5BTTA 2WURA 5BTTB 1SBJA 1OXEA 1U5IA 1XA9A 4W6DA 1U5IB 4ORAB 4H3NA 2QRFA 2MAZA 1MWNA 1BT6A 1IG5A 1ZFSA 2OKWA 1JF0A 4W6AA 3DVMA 2BE6A 1EMBA 1H4UA 1PRWA 4AR7A 4QJ4B 4QJ5B 3DQ4A 1SK6D 4JQ0D 1N2DA 1J55A 3OB2B 1SY9A 4HRGA 3SG4A 4Q7UA 1KFUS 5JJGA 1PVBA 2HQZA 3AKAA 4KF5C 4YI8A 2KHNA 3DQFA 1QS7A 1ODBA 3ICBA 1CFFA 4OKHA 5EXBA 1PALA 3DQJA 3NSLA 1JBAA 4EN1A 3DQ2A 4OVNF 4ETOA 4N3DA 1JWDA 2L4HA 4KEXA 2FJUB 2LVIA 2OS8C 1B8LA 2WCEA 5HYDA 5LTQA 2M7NA 2HQKA 1CMFA 1B8RA 1B9CA 4GOBA 3SVSA 4W73A 1JUOA 1MOVA 3PFVA 1W7UA 1KP5A 1QXTA 1MUXA 1A2XA 4IK9A 2Z6XA 1RRXA 2K7DA 5AXIA 5J3XA 1FPWA 4UTSA 1EXRA 1SR6C 4BDUA 2P4MA 2AAOA 1IWQA 1YX8A 1KQVA 1CKKA 1QIVA 3TZ1A 4ZFSA 4YBHB 2JU0A 3GB3A 1J7PA 4W6FA 2ZRSA 3LVCA 1CDNA 1K93D 2HCGA 1SYMA 2VZXA 4KF5A 3ST0A 2AWKA 3DPXA 1NX0A 1RWYA 2JQ6A 2H61C 2PASA 5HZSA 2JXCA 4RYWA 3LVAA 3DQLA 3HX4A 2G5ZB 4MRXA 3BUXB 3A8SA 3GEXA 4TZAA 2F8PA 1A29A 3I5GC 1S6JA 2JULA 3DQ9A 4JPZB 3ZWHA 2EC6C 2NXQA 2LLUA 5H87A 2COLB 1D1OA 3ZULA 1ZACA 4YGEB 5F9GA 4U8DA 3CD9A 2ZKMX 5DPHA 2A52B 5T3IA 2PMYA 2WSNA 2LVKA 2OTEA 2IB6A 5ER4X 1Q4DA 1IGVA 1QX5B 1SR6B 4W6LA 4W6UA 1TCOB 1PK0D 1KK7Z 2JC2A 3I5IC 4N5XA 4PPLA 2G9BA 4EDOA 4PFEA 2LLSA 3SSPA 4YRUA 1NPQA 1GFLA 5H88A 3PJ5A 5HKZA 2H61A 2F2OA 2WCFA 1QX7A 1IQ3A 1UHIA 3OB1B 1JBZA 4W6MA 4PPJA 3I19A 4IL1A 4P5OE 2M7LA 1OXFA 1ZUZA 1OMDA 1JBYA 2QACA 4W6BA 3SVBA 3P28A 3I5GB 2NZ0A 2M1KB 1KYPA 1XSSA 3JVTC 3LK0A 2I94A 1IJ5A 2EC6B 1S6IA 3U0LA 1YVLA 1QXPA 1CLLA 2O60A 4IK1A 4DRWA 3U8PA 3IQQA 3LF4B 5CPVA 1SCVA 1QLKA 3CGLA 1EMFA 1RK9A 5HZTA 1JFJA 2HGDA 1CNPA 2Q4UA 3CZTX 2L50A 3W1DA 2QPTA 1QJTA 4A4BA 1SNLA 2DUGA 1G8IA 1N65A 3E3RA 5PALA 3GL4A 3SVUA 2LVJA 4GGFC 1KCYA 1IQ5A 1CFCA 2LMTA 3CFAA 2KNEA 4ZCVA 3EVRA 1L7ZA 1Y6WA 2OPOA 4PPKA 4W6NA 2WORA 2MJWB 4ZF3A 1YFPA 1OOJA 2OTGC 4DS7A 1A75A 3TDUA 2RH7A 4PDZA 1A75B 1UP5A 3JVTB 1CM1A 1DJYA 2QLGA 2DUFA 2LCPA 2QLGB 5LK4A 2D8NA 4W72A 3CR4X 1CDMA 2O5GA 4GF6B 1YVHA 2ZN9A 3LK1A 4ZINA 2EMNA 2WSOA 4MEWA 4GUKA 2DD7A 2ZNEA 3ZUJA 1C7VA 4NQGA 3SSHA 5ER5A 4DKMA 1G33A 2VRGA 5DKQA 1PSBA 2K2FA 1K9UA 1SL8A 1S26D 1WRZA 2HETA 2DUIA 4MLWA 2KAVA 4GAOA 4EDSA 4GGFA 1QX2A 1PSRA 2B3QA 2HJOA 1Z1PA 2VVJA 2L98A 4USLA 5DKRA 3DQ8A 3MGFA 1RECA 2KDHA 2JPTA 3M24A 3S05A 5DQBA 1Q4EA 2FCEA 2ZNDA 1K90D 2K7BA 1MYWA 4YGAA 1CTRA 1MQ1A 2PSRA 2OTGB 2DUEA 2KI4B 1OE9B 4Q04A 3AKOA 5JOLA 4TZGA 3VRQA 2H9WA 5DQMA 1AUIB 3DQEA 2KI6C 4D1EA 2Q6PA 4J89A 4M2PA 2Y1NA 1S6ZA 2A47A 3I5FB 3P8UA 3NSIA 1NCZA 4OGSA 3DQ5A 1RMPA 1S3PA 4NDCA 5KU1A 2OGRA 5FHVA 2JADA 3SIAA 2G6EA 4PE4A 1B9AA 3U0KA 1B8CA 1G4YR 1WRKA 4ZCUA 1J7RA 2OTBA 5HLVA 4LJBA 5EB7A 1S6CA 4I5KA 2FOTA 1NYAA 4QJ3B 1M46A 1NCXA 3PALA 1NX3A 4DXQA 1Y1XA 4ORBB 3TUYC 1LA3A 1Y1AA 4DXOA 1UHHA 3ZTFA 1S36A 1SRAA 4AS8A 4DIRA 1W7JB 1C4FA 2H5RA 1EL4A 4DXPA 1K9PA 1M45A 1OXDA 1QVIZ 4H47A 1H8BA 1OMRA 2LV7A 4DUQA 3KEVA 1CFPA 4MRYA 2QZ0A 4HE4A 2A54B 1SL9A 2BKIB 1SCMC 2H5OA 4L12A 1KK8C 3WLDA 2JT0A 3PJBA 2LM5A 3LF3A 2KI6D 1C07A 4W74A 4ANJA 3GK2A 4W7EA 1L2OC 5I2OA 1TOPA 2O2BA 3DQNA 3SVCA 3NF0A 1BR4B 4W7CA 1GGXA 1DJIA 4W6RA 4MVFA 2KYCA 2ZMUA 1M39A 2TN4A 2G2BA 3TUYB 4OY4A 5G08A 3VROA 1MOUA 4PE1A 1B7TY 4W6TA 2I7AA 2FWQA 2M9GA 2BCXA 1QLSA 2H2KA 1XFZO 3SG3A 4MSPA 5LTPA 2BECA 1XFYO 1KSMA 1K95A 4C0JA 5KTYA 4IK8A 1J1EA 4ORNA 1XFUO 3KCTA 1B4CA 1AVSA 1TRFA 1MXLC 4ZB1A 1EMCA 2BBMA 1PVAA 3ED8A 5EB6A 1FI5A 2LVVA 1KFXS 3TDZA 2FZUA 3KHEA 1AP4A 2FL1A 3M0WA 3FIAA 5DY6A 2BE4A 1J1DA 1F09A 1L2OB 2M29A 4W6CA 3U8AA 3BXKA 4YGCB 4Z4MA 3DQIA 1TN4A 2HPWA 3BXCA 2F2PA 4J88A 2CCMA 5EJUA 2YFPA 3K1KA 3VRRA 3EK7A 2MHHA 3H1OA 5FVFA 4FTGA 1XA5A 4W77A 1JC1A 2C9JA 1IKUA 2P6BB 4JC2A 1S5GZ 1MR8A 2C9IA 2EGDA 2QLIA 4BY4A 4W6HA 3IP2A 1CFDA 1NX2A 2M1UA 2OS8B 2RGIA 4Q7RA 1QV1A 2B3PA 1CM4A 1RROA 2VADA 3KO0A 5HZUA 3SVRA 4B5YA 5I8NA 2M49B 2MBXA 3FWBA 1XQMA 3WNXB 1YTZC 1YR5A 3H4SE 1CMGA 4W7AA 3RWAA 3LVDA 1WDCC 3O77A 2O24A 1UHJA 1K94A 4W6KA 1UHNA 4C0LA 4J8AA 2GW3A 2L51A 4NWSA 1IH0A 1ZGPA 3SSLA 4YI9A 2JT3A 4KW8A 4WQ3A 2V4EC 1BF5A 4GESB 4DCKA 5AFPA 2LP3A 3OX6A 4RTCA 3D10A 1LA0A 1FBVA 4LQUA 1TNWA 2F3YA 4KGFA 1OZOA 1YRTB 5AANA 1KYSA 4W6SA 2ISDA 2GGMA 2KAYA 2ZRTA 1OSAA 4KF4A 3SVEA 2SCPA 5HZOA 2PVBA 1CV7A 2A50B 4ICBA 1HQVA 2OKYA 4JRBA 4TNCA 4LJDC 2QLHA 1GL4A 3VGOA 4I5NB 5KSZA 3WLCA 5HKYA 2BCBA 3D0YA 3GJ2A 1TNQA 3D0YB 4PE0A 5BPJA 4OHSA 4NDDA 1JC2A 1ALWA 1QTXA 2Y0GA 2WHUA 3ADFA 1WDCB 2H5PA 3UG0A 2M3WA 1MF8B 3I5IB 4CPVA 3SSKA 2K8MB 2H5QA 1Z1QA 3ST2A 3BQ3A 1X02A 2GGZA 1OQPA 2LNKA 1NIWA 3TMRA 4LJCA 1ZMZA 2B1UA 2YDZA 3O6BA 3FS7A 1J7OA 3DPZA 1EH2A 1YHHA 1QY3A 4HQCA 3DQHA 1BLQA 1K9KA 1GQMA 3RM1A 4OJ0A 1XVJA 3EVVA 3NT3A 1BFPA 1YJFA 1SW8A 4W6GA 2CTNA 1CLBA 4ZIOA 4IK4A 1GGWA 3OSQA 4DKNA 3OX5A 2KGRA 4W76A 4EULA 5EXUA 1F8HA 1TCFA 1Y0VH 1XYDA 1Q4BA 3AKBA 2O29A 3GOFA 1H4BA 2KAXA 4XYNA 5CSJA 1UUSA 2JZIA 2LMVA 3DQMA 5K89A 3BUOB 3ZNIA 2IOVA 1KQMC 2LAPA 4W7FA 3V3DA 3IF7A 4OV2A 2KFHA 3OGOA 2JTTA 1CDPA 1M63B 2ARLA 2KGBC 1E8AA 2G3OA 4C0KA 1GJYA 1HUYA 1K8UA 2LHIA 1LINA 3GK1A 1H6RA 4XOWA 1B47A 1RFJA 4W6JA 4HQ9A 3ST4A 2KFGA 4JEOA 2R2IA 1NX1A 1F4OA 3E5VA 1PULA 4W7DA 2NCOA 1RTP1 1MHOA 3NSKA 5IBWA 2NLNA 2QT2A 5DTLA 3SVNA 2CT9A 4LQTA 3DQ1A 5F6TA 3CGAA 2LC5A 3NT9A 1TIZA 1F54A 1IRJA 1FW4A 2LANA 1S1EA 3SRYA 2CNPA 3OHMB 3BX9A 3DQ7A 2AH8A 4PALA 1F4QA 2JXLA 4HVFA 2AUCA 1YUUA 1TTXA 4PHKA 2AWLA 3SSVA 1DGUA 1K2HA 3DQOA 3EKJA 4MZJA 1WLZA 1HCJA 4CLNA 2Q57A 3TS5C 1YURA 1NSHA 5DRGA 1RMOA 3DQ3A 1KYRA 2DUHA 1OMVA 5DPGA 1LXFC 3E5TA 4OCIA 4L13A 1CB1A 1YJ2A 3WHTB 1DJGA 3GJ1A 2L4IA 4KPIA 4E68A 5BQLA 1JF2A 4DXMA 2M97A 2GW4B 3PSRA 2BBNA 3NEZA 4BY5A 1ZOTB 4HQ8A 3DQKA 3DQAA 1QATA 3A4UB 4W7XA 4W69A 2HGYA 4A4CA 3CBEA 4KW4A 4R1EA 1WY9A 3DQDA 5B8IB 3DD4A 3JTDC 4CFRA 3EKHA 5DRFA 5FVGA 1EMAA 5HLOA 3ST3A 5HGEA 3WHUB 2LE9B 3PIBA 4CIDA 1EJ3A 5AEQA 4R6DA 3LL8B 2ZO6A 5H89A 1JSAA 5LTRA 3RLZA 5DU0A 1FI6A 4JWQA 2LUXA 3BYAA 1F0BA 4JGEA 3CTNA 1Q73A 3DVKA 1UISA 3H1RA 1QVIY 2K61A 4M2OA 1RJVA 2G2SB 2POXA 2HF5A 5J2OA 4I5JA 1W7IB 3TS5B 2A4JA 4Z4KA 4W7RA 2Y1MA 1DTLA 1FF1A 4PE7A 2YE0A 5DKNA 2L0PA 1ZGQA 2ZFDA 3EK4A 4GBAA 5EHUA 3CLNA 1EMKA 4XGYA 4WQ2A 3DF0A 2MLEC 2BCAA 3DF0B 3FWCA 1QIWA 3UFZA 3WCKA 1SCMB 1XK4C 2L2EA 2Z6YA 4CFQA 1KK8B 3SSTA 2PXWA 3GK4X 3C1VA 2KYFA 3CWGA 2KBMA 4M2QA 2H6VA 3DPWA 3JTDB 1JC0A 4Q9WA 2AMIA 3ZUFA 3RWTA 1DJWA 4W6IA 3AAKA 3SG6A 4DXIA 2KSPA 3HCMA 1V1GA 2K2AA 2CXJA 4N1GA 1AK8A 2JNXA 4AQIA 1RM9A 3LLEA 1BODA 3U0NA 3I5HC 3PJ7A 3CR2A 3IR8A 3WXAA 1SMGA 4P2YB 1DT7B 1YHGA 4PHJA 3AI4A 1K96A 1EMEA 4OR9B 1DVIA 2GX0A 3DVEA 3O4YA 3KCSA 2EMOA 4PHNA 2WHSA 2K7OA 2WNDA 2ZN8A 3SIBA 3IQOA 4R6BA 1XFXO 1VRKA 3OP0A 1XFVO 2JOJA 4MZKA 2Q91A 3OSRA 1XK4A 2KFFA 1F55A 5TNCA 5AQBB 5D7FA 4MZLA 1AHRA 1ZGOA 3QRXA 1LKJA 2ZO7A 2G6YA 1UHKA 4AQJA 5I2LA 3VHTA 2F33A 4UPGA 3F45A 1W7SA 3BUNB 2AWMA 4W6PA 3SSYA 1CLMA 3VHTB 2MLFC 1EMMA 2HFCA 1Q4AA 1YZWA 1RMMA 4GPLB 4JFGA 1HT9A 5GQQC 4EMQA 2DOQA 3I5HB 3SJSA 1XFWO 1BU3A 3CS1A 3SG2A 1S5GY 1XAEA 3VICA 3DQCA 5BT0A 4MBEA 4RYSA 4KA9A 1XO5A 1IJ6A 3CB9A 2PRUA 4ZBLA 1EG4A 2I2RE 2KQYA 5I2QA 4ZF5A 4KGEA
chains in the Genus database with same CATH superfamily
4OQWA 1KWOC 2NCPA 1NP8A 1QYQA 1N0YA 3PLFB 2HQ8A 3BFHA 4L1IA 2ICRA 4PHMA 1TNXA 2LLTA 3SV5A 3SG5A 1Q80A 2MA2A 4IZNA 2WIQA 5HBDA 3KPXA 3TDIA 3E5WA 1XMZA 4YGDB 5DTXA 3SVOA 1KFUL 4GNKB 2FCDA 1G7KA 4I5LB 2G3DB 1QV0A 3Q8IA 4W75A 4GGNA 1BMOA 2BTJA 2DDCA 3U0MA 3M22A 1GGZA 3VRNA 1KK7Y 1YUSA 5DTYA 3BFAA 1Q4CA 3B87A 3NSOA 4FQOA 3BXBA 1DF0A 3SG7A 4LW5A 5EXCI 3MSEB 1EMGA 1DF0B 2BL0C 2OJKA 3CR5X 1AJ5A 2WC8A 1DJZA 2WCBA 3NXAA 3KF9A 2KOTA 3RZSA 2WCKA 2GX2A 2LUCA 4Q9XA 2CBLA 1SPYA 1KFXL 2QLEA 1DMOA 2V4EA 3K21A 4HRHA 2FJYA 3LSAA 2V4EB 2L5XB 3O78A 4B30A 2A56B 3BXAA 3BUWB 5FVIA 4B30B 1TNPA 2H8QA 1A4PA 3SS3A 1M31A 2LP2A 2JRFA 1KWOB 1NUBA 4WRIA 4INWA 4N1FA 4GFTA 3B6XA 3O2PA 1YX7A 1BOCA 1OZSA 1ALVA 2Y4QA 2IB5A 1WLMA 1R2UA 1AJ4A 2HQWA 2A53B 5HKWA 5KTGA 1QASA 4L9MA 2E6WA 3PN7C 4LJDA 5CSNA 2KI4C 1TUZA 2IE2A 3TMTA 4IK5A 1BJFA 3A8RA 2VVIA 2I18A 4PCWA 1QYOA 2VVHA 4MN0A 1WRLA 4XL5A 1MXEA 2BL0B 2Y5IA 2QU1A 1JFKA 3I5FC 3FE9A 5HW9A 5FI6A 1EMLA 4JF9A 3SVDA 2SASA 4HREE 3EK8A 1DJHA 1V1FA 1R6PA 4XOVA 3SS0A 2K0JA 2Z1OA 2JTZA 1YHIA 2AHAA 4KAGA 5D69A 1W7TA 1ORGA 3VRPA 3PATA 1SL7A 3EVUA 2BKHB 3DQUA 3LA1A 4IK3A 5DPIA 2A48A 1CDLA 2KBIA 2K7CA 2IS9A 2MRDA 4I2YA 2A46A 3W1CA 2JT8A 1KSOA 3PN7B 3D78A 3R1OA 1F70A 3R1VA 1DJXA 2P70A 2HPSA 1BR1B 1LVCD 2HRSA 2ZMWA 2EMDA 4H48A 4ZF4A 4P1QA 1B1GA 5DPJA 1J7QA 5AERA 2EHBA 1Y1UA 1DGVA 3VK1A 4P76A 1NWDA 4W6OA 5FYXA 1NCYA 1UURA 3CFHA 3LCPC 2LHLA 1YUTA 4JD9A 1ZUXA 4KW9A 3LS3A 2M0RA 3AI5A 3BUMB 1KQMB 2JNFA 5DTZA 3CD1A 2DD9A 2G6XA 2PXSA 4H3MA 4U2VA 2KQ6A 3PM2A 4F0ZB 4XJKA 2WOSA 1F71A 4XJKB 3G9AA 2WHTA 2DDDA 1UWOA 1SKTA 1YRUB 3R1PA 3DQ6A 4Q7TA 2G16B 3U8CA 2LMUA 1A03A 2AWJA 1BG1A 3PM8A 2JWWA 4ORCB 4YGBB 5CSFA 1QYFA 4HSZA 4NDBA 5CSIA 2F3ZA 1B7TZ 4AOMA 2VAEA 2E30A 3DY9A 2YE1A 3EVPA 2Z6ZA 1EG3A 4H3LA 2WISA 2V53A 1C7WA 3AAJA 3CFFA 5EBJA 2GV5A 2M8UA 3BOWA 3NEDA 4DXNA 3BOWB 3DVJA 4XVPA 2PALA 5BTTA 2WURA 5BTTB 1SBJA 1OXEA 1U5IA 1XA9A 4W6DA 2WC5A 1U5IB 2GTEA 4ORAB 4H3NA 2QRFA 2MAZA 1MWNA 1BT6A 1IG5A 1ZFSA 2OKWA 1JF0A 4W6AA 3DVMA 2BE6A 1EMBA 1H4UA 1PRWA 4AR7A 4QJ4B 4QJ5B 3DQ4A 1SK6D 4JQ0D 1N2DA 1J55A 3OB2B 1SY9A 4HRGA 3SG4A 4Q7UA 1KFUS 5JJGA 1PVBA 2HQZA 3AKAA 4KF5C 3VB1A 4YI8A 2KHNA 3DQFA 1QS7A 1ODBA 3ICBA 4KYNA 1CFFA 4OKHA 5EXBA 1PALA 3DQJA 3NSLA 1JBAA 4EN1A 3DQ2A 4OVNF 3S0EA 4ETOA 4N3DA 3CZ0A 1JWDA 2L4HA 4KEXA 2FJUB 2LVIA 2OS8C 1B8LA 2WCEA 3D73A 3S0BA 5HYDA 5LTQA 2M7NA 2HQKA 1CMFA 1B8RA 1B9CA 4GOBA 3SVSA 4W73A 1JUOA 1MOVA 3PFVA 1W7UA 1KP5A 1QXTA 1MUXA 2KLDA 1A2XA 3FE8A 4IK9A 2Z6XA 1RRXA 2K7DA 5AXIA 5J3XA 1FPWA 4UTSA 1EXRA 1SR6C 3OBVA 4BDUA 2P4MA 2AAOA 1IWQA 1YX8A 1KQVA 1CKKA 2KLEA 1QIVA 3TZ1A 4ZFSA 4YBHB 2JU0A 3GB3A 1J7PA 4W6FA 2ZRSA 3LVCA 1CDNA 1K93D 2HCGA 1SYMA 2VZXA 1Z4HA 4KF5A 3ST0A 2AWKA 3DPXA 1NX0A 1RWYA 2JQ6A 2H61C 2PASA 5HZSA 2JXCA 4RYWA 3LVAA 3DQLA 3HX4A 2G5ZB 4MRXA 3BUXB 3A8SA 3GEXA 4TZAA 2F8PA 1A29A 3I5GC 1S6JA 2JULA 3DQ9A 4JPZB 3ZWHA 2EC6C 2NXQA 2LLUA 5H87A 2COLB 1D1OA 3ZULA 1ZACA 4YGEB 5F9GA 4U8DA 3CD9A 2ZKMX 5DPHA 2A52B 5T3IA 2PMYA 2WSNA 2LVKA 2OTEA 2IB6A 5ER4X 1Q4DA 1IGVA 1QX5B 1SR6B 4W6LA 4W6UA 1TCOB 3B86A 1PK0D 2WCJA 1KK7Z 2JC2A 3I5IC 4N5XA 4PPLA 2G9BA 4EDOA 2QDIA 4PFEA 2LLSA 1OOGA 3SSPA 4YRUA 1NPQA 1Z2CB 1GFLA 5H88A 3PJ5A 5HKZA 2H61A 2F2OA 2WCFA 1QX7A 1IQ3A 1UHIA 3OB1B 1JBZA 4W6MA 4PPJA 3I19A 4IL1A 4P5OE 2M7LA 2ERBA 1OXFA 1ZUZA 1OMDA 1JBYA 2QACA 4W6BA 3SVBA 3P28A 3IVTA 3I5GB 2NZ0A 2M1KB 1KYPA 1XSSA 3JVTC 3LK0A 2I94A 1IJ5A 2EC6B 1S6IA 3U0LA 1YVLA 1QXPA 2L5YA 1CLLA 2BAPA 2O60A 4IK1A 4DRWA 3U8PA 3IQQA 3LF4B 5CPVA 1SCVA 1QLKA 2PYQA 1P28A 3CGLA 1EMFA 1RK9A 5HZTA 1JFJA 2HGDA 1CNPA 2Q4UA 3CZTX 2L50A 3W1DA 2QPTA 1QJTA 3NHIA 4A4BA 1SNLA 2DUGA 1C3YA 1G8IA 1N65A 3E3RA 5PALA 3GL4A 1IIOA 3SVUA 2LVJA 4GGFC 1KCYA 1IQ5A 1CFCA 2LMTA 3CFAA 2KNEA 4ZCVA 3EVRA 1L7ZA 3CABA 1Y6WA 2OPOA 4PPKA 4W6NA 2WORA 2MJWB 4ZF3A 1YFPA 1OOJA 2OTGC 4DS7A 1A75A 3TDUA 2RH7A 4PDZA 1A75B 1UP5A 3JVTB 1CM1A 1DJYA 3L47A 2QLGA 2DUFA 2LCPA 2QLGB 2P71A 5LK4A 2D8NA 4W72A 3CR4X 3L4AA 1CDMA 2O5GA 4GF6B 1YVHA 2ZN9A 3LK1A 4ZINA 2EMNA 3R72A 2WSOA 4MEWA 4GUKA 2DD7A 2ZNEA 3ZUJA 1C7VA 4NQGA 3SSHA 5ER5A 4INXA 4DKMA 3V2LA 1G33A 2VRGA 5DKQA 1PSBA 2K2FA 1K9UA 1SL8A 1S26D 1WRZA 2HETA 2DUIA 4MLWA 2KAVA 4GAOA 4EDSA 4GGFA 1QX2A 1PSRA 2B3QA 2HJOA 1Z1PA 2VVJA 2L98A 4USLA 5DKRA 3DQ8A 3MGFA 1RECA 2KDHA 2JPTA 3M24A 3S05A 5DQBA 3B7AA 1Q4EA 2FCEA 2ZNDA 1K90D 2K7BA 1MYWA 4YGAA 1CTRA 1MQ1A 2PSRA 2OTGB 2DUEA 2KI4B 1OE9B 4Q04A 3AKOA 5JOLA 4TZGA 3VRQA 2H9WA 5DQMA 1AUIB 3DQEA 2KI6C 4D1EA 2Q6PA 4J89A 3SS4A 4M2PA 2Y1NA 3S0GA 1S6ZA 3FE6A 2A47A 3I5FB 3P8UA 3NSIA 1NCZA 4OGSA 3DQ5A 1RMPA 1S3PA 4NDCA 5KU1A 2OGRA 5FHVA 2JADA 3SIAA 2G6EA 4PE4A 1B9AA 3U0KA 1B8CA 1G4YR 1WRKA 4ZCUA 1J7RA 3S0FA 2OTBA 5HLVA 4LJBA 1TUJA 5EB7A 1S6CA 4I5KA 2FOTA 1NYAA 4QJ3B 1M46A 3S0DA 1NCXA 3PALA 1NX3A 4DXQA 1Y1XA 4ORBB 3TUYC 1LA3A 1Y1AA 4DXOA 1UHHA 3ZTFA 1S36A 1SRAA 3OGNA 4AS8A 4DIRA 1W7JB 1C4FA 2H5RA 1EL4A 4DXPA 1K9PA 1M45A 1OXDA 1QVIZ 4H47A 1H8BA 1OMRA 2LV7A 4DUQA 3KEVA 1CFPA 4MRYA 2QZ0A 4HE4A 2A54B 1SL9A 4FQTA 2BKIB 1SCMC 2H5OA 4L12A 1KK8C 3WLDA 2JT0A 3PJBA 2LM5A 3LF3A 2KI6D 1C07A 4W74A 4ANJA 3GK2A 4W7EA 1L2OC 5I2OA 1TOPA 2O2BA 3DQNA 3SVCA 3DZTA 3NF0A 2H8VA 1BR4B 4W7CA 1GGXA 5EL2A 1DJIA 4W6RA 4MVFA 2KYCA 2ZMUA 3BJHA 1M39A 2TN4A 5D3OA 2G2BA 3TUYB 4OY4A 5I94A 5G08A 3VROA 1MOUA 4PE1A 1B7TY 4W6TA 2I7AA 2FWQA 3D75A 2M9GA 3D76A 2BCXA 1QLSA 2H2KA 1XFZO 3SG3A 4MSPA 5LTPA 2BECA 1XFYO 1KSMA 1K95A 4C0JA 5KTYA 4IK8A 1J1EA 4ORNA 1XFUO 1C3ZA 3KCTA 1B4CA 1AVSA 1TRFA 1MXLC 4ZB1A 1EMCA 2QEVA 2BBMA 1PVAA 3ED8A 5EB6A 1FI5A 2LVVA 1KFXS 3TDZA 3B88A 3UNWA 2FZUA 3KHEA 1AP4A 2FL1A 3M0WA 3FIAA 5DY6A 2BE4A 1J1DA 1F09A 1L2OB 2M29A 2BNXA 4W6CA 3U8AA 3BXKA 4YGCB 4Z4MA 3DQIA 1TN4A 4PT1A 2HPWA 3BXCA 2F2PA 4J88A 2CCMA 5EJUA 2YFPA 3K1KA 3VRRA 3EK7A 2MHHA 3H1OA 5FVFA 4FTGA 3EG5B 1XA5A 4W77A 1JC1A 2C9JA 1IKUA 2P6BB 4JC2A 1S5GZ 1MR8A 2C9IA 2EGDA 4JKTA 2QLIA 4BY4A 4W6HA 3IP2A 1CFDA 1NX2A 2M1UA 2OS8B 2RGIA 1DC1A 2QEHA 4Q7RA 3CZ1A 1QV1A 1OOHA 3CZ2A 2B3PA 1CM4A 1RROA 3S0AA 2VADA 3KO0A 5HZUA 3SVRA 3D77A 4B5YA 5I8NA 2M49B 2MBXA 3FWBA 1XQMA 3WNXB 1YTZC 1YR5A 3H4SE 1CMGA 4W7AA 3RWAA 3LVDA 1WDCC 3K1EA 3O77A 2O24A 1UHJA 1K94A 3CDNA 4W6KA 1UHNA 4C0LA 4J8AA 2GW3A 2L51A 4NWSA 1IH0A 1ZGPA 4OZDA 3SSLA 4YI9A 2JT3A 4KW8A 4WQ3A 2V4EC 2KPHA 1BF5A 4GESB 4DCKA 5AFPA 2LP3A 2WC6A 3OX6A 2WCMA 4RTCA 3D10A 3D74A 1LA0A 1FBVA 4LQUA 3BFBA 1TNWA 2F3YA 4KGFA 1OZOA 1YRTB 5AANA 3NGVA 1KYSA 4W6SA 2ISDA 2GGMA 2KAYA 2ZRTA 1OSAA 4KF4A 3SVEA 2SCPA 5HZOA 2K60A 2PVBA 1CV7A 2A50B 4ICBA 1HQVA 2OKYA 2L2CA 4JRBA 4TNCA 4LJDC 2QLHA 1GL4A 3VGOA 4I5NB 5KSZA 3WLCA 5HKYA 2BCBA 3D0YA 3GJ2A 1TNQA 3D0YB 4PE0A 5BPJA 4OHSA 4NDDA 1JC2A 1ALWA 1QTXA 2Y0GA 2WHUA 3ADFA 1WDCB 2H5PA 3UG0A 2M3WA 1MF8B 1XFRA 3I5IB 4CPVA 3SSKA 2K8MB 2H5QA 1Z1QA 3ST2A 3BQ3A 1X02A 1LS8A 2GGZA 3O4XA 3N7HA 1OQPA 2LNKA 1NIWA 3TMRA 4LJCA 1ZMZA 2B1UA 2YDZA 3O6BA 3DYEA 3FS7A 1DEKA 1J7OA 3DPZA 1EH2A 1YHHA 1QY3A 4HQCA 3DQHA 1BLQA 1K9KA 5FI7A 1GQMA 4IJ7A 2WCHA 3RM1A 4OJ0A 1XVJA 3EVVA 3NT3A 1BFPA 1YJFA 2JPOA 1SW8A 4W6GA 2CTNA 1CLBA 4ZIOA 4IK4A 1GGWA 3OSQA 4DKNA 3OX5A 2KGRA 4W76A 4EULA 5EXUA 1F8HA 1DELA 1TCFA 1Y0VH 3PJIA 1XYDA 1Q4BA 1DQEA 3AKBA 2O29A 3GOFA 1H4BA 2KAXA 2WCLA 4XYNA 5CSJA 1OOFA 1UUSA 2JZIA 2LMVA 3DQMA 5K89A 3BUOB 3ZNIA 2IOVA 1KQMC 2LAPA 4W7FA 3V3DA 3IF7A 4OV2A 2KFHA 3OGOA 2JTTA 1CDPA 1TWOA 1M63B 4F7FA 2ARLA 2KGBC 1E8AA 2G3OA 4C0KA 1GM0A 1GJYA 1HUYA 1K8UA 2LHIA 1LINA 3GK1A 1H6RA 4XOWA 1B47A 1RFJA 4W6JA 4HQ9A 3ST4A 2KFGA 4JEOA 1OW4A 2R2IA 1NX1A 1F4OA 3E5VA 1PULA 4W7DA 2NCOA 1RTP1 1MHOA 3NSKA 5IBWA 2NLNA 2QT2A 5DTLA 3SVNA 2CT9A 4LQTA 3DQ1A 5F6TA 3CGAA 2LC5A 3NT9A 1TIZA 1F54A 1IRJA 1FW4A 2LANA 1S1EA 3SRYA 2CNPA 3OHMB 3BX9A 3DQ7A 2AH8A 4PALA 1F4QA 2JXLA 4HVFA 2AUCA 3NHTA 1YUUA 1QWVA 1TTXA 4PHKA 2AWLA 3SSVA 1DGUA 1K2HA 2QEBA 3DQOA 3EKJA 4MZJA 1WLZA 1HCJA 4CLNA 2Q57A 3TS5C 1YURA 1NSHA 5DRGA 1RMOA 3SS5A 3DQ3A 1KYRA 2DUHA 1OMVA 5DPGA 1LXFC 1W9ZA 3E5TA 4OCIA 4L13A 1CB1A 1YJ2A 3WHTB 1DJGA 3GJ1A 2L4IA 4KPIA 4E68A 5BQLA 1JF2A 4DXMA 2M97A 2GW4B 3PSRA 2BBNA 3NEZA 4BY5A 1ZOTB 4HQ8A 3DQKA 3DQAA 1QATA 3A4UB 4W7XA 4W69A 2HGYA 4A4CA 3CBEA 4KW4A 4R1EA 2QEOA 1WY9A 3DQDA 5B8IB 3DD4A 3JTDC 4CFRA 3EKHA 5DRFA 5FVGA 1EMAA 5HLOA 3ST3A 5HGEA 3WHUB 2LE9B 3PIBA 4CIDA 1EJ3A 5AEQA 4R6DA 3LL8B 2ZO6A 5H89A 1JSAA 5LTRA 3RLZA 5DU0A 1FI6A 4JWQA 2LUXA 3BYAA 1F0BA 4JGEA 3CTNA 2YGUA 1Q73A 3DVKA 1UISA 3H1RA 1QVIY 2K61A 4M2OA 3UO9A 1RJVA 2G2SB 2POXA 2HF5A 5J2OA 4I5JA 1W7IB 3TS5B 2A4JA 4Z4KA 4W7RA 2Y1MA 1DTLA 1FF1A 2YE0A 4PE7A 5FI2A 5DKNA 2L0PA 1ZGQA 2ZFDA 3EK4A 4GBAA 5EHUA 3CLNA 1EMKA 4XGYA 4WQ2A 3DF0A 2MLEC 2BCAA 3L4LA 3DF0B 3FWCA 1QIWA 3CYZA 3UFZA 3WCKA 1SCMB 1XK4C 2L2EA 2Z6YA 4CFQA 1KK8B 3SSTA 2PXWA 3GK4X 3C1VA 2KYFA 3CWGA 2KBMA 4M2QA 2H6VA 3DPWA 3JTDB 1JC0A 4Q9WA 2AMIA 3ZUFA 3RWTA 1DJWA 1OOIX 4W6IA 3AAKA 3SG6A 4DXIA 2KSPA 3HCMA 1V1GA 2K2AA 2CXJA 4N1GA 1AK8A 2JNXA 4AQIA 5DICA 1RM9A 3LLEA 1SSEB 1BODA 3U0NA 3I5HC 3PJ7A 3CR2A 3IR8A 3WXAA 1SMGA 4P2YB 1DT7B 1YHGA 4PHJA 3AI4A 1K96A 1EMEA 4OR9B 1DVIA 2GX0A 3DVEA 3O4YA 3KCSA 2EMOA 4PHNA 2WHSA 2K7OA 2WNDA 2ZN8A 3SIBA 3IQOA 4R6BA 1XFXO 1VRKA 3OP0A 1XFVO 2JOJA 4MZKA 2Q91A 3OSRA 1XK4A 2KFFA 1F55A 5TNCA 5AQBB 5D7FA 4MZLA 1AHRA 1ZGOA 3QRXA 1LKJA 5HL1A 2ZO7A 2G6YA 1UHKA 4AQJA 5I2LA 3VHTA 2F33A 4UPGA 3F45A 1W7SA 3BUNB 2AWMA 4W6PA 3SSYA 1CLMA 3VHTB 3DXLA 2MLFC 1EMMA 2HFCA 1Q4AA 1YZWA 1RMMA 4GPLB 4JFGA 1HT9A 5GQQC 4EMQA 2DOQA 3I5HB 3SJSA 1XFWO 3QMEA 1BU3A 3CS1A 3SG2A 1S5GY 2PQLA 1XAEA 3VICA 3DQCA 5BT0A 4MBEA 4RYSA 4KA9A 1XO5A 1IJ6A 3CB9A 2PRUA 4ZBLA 1EG4A 2I2RE 2KQYA 5I2QA 4ZF5A 4KGEA 1T14A
chains in the Genus database with same CATH topology
4OQWA 1KWOC 2NCPA 1NP8A 1QYQA 1N0YA 3PLFB 2HQ8A 4L1IA 2ICRA 4PHMA 1TNXA 2LLTA 3SV5A 3SG5A 1Q80A 2MA2A 4IZNA 2WIQA 5HBDA 3KPXA 3TDIA 3E5WA 1XMZA 4YGDB 5DTXA 3SVOA 1KFUL 4GNKB 2FCDA 1G7KA 4I5LB 2G3DB 1QV0A 4W75A 4GGNA 1BMOA 2BTJA 2DDCA 3U0MA 3M22A 1GGZA 3VRNA 1KK7Y 1YUSA 5DTYA 1Q4CA 3NSOA 4FQOA 3BXBA 1DF0A 3SG7A 4LW5A 5EXCI 3MSEB 1EMGA 1DF0B 2BL0C 2OJKA 3CR5X 1AJ5A 2WC8A 1DJZA 2WCBA 3NXAA 3KF9A 2KOTA 2GX2A 2LUCA 4Q9XA 2CBLA 1SPYA 1KFXL 2QLEA 1DMOA 2V4EA 3K21A 4HRHA 3LSAA 2V4EB 2L5XB 3O78A 4B30A 2A56B 3BXAA 3BUWB 5FVIA 4B30B 1TNPA 2H8QA 1A4PA 1M31A 2LP2A 2JRFA 1KWOB 1NUBA 4WRIA 4N1FA 4GFTA 3O2PA 1YX7A 1BOCA 1OZSA 1ALVA 2Y4QA 2IB5A 1WLMA 1R2UA 1AJ4A 2HQWA 2A53B 5HKWA 5KTGA 1QASA 4L9MA 2E6WA 3PN7C 4LJDA 5CSNA 2KI4C 2IE2A 3TMTA 4IK5A 1BJFA 3A8RA 2VVIA 2I18A 4PCWA 1QYOA 2VVHA 4MN0A 1WRLA 4XL5A 1MXEA 2BL0B 2Y5IA 2QU1A 1JFKA 3I5FC 5HW9A 1EMLA 4JF9A 3SVDA 2SASA 4HREE 3EK8A 1DJHA 1V1FA 1R6PA 4XOVA 3SS0A 2K0JA 2Z1OA 2JTZA 1YHIA 2AHAA 4KAGA 5D69A 1W7TA 3VRPA 3PATA 1SL7A 3EVUA 2BKHB 3DQUA 3LA1A 4IK3A 5DPIA 2A48A 1CDLA 2KBIA 2K7CA 2IS9A 2MRDA 4I2YA 2A46A 3W1CA 2JT8A 1KSOA 3PN7B 1F70A 1DJXA 2HPSA 1BR1B 1LVCD 2HRSA 2ZMWA 2EMDA 4H48A 4ZF4A 4P1QA 1B1GA 5DPJA 1J7QA 5AERA 2EHBA 1Y1UA 1DGVA 3VK1A 4P76A 1NWDA 4W6OA 5FYXA 1NCYA 1UURA 3CFHA 3LCPC 2LHLA 1YUTA 1ZUXA 4KW9A 3LS3A 2M0RA 3AI5A 3BUMB 1KQMB 2JNFA 5DTZA 3CD1A 2DD9A 2G6XA 2PXSA 4H3MA 4U2VA 2KQ6A 4F0ZB 4XJKA 2WOSA 1F71A 4XJKB 3G9AA 2WHTA 2DDDA 1UWOA 1SKTA 1YRUB 3DQ6A 4Q7TA 2G16B 3U8CA 2LMUA 1A03A 2AWJA 1BG1A 3PM8A 2JWWA 4ORCB 4YGBB 5CSFA 1QYFA 4HSZA 4NDBA 5CSIA 2F3ZA 1B7TZ 4AOMA 2VAEA 2E30A 2YE1A 3EVPA 2Z6ZA 1EG3A 4H3LA 2WISA 2V53A 1C7WA 3AAJA 3CFFA 5EBJA 2GV5A 2M8UA 3BOWA 3NEDA 4DXNA 3BOWB 3DVJA 4XVPA 2PALA 5BTTA 2WURA 5BTTB 1SBJA 1OXEA 1U5IA 1XA9A 4W6DA 1U5IB 4ORAB 4H3NA 2QRFA 2MAZA 1MWNA 1BT6A 1IG5A 1ZFSA 2OKWA 1JF0A 4W6AA 3DVMA 2BE6A 1EMBA 1H4UA 1PRWA 4AR7A 4QJ4B 4QJ5B 3DQ4A 1SK6D 4JQ0D 1N2DA 1J55A 3OB2B 1SY9A 4HRGA 3SG4A 4Q7UA 1KFUS 5JJGA 1PVBA 2HQZA 3AKAA 4KF5C 4YI8A 2KHNA 3DQFA 1QS7A 1ODBA 3ICBA 1CFFA 4OKHA 5EXBA 1PALA 3DQJA 3NSLA 1JBAA 4EN1A 3DQ2A 4OVNF 4ETOA 4N3DA 1JWDA 2L4HA 4KEXA 2FJUB 2LVIA 2OS8C 1B8LA 2WCEA 5HYDA 5LTQA 2M7NA 2HQKA 1CMFA 1B8RA 1B9CA 4GOBA 3SVSA 4W73A 1JUOA 1MOVA 3PFVA 1W7UA 1KP5A 1QXTA 1MUXA 1A2XA 4IK9A 2Z6XA 1RRXA 2K7DA 5AXIA 5J3XA 1FPWA 4UTSA 1EXRA 1SR6C 4BDUA 2P4MA 2AAOA 1IWQA 1YX8A 1KQVA 1CKKA 1QIVA 3TZ1A 4ZFSA 4YBHB 2JU0A 3GB3A 1J7PA 4W6FA 2ZRSA 3LVCA 1CDNA 1K93D 2HCGA 1SYMA 2VZXA 4KF5A 3ST0A 2AWKA 3DPXA 1NX0A 1RWYA 2JQ6A 2H61C 2PASA 5HZSA 2JXCA 4RYWA 3LVAA 3DQLA 3HX4A 2G5ZB 4MRXA 3BUXB 3A8SA 3GEXA 4TZAA 2F8PA 1A29A 3I5GC 1S6JA 2JULA 3DQ9A 4JPZB 3ZWHA 2EC6C 2NXQA 2LLUA 5H87A 2COLB 1D1OA 3ZULA 1ZACA 4YGEB 5F9GA 4U8DA 3CD9A 2ZKMX 5DPHA 2A52B 5T3IA 2PMYA 2WSNA 2LVKA 2OTEA 2IB6A 5ER4X 1Q4DA 1IGVA 1QX5B 1SR6B 4W6LA 4W6UA 1TCOB 1PK0D 1KK7Z 2JC2A 3I5IC 4N5XA 4PPLA 2G9BA 4EDOA 4PFEA 2LLSA 3SSPA 4YRUA 1NPQA 1GFLA 5H88A 3PJ5A 5HKZA 2H61A 2F2OA 2WCFA 1QX7A 1IQ3A 1UHIA 3OB1B 1JBZA 4W6MA 4PPJA 3I19A 4IL1A 4P5OE 2M7LA 1OXFA 1ZUZA 1OMDA 1JBYA 2QACA 4W6BA 3SVBA 3P28A 3I5GB 2NZ0A 2M1KB 1KYPA 1XSSA 3JVTC 3LK0A 2I94A 1IJ5A 2EC6B 1S6IA 3U0LA 1YVLA 1QXPA 1CLLA 2O60A 4IK1A 4DRWA 3U8PA 3IQQA 3LF4B 5CPVA 1SCVA 1QLKA 3CGLA 1EMFA 1RK9A 5HZTA 1JFJA 2HGDA 1CNPA 2Q4UA 3CZTX 2L50A 3W1DA 2QPTA 1QJTA 4A4BA 1SNLA 2DUGA 1G8IA 1N65A 3E3RA 5PALA 3GL4A 3SVUA 2LVJA 4GGFC 1KCYA 1IQ5A 1CFCA 2LMTA 3CFAA 2KNEA 4ZCVA 3EVRA 1L7ZA 1Y6WA 2OPOA 4PPKA 4W6NA 2WORA 2MJWB 4ZF3A 1YFPA 1OOJA 2OTGC 4DS7A 1A75A 3TDUA 2RH7A 4PDZA 1A75B 1UP5A 3JVTB 1CM1A 1DJYA 2QLGA 2DUFA 2LCPA 2QLGB 5LK4A 2D8NA 4W72A 3CR4X 1CDMA 2O5GA 4GF6B 1YVHA 2ZN9A 3LK1A 4ZINA 2EMNA 2WSOA 4MEWA 4GUKA 2DD7A 2ZNEA 3ZUJA 1C7VA 4NQGA 3SSHA 5ER5A 4DKMA 1G33A 2VRGA 5DKQA 1PSBA 2K2FA 1K9UA 1SL8A 1S26D 1WRZA 2HETA 2DUIA 4MLWA 2KAVA 4GAOA 4EDSA 4GGFA 1QX2A 1PSRA 2B3QA 2HJOA 1Z1PA 2VVJA 2L98A 4USLA 5DKRA 3DQ8A 3MGFA 1RECA 2KDHA 2JPTA 3M24A 3S05A 5DQBA 1Q4EA 2FCEA 2ZNDA 1K90D 2K7BA 1MYWA 4YGAA 1CTRA 1MQ1A 2PSRA 2OTGB 2DUEA 2KI4B 1OE9B 4Q04A 3AKOA 5JOLA 4TZGA 3VRQA 2H9WA 5DQMA 1AUIB 3DQEA 2KI6C 4D1EA 2Q6PA 4J89A 4M2PA 2Y1NA 1S6ZA 2A47A 3I5FB 3P8UA 3NSIA 1NCZA 4OGSA 3DQ5A 1RMPA 1S3PA 4NDCA 5KU1A 2OGRA 5FHVA 2JADA 3SIAA 2G6EA 4PE4A 1B9AA 3U0KA 1B8CA 1G4YR 1WRKA 4ZCUA 1J7RA 2OTBA 5HLVA 4LJBA 5EB7A 1S6CA 4I5KA 2FOTA 1NYAA 4QJ3B 1M46A 1NCXA 3PALA 1NX3A 4DXQA 1Y1XA 4ORBB 3TUYC 1LA3A 1Y1AA 4DXOA 1UHHA 3ZTFA 1S36A 1SRAA 4AS8A 4DIRA 1W7JB 1C4FA 2H5RA 1EL4A 4DXPA 1K9PA 1M45A 1OXDA 1QVIZ 4H47A 1H8BA 1OMRA 2LV7A 4DUQA 3KEVA 1CFPA 4MRYA 2QZ0A 4HE4A 2A54B 1SL9A 2BKIB 1SCMC 2H5OA 4L12A 1KK8C 3WLDA 2JT0A 3PJBA 2LM5A 3LF3A 2KI6D 1C07A 4W74A 4ANJA 3GK2A 4W7EA 1L2OC 5I2OA 1TOPA 2O2BA 3DQNA 3SVCA 3NF0A 1BR4B 4W7CA 1GGXA 1DJIA 4W6RA 4MVFA 2KYCA 2ZMUA 1M39A 2TN4A 2G2BA 3TUYB 4OY4A 5G08A 3VROA 1MOUA 4PE1A 1B7TY 4W6TA 2I7AA 2FWQA 2M9GA 2BCXA 1QLSA 2H2KA 1XFZO 3SG3A 4MSPA 5LTPA 2BECA 1XFYO 1KSMA 1K95A 4C0JA 5KTYA 4IK8A 1J1EA 4ORNA 1XFUO 3KCTA 1B4CA 1AVSA 1TRFA 1MXLC 4ZB1A 1EMCA 2BBMA 1PVAA 3ED8A 5EB6A 1FI5A 2LVVA 1KFXS 3TDZA 2FZUA 3KHEA 1AP4A 2FL1A 3M0WA 3FIAA 5DY6A 2BE4A 1J1DA 1F09A 1L2OB 2M29A 4W6CA 3U8AA 3BXKA 4YGCB 4Z4MA 3DQIA 1TN4A 2HPWA 3BXCA 2F2PA 4J88A 2CCMA 5EJUA 2YFPA 3K1KA 3VRRA 3EK7A 2MHHA 3H1OA 5FVFA 4FTGA 1XA5A 4W77A 1JC1A 2C9JA 1IKUA 2P6BB 4JC2A 1S5GZ 1MR8A 2C9IA 2EGDA 2QLIA 4BY4A 4W6HA 3IP2A 1CFDA 1NX2A 2M1UA 2OS8B 2RGIA 4Q7RA 1QV1A 2B3PA 1CM4A 1RROA 2VADA 3KO0A 5HZUA 3SVRA 4B5YA 5I8NA 2M49B 2MBXA 3FWBA 1XQMA 3WNXB 1YTZC 1YR5A 3H4SE 1CMGA 4W7AA 3RWAA 3LVDA 1WDCC 3O77A 2O24A 1UHJA 1K94A 4W6KA 1UHNA 4C0LA 4J8AA 2GW3A 2L51A 4NWSA 1IH0A 1ZGPA 3SSLA 4YI9A 2JT3A 4KW8A 4WQ3A 2V4EC 1BF5A 4GESB 4DCKA 5AFPA 2LP3A 3OX6A 4RTCA 3D10A 1LA0A 1FBVA 4LQUA 1TNWA 2F3YA 4KGFA 1OZOA 1YRTB 5AANA 1KYSA 4W6SA 2ISDA 2GGMA 2KAYA 2ZRTA 1OSAA 4KF4A 3SVEA 2SCPA 5HZOA 2PVBA 1CV7A 2A50B 4ICBA 1HQVA 2OKYA 4JRBA 4TNCA 4LJDC 2QLHA 1GL4A 3VGOA 4I5NB 5KSZA 3WLCA 5HKYA 2BCBA 3D0YA 3GJ2A 1TNQA 3D0YB 4PE0A 5BPJA 4OHSA 4NDDA 1JC2A 1ALWA 1QTXA 2Y0GA 2WHUA 3ADFA 1WDCB 2H5PA 3UG0A 2M3WA 1MF8B 3I5IB 4CPVA 3SSKA 2K8MB 2H5QA 1Z1QA 3ST2A 3BQ3A 1X02A 2GGZA 1OQPA 2LNKA 1NIWA 3TMRA 4LJCA 1ZMZA 2B1UA 2YDZA 3O6BA 3FS7A 1J7OA 3DPZA 1EH2A 1YHHA 1QY3A 4HQCA 3DQHA 1BLQA 1K9KA 1GQMA 3RM1A 4OJ0A 1XVJA 3EVVA 3NT3A 1BFPA 1YJFA 1SW8A 4W6GA 2CTNA 1CLBA 4ZIOA 4IK4A 1GGWA 3OSQA 4DKNA 3OX5A 2KGRA 4W76A 4EULA 5EXUA 1F8HA 1TCFA 1Y0VH 1XYDA 1Q4BA 3AKBA 2O29A 3GOFA 1H4BA 2KAXA 4XYNA 5CSJA 1UUSA 2JZIA 2LMVA 3DQMA 5K89A 3BUOB 3ZNIA 2IOVA 1KQMC 2LAPA 4W7FA 3V3DA 3IF7A 4OV2A 2KFHA 3OGOA 2JTTA 1CDPA 1M63B 2ARLA 2KGBC 1E8AA 2G3OA 4C0KA 1GJYA 1HUYA 1K8UA 2LHIA 1LINA 3GK1A 1H6RA 4XOWA 1B47A 1RFJA 4W6JA 4HQ9A 3ST4A 2KFGA 4JEOA 2R2IA 1NX1A 1F4OA 3E5VA 1PULA 4W7DA 2NCOA 1RTP1 1MHOA 3NSKA 5IBWA 2NLNA 2QT2A 5DTLA 3SVNA 2CT9A 4LQTA 3DQ1A 5F6TA 3CGAA 2LC5A 3NT9A 1TIZA 1F54A 1IRJA 1FW4A 2LANA 1S1EA 3SRYA 2CNPA 3OHMB 3BX9A 3DQ7A 2AH8A 4PALA 1F4QA 2JXLA 4HVFA 2AUCA 1YUUA 1TTXA 4PHKA 2AWLA 3SSVA 1DGUA 1K2HA 3DQOA 3EKJA 4MZJA 1WLZA 1HCJA 4CLNA 2Q57A 3TS5C 1YURA 1NSHA 5DRGA 1RMOA 3DQ3A 1KYRA 2DUHA 1OMVA 5DPGA 1LXFC 3E5TA 4OCIA 4L13A 1CB1A 1YJ2A 3WHTB 1DJGA 3GJ1A 2L4IA 4KPIA 4E68A 5BQLA 1JF2A 4DXMA 2M97A 2GW4B 3PSRA 2BBNA 3NEZA 4BY5A 1ZOTB 4HQ8A 3DQKA 3DQAA 1QATA 3A4UB 4W7XA 4W69A 2HGYA 4A4CA 3CBEA 4KW4A 4R1EA 1WY9A 3DQDA 5B8IB 3DD4A 3JTDC 4CFRA 3EKHA 5DRFA 5FVGA 1EMAA 5HLOA 3ST3A 5HGEA 3WHUB 2LE9B 3PIBA 4CIDA 1EJ3A 5AEQA 4R6DA 3LL8B 2ZO6A 5H89A 1JSAA 5LTRA 3RLZA 5DU0A 1FI6A 4JWQA 2LUXA 3BYAA 1F0BA 4JGEA 3CTNA 1Q73A 3DVKA 1UISA 3H1RA 1QVIY 2K61A 4M2OA 1RJVA 2G2SB 2POXA 2HF5A 5J2OA 4I5JA 1W7IB 3TS5B 2A4JA 4Z4KA 4W7RA 2Y1MA 1DTLA 1FF1A 4PE7A 2YE0A 5DKNA 2L0PA 1ZGQA 2ZFDA 3EK4A 4GBAA 5EHUA 3CLNA 1EMKA 4XGYA 4WQ2A 3DF0A 2MLEC 2BCAA 3DF0B 3FWCA 1QIWA 3UFZA 3WCKA 1SCMB 1XK4C 2L2EA 2Z6YA 4CFQA 1KK8B 3SSTA 2PXWA 3GK4X 3C1VA 2KYFA 3CWGA 2KBMA 4M2QA 2H6VA 3DPWA 3JTDB 1JC0A 4Q9WA 2AMIA 3ZUFA 3RWTA 1DJWA 4W6IA 3AAKA 3SG6A 4DXIA 2KSPA 3HCMA 1V1GA 2K2AA 2CXJA 4N1GA 1AK8A 2JNXA 4AQIA 1RM9A 3LLEA 1BODA 3U0NA 3I5HC 3PJ7A 3CR2A 3IR8A 3WXAA 1SMGA 4P2YB 1DT7B 1YHGA 4PHJA 3AI4A 1K96A 1EMEA 4OR9B 1DVIA 2GX0A 3DVEA 3O4YA 3KCSA 2EMOA 4PHNA 2WHSA 2K7OA 2WNDA 2ZN8A 3SIBA 3IQOA 4R6BA 1XFXO 1VRKA 3OP0A 1XFVO 2JOJA 4MZKA 2Q91A 3OSRA 1XK4A 2KFFA 1F55A 5TNCA 5AQBB 5D7FA 4MZLA 1AHRA 1ZGOA 3QRXA 1LKJA 2ZO7A 2G6YA 1UHKA 4AQJA 5I2LA 3VHTA 2F33A 4UPGA 3F45A 1W7SA 3BUNB 2AWMA 4W6PA 3SSYA 1CLMA 3VHTB 2MLFC 1EMMA 2HFCA 1Q4AA 1YZWA 1RMMA 4GPLB 4JFGA 1HT9A 5GQQC 4EMQA 2DOQA 3I5HB 3SJSA 1XFWO 1BU3A 3CS1A 3SG2A 1S5GY 1XAEA 3VICA 3DQCA 5BT0A 4MBEA 4RYSA 4KA9A 1XO5A 1IJ6A 3CB9A 2PRUA 4ZBLA 1EG4A 2I2RE 2KQYA 5I2QA 4ZF5A 4KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQW A;  1KWO C;  2NCP A;  1NP8 A;  1QYQ A;  1N0Y A;  3PLF B;  2HQ8 A;  4L1I A;  2ICR A;  4PHM A;  1TNX A;  2LLT A;  3SV5 A;  3SG5 A;  1Q80 A;  2MA2 A;  4IZN A;  2WIQ A;  5HBD A;  3KPX A;  3TDI A;  3E5W A;  1XMZ A;  4YGD B;  5DTX A;  3SVO A;  1KFU L;  4GNK B;  2FCD A;  1G7K A;  4I5L B;  2G3D B;  1QV0 A;  4W75 A;  4GGN A;  1BMO A;  2BTJ A;  2DDC A;  3U0M A;  3M22 A;  1GGZ A;  3VRN A;  1KK7 Y;  1YUS A;  5DTY A;  1Q4C A;  3NSO A;  4FQO A;  3BXB A;  1DF0 A;  3SG7 A;  4LW5 A;  5EXC I;  3MSE B;  1EMG A;  1DF0 B;  2BL0 C;  2OJK A;  3CR5 X;  1AJ5 A;  2WC8 A;  1DJZ A;  2WCB A;  3NXA A;  3KF9 A;  2KOT A;  2GX2 A;  2LUC A;  4Q9X A;  2CBL A;  1SPY A;  1KFX L;  2QLE A;  1DMO A;  2V4E A;  3K21 A;  4HRH A;  3LSA A;  2V4E B;  2L5X B;  3O78 A;  4B30 A;  2A56 B;  3BXA A;  3BUW B;  5FVI A;  4B30 B;  1TNP A;  2H8Q A;  1A4P A;  1M31 A;  2LP2 A;  2JRF A;  1KWO B;  1NUB A;  4WRI A;  4N1F A;  4GFT A;  3O2P A;  1YX7 A;  1BOC A;  1OZS A;  1ALV A;  2Y4Q A;  2IB5 A;  1WLM A;  1R2U A;  1AJ4 A;  2HQW A;  2A53 B;  5HKW A;  5KTG A;  1QAS A;  4L9M A;  2E6W A;  3PN7 C;  4LJD A;  5CSN A;  2KI4 C;  2IE2 A;  3TMT A;  4IK5 A;  1BJF A;  3A8R A;  2VVI A;  2I18 A;  4PCW A;  1QYO A;  2VVH A;  4MN0 A;  1WRL A;  4XL5 A;  1MXE A;  2BL0 B;  2Y5I A;  2QU1 A;  1JFK A;  3I5F C;  5HW9 A;  1EML A;  4JF9 A;  3SVD A;  2SAS A;  4HRE E;  3EK8 A;  1DJH A;  1V1F A;  1R6P A;  4XOV A;  3SS0 A;  2K0J A;  2Z1O A;  2JTZ A;  1YHI A;  2AHA A;  4KAG A;  5D69 A;  1W7T A;  3VRP A;  3PAT A;  1SL7 A;  3EVU A;  2BKH B;  3DQU A;  3LA1 A;  4IK3 A;  5DPI A;  2A48 A;  1CDL A;  2KBI A;  2K7C A;  2IS9 A;  2MRD A;  4I2Y A;  2A46 A;  3W1C A;  2JT8 A;  1KSO A;  3PN7 B;  1F70 A;  1DJX A;  2HPS A;  1BR1 B;  1LVC D;  2HRS A;  2ZMW A;  2EMD A;  4H48 A;  4ZF4 A;  4P1Q A;  1B1G A;  5DPJ A;  1J7Q A;  5AER A;  2EHB A;  1Y1U A;  1DGV A;  3VK1 A;  4P76 A;  1NWD A;  4W6O A;  5FYX A;  1NCY A;  1UUR A;  3CFH A;  3LCP C;  2LHL A;  1YUT A;  1ZUX A;  4KW9 A;  3LS3 A;  2M0R A;  3AI5 A;  3BUM B;  1KQM B;  2JNF A;  5DTZ A;  3CD1 A;  2DD9 A;  2G6X A;  2PXS A;  4H3M A;  4U2V A;  2KQ6 A;  4F0Z B;  4XJK A;  2WOS A;  1F71 A;  4XJK B;  3G9A A;  2WHT A;  2DDD A;  1UWO A;  1SKT A;  1YRU B;  3DQ6 A;  4Q7T A;  2G16 B;  3U8C A;  2LMU A;  1A03 A;  2AWJ A;  1BG1 A;  3PM8 A;  2JWW A;  4ORC B;  4YGB B;  5CSF A;  1QYF A;  4HSZ A;  4NDB A;  5CSI A;  2F3Z A;  1B7T Z;  4AOM A;  2VAE A;  2E30 A;  2YE1 A;  3EVP A;  2Z6Z A;  1EG3 A;  4H3L A;  2WIS A;  2V53 A;  1C7W A;  3AAJ A;  3CFF A;  5EBJ A;  2GV5 A;  2M8U A;  3BOW A;  3NED A;  4DXN A;  3BOW B;  3DVJ A;  4XVP A;  2PAL A;  5BTT A;  2WUR A;  5BTT B;  1SBJ A;  1OXE A;  1U5I A;  1XA9 A;  4W6D A;  1U5I B;  4ORA B;  4H3N A;  2QRF A;  2MAZ A;  1MWN A;  1BT6 A;  1IG5 A;  1ZFS A;  2OKW A;  1JF0 A;  4W6A A;  3DVM A;  2BE6 A;  1EMB A;  1H4U A;  1PRW A;  4AR7 A;  4QJ4 B;  4QJ5 B;  3DQ4 A;  1SK6 D;  4JQ0 D;  1N2D A;  1J55 A;  3OB2 B;  1SY9 A;  4HRG A;  3SG4 A;  4Q7U A;  1KFU S;  5JJG A;  1PVB A;  2HQZ A;  3AKA A;  4KF5 C;  4YI8 A;  2KHN A;  3DQF A;  1QS7 A;  1ODB A;  3ICB A;  1CFF A;  4OKH A;  5EXB A;  1PAL A;  3DQJ A;  3NSL A;  1JBA A;  4EN1 A;  3DQ2 A;  4OVN F;  4ETO A;  4N3D A;  1JWD A;  2L4H A;  4KEX A;  2FJU B;  2LVI A;  2OS8 C;  1B8L A;  2WCE A;  5HYD A;  5LTQ A;  2M7N A;  2HQK A;  1CMF A;  1B8R A;  1B9C A;  4GOB A;  3SVS A;  4W73 A;  1JUO A;  1MOV A;  3PFV A;  1W7U A;  1KP5 A;  1QXT A;  1MUX A;  1A2X A;  4IK9 A;  2Z6X A;  1RRX A;  2K7D A;  5AXI A;  5J3X A;  1FPW A;  4UTS A;  1EXR A;  1SR6 C;  4BDU A;  2P4M A;  2AAO A;  1IWQ A;  1YX8 A;  1KQV A;  1CKK A;  1QIV A;  3TZ1 A;  4ZFS A;  4YBH B;  2JU0 A;  3GB3 A;  1J7P A;  4W6F A;  2ZRS A;  3LVC A;  1CDN A;  1K93 D;  2HCG A;  1SYM A;  2VZX A;  4KF5 A;  3ST0 A;  2AWK A;  3DPX A;  1NX0 A;  1RWY A;  2JQ6 A;  2H61 C;  2PAS A;  5HZS A;  2JXC A;  4RYW A;  3LVA A;  3DQL A;  3HX4 A;  2G5Z B;  4MRX A;  3BUX B;  3A8S A;  3GEX A;  4TZA A;  2F8P A;  1A29 A;  3I5G C;  1S6J A;  2JUL A;  3DQ9 A;  4JPZ B;  3ZWH A;  2EC6 C;  2NXQ A;  2LLU A;  5H87 A;  2COL B;  1D1O A;  3ZUL A;  1ZAC A;  4YGE B;  5F9G A;  4U8D A;  3CD9 A;  2ZKM X;  5DPH A;  2A52 B;  5T3I A;  2PMY A;  2WSN A;  2LVK A;  2OTE A;  2IB6 A;  5ER4 X;  1Q4D A;  1IGV A;  1QX5 B;  1SR6 B;  4W6L A;  4W6U A;  1TCO B;  1PK0 D;  1KK7 Z;  2JC2 A;  3I5I C;  4N5X A;  4PPL A;  2G9B A;  4EDO A;  4PFE A;  2LLS A;  3SSP A;  4YRU A;  1NPQ A;  1GFL A;  5H88 A;  3PJ5 A;  5HKZ A;  2H61 A;  2F2O A;  2WCF A;  1QX7 A;  1IQ3 A;  1UHI A;  3OB1 B;  1JBZ A;  4W6M A;  4PPJ A;  3I19 A;  4IL1 A;  4P5O E;  2M7L A;  1OXF A;  1ZUZ A;  1OMD A;  1JBY A;  2QAC A;  4W6B A;  3SVB A;  3P28 A;  3I5G B;  2NZ0 A;  2M1K B;  1KYP A;  1XSS A;  3JVT C;  3LK0 A;  2I94 A;  1IJ5 A;  2EC6 B;  1S6I A;  3U0L A;  1YVL A;  1QXP A;  1CLL A;  2O60 A;  4IK1 A;  4DRW A;  3U8P A;  3IQQ A;  3LF4 B;  5CPV A;  1SCV A;  1QLK A;  3CGL A;  1EMF A;  1RK9 A;  5HZT A;  1JFJ A;  2HGD A;  1CNP A;  2Q4U A;  3CZT X;  2L50 A;  3W1D A;  2QPT A;  1QJT A;  4A4B A;  1SNL A;  2DUG A;  1G8I A;  1N65 A;  3E3R A;  5PAL A;  3GL4 A;  3SVU A;  2LVJ A;  4GGF C;  1KCY A;  1IQ5 A;  1CFC A;  2LMT A;  3CFA A;  2KNE A;  4ZCV A;  3EVR A;  1L7Z A;  1Y6W A;  2OPO A;  4PPK A;  4W6N A;  2WOR A;  2MJW B;  4ZF3 A;  1YFP A;  1OOJ A;  2OTG C;  4DS7 A;  1A75 A;  3TDU A;  2RH7 A;  4PDZ A;  1A75 B;  1UP5 A;  3JVT B;  1CM1 A;  1DJY A;  2QLG A;  2DUF A;  2LCP A;  2QLG B;  5LK4 A;  2D8N A;  4W72 A;  3CR4 X;  1CDM A;  2O5G A;  4GF6 B;  1YVH A;  2ZN9 A;  3LK1 A;  4ZIN A;  2EMN A;  2WSO A;  4MEW A;  4GUK A;  2DD7 A;  2ZNE A;  3ZUJ A;  1C7V A;  4NQG A;  3SSH A;  5ER5 A;  4DKM A;  1G33 A;  2VRG A;  5DKQ A;  1PSB A;  2K2F A;  1K9U A;  1SL8 A;  1S26 D;  1WRZ A;  2HET A;  2DUI A;  4MLW A;  2KAV A;  4GAO A;  4EDS A;  4GGF A;  1QX2 A;  1PSR A;  2B3Q A;  2HJO A;  1Z1P A;  2VVJ A;  2L98 A;  4USL A;  5DKR A;  3DQ8 A;  3MGF A;  1REC A;  2KDH A;  2JPT A;  3M24 A;  3S05 A;  5DQB A;  1Q4E A;  2FCE A;  2ZND A;  1K90 D;  2K7B A;  1MYW A;  4YGA A;  1CTR A;  1MQ1 A;  2PSR A;  2OTG B;  2DUE A;  2KI4 B;  1OE9 B;  4Q04 A;  3AKO A;  5JOL A;  4TZG A;  3VRQ A;  2H9W A;  5DQM A;  1AUI B;  3DQE A;  2KI6 C;  4D1E A;  2Q6P A;  4J89 A;  4M2P A;  2Y1N A;  1S6Z A;  2A47 A;  3I5F B;  3P8U A;  3NSI A;  1NCZ A;  4OGS A;  3DQ5 A;  1RMP A;  1S3P A;  4NDC A;  5KU1 A;  2OGR A;  5FHV A;  2JAD A;  3SIA A;  2G6E A;  4PE4 A;  1B9A A;  3U0K A;  1B8C A;  1G4Y R;  1WRK A;  4ZCU A;  1J7R A;  2OTB A;  5HLV A;  4LJB A;  5EB7 A;  1S6C A;  4I5K A;  2FOT A;  1NYA A;  4QJ3 B;  1M46 A;  1NCX A;  3PAL A;  1NX3 A;  4DXQ A;  1Y1X A;  4ORB B;  3TUY C;  1LA3 A;  1Y1A A;  4DXO A;  1UHH A;  3ZTF A;  1S36 A;  1SRA A;  4AS8 A;  4DIR A;  1W7J B;  1C4F A;  2H5R A;  1EL4 A;  4DXP A;  1K9P A;  1M45 A;  1OXD A;  1QVI Z;  4H47 A;  1H8B A;  1OMR A;  2LV7 A;  4DUQ A;  3KEV A;  1CFP A;  4MRY A;  2QZ0 A;  4HE4 A;  2A54 B;  1SL9 A;  2BKI B;  1SCM C;  2H5O A;  4L12 A;  1KK8 C;  3WLD A;  2JT0 A;  3PJB A;  2LM5 A;  3LF3 A;  2KI6 D;  1C07 A;  4W74 A;  4ANJ A;  3GK2 A;  4W7E A;  1L2O C;  5I2O A;  1TOP A;  2O2B A;  3DQN A;  3SVC A;  3NF0 A;  1BR4 B;  4W7C A;  1GGX A;  1DJI A;  4W6R A;  4MVF A;  2KYC A;  2ZMU A;  1M39 A;  2TN4 A;  2G2B A;  3TUY B;  4OY4 A;  5G08 A;  3VRO A;  1MOU A;  4PE1 A;  1B7T Y;  4W6T A;  2I7A A;  2FWQ A;  2M9G A;  2BCX A;  1QLS A;  2H2K A;  1XFZ O;  3SG3 A;  4MSP A;  5LTP A;  2BEC A;  1XFY O;  1KSM A;  1K95 A;  4C0J A;  5KTY A;  4IK8 A;  1J1E A;  4ORN A;  1XFU O;  3KCT A;  1B4C A;  1AVS A;  1TRF A;  1MXL C;  4ZB1 A;  1EMC A;  2BBM A;  1PVA A;  3ED8 A;  5EB6 A;  1FI5 A;  2LVV A;  1KFX S;  3TDZ A;  2FZU A;  3KHE A;  1AP4 A;  2FL1 A;  3M0W A;  3FIA A;  5DY6 A;  2BE4 A;  1J1D A;  1F09 A;  1L2O B;  2M29 A;  4W6C A;  3U8A A;  3BXK A;  4YGC B;  4Z4M A;  3DQI A;  1TN4 A;  2HPW A;  3BXC A;  2F2P A;  4J88 A;  2CCM A;  5EJU A;  2YFP A;  3K1K A;  3VRR A;  3EK7 A;  2MHH A;  3H1O A;  5FVF A;  4FTG A;  1XA5 A;  4W77 A;  1JC1 A;  2C9J A;  1IKU A;  2P6B B;  4JC2 A;  1S5G Z;  1MR8 A;  2C9I A;  2EGD A;  2QLI A;  4BY4 A;  4W6H A;  3IP2 A;  1CFD A;  1NX2 A;  2M1U A;  2OS8 B;  2RGI A;  4Q7R A;  1QV1 A;  2B3P A;  1CM4 A;  1RRO A;  2VAD A;  3KO0 A;  5HZU A;  3SVR A;  4B5Y A;  5I8N A;  2M49 B;  2MBX A;  3FWB A;  1XQM A;  3WNX B;  1YTZ C;  1YR5 A;  3H4S E;  1CMG A;  4W7A A;  3RWA A;  3LVD A;  1WDC C;  3O77 A;  2O24 A;  1UHJ A;  1K94 A;  4W6K A;  1UHN A;  4C0L A;  4J8A A;  2GW3 A;  2L51 A;  4NWS A;  1IH0 A;  1ZGP A;  3SSL A;  4YI9 A;  2JT3 A;  4KW8 A;  4WQ3 A;  2V4E C;  1BF5 A;  4GES B;  4DCK A;  5AFP A;  2LP3 A;  3OX6 A;  4RTC A;  3D10 A;  1LA0 A;  1FBV A;  4LQU A;  1TNW A;  2F3Y A;  4KGF A;  1OZO A;  1YRT B;  5AAN A;  1KYS A;  4W6S A;  2ISD A;  2GGM A;  2KAY A;  2ZRT A;  1OSA A;  4KF4 A;  3SVE A;  2SCP A;  5HZO A;  2PVB A;  1CV7 A;  2A50 B;  4ICB A;  1HQV A;  2OKY A;  4JRB A;  4TNC A;  4LJD C;  2QLH A;  1GL4 A;  3VGO A;  4I5N B;  5KSZ A;  3WLC A;  5HKY A;  2BCB A;  3D0Y A;  3GJ2 A;  1TNQ A;  3D0Y B;  4PE0 A;  5BPJ A;  4OHS A;  4NDD A;  1JC2 A;  1ALW A;  1QTX A;  2Y0G A;  2WHU A;  3ADF A;  1WDC B;  2H5P A;  3UG0 A;  2M3W A;  1MF8 B;  3I5I B;  4CPV A;  3SSK A;  2K8M B;  2H5Q A;  1Z1Q A;  3ST2 A;  3BQ3 A;  1X02 A;  2GGZ A;  1OQP A;  2LNK A;  1NIW A;  3TMR A;  4LJC A;  1ZMZ A;  2B1U A;  2YDZ A;  3O6B A;  3FS7 A;  1J7O A;  3DPZ A;  1EH2 A;  1YHH A;  1QY3 A;  4HQC A;  3DQH A;  1BLQ A;  1K9K A;  1GQM A;  3RM1 A;  4OJ0 A;  1XVJ A;  3EVV A;  3NT3 A;  1BFP A;  1YJF A;  1SW8 A;  4W6G A;  2CTN A;  1CLB A;  4ZIO A;  4IK4 A;  1GGW A;  3OSQ A;  4DKN A;  3OX5 A;  2KGR A;  4W76 A;  4EUL A;  5EXU A;  1F8H A;  1TCF A;  1Y0V H;  1XYD A;  1Q4B A;  3AKB A;  2O29 A;  3GOF A;  1H4B A;  2KAX A;  4XYN A;  5CSJ A;  1UUS A;  2JZI A;  2LMV A;  3DQM A;  5K89 A;  3BUO B;  3ZNI A;  2IOV A;  1KQM C;  2LAP A;  4W7F A;  3V3D A;  3IF7 A;  4OV2 A;  2KFH A;  3OGO A;  2JTT A;  1CDP A;  1M63 B;  2ARL A;  2KGB C;  1E8A A;  2G3O A;  4C0K A;  1GJY A;  1HUY A;  1K8U A;  2LHI A;  1LIN A;  3GK1 A;  1H6R A;  4XOW A;  1B47 A;  1RFJ A;  4W6J A;  4HQ9 A;  3ST4 A;  2KFG A;  4JEO A;  2R2I A;  1NX1 A;  1F4O A;  3E5V A;  1PUL A;  4W7D A;  2NCO A;  1RTP 1;  1MHO A;  3NSK A;  5IBW A;  2NLN A;  2QT2 A;  5DTL A;  3SVN A;  2CT9 A;  4LQT A;  3DQ1 A;  5F6T A;  3CGA A;  2LC5 A;  3NT9 A;  1TIZ A;  1F54 A;  1IRJ A;  1FW4 A;  2LAN A;  1S1E A;  3SRY A;  2CNP A;  3OHM B;  3BX9 A;  3DQ7 A;  2AH8 A;  4PAL A;  1F4Q A;  2JXL A;  4HVF A;  2AUC A;  1YUU A;  1TTX A;  4PHK A;  2AWL A;  3SSV A;  1DGU A;  1K2H A;  3DQO A;  3EKJ A;  4MZJ A;  1WLZ A;  1HCJ A;  4CLN A;  2Q57 A;  3TS5 C;  1YUR A;  1NSH A;  5DRG A;  1RMO A;  3DQ3 A;  1KYR A;  2DUH A;  1OMV A;  5DPG A;  1LXF C;  3E5T A;  4OCI A;  4L13 A;  1CB1 A;  1YJ2 A;  3WHT B;  1DJG A;  3GJ1 A;  2L4I A;  4KPI A;  4E68 A;  5BQL A;  1JF2 A;  4DXM A;  2M97 A;  2GW4 B;  3PSR A;  2BBN A;  3NEZ A;  4BY5 A;  1ZOT B;  4HQ8 A;  3DQK A;  3DQA A;  1QAT A;  3A4U B;  4W7X A;  4W69 A;  2HGY A;  4A4C A;  3CBE A;  4KW4 A;  4R1E A;  1WY9 A;  3DQD A;  5B8I B;  3DD4 A;  3JTD C;  4CFR A;  3EKH A;  5DRF A;  5FVG A;  1EMA A;  5HLO A;  3ST3 A;  5HGE A;  3WHU B;  2LE9 B;  3PIB A;  4CID A;  1EJ3 A;  5AEQ A;  4R6D A;  3LL8 B;  2ZO6 A;  5H89 A;  1JSA A;  5LTR A;  3RLZ A;  5DU0 A;  1FI6 A;  4JWQ A;  2LUX A;  3BYA A;  1F0B A;  4JGE A;  3CTN A;  1Q73 A;  3DVK A;  1UIS A;  3H1R A;  1QVI Y;  2K61 A;  4M2O A;  1RJV A;  2G2S B;  2POX A;  2HF5 A;  5J2O A;  4I5J A;  1W7I B;  3TS5 B;  2A4J A;  4Z4K A;  4W7R A;  2Y1M A;  1DTL A;  1FF1 A;  4PE7 A;  2YE0 A;  5DKN A;  2L0P A;  1ZGQ A;  2ZFD A;  3EK4 A;  4GBA A;  5EHU A;  3CLN A;  1EMK A;  4XGY A;  4WQ2 A;  3DF0 A;  2MLE C;  2BCA A;  3DF0 B;  3FWC A;  1QIW A;  3UFZ A;  3WCK A;  1SCM B;  1XK4 C;  2L2E A;  2Z6Y A;  4CFQ A;  1KK8 B;  3SST A;  2PXW A;  3GK4 X;  3C1V A;  2KYF A;  3CWG A;  2KBM A;  4M2Q A;  2H6V A;  3DPW A;  3JTD B;  1JC0 A;  4Q9W A;  2AMI A;  3ZUF A;  3RWT A;  1DJW A;  4W6I A;  3AAK A;  3SG6 A;  4DXI A;  2KSP A;  3HCM A;  1V1G A;  2K2A A;  2CXJ A;  4N1G A;  1AK8 A;  2JNX A;  4AQI A;  1RM9 A;  3LLE A;  1BOD A;  3U0N A;  3I5H C;  3PJ7 A;  3CR2 A;  3IR8 A;  3WXA A;  1SMG A;  4P2Y B;  1DT7 B;  1YHG A;  4PHJ A;  3AI4 A;  1K96 A;  1EME A;  4OR9 B;  1DVI A;  2GX0 A;  3DVE A;  3O4Y A;  3KCS A;  2EMO A;  4PHN A;  2WHS A;  2K7O A;  2WND A;  2ZN8 A;  3SIB A;  3IQO A;  4R6B A;  1XFX O;  1VRK A;  3OP0 A;  1XFV O;  2JOJ A;  4MZK A;  2Q91 A;  3OSR A;  1XK4 A;  2KFF A;  1F55 A;  5TNC A;  5AQB B;  5D7F A;  4MZL A;  1AHR A;  1ZGO A;  3QRX A;  1LKJ A;  2ZO7 A;  2G6Y A;  1UHK A;  4AQJ A;  5I2L A;  3VHT A;  2F33 A;  4UPG A;  3F45 A;  1W7S A;  3BUN B;  2AWM A;  4W6P A;  3SSY A;  1CLM A;  3VHT B;  2MLF C;  1EMM A;  2HFC A;  1Q4A A;  1YZW A;  1RMM A;  4GPL B;  4JFG A;  1HT9 A;  5GQQ C;  4EMQ A;  2DOQ A;  3I5H B;  3SJS A;  1XFW O;  1BU3 A;  3CS1 A;  3SG2 A;  1S5G Y;  1XAE A;  3VIC A;  3DQC A;  5BT0 A;  4MBE A;  4RYS A;  4KA9 A;  1XO5 A;  1IJ6 A;  3CB9 A;  2PRU A;  4ZBL A;  1EG4 A;  2I2R E;  2KQY A;  5I2Q A;  4ZF5 A;  4KGE A; 
#chains in the Genus database with same CATH topology
 4OQW A;  1KWO C;  2NCP A;  1NP8 A;  1QYQ A;  1N0Y A;  3PLF B;  2HQ8 A;  3BFH A;  4L1I A;  2ICR A;  4PHM A;  1TNX A;  2LLT A;  3SV5 A;  3SG5 A;  1Q80 A;  2MA2 A;  4IZN A;  2WIQ A;  5HBD A;  3KPX A;  3TDI A;  3E5W A;  1XMZ A;  4YGD B;  5DTX A;  3SVO A;  1KFU L;  4GNK B;  2FCD A;  1G7K A;  4I5L B;  2G3D B;  1QV0 A;  3Q8I A;  4W75 A;  4GGN A;  1BMO A;  2BTJ A;  2DDC A;  3U0M A;  3M22 A;  1GGZ A;  3VRN A;  1KK7 Y;  1YUS A;  5DTY A;  3BFA A;  1Q4C A;  3B87 A;  3NSO A;  4FQO A;  3BXB A;  1DF0 A;  3SG7 A;  4LW5 A;  5EXC I;  3MSE B;  1EMG A;  1DF0 B;  2BL0 C;  2OJK A;  3CR5 X;  1AJ5 A;  2WC8 A;  1DJZ A;  2WCB A;  3NXA A;  3KF9 A;  2KOT A;  3RZS A;  2WCK A;  2GX2 A;  2LUC A;  4Q9X A;  2CBL A;  1SPY A;  1KFX L;  2QLE A;  1DMO A;  2V4E A;  3K21 A;  4HRH A;  2FJY A;  3LSA A;  2V4E B;  2L5X B;  3O78 A;  4B30 A;  2A56 B;  3BXA A;  3BUW B;  5FVI A;  4B30 B;  1TNP A;  2H8Q A;  1A4P A;  3SS3 A;  1M31 A;  2LP2 A;  2JRF A;  1KWO B;  1NUB A;  4WRI A;  4INW A;  4N1F A;  4GFT A;  3B6X A;  3O2P A;  1YX7 A;  1BOC A;  1OZS A;  1ALV A;  2Y4Q A;  2IB5 A;  1WLM A;  1R2U A;  1AJ4 A;  2HQW A;  2A53 B;  5HKW A;  5KTG A;  1QAS A;  4L9M A;  2E6W A;  3PN7 C;  4LJD A;  5CSN A;  2KI4 C;  1TUZ A;  2IE2 A;  3TMT A;  4IK5 A;  1BJF A;  3A8R A;  2VVI A;  2I18 A;  4PCW A;  1QYO A;  2VVH A;  4MN0 A;  1WRL A;  4XL5 A;  1MXE A;  2BL0 B;  2Y5I A;  2QU1 A;  1JFK A;  3I5F C;  3FE9 A;  5HW9 A;  5FI6 A;  1EML A;  4JF9 A;  3SVD A;  2SAS A;  4HRE E;  3EK8 A;  1DJH A;  1V1F A;  1R6P A;  4XOV A;  3SS0 A;  2K0J A;  2Z1O A;  2JTZ A;  1YHI A;  2AHA A;  4KAG A;  5D69 A;  1W7T A;  1ORG A;  3VRP A;  3PAT A;  1SL7 A;  3EVU A;  2BKH B;  3DQU A;  3LA1 A;  4IK3 A;  5DPI A;  2A48 A;  1CDL A;  2KBI A;  2K7C A;  2IS9 A;  2MRD A;  4I2Y A;  2A46 A;  3W1C A;  2JT8 A;  1KSO A;  3PN7 B;  3D78 A;  3R1O A;  1F70 A;  3R1V A;  1DJX A;  2P70 A;  2HPS A;  1BR1 B;  1LVC D;  2HRS A;  2ZMW A;  2EMD A;  4H48 A;  4ZF4 A;  4P1Q A;  1B1G A;  5DPJ A;  1J7Q A;  5AER A;  2EHB A;  1Y1U A;  1DGV A;  3VK1 A;  4P76 A;  1NWD A;  4W6O A;  5FYX A;  1NCY A;  1UUR A;  3CFH A;  3LCP C;  2LHL A;  1YUT A;  4JD9 A;  1ZUX A;  4KW9 A;  3LS3 A;  2M0R A;  3AI5 A;  3BUM B;  1KQM B;  2JNF A;  5DTZ A;  3CD1 A;  2DD9 A;  2G6X A;  2PXS A;  4H3M A;  4U2V A;  2KQ6 A;  3PM2 A;  4F0Z B;  4XJK A;  2WOS A;  1F71 A;  4XJK B;  3G9A A;  2WHT A;  2DDD A;  1UWO A;  1SKT A;  1YRU B;  3R1P A;  3DQ6 A;  4Q7T A;  2G16 B;  3U8C A;  2LMU A;  1A03 A;  2AWJ A;  1BG1 A;  3PM8 A;  2JWW A;  4ORC B;  4YGB B;  5CSF A;  1QYF A;  4HSZ A;  4NDB A;  5CSI A;  2F3Z A;  1B7T Z;  4AOM A;  2VAE A;  2E30 A;  3DY9 A;  2YE1 A;  3EVP A;  2Z6Z A;  1EG3 A;  4H3L A;  2WIS A;  2V53 A;  1C7W A;  3AAJ A;  3CFF A;  5EBJ A;  2GV5 A;  2M8U A;  3BOW A;  3NED A;  4DXN A;  3BOW B;  3DVJ A;  4XVP A;  2PAL A;  5BTT A;  2WUR A;  5BTT B;  1SBJ A;  1OXE A;  1U5I A;  1XA9 A;  4W6D A;  2WC5 A;  1U5I B;  2GTE A;  4ORA B;  4H3N A;  2QRF A;  2MAZ A;  1MWN A;  1BT6 A;  1IG5 A;  1ZFS A;  2OKW A;  1JF0 A;  4W6A A;  3DVM A;  2BE6 A;  1EMB A;  1H4U A;  1PRW A;  4AR7 A;  4QJ4 B;  4QJ5 B;  3DQ4 A;  1SK6 D;  4JQ0 D;  1N2D A;  1J55 A;  3OB2 B;  1SY9 A;  4HRG A;  3SG4 A;  4Q7U A;  1KFU S;  5JJG A;  1PVB A;  2HQZ A;  3AKA A;  4KF5 C;  3VB1 A;  4YI8 A;  2KHN A;  3DQF A;  1QS7 A;  1ODB A;  3ICB A;  4KYN A;  1CFF A;  4OKH A;  5EXB A;  1PAL A;  3DQJ A;  3NSL A;  1JBA A;  4EN1 A;  3DQ2 A;  4OVN F;  3S0E A;  4ETO A;  4N3D A;  3CZ0 A;  1JWD A;  2L4H A;  4KEX A;  2FJU B;  2LVI A;  2OS8 C;  1B8L A;  2WCE A;  3D73 A;  3S0B A;  5HYD A;  5LTQ A;  2M7N A;  2HQK A;  1CMF A;  1B8R A;  1B9C A;  4GOB A;  3SVS A;  4W73 A;  1JUO A;  1MOV A;  3PFV A;  1W7U A;  1KP5 A;  1QXT A;  1MUX A;  2KLD A;  1A2X A;  3FE8 A;  4IK9 A;  2Z6X A;  1RRX A;  2K7D A;  5AXI A;  5J3X A;  1FPW A;  4UTS A;  1EXR A;  1SR6 C;  3OBV A;  4BDU A;  2P4M A;  2AAO A;  1IWQ A;  1YX8 A;  1KQV A;  1CKK A;  2KLE A;  1QIV A;  3TZ1 A;  4ZFS A;  4YBH B;  2JU0 A;  3GB3 A;  1J7P A;  4W6F A;  2ZRS A;  3LVC A;  1CDN A;  1K93 D;  2HCG A;  1SYM A;  2VZX A;  1Z4H A;  4KF5 A;  3ST0 A;  2AWK A;  3DPX A;  1NX0 A;  1RWY A;  2JQ6 A;  2H61 C;  2PAS A;  5HZS A;  2JXC A;  4RYW A;  3LVA A;  3DQL A;  3HX4 A;  2G5Z B;  4MRX A;  3BUX B;  3A8S A;  3GEX A;  4TZA A;  2F8P A;  1A29 A;  3I5G C;  1S6J A;  2JUL A;  3DQ9 A;  4JPZ B;  3ZWH A;  2EC6 C;  2NXQ A;  2LLU A;  5H87 A;  2COL B;  1D1O A;  3ZUL A;  1ZAC A;  4YGE B;  5F9G A;  4U8D A;  3CD9 A;  2ZKM X;  5DPH A;  2A52 B;  5T3I A;  2PMY A;  2WSN A;  2LVK A;  2OTE A;  2IB6 A;  5ER4 X;  1Q4D A;  1IGV A;  1QX5 B;  1SR6 B;  4W6L A;  4W6U A;  1TCO B;  3B86 A;  1PK0 D;  2WCJ A;  1KK7 Z;  2JC2 A;  3I5I C;  4N5X A;  4PPL A;  2G9B A;  4EDO A;  2QDI A;  4PFE A;  2LLS A;  1OOG A;  3SSP A;  4YRU A;  1NPQ A;  1Z2C B;  1GFL A;  5H88 A;  3PJ5 A;  5HKZ A;  2H61 A;  2F2O A;  2WCF A;  1QX7 A;  1IQ3 A;  1UHI A;  3OB1 B;  1JBZ A;  4W6M A;  4PPJ A;  3I19 A;  4IL1 A;  4P5O E;  2M7L A;  2ERB A;  1OXF A;  1ZUZ A;  1OMD A;  1JBY A;  2QAC A;  4W6B A;  3SVB A;  3P28 A;  3IVT A;  3I5G B;  2NZ0 A;  2M1K B;  1KYP A;  1XSS A;  3JVT C;  3LK0 A;  2I94 A;  1IJ5 A;  2EC6 B;  1S6I A;  3U0L A;  1YVL A;  1QXP A;  2L5Y A;  1CLL A;  2BAP A;  2O60 A;  4IK1 A;  4DRW A;  3U8P A;  3IQQ A;  3LF4 B;  5CPV A;  1SCV A;  1QLK A;  2PYQ A;  1P28 A;  3CGL A;  1EMF A;  1RK9 A;  5HZT A;  1JFJ A;  2HGD A;  1CNP A;  2Q4U A;  3CZT X;  2L50 A;  3W1D A;  2QPT A;  1QJT A;  3NHI A;  4A4B A;  1SNL A;  2DUG A;  1C3Y A;  1G8I A;  1N65 A;  3E3R A;  5PAL A;  3GL4 A;  1IIO A;  3SVU A;  2LVJ A;  4GGF C;  1KCY A;  1IQ5 A;  1CFC A;  2LMT A;  3CFA A;  2KNE A;  4ZCV A;  3EVR A;  1L7Z A;  3CAB A;  1Y6W A;  2OPO A;  4PPK A;  4W6N A;  2WOR A;  2MJW B;  4ZF3 A;  1YFP A;  1OOJ A;  2OTG C;  4DS7 A;  1A75 A;  3TDU A;  2RH7 A;  4PDZ A;  1A75 B;  1UP5 A;  3JVT B;  1CM1 A;  1DJY A;  3L47 A;  2QLG A;  2DUF A;  2LCP A;  2QLG B;  2P71 A;  5LK4 A;  2D8N A;  4W72 A;  3CR4 X;  3L4A A;  1CDM A;  2O5G A;  4GF6 B;  1YVH A;  2ZN9 A;  3LK1 A;  4ZIN A;  2EMN A;  3R72 A;  2WSO A;  4MEW A;  4GUK A;  2DD7 A;  2ZNE A;  3ZUJ A;  1C7V A;  4NQG A;  3SSH A;  5ER5 A;  4INX A;  4DKM A;  3V2L A;  1G33 A;  2VRG A;  5DKQ A;  1PSB A;  2K2F A;  1K9U A;  1SL8 A;  1S26 D;  1WRZ A;  2HET A;  2DUI A;  4MLW A;  2KAV A;  4GAO A;  4EDS A;  4GGF A;  1QX2 A;  1PSR A;  2B3Q A;  2HJO A;  1Z1P A;  2VVJ A;  2L98 A;  4USL A;  5DKR A;  3DQ8 A;  3MGF A;  1REC A;  2KDH A;  2JPT A;  3M24 A;  3S05 A;  5DQB A;  3B7A A;  1Q4E A;  2FCE A;  2ZND A;  1K90 D;  2K7B A;  1MYW A;  4YGA A;  1CTR A;  1MQ1 A;  2PSR A;  2OTG B;  2DUE A;  2KI4 B;  1OE9 B;  4Q04 A;  3AKO A;  5JOL A;  4TZG A;  3VRQ A;  2H9W A;  5DQM A;  1AUI B;  3DQE A;  2KI6 C;  4D1E A;  2Q6P A;  4J89 A;  3SS4 A;  4M2P A;  2Y1N A;  3S0G A;  1S6Z A;  3FE6 A;  2A47 A;  3I5F B;  3P8U A;  3NSI A;  1NCZ A;  4OGS A;  3DQ5 A;  1RMP A;  1S3P A;  4NDC A;  5KU1 A;  2OGR A;  5FHV A;  2JAD A;  3SIA A;  2G6E A;  4PE4 A;  1B9A A;  3U0K A;  1B8C A;  1G4Y R;  1WRK A;  4ZCU A;  1J7R A;  3S0F A;  2OTB A;  5HLV A;  4LJB A;  1TUJ A;  5EB7 A;  1S6C A;  4I5K A;  2FOT A;  1NYA A;  4QJ3 B;  1M46 A;  3S0D A;  1NCX A;  3PAL A;  1NX3 A;  4DXQ A;  1Y1X A;  4ORB B;  3TUY C;  1LA3 A;  1Y1A A;  4DXO A;  1UHH A;  3ZTF A;  1S36 A;  1SRA A;  3OGN A;  4AS8 A;  4DIR A;  1W7J B;  1C4F A;  2H5R A;  1EL4 A;  4DXP A;  1K9P A;  1M45 A;  1OXD A;  1QVI Z;  4H47 A;  1H8B A;  1OMR A;  2LV7 A;  4DUQ A;  3KEV A;  1CFP A;  4MRY A;  2QZ0 A;  4HE4 A;  2A54 B;  1SL9 A;  4FQT A;  2BKI B;  1SCM C;  2H5O A;  4L12 A;  1KK8 C;  3WLD A;  2JT0 A;  3PJB A;  2LM5 A;  3LF3 A;  2KI6 D;  1C07 A;  4W74 A;  4ANJ A;  3GK2 A;  4W7E A;  1L2O C;  5I2O A;  1TOP A;  2O2B A;  3DQN A;  3SVC A;  3DZT A;  3NF0 A;  2H8V A;  1BR4 B;  4W7C A;  1GGX A;  5EL2 A;  1DJI A;  4W6R A;  4MVF A;  2KYC A;  2ZMU A;  3BJH A;  1M39 A;  2TN4 A;  5D3O A;  2G2B A;  3TUY B;  4OY4 A;  5I94 A;  5G08 A;  3VRO A;  1MOU A;  4PE1 A;  1B7T Y;  4W6T A;  2I7A A;  2FWQ A;  3D75 A;  2M9G A;  3D76 A;  2BCX A;  1QLS A;  2H2K A;  1XFZ O;  3SG3 A;  4MSP A;  5LTP A;  2BEC A;  1XFY O;  1KSM A;  1K95 A;  4C0J A;  5KTY A;  4IK8 A;  1J1E A;  4ORN A;  1XFU O;  1C3Z A;  3KCT A;  1B4C A;  1AVS A;  1TRF A;  1MXL C;  4ZB1 A;  1EMC A;  2QEV A;  2BBM A;  1PVA A;  3ED8 A;  5EB6 A;  1FI5 A;  2LVV A;  1KFX S;  3TDZ A;  3B88 A;  3UNW A;  2FZU A;  3KHE A;  1AP4 A;  2FL1 A;  3M0W A;  3FIA A;  5DY6 A;  2BE4 A;  1J1D A;  1F09 A;  1L2O B;  2M29 A;  2BNX A;  4W6C A;  3U8A A;  3BXK A;  4YGC B;  4Z4M A;  3DQI A;  1TN4 A;  4PT1 A;  2HPW A;  3BXC A;  2F2P A;  4J88 A;  2CCM A;  5EJU A;  2YFP A;  3K1K A;  3VRR A;  3EK7 A;  2MHH A;  3H1O A;  5FVF A;  4FTG A;  3EG5 B;  1XA5 A;  4W77 A;  1JC1 A;  2C9J A;  1IKU A;  2P6B B;  4JC2 A;  1S5G Z;  1MR8 A;  2C9I A;  2EGD A;  4JKT A;  2QLI A;  4BY4 A;  4W6H A;  3IP2 A;  1CFD A;  1NX2 A;  2M1U A;  2OS8 B;  2RGI A;  1DC1 A;  2QEH A;  4Q7R A;  3CZ1 A;  1QV1 A;  1OOH A;  3CZ2 A;  2B3P A;  1CM4 A;  1RRO A;  3S0A A;  2VAD A;  3KO0 A;  5HZU A;  3SVR A;  3D77 A;  4B5Y A;  5I8N A;  2M49 B;  2MBX A;  3FWB A;  1XQM A;  3WNX B;  1YTZ C;  1YR5 A;  3H4S E;  1CMG A;  4W7A A;  3RWA A;  3LVD A;  1WDC C;  3K1E A;  3O77 A;  2O24 A;  1UHJ A;  1K94 A;  3CDN A;  4W6K A;  1UHN A;  4C0L A;  4J8A A;  2GW3 A;  2L51 A;  4NWS A;  1IH0 A;  1ZGP A;  4OZD A;  3SSL A;  4YI9 A;  2JT3 A;  4KW8 A;  4WQ3 A;  2V4E C;  2KPH A;  1BF5 A;  4GES B;  4DCK A;  5AFP A;  2LP3 A;  2WC6 A;  3OX6 A;  2WCM A;  4RTC A;  3D10 A;  3D74 A;  1LA0 A;  1FBV A;  4LQU A;  3BFB A;  1TNW A;  2F3Y A;  4KGF A;  1OZO A;  1YRT B;  5AAN A;  3NGV A;  1KYS A;  4W6S A;  2ISD A;  2GGM A;  2KAY A;  2ZRT A;  1OSA A;  4KF4 A;  3SVE A;  2SCP A;  5HZO A;  2K60 A;  2PVB A;  1CV7 A;  2A50 B;  4ICB A;  1HQV A;  2OKY A;  2L2C A;  4JRB A;  4TNC A;  4LJD C;  2QLH A;  1GL4 A;  3VGO A;  4I5N B;  5KSZ A;  3WLC A;  5HKY A;  2BCB A;  3D0Y A;  3GJ2 A;  1TNQ A;  3D0Y B;  4PE0 A;  5BPJ A;  4OHS A;  4NDD A;  1JC2 A;  1ALW A;  1QTX A;  2Y0G A;  2WHU A;  3ADF A;  1WDC B;  2H5P A;  3UG0 A;  2M3W A;  1MF8 B;  1XFR A;  3I5I B;  4CPV A;  3SSK A;  2K8M B;  2H5Q A;  1Z1Q A;  3ST2 A;  3BQ3 A;  1X02 A;  1LS8 A;  2GGZ A;  3O4X A;  3N7H A;  1OQP A;  2LNK A;  1NIW A;  3TMR A;  4LJC A;  1ZMZ A;  2B1U A;  2YDZ A;  3O6B A;  3DYE A;  3FS7 A;  1DEK A;  1J7O A;  3DPZ A;  1EH2 A;  1YHH A;  1QY3 A;  4HQC A;  3DQH A;  1BLQ A;  1K9K A;  5FI7 A;  1GQM A;  4IJ7 A;  2WCH A;  3RM1 A;  4OJ0 A;  1XVJ A;  3EVV A;  3NT3 A;  1BFP A;  1YJF A;  2JPO A;  1SW8 A;  4W6G A;  2CTN A;  1CLB A;  4ZIO A;  4IK4 A;  1GGW A;  3OSQ A;  4DKN A;  3OX5 A;  2KGR A;  4W76 A;  4EUL A;  5EXU A;  1F8H A;  1DEL A;  1TCF A;  1Y0V H;  3PJI A;  1XYD A;  1Q4B A;  1DQE A;  3AKB A;  2O29 A;  3GOF A;  1H4B A;  2KAX A;  2WCL A;  4XYN A;  5CSJ A;  1OOF A;  1UUS A;  2JZI A;  2LMV A;  3DQM A;  5K89 A;  3BUO B;  3ZNI A;  2IOV A;  1KQM C;  2LAP A;  4W7F A;  3V3D A;  3IF7 A;  4OV2 A;  2KFH A;  3OGO A;  2JTT A;  1CDP A;  1TWO A;  1M63 B;  4F7F A;  2ARL A;  2KGB C;  1E8A A;  2G3O A;  4C0K A;  1GM0 A;  1GJY A;  1HUY A;  1K8U A;  2LHI A;  1LIN A;  3GK1 A;  1H6R A;  4XOW A;  1B47 A;  1RFJ A;  4W6J A;  4HQ9 A;  3ST4 A;  2KFG A;  4JEO A;  1OW4 A;  2R2I A;  1NX1 A;  1F4O A;  3E5V A;  1PUL A;  4W7D A;  2NCO A;  1RTP 1;  1MHO A;  3NSK A;  5IBW A;  2NLN A;  2QT2 A;  5DTL A;  3SVN A;  2CT9 A;  4LQT A;  3DQ1 A;  5F6T A;  3CGA A;  2LC5 A;  3NT9 A;  1TIZ A;  1F54 A;  1IRJ A;  1FW4 A;  2LAN A;  1S1E A;  3SRY A;  2CNP A;  3OHM B;  3BX9 A;  3DQ7 A;  2AH8 A;  4PAL A;  1F4Q A;  2JXL A;  4HVF A;  2AUC A;  3NHT A;  1YUU A;  1QWV A;  1TTX A;  4PHK A;  2AWL A;  3SSV A;  1DGU A;  1K2H A;  2QEB A;  3DQO A;  3EKJ A;  4MZJ A;  1WLZ A;  1HCJ A;  4CLN A;  2Q57 A;  3TS5 C;  1YUR A;  1NSH A;  5DRG A;  1RMO A;  3SS5 A;  3DQ3 A;  1KYR A;  2DUH A;  1OMV A;  5DPG A;  1LXF C;  1W9Z A;  3E5T A;  4OCI A;  4L13 A;  1CB1 A;  1YJ2 A;  3WHT B;  1DJG A;  3GJ1 A;  2L4I A;  4KPI A;  4E68 A;  5BQL A;  1JF2 A;  4DXM A;  2M97 A;  2GW4 B;  3PSR A;  2BBN A;  3NEZ A;  4BY5 A;  1ZOT B;  4HQ8 A;  3DQK A;  3DQA A;  1QAT A;  3A4U B;  4W7X A;  4W69 A;  2HGY A;  4A4C A;  3CBE A;  4KW4 A;  4R1E A;  2QEO A;  1WY9 A;  3DQD A;  5B8I B;  3DD4 A;  3JTD C;  4CFR A;  3EKH A;  5DRF A;  5FVG A;  1EMA A;  5HLO A;  3ST3 A;  5HGE A;  3WHU B;  2LE9 B;  3PIB A;  4CID A;  1EJ3 A;  5AEQ A;  4R6D A;  3LL8 B;  2ZO6 A;  5H89 A;  1JSA A;  5LTR A;  3RLZ A;  5DU0 A;  1FI6 A;  4JWQ A;  2LUX A;  3BYA A;  1F0B A;  4JGE A;  3CTN A;  2YGU A;  1Q73 A;  3DVK A;  1UIS A;  3H1R A;  1QVI Y;  2K61 A;  4M2O A;  3UO9 A;  1RJV A;  2G2S B;  2POX A;  2HF5 A;  5J2O A;  4I5J A;  1W7I B;  3TS5 B;  2A4J A;  4Z4K A;  4W7R A;  2Y1M A;  1DTL A;  1FF1 A;  2YE0 A;  4PE7 A;  5FI2 A;  5DKN A;  2L0P A;  1ZGQ A;  2ZFD A;  3EK4 A;  4GBA A;  5EHU A;  3CLN A;  1EMK A;  4XGY A;  4WQ2 A;  3DF0 A;  2MLE C;  2BCA A;  3L4L A;  3DF0 B;  3FWC A;  1QIW A;  3CYZ A;  3UFZ A;  3WCK A;  1SCM B;  1XK4 C;  2L2E A;  2Z6Y A;  4CFQ A;  1KK8 B;  3SST A;  2PXW A;  3GK4 X;  3C1V A;  2KYF A;  3CWG A;  2KBM A;  4M2Q A;  2H6V A;  3DPW A;  3JTD B;  1JC0 A;  4Q9W A;  2AMI A;  3ZUF A;  3RWT A;  1DJW A;  1OOI X;  4W6I A;  3AAK A;  3SG6 A;  4DXI A;  2KSP A;  3HCM A;  1V1G A;  2K2A A;  2CXJ A;  4N1G A;  1AK8 A;  2JNX A;  4AQI A;  5DIC A;  1RM9 A;  3LLE A;  1SSE B;  1BOD A;  3U0N A;  3I5H C;  3PJ7 A;  3CR2 A;  3IR8 A;  3WXA A;  1SMG A;  4P2Y B;  1DT7 B;  1YHG A;  4PHJ A;  3AI4 A;  1K96 A;  1EME A;  4OR9 B;  1DVI A;  2GX0 A;  3DVE A;  3O4Y A;  3KCS A;  2EMO A;  4PHN A;  2WHS A;  2K7O A;  2WND A;  2ZN8 A;  3SIB A;  3IQO A;  4R6B A;  1XFX O;  1VRK A;  3OP0 A;  1XFV O;  2JOJ A;  4MZK A;  2Q91 A;  3OSR A;  1XK4 A;  2KFF A;  1F55 A;  5TNC A;  5AQB B;  5D7F A;  4MZL A;  1AHR A;  1ZGO A;  3QRX A;  1LKJ A;  5HL1 A;  2ZO7 A;  2G6Y A;  1UHK A;  4AQJ A;  5I2L A;  3VHT A;  2F33 A;  4UPG A;  3F45 A;  1W7S A;  3BUN B;  2AWM A;  4W6P A;  3SSY A;  1CLM A;  3VHT B;  3DXL A;  2MLF C;  1EMM A;  2HFC A;  1Q4A A;  1YZW A;  1RMM A;  4GPL B;  4JFG A;  1HT9 A;  5GQQ C;  4EMQ A;  2DOQ A;  3I5H B;  3SJS A;  1XFW O;  3QME A;  1BU3 A;  3CS1 A;  3SG2 A;  1S5G Y;  2PQL A;  1XAE A;  3VIC A;  3DQC A;  5BT0 A;  4MBE A;  4RYS A;  4KA9 A;  1XO5 A;  1IJ6 A;  3CB9 A;  2PRU A;  4ZBL A;  1EG4 A;  2I2R E;  2KQY A;  5I2Q A;  4ZF5 A;  4KGE A;  1T14 A; 
#chains in the Genus database with same CATH homology
 4OQW A;  1KWO C;  2NCP A;  1NP8 A;  1QYQ A;  1N0Y A;  3PLF B;  2HQ8 A;  4L1I A;  2ICR A;  4PHM A;  1TNX A;  2LLT A;  3SV5 A;  3SG5 A;  1Q80 A;  2MA2 A;  4IZN A;  2WIQ A;  5HBD A;  3KPX A;  3TDI A;  3E5W A;  1XMZ A;  4YGD B;  5DTX A;  3SVO A;  1KFU L;  4GNK B;  2FCD A;  1G7K A;  4I5L B;  2G3D B;  1QV0 A;  4W75 A;  4GGN A;  1BMO A;  2BTJ A;  2DDC A;  3U0M A;  3M22 A;  1GGZ A;  3VRN A;  1KK7 Y;  1YUS A;  5DTY A;  1Q4C A;  3NSO A;  4FQO A;  3BXB A;  1DF0 A;  3SG7 A;  4LW5 A;  5EXC I;  3MSE B;  1EMG A;  1DF0 B;  2BL0 C;  2OJK A;  3CR5 X;  1AJ5 A;  2WC8 A;  1DJZ A;  2WCB A;  3NXA A;  3KF9 A;  2KOT A;  2GX2 A;  2LUC A;  4Q9X A;  2CBL A;  1SPY A;  1KFX L;  2QLE A;  1DMO A;  2V4E A;  3K21 A;  4HRH A;  3LSA A;  2V4E B;  2L5X B;  3O78 A;  4B30 A;  2A56 B;  3BXA A;  3BUW B;  5FVI A;  4B30 B;  1TNP A;  2H8Q A;  1A4P A;  1M31 A;  2LP2 A;  2JRF A;  1KWO B;  1NUB A;  4WRI A;  4N1F A;  4GFT A;  3O2P A;  1YX7 A;  1BOC A;  1OZS A;  1ALV A;  2Y4Q A;  2IB5 A;  1WLM A;  1R2U A;  1AJ4 A;  2HQW A;  2A53 B;  5HKW A;  5KTG A;  1QAS A;  4L9M A;  2E6W A;  3PN7 C;  4LJD A;  5CSN A;  2KI4 C;  2IE2 A;  3TMT A;  4IK5 A;  1BJF A;  3A8R A;  2VVI A;  2I18 A;  4PCW A;  1QYO A;  2VVH A;  4MN0 A;  1WRL A;  4XL5 A;  1MXE A;  2BL0 B;  2Y5I A;  2QU1 A;  1JFK A;  3I5F C;  5HW9 A;  1EML A;  4JF9 A;  3SVD A;  2SAS A;  4HRE E;  3EK8 A;  1DJH A;  1V1F A;  1R6P A;  4XOV A;  3SS0 A;  2K0J A;  2Z1O A;  2JTZ A;  1YHI A;  2AHA A;  4KAG A;  5D69 A;  1W7T A;  3VRP A;  3PAT A;  1SL7 A;  3EVU A;  2BKH B;  3DQU A;  3LA1 A;  4IK3 A;  5DPI A;  2A48 A;  1CDL A;  2KBI A;  2K7C A;  2IS9 A;  2MRD A;  4I2Y A;  2A46 A;  3W1C A;  2JT8 A;  1KSO A;  3PN7 B;  1F70 A;  1DJX A;  2HPS A;  1BR1 B;  1LVC D;  2HRS A;  2ZMW A;  2EMD A;  4H48 A;  4ZF4 A;  4P1Q A;  1B1G A;  5DPJ A;  1J7Q A;  5AER A;  2EHB A;  1Y1U A;  1DGV A;  3VK1 A;  4P76 A;  1NWD A;  4W6O A;  5FYX A;  1NCY A;  1UUR A;  3CFH A;  3LCP C;  2LHL A;  1YUT A;  1ZUX A;  4KW9 A;  3LS3 A;  2M0R A;  3AI5 A;  3BUM B;  1KQM B;  2JNF A;  5DTZ A;  3CD1 A;  2DD9 A;  2G6X A;  2PXS A;  4H3M A;  4U2V A;  2KQ6 A;  4F0Z B;  4XJK A;  2WOS A;  1F71 A;  4XJK B;  3G9A A;  2WHT A;  2DDD A;  1UWO A;  1SKT A;  1YRU B;  3DQ6 A;  4Q7T A;  2G16 B;  3U8C A;  2LMU A;  1A03 A;  2AWJ A;  1BG1 A;  3PM8 A;  2JWW A;  4ORC B;  4YGB B;  5CSF A;  1QYF A;  4HSZ A;  4NDB A;  5CSI A;  2F3Z A;  1B7T Z;  4AOM A;  2VAE A;  2E30 A;  2YE1 A;  3EVP A;  2Z6Z A;  1EG3 A;  4H3L A;  2WIS A;  2V53 A;  1C7W A;  3AAJ A;  3CFF A;  5EBJ A;  2GV5 A;  2M8U A;  3BOW A;  3NED A;  4DXN A;  3BOW B;  3DVJ A;  4XVP A;  2PAL A;  5BTT A;  2WUR A;  5BTT B;  1SBJ A;  1OXE A;  1U5I A;  1XA9 A;  4W6D A;  1U5I B;  4ORA B;  4H3N A;  2QRF A;  2MAZ A;  1MWN A;  1BT6 A;  1IG5 A;  1ZFS A;  2OKW A;  1JF0 A;  4W6A A;  3DVM A;  2BE6 A;  1EMB A;  1H4U A;  1PRW A;  4AR7 A;  4QJ4 B;  4QJ5 B;  3DQ4 A;  1SK6 D;  4JQ0 D;  1N2D A;  1J55 A;  3OB2 B;  1SY9 A;  4HRG A;  3SG4 A;  4Q7U A;  1KFU S;  5JJG A;  1PVB A;  2HQZ A;  3AKA A;  4KF5 C;  4YI8 A;  2KHN A;  3DQF A;  1QS7 A;  1ODB A;  3ICB A;  1CFF A;  4OKH A;  5EXB A;  1PAL A;  3DQJ A;  3NSL A;  1JBA A;  4EN1 A;  3DQ2 A;  4OVN F;  4ETO A;  4N3D A;  1JWD A;  2L4H A;  4KEX A;  2FJU B;  2LVI A;  2OS8 C;  1B8L A;  2WCE A;  5HYD A;  5LTQ A;  2M7N A;  2HQK A;  1CMF A;  1B8R A;  1B9C A;  4GOB A;  3SVS A;  4W73 A;  1JUO A;  1MOV A;  3PFV A;  1W7U A;  1KP5 A;  1QXT A;  1MUX A;  1A2X A;  4IK9 A;  2Z6X A;  1RRX A;  2K7D A;  5AXI A;  5J3X A;  1FPW A;  4UTS A;  1EXR A;  1SR6 C;  4BDU A;  2P4M A;  2AAO A;  1IWQ A;  1YX8 A;  1KQV A;  1CKK A;  1QIV A;  3TZ1 A;  4ZFS A;  4YBH B;  2JU0 A;  3GB3 A;  1J7P A;  4W6F A;  2ZRS A;  3LVC A;  1CDN A;  1K93 D;  2HCG A;  1SYM A;  2VZX A;  4KF5 A;  3ST0 A;  2AWK A;  3DPX A;  1NX0 A;  1RWY A;  2JQ6 A;  2H61 C;  2PAS A;  5HZS A;  2JXC A;  4RYW A;  3LVA A;  3DQL A;  3HX4 A;  2G5Z B;  4MRX A;  3BUX B;  3A8S A;  3GEX A;  4TZA A;  2F8P A;  1A29 A;  3I5G C;  1S6J A;  2JUL A;  3DQ9 A;  4JPZ B;  3ZWH A;  2EC6 C;  2NXQ A;  2LLU A;  5H87 A;  2COL B;  1D1O A;  3ZUL A;  1ZAC A;  4YGE B;  5F9G A;  4U8D A;  3CD9 A;  2ZKM X;  5DPH A;  2A52 B;  5T3I A;  2PMY A;  2WSN A;  2LVK A;  2OTE A;  2IB6 A;  5ER4 X;  1Q4D A;  1IGV A;  1QX5 B;  1SR6 B;  4W6L A;  4W6U A;  1TCO B;  1PK0 D;  1KK7 Z;  2JC2 A;  3I5I C;  4N5X A;  4PPL A;  2G9B A;  4EDO A;  4PFE A;  2LLS A;  3SSP A;  4YRU A;  1NPQ A;  1GFL A;  5H88 A;  3PJ5 A;  5HKZ A;  2H61 A;  2F2O A;  2WCF A;  1QX7 A;  1IQ3 A;  1UHI A;  3OB1 B;  1JBZ A;  4W6M A;  4PPJ A;  3I19 A;  4IL1 A;  4P5O E;  2M7L A;  1OXF A;  1ZUZ A;  1OMD A;  1JBY A;  2QAC A;  4W6B A;  3SVB A;  3P28 A;  3I5G B;  2NZ0 A;  2M1K B;  1KYP A;  1XSS A;  3JVT C;  3LK0 A;  2I94 A;  1IJ5 A;  2EC6 B;  1S6I A;  3U0L A;  1YVL A;  1QXP A;  1CLL A;  2O60 A;  4IK1 A;  4DRW A;  3U8P A;  3IQQ A;  3LF4 B;  5CPV A;  1SCV A;  1QLK A;  3CGL A;  1EMF A;  1RK9 A;  5HZT A;  1JFJ A;  2HGD A;  1CNP A;  2Q4U A;  3CZT X;  2L50 A;  3W1D A;  2QPT A;  1QJT A;  4A4B A;  1SNL A;  2DUG A;  1G8I A;  1N65 A;  3E3R A;  5PAL A;  3GL4 A;  3SVU A;  2LVJ A;  4GGF C;  1KCY A;  1IQ5 A;  1CFC A;  2LMT A;  3CFA A;  2KNE A;  4ZCV A;  3EVR A;  1L7Z A;  1Y6W A;  2OPO A;  4PPK A;  4W6N A;  2WOR A;  2MJW B;  4ZF3 A;  1YFP A;  1OOJ A;  2OTG C;  4DS7 A;  1A75 A;  3TDU A;  2RH7 A;  4PDZ A;  1A75 B;  1UP5 A;  3JVT B;  1CM1 A;  1DJY A;  2QLG A;  2DUF A;  2LCP A;  2QLG B;  5LK4 A;  2D8N A;  4W72 A;  3CR4 X;  1CDM A;  2O5G A;  4GF6 B;  1YVH A;  2ZN9 A;  3LK1 A;  4ZIN A;  2EMN A;  2WSO A;  4MEW A;  4GUK A;  2DD7 A;  2ZNE A;  3ZUJ A;  1C7V A;  4NQG A;  3SSH A;  5ER5 A;  4DKM A;  1G33 A;  2VRG A;  5DKQ A;  1PSB A;  2K2F A;  1K9U A;  1SL8 A;  1S26 D;  1WRZ A;  2HET A;  2DUI A;  4MLW A;  2KAV A;  4GAO A;  4EDS A;  4GGF A;  1QX2 A;  1PSR A;  2B3Q A;  2HJO A;  1Z1P A;  2VVJ A;  2L98 A;  4USL A;  5DKR A;  3DQ8 A;  3MGF A;  1REC A;  2KDH A;  2JPT A;  3M24 A;  3S05 A;  5DQB A;  1Q4E A;  2FCE A;  2ZND A;  1K90 D;  2K7B A;  1MYW A;  4YGA A;  1CTR A;  1MQ1 A;  2PSR A;  2OTG B;  2DUE A;  2KI4 B;  1OE9 B;  4Q04 A;  3AKO A;  5JOL A;  4TZG A;  3VRQ A;  2H9W A;  5DQM A;  1AUI B;  3DQE A;  2KI6 C;  4D1E A;  2Q6P A;  4J89 A;  4M2P A;  2Y1N A;  1S6Z A;  2A47 A;  3I5F B;  3P8U A;  3NSI A;  1NCZ A;  4OGS A;  3DQ5 A;  1RMP A;  1S3P A;  4NDC A;  5KU1 A;  2OGR A;  5FHV A;  2JAD A;  3SIA A;  2G6E A;  4PE4 A;  1B9A A;  3U0K A;  1B8C A;  1G4Y R;  1WRK A;  4ZCU A;  1J7R A;  2OTB A;  5HLV A;  4LJB A;  5EB7 A;  1S6C A;  4I5K A;  2FOT A;  1NYA A;  4QJ3 B;  1M46 A;  1NCX A;  3PAL A;  1NX3 A;  4DXQ A;  1Y1X A;  4ORB B;  3TUY C;  1LA3 A;  1Y1A A;  4DXO A;  1UHH A;  3ZTF A;  1S36 A;  1SRA A;  4AS8 A;  4DIR A;  1W7J B;  1C4F A;  2H5R A;  1EL4 A;  4DXP A;  1K9P A;  1M45 A;  1OXD A;  1QVI Z;  4H47 A;  1H8B A;  1OMR A;  2LV7 A;  4DUQ A;  3KEV A;  1CFP A;  4MRY A;  2QZ0 A;  4HE4 A;  2A54 B;  1SL9 A;  2BKI B;  1SCM C;  2H5O A;  4L12 A;  1KK8 C;  3WLD A;  2JT0 A;  3PJB A;  2LM5 A;  3LF3 A;  2KI6 D;  1C07 A;  4W74 A;  4ANJ A;  3GK2 A;  4W7E A;  1L2O C;  5I2O A;  1TOP A;  2O2B A;  3DQN A;  3SVC A;  3NF0 A;  1BR4 B;  4W7C A;  1GGX A;  1DJI A;  4W6R A;  4MVF A;  2KYC A;  2ZMU A;  1M39 A;  2TN4 A;  2G2B A;  3TUY B;  4OY4 A;  5G08 A;  3VRO A;  1MOU A;  4PE1 A;  1B7T Y;  4W6T A;  2I7A A;  2FWQ A;  2M9G A;  2BCX A;  1QLS A;  2H2K A;  1XFZ O;  3SG3 A;  4MSP A;  5LTP A;  2BEC A;  1XFY O;  1KSM A;  1K95 A;  4C0J A;  5KTY A;  4IK8 A;  1J1E A;  4ORN A;  1XFU O;  3KCT A;  1B4C A;  1AVS A;  1TRF A;  1MXL C;  4ZB1 A;  1EMC A;  2BBM A;  1PVA A;  3ED8 A;  5EB6 A;  1FI5 A;  2LVV A;  1KFX S;  3TDZ A;  2FZU A;  3KHE A;  1AP4 A;  2FL1 A;  3M0W A;  3FIA A;  5DY6 A;  2BE4 A;  1J1D A;  1F09 A;  1L2O B;  2M29 A;  4W6C A;  3U8A A;  3BXK A;  4YGC B;  4Z4M A;  3DQI A;  1TN4 A;  2HPW A;  3BXC A;  2F2P A;  4J88 A;  2CCM A;  5EJU A;  2YFP A;  3K1K A;  3VRR A;  3EK7 A;  2MHH A;  3H1O A;  5FVF A;  4FTG A;  1XA5 A;  4W77 A;  1JC1 A;  2C9J A;  1IKU A;  2P6B B;  4JC2 A;  1S5G Z;  1MR8 A;  2C9I A;  2EGD A;  2QLI A;  4BY4 A;  4W6H A;  3IP2 A;  1CFD A;  1NX2 A;  2M1U A;  2OS8 B;  2RGI A;  4Q7R A;  1QV1 A;  2B3P A;  1CM4 A;  1RRO A;  2VAD A;  3KO0 A;  5HZU A;  3SVR A;  4B5Y A;  5I8N A;  2M49 B;  2MBX A;  3FWB A;  1XQM A;  3WNX B;  1YTZ C;  1YR5 A;  3H4S E;  1CMG A;  4W7A A;  3RWA A;  3LVD A;  1WDC C;  3O77 A;  2O24 A;  1UHJ A;  1K94 A;  4W6K A;  1UHN A;  4C0L A;  4J8A A;  2GW3 A;  2L51 A;  4NWS A;  1IH0 A;  1ZGP A;  3SSL A;  4YI9 A;  2JT3 A;  4KW8 A;  4WQ3 A;  2V4E C;  1BF5 A;  4GES B;  4DCK A;  5AFP A;  2LP3 A;  3OX6 A;  4RTC A;  3D10 A;  1LA0 A;  1FBV A;  4LQU A;  1TNW A;  2F3Y A;  4KGF A;  1OZO A;  1YRT B;  5AAN A;  1KYS A;  4W6S A;  2ISD A;  2GGM A;  2KAY A;  2ZRT A;  1OSA A;  4KF4 A;  3SVE A;  2SCP A;  5HZO A;  2PVB A;  1CV7 A;  2A50 B;  4ICB A;  1HQV A;  2OKY A;  4JRB A;  4TNC A;  4LJD C;  2QLH A;  1GL4 A;  3VGO A;  4I5N B;  5KSZ A;  3WLC A;  5HKY A;  2BCB A;  3D0Y A;  3GJ2 A;  1TNQ A;  3D0Y B;  4PE0 A;  5BPJ A;  4OHS A;  4NDD A;  1JC2 A;  1ALW A;  1QTX A;  2Y0G A;  2WHU A;  3ADF A;  1WDC B;  2H5P A;  3UG0 A;  2M3W A;  1MF8 B;  3I5I B;  4CPV A;  3SSK A;  2K8M B;  2H5Q A;  1Z1Q A;  3ST2 A;  3BQ3 A;  1X02 A;  2GGZ A;  1OQP A;  2LNK A;  1NIW A;  3TMR A;  4LJC A;  1ZMZ A;  2B1U A;  2YDZ A;  3O6B A;  3FS7 A;  1J7O A;  3DPZ A;  1EH2 A;  1YHH A;  1QY3 A;  4HQC A;  3DQH A;  1BLQ A;  1K9K A;  1GQM A;  3RM1 A;  4OJ0 A;  1XVJ A;  3EVV A;  3NT3 A;  1BFP A;  1YJF A;  1SW8 A;  4W6G A;  2CTN A;  1CLB A;  4ZIO A;  4IK4 A;  1GGW A;  3OSQ A;  4DKN A;  3OX5 A;  2KGR A;  4W76 A;  4EUL A;  5EXU A;  1F8H A;  1TCF A;  1Y0V H;  1XYD A;  1Q4B A;  3AKB A;  2O29 A;  3GOF A;  1H4B A;  2KAX A;  4XYN A;  5CSJ A;  1UUS A;  2JZI A;  2LMV A;  3DQM A;  5K89 A;  3BUO B;  3ZNI A;  2IOV A;  1KQM C;  2LAP A;  4W7F A;  3V3D A;  3IF7 A;  4OV2 A;  2KFH A;  3OGO A;  2JTT A;  1CDP A;  1M63 B;  2ARL A;  2KGB C;  1E8A A;  2G3O A;  4C0K A;  1GJY A;  1HUY A;  1K8U A;  2LHI A;  1LIN A;  3GK1 A;  1H6R A;  4XOW A;  1B47 A;  1RFJ A;  4W6J A;  4HQ9 A;  3ST4 A;  2KFG A;  4JEO A;  2R2I A;  1NX1 A;  1F4O A;  3E5V A;  1PUL A;  4W7D A;  2NCO A;  1RTP 1;  1MHO A;  3NSK A;  5IBW A;  2NLN A;  2QT2 A;  5DTL A;  3SVN A;  2CT9 A;  4LQT A;  3DQ1 A;  5F6T A;  3CGA A;  2LC5 A;  3NT9 A;  1TIZ A;  1F54 A;  1IRJ A;  1FW4 A;  2LAN A;  1S1E A;  3SRY A;  2CNP A;  3OHM B;  3BX9 A;  3DQ7 A;  2AH8 A;  4PAL A;  1F4Q A;  2JXL A;  4HVF A;  2AUC A;  1YUU A;  1TTX A;  4PHK A;  2AWL A;  3SSV A;  1DGU A;  1K2H A;  3DQO A;  3EKJ A;  4MZJ A;  1WLZ A;  1HCJ A;  4CLN A;  2Q57 A;  3TS5 C;  1YUR A;  1NSH A;  5DRG A;  1RMO A;  3DQ3 A;  1KYR A;  2DUH A;  1OMV A;  5DPG A;  1LXF C;  3E5T A;  4OCI A;  4L13 A;  1CB1 A;  1YJ2 A;  3WHT B;  1DJG A;  3GJ1 A;  2L4I A;  4KPI A;  4E68 A;  5BQL A;  1JF2 A;  4DXM A;  2M97 A;  2GW4 B;  3PSR A;  2BBN A;  3NEZ A;  4BY5 A;  1ZOT B;  4HQ8 A;  3DQK A;  3DQA A;  1QAT A;  3A4U B;  4W7X A;  4W69 A;  2HGY A;  4A4C A;  3CBE A;  4KW4 A;  4R1E A;  1WY9 A;  3DQD A;  5B8I B;  3DD4 A;  3JTD C;  4CFR A;  3EKH A;  5DRF A;  5FVG A;  1EMA A;  5HLO A;  3ST3 A;  5HGE A;  3WHU B;  2LE9 B;  3PIB A;  4CID A;  1EJ3 A;  5AEQ A;  4R6D A;  3LL8 B;  2ZO6 A;  5H89 A;  1JSA A;  5LTR A;  3RLZ A;  5DU0 A;  1FI6 A;  4JWQ A;  2LUX A;  3BYA A;  1F0B A;  4JGE A;  3CTN A;  1Q73 A;  3DVK A;  1UIS A;  3H1R A;  1QVI Y;  2K61 A;  4M2O A;  1RJV A;  2G2S B;  2POX A;  2HF5 A;  5J2O A;  4I5J A;  1W7I B;  3TS5 B;  2A4J A;  4Z4K A;  4W7R A;  2Y1M A;  1DTL A;  1FF1 A;  4PE7 A;  2YE0 A;  5DKN A;  2L0P A;  1ZGQ A;  2ZFD A;  3EK4 A;  4GBA A;  5EHU A;  3CLN A;  1EMK A;  4XGY A;  4WQ2 A;  3DF0 A;  2MLE C;  2BCA A;  3DF0 B;  3FWC A;  1QIW A;  3UFZ A;  3WCK A;  1SCM B;  1XK4 C;  2L2E A;  2Z6Y A;  4CFQ A;  1KK8 B;  3SST A;  2PXW A;  3GK4 X;  3C1V A;  2KYF A;  3CWG A;  2KBM A;  4M2Q A;  2H6V A;  3DPW A;  3JTD B;  1JC0 A;  4Q9W A;  2AMI A;  3ZUF A;  3RWT A;  1DJW A;  4W6I A;  3AAK A;  3SG6 A;  4DXI A;  2KSP A;  3HCM A;  1V1G A;  2K2A A;  2CXJ A;  4N1G A;  1AK8 A;  2JNX A;  4AQI A;  1RM9 A;  3LLE A;  1BOD A;  3U0N A;  3I5H C;  3PJ7 A;  3CR2 A;  3IR8 A;  3WXA A;  1SMG A;  4P2Y B;  1DT7 B;  1YHG A;  4PHJ A;  3AI4 A;  1K96 A;  1EME A;  4OR9 B;  1DVI A;  2GX0 A;  3DVE A;  3O4Y A;  3KCS A;  2EMO A;  4PHN A;  2WHS A;  2K7O A;  2WND A;  2ZN8 A;  3SIB A;  3IQO A;  4R6B A;  1XFX O;  1VRK A;  3OP0 A;  1XFV O;  2JOJ A;  4MZK A;  2Q91 A;  3OSR A;  1XK4 A;  2KFF A;  1F55 A;  5TNC A;  5AQB B;  5D7F A;  4MZL A;  1AHR A;  1ZGO A;  3QRX A;  1LKJ A;  2ZO7 A;  2G6Y A;  1UHK A;  4AQJ A;  5I2L A;  3VHT A;  2F33 A;  4UPG A;  3F45 A;  1W7S A;  3BUN B;  2AWM A;  4W6P A;  3SSY A;  1CLM A;  3VHT B;  2MLF C;  1EMM A;  2HFC A;  1Q4A A;  1YZW A;  1RMM A;  4GPL B;  4JFG A;  1HT9 A;  5GQQ C;  4EMQ A;  2DOQ A;  3I5H B;  3SJS A;  1XFW O;  1BU3 A;  3CS1 A;  3SG2 A;  1S5G Y;  1XAE A;  3VIC A;  3DQC A;  5BT0 A;  4MBE A;  4RYS A;  4KA9 A;  1XO5 A;  1IJ6 A;  3CB9 A;  2PRU A;  4ZBL A;  1EG4 A;  2I2R E;  2KQY A;  5I2Q A;  4ZF5 A;  4KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...