3SG7A

Crystal structure of gcamp3-kf(linker 1)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
410
structure length
398
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSKFNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDESKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 132
structure length 398
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg7A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg7A02
2BKHB 5I2QA 3I5HB 2ZNEA 3CFHA 3SJSA 1G4YR 4W76A 3SG5A 1LXFC 4UTSA 4OR9B 3VHTB 1XA5A 2JWWA 4ANJA 2HCGA 1AUIB 5IBWA 4Z4KA 1L2OC 1RK9A 4CLNA 5D7FA 4ORAB 3U8PA 1UHNA 2D8NA 3OB2B 2LNKA 4MVFA 3VHTA 1OXDA 3DQLA 3LK0A 3WLCA 4QJ3B 3TDUA 4AR7A 2NZ0A 1B7TZ 2O24A 1EJ3A 4HE4A 3I5GC 2ZKMX 1YURA 3ZTFA 1W7UA 3U0NA 4FTGA 1JC1A 1BU3A 2PASA 1YZWA 2BBMA 4JQ0D 4MN0A 5DY6A 1XFZO 2LLUA 1KYPA 1UISA 2BL0C 1F55A 1W7IB 3BUXB 1K9KA 4FQOA 1JF0A 1IQ3A 1HCJA 3ICBA 4GGFC 3O78A 3NXAA 2JADA 3EKJA 1R2UA 1SRAA 3NSOA 4W7XA 1J1EA 3WCKA 4MBEA 2MA2A 3BUMB 2ZN8A 3AI5A 3KHEA 1K9PA 4IK1A 5LTPA 1QLKA 2Z6YA 4IK4A 2OTGC 4Q7UA 4W6AA 4BY5A 4N1FA 1B8CA 2O60A 4F0ZB 3BXCA 3DPZA 4C0JA 4Z4MA 3CTNA 1GFLA 3U8AA 2G3OA 3EVPA 2OKYA 4GGNA 3TS5B 2GX0A 4W6RA 4PE1A 4MZLA 2A52B 1MQ1A 3GL4A 4W6IA 5HLVA 4ZINA 3OB1B 1EG3A 1B7TY 3DQ5A 1YUTA 1RTP1 1QS7A 3IQOA 3OP0A 4PFEA 2LM5A 1MXLC 1J7QA 1F8HA 4HREE 3LVCA 2KYCA 4N5XA 2H5OA 1UURA 4DKMA 1K93D 2LUCA 1ZGOA 4Q7RA 2OJKA 1OMVA 1BMOA 1ZOTB 1WRKA 2NXQA 3PALA 3UG0A 2QACA 4TZGA 2VAEA 3F45A 2WNDA 1AVSA 4YGEB 2VVHA 1EMAA 4J8AA 1Z1QA 1OOJA 2KAYA 3DQEA 2AWKA 5H88A 4XJKA 2B3PA 3OSRA 3CGLA 1TNQA 4JGEA 4U8DA 2CXJA 5EBJA 4D1EA 3PLFB 2JU0A 2LMVA 2H61A 3GJ1A 3CR4X 1QV0A 1PRWA 1S3PA 1XMZA 2HQZA 2WCEA 1BG1A 3DVEA 1YX8A 5BTTB 3A4UB 2LMUA 2QPTA 2O2BA 1BODA 1EXRA 1GGXA 1DF0A 2ZRSA 1V1GA 2I2RE 1SYMA 4L1IA 3MGFA 1JFJA 4GFTA 4E68A 3CR5X 1NPQA 2AWMA 1B9CA 3DQMA 5ER4X 2KGRA 1EH2A 1EMBA 4OY4A 2A47A 1S6ZA 4YI9A 4XOWA 2HFCA 1YHHA 1M31A 3DVMA 4W72A 4N1GA 2ISDA 4U2VA 5EXBA 1MOVA 1CDNA 4OQWA 4DXMA 2DUEA 3GK1A 1HUYA 1KK8B 4DXIA 4GPLB 3EVRA 1OQPA 2G6EA 4KPIA 2MHHA 3LVDA 1MYWA 5DPHA 4LQTA 2O5GA 2VADA 3EKHA 4YGDB 1RM9A 1C07A 3PN7C 3DPWA 1XFWO 4OVNF 3DF0B 3DQUA 1SK6D 5KU1A 1HT9A 1L7ZA 3M0WA 1YJ2A 4CIDA 1IWQA 2M9GA 3DQHA 3DQ4A 4ORCB 1XK4C 1FI5A 3BUNB 5LTQA 3DQ6A 4W6UA 4P1QA 1M45A 1YFPA 3NEDA 2LVIA 2YDZA 1QTXA 3I5HC 4OGSA 2F3YA 3VRPA 4W7EA 4PPJA 1Q4EA 4PE7A 1QIVA 2HPWA 1F09A 2ZFDA 4YGCB 1YHIA 3ST2A 3LA1A 4PE0A 1Z1PA 1CFPA 2LP3A 1CMFA 1ODBA 3BUWB 5DPJA 2M1UA 3A8RA 2KI4B 2LV7A 4MRYA 4USLA 1ZGPA 5DTZA 3FWBA 2WOSA 2JXLA 3K21A 4I5KA 2LLSA 1TN4A 3CWGA 4MZKA 2Q57A 2KDHA 1IH0A 4CFQA 1NX0A 4CPVA 1NX2A 2AUCA 3BX9A 1D1OA 4EULA 3M22A 1M63B 5EJUA 2NCOA 1Y1UA 1OMRA 4KGEA 3DVKA 5HZTA 1YVHA 2WHSA 4DXNA 1U5IA 1ZUXA 4MLWA 1NCZA 5AEQA 1K8UA 3O77A 4DS7A 1TOPA 2A53B 3LS3A 2JULA 1RMPA 2VZXA 2F33A 1KWOB 1BF5A 2WISA 1GL4A 4I5JA 4R1EA 2QU1A 1CNPA 1GGWA 2G16B 2QLHA 3G9AA 4EN1A 1Y6WA 2IB5A 4ZCUA 3AI4A 1M39A 1KSMA 5DRGA 1DVIA 1F0BA 5HZUA 3U0LA 3SVDA 5AERA 2B1UA 2DDCA 3NF0A 3KCTA 4KGFA 2H6VA 2AWLA 1QASA 4W6HA 5J2OA 3RWAA 2H2KA 2ZRTA 3D0YA 4AS8A 1WRLA 1XVJA 3P28A 2VVIA 3O2PA 1OSAA 2JT8A 2OS8B 2RGIA 4DCKA 4H48A 1OXFA 4XL5A 3GK4X 3CBEA 2SCPA 2BCAA 2CT9A 4KAGA 4LJDA 4W7AA 4A4BA 2Z1OA 2AH8A 1K94A 4GESB 2G6YA 4MZJA 2WORA 1XK4A 4P5OE 1S6JA 5GQQC 3SG4A 5EB7A 1EMKA 1W7JB 5DKQA 2Z6ZA 1YRUB 1TIZA 4ORNA 2KAXA 2MLEC 2AAOA 1PK0D 2B3QA 1JBAA 1DMOA 4RYSA 4YGAA 2WCBA 4KF4A 3BQ3A 3PIBA 3LL8B 2O29A 2ZMUA 2K0JA 3DQJA 3CB9A 4JEOA 3EK7A 1NUBA 3KPXA 3CFFA 2JNFA 4OCIA 3AAKA 3PJ7A 1M46A 1K2HA 5DTLA 5FVFA 5DTXA 5I2LA 1GQMA 1DJYA 2SASA 2C9IA 4W6CA 1QVIY 1DJIA 4PHMA 1XYDA 1G8IA 2EMDA 4KF5C 1KK8C 2M7LA 1XAEA 1Q80A 4IZNA 1CM4A 1PULA 4GNKB 2G6XA 2A56B 3ZUJA 4NDBA 2F8PA 2JT3A 4L13A 2WCFA 5DTYA 2NLNA 1BFPA 3RM1A 1E8AA 4I2YA 3GOFA 4W6JA 5BT0A 1A29A 4GUKA 1AK8A 3DD4A 1Y0VH 4H3NA 1DJGA 1ZMZA 1A4PA 2BKIB 3I19A 4XYNA 2V4EB 1MR8A 4MSPA 2KBIA 3O4YA 3SVCA 4GF6B 5CSFA 1AJ5A 5LTRA 5I2OA 3VRNA 2R2IA 2L51A 4EMQA 2E30A 5AFPA 3OSQA 4W7FA 1SY9A 2HQWA 2K7CA 3WXAA 1W7SA 2DUIA 2V53A 3SG2A 4PALA 3PJBA 2KI4C 4TNCA 2Q4UA 4N3DA 4B30B 3KCSA 3NT9A 3FIAA 1XFYO 4W77A 1NIWA 2K2AA 5JOLA 1FBVA 1LINA 2WURA 2H5QA 2EGDA 4W73A 1Q4BA 5EXCI 1G7KA 1LA0A 1MOUA 4OHSA 3EK4A 3O6BA 5HZOA 4IK8A 2JTTA 4W6OA 1DGVA 3DQIA 5JJGA 1XFXO 3TDIA 3NT3A 3HCMA 2K8MB 4KA9A 3BXKA 1B8LA 3BOWB 2BE4A 4R6DA 3WHUB 1B8RA 2DOQA 4IK9A 3OX6A 5CSIA 4DXOA 3PFVA 4IK3A 2C9JA 4XGYA 1N0YA 5BTTA 1L2OB 3BOWA 1KWOC 3PM8A 3CZTX 3FS7A 3DQOA 2K7OA 2LP2A 1CDPA 4RTCA 1AHRA 1YHGA 1V1FA 3IF7A 3KO0A 4JWQA 4YGBB 1KFUL 3DQ3A 4W75A 4KW4A 2KYFA 3I5FC 4MRXA 4W7DA 2LMTA 3TMRA 1MUXA 3DQNA 3DQAA 3ADFA 1W7TA 1QYFA 3ZWHA 3U8CA 1JC2A 3E3RA 2MAZA 3OX5A 5HLOA 4W6MA 2MJWB 1KSOA 2JPTA 3AKBA 3VK1A 3FWCA 2FOTA 2JT0A 5DPIA 1KP5A 4IK5A 4DKNA 5EHUA 2L5XB 1H8BA 1PVBA 1WLMA 4LJDC 1DT7B 4KF5A 2L4HA 1Y1AA 1S6CA 3SIBA 2OS8C 4AOMA 4HQCA 1BR1B 3NSKA 2G9BA 3SVSA 3WHTB 3LVAA 3ST0A 3V3DA 1A03A 2NCPA 2ZMWA 1S5GZ 3DF0A 3CD1A 3DQ9A 2P4MA 1EG4A 4ICBA 2M8UA 4PPKA 2POXA 1XA9A 1XSSA 2KSPA 3NSIA 1J1DA 4ZF4A 1B47A 1TTXA 1SL7A 1NCYA 2PXWA 2Z6XA 1JF2A 4ORBB 2OTBA 4W6LA 2COLB 1CMGA 3PSRA 1RJVA 3SG7A 1F70A 3QRXA 1UHJA 3LCPC 3DQ2A 2PALA 2FCEA 2L98A 4W7RA 1B4CA 1LA3A 1WDCB 1FPWA 1KFUS 1H6RA 2HRSA 3BXAA 3WLDA 2M3WA 4BY4A 1AP4A 2EMNA 3W1DA 2MLFC 2GGMA 3GJ2A 1RECA 3JVTB 1RWYA 4JC2A 3K1KA 3E5WA 3ST4A 3SG6A 4P76A 1QX5B 5HKWA 4HRHA 3SVBA 1N65A 4WRIA 2FWQA 1RFJA 3W1CA 5BPJA 4HSZA 2HQ8A 1BT6A 4I5NB 2KFGA 2FJUB 2A54B 4JF9A 4UPGA 1TNXA 1VRKA 3ST3A 2CBLA 3SVUA 1MHOA 2PRUA 1EMFA 1QJTA 1KYRA 2GV5A 3VROA 1CFDA 1DGUA 4H3MA 1WLZA 1CKKA 2A4JA 3H4SE 4M2OA 1YX7A 4ZBLA 1RMOA 1IGVA 1QXTA 2Q6PA 2L4IA 3SS0A 3TS5C 1OZSA 2M29A 1NSHA 3BUOB 4YBHB 1ZUZA 2F3ZA 3SSLA 1PSBA 1K96A 3LLEA 4NQGA 4R6BA 4H47A 5F6TA 2PSRA 2ZO7A 3MSEB 4ZFSA 2HPSA 1SR6B 1CFFA 4DXPA 1GGZA 3ED8A 4W6TA 1S1EA 3JTDB 1DJXA 4EDOA 4OJ0A 1ZFSA 3IQQA 1KQVA 2G3DB 3DQ1A 1UWOA 3ZUFA 3PJ5A 3AAJA 3CR2A 2G2SB 1CB1A 3AKAA 1EMGA 5HZSA 2JXCA 1FF1A 2L50A 2JC2A 1JBYA 4ZF3A 2HF5A 1SL8A 2CCMA 2IB6A 3GEXA 1CLBA 2BTJA 1K9UA 3PN7B 1MF8B 2QLGB 1A2XA 4HQ9A 1B9AA 4JPZB 2QLEA 1QV1A 2LVJA 4PE4A 4PCWA 3OHMB 3TUYB 2ZN9A 4QJ5B 3NEZA 5CPVA 1RRXA 5HW9A 2HJOA 1NX3A 1OZOA 2VRGA 4L12A 1Y1XA 4W7CA 4W6NA 2PMYA 2OGRA 4J88A 1DJWA 1MWNA 2GGZA 4AQIA 1H4BA 1SMGA 1LVCD 5HKYA 2JTZA 4LQUA 1CDMA 3BXBA 5FVIA 4PHKA 4XVPA 3SIAA 4AQJA 2ARLA 1IKUA 1NYAA 4ETOA 3TDZA 2WC8A 4HRGA 1G33A 1YJFA 2WSNA 1YR5A 5FHVA 1KK7Z 1BLQA 1UHHA 2H9WA 2KQ6A 4W6KA 4C0KA 1RMMA 4W6GA 4WQ3A 1NP8A 2IE2A 2FCDA 4Q9XA 1NX1A 3LK1A 2H5PA 1GJYA 2MRDA 1Q73A 1Q4CA 1ALVA 2OPOA 2BCXA 1SCMB 4KEXA 1ALWA 1F71A 5CSNA 2GW3A 3DPXA 4NWSA 5HYDA 2EC6B 1PVAA 3SVRA 5EB6A 2CNPA 3EVVA 4CFRA 1H4UA 4ZB1A 5J3XA 4YRUA 5K89A 2Y4QA 1WY9A 3KF9A 4OV2A 1RROA 2WHTA 3WNXB 2DDDA 1IQ5A 2MBXA 1A75B 2BBNA 2HGYA 3M24A 3VICA 4DRWA 2KBMA 2JZIA 5BQLA 3CS1A 1PALA 4W6DA 1B1GA 4LW5A 5I8NA 3GB3A 5HKZA 4HVFA 4Q04A 1QYOA 4W6PA 5FYXA 1QYQA 5TNCA 1A75A 2QLIA 3KEVA 1SCVA 1F54A 4J89A 3DVJA 4JRBA 1EMLA 1KK7Y 2BCBA 1CM1A 3SVEA 2IOVA 5PALA 1LKJA 3A8SA 3LF3A 3VRRA 5B8IB 2FZUA 2Y0GA 3I5IB 5CSJA 2WIQA 5LK4A 3GK2A 1KFXL 1F4OA 1R6PA 1SBJA 2V4EA 2LE9B 4H3LA 2I7AA 4P2YB 1BR4B 2F2PA 2DD7A 1QXPA 2A46A 2LC5A 2QRFA 5D69A 2H5RA 1Q4AA 3EK8A 2KQYA 2HGDA 1WDCC 2I94A 1HQVA 3SSPA 3SVNA 4ZIOA 2YE1A 4PHJA 4NDCA 1NCXA 3LSAA 1S26D 2LAPA 2GX2A 3JVTC 4Q7TA 4B30A 4XJKB 2LHLA 3E5VA 3D10A 4GOBA 1YVLA 4TZAA 3DQ7A 4DXQA 5DQBA 1KQMB 1FW4A 3SSYA 3ZNIA 2JOJA 3SSKA 1J55A 4PPLA 2KGBC 3NSLA 1YUSA 2Y1NA 2HQKA 3SSVA 5G08A 2G5ZB 4ZCVA 5DRFA 4KW8A 1DF0B 4PDZA 1C7VA 2FL1A 1SNLA 3OGOA 5HBDA 2Q91A 2Y1MA 1CLMA 2LHIA 2IS9A 1EMMA 3H1OA 5AQBB 3SG3A 1IJ6A 1AJ4A 1TRFA 1YRTB 1EMEA 3TMTA 3ZULA 4LJCA 3I5GB 3HX4A 2DUHA 5EXUA 2K7BA 2WHUA 1KFXS 2KI6C 4A4CA 4W6FA 4Q9WA 1SR6C 5AXIA 4ZF5A 1QX2A 3H1RA 3CGAA 1JFKA 4EDSA 2BL0B 3CFAA 2BE6A 5DQMA 1KCYA 3JTDC 3DQCA 2L0PA 2P6BB 2G2BA 4PHNA 2LANA 1TCFA 1BJFA 4I5LB 2LLTA 4W6BA 1JWDA 3RWTA 1K90D 1TNWA 1YTZC 1QLSA 1SPYA 2K61A 1CLLA 2F2OA 2M97A 2KI6D 1C4FA 2E6WA 2M1KB 1SW8A 5DU0A 3SRYA 2A50B 3AKOA 1BOCA 4DUQA 4BDUA 4GGFA 2PXSA 2OTGB 2H8QA 2KNEA 2RH7A 3VGOA 2KFHA 2AWJA 2QZ0A 1QATA 3U0MA 3DQ8A 3TUYC 1X02A 3PATA 1CV7A 2KFFA 3RLZA 1KYSA 4QJ4B 5KTGA 1IG5A 5FVGA 2VVJA 4W74A 2M0RA 1WRZA 5ER5A 2I18A 3DQFA 1CFCA 3P8UA 3SSTA 3LF4B 2JRFA 2DUFA 2KOTA 4KW9A 4M2PA 1IJ5A 2LVVA 1UHIA 5DKNA 4B5YA 2WSOA 1DTLA 1OMDA 3DQDA 1NWDA 1C7WA 2DUGA 4L9MA 1SL9A 5H87A 4DIRA 4W6SA 2GW4B 4MEWA 4IL1A 2Y5IA 1IRJA 2AMIA 2TN4A 4RYWA 4GAOA 4XOVA 2ZNDA 5KSZA 1J7OA 5T3IA 1SCMC 2LVKA 1S5GY 2OTEA 1XFVO 2ICRA 2QT2A 2EC6C 5HGEA 1K95A 3UFZA 2M49B 2JQ6A 2ZO6A 5DPGA 1DJHA 1MXEA 1U5IB 3BYAA 1OE9B 1F4QA 1JSAA 1CTRA 2EMOA 3CD9A 5DKRA 3S05A 1QY3A 2L2EA 1TCOB 2YFPA 2CTNA 1FI6A 1XFUO 1SKTA 5H89A 3IR8A 4NDDA 1EL4A 1JBZA 1JUOA 1N2DA 2OKWA 2PVBA 4W69A 3TZ1A 2LUXA 1PSRA 3CLNA 3EVUA 1S6IA 1S36A 4HQ8A 3DQKA 2K2FA 1UUSA 5F9GA 3SV5A 2YE0A 2KHNA 1CDLA 1Q4DA 2K7DA 4JFGA 2V4EC 2BECA 3SVOA 2JNXA 4C0LA 2EHBA 1UHKA 1QX7A 3I5FB 3D0YB 3I5IC 3U0KA 1EMCA 5KTYA 4M2QA 4OKHA 4YI8A 3VRQA 3E5TA 4WQ2A 2AHAA 1TNPA 1XQMA 1J7RA 1ZACA 3C1VA 4LJBA 4GBAA 1XO5A 1JC0A 3IP2A 2HETA 2A48A 1ZGQA 1YUUA 1J7PA 3SSHA 2LCPA 2DD9A 2KAVA 1DJZA 1OXEA 5AANA 1UP5A 1QIWA 1QVIZ 2H61C 2M7NA 1KQMC 2QLGA
chains in the Genus database with same CATH superfamily
2BKHB 5I2QA 3I5HB 2ZNEA 3CFHA 3PM2A 3SJSA 1G4YR 4W76A 3SG5A 1LXFC 4UTSA 4OR9B 3VHTB 1XA5A 2JWWA 3L47A 4ANJA 4OZDA 2HCGA 1AUIB 5IBWA 4Z4KA 1L2OC 1RK9A 4CLNA 1ORGA 5D7FA 4ORAB 3U8PA 1UHNA 2D8NA 3OB2B 2LNKA 4MVFA 3VHTA 3S0AA 1OXDA 3DQLA 3LK0A 3WLCA 4QJ3B 3TDUA 4AR7A 2NZ0A 3FE9A 1B7TZ 2O24A 1EJ3A 4HE4A 3I5GC 2ZKMX 1YURA 3ZTFA 1W7UA 3U0NA 4FTGA 1JC1A 1BU3A 2PASA 1YZWA 3L4LA 2BBMA 4JQ0D 4MN0A 5DY6A 1XFZO 2LLUA 1KYPA 1UISA 2BL0C 1F55A 1W7IB 3BUXB 1K9KA 4FQOA 1JF0A 1IQ3A 1HCJA 3ICBA 4GGFC 3O78A 3NXAA 2JADA 3EKJA 1R2UA 1SRAA 3NSOA 4W7XA 3R1VA 1J1EA 3WCKA 4MBEA 2MA2A 3BUMB 2ZN8A 3EG5B 3AI5A 3KHEA 1K9PA 4IK1A 5LTPA 1QLKA 2Z6YA 4IK4A 2OTGC 4Q7UA 4INWA 4W6AA 4BY5A 1Z4HA 4N1FA 1B8CA 2WCMA 2O60A 4F0ZB 3BXCA 3DPZA 4C0JA 4Z4MA 3CTNA 1GFLA 3U8AA 2G3OA 3EVPA 2OKYA 4GGNA 3CDNA 3TS5B 2GX0A 4W6RA 4PE1A 3DYEA 4MZLA 2A52B 1MQ1A 3DXLA 3GL4A 4W6IA 5HLVA 4ZINA 3OB1B 1EG3A 1B7TY 3DQ5A 1YUTA 1RTP1 1QS7A 3IQOA 3OP0A 4PFEA 2LM5A 1DQEA 1MXLC 1J7QA 1F8HA 4HREE 3LVCA 2KYCA 4N5XA 2H5OA 1UURA 4DKMA 1K93D 1Z2CB 2LUCA 1ZGOA 4Q7RA 2OJKA 1OMVA 1BMOA 1ZOTB 1WRKA 2NXQA 3PALA 3UG0A 2QACA 4TZGA 2VAEA 3BFAA 3F45A 2WNDA 1AVSA 4YGEB 2VVHA 1EMAA 4J8AA 1Z1QA 1OOJA 2KAYA 3DQEA 2AWKA 5H88A 4XJKA 2B3PA 3FE6A 3OSRA 3CGLA 1TNQA 4JGEA 4U8DA 2CXJA 5EBJA 4D1EA 3PLFB 2JU0A 2LMVA 2H61A 3GJ1A 3CR4X 1QV0A 1PRWA 1S3PA 1XMZA 2HQZA 2WCEA 1BG1A 3DVEA 1YX8A 5BTTB 3A4UB 2LMUA 2QPTA 2O2BA 1BODA 1EXRA 1GGXA 1DF0A 2ZRSA 1V1GA 2I2RE 1SYMA 4L1IA 3MGFA 1JFJA 4GFTA 4E68A 3CR5X 2BNXA 3OGNA 1NPQA 2AWMA 1B9CA 3R72A 3S0DA 3DQMA 5ER4X 2KGRA 1EH2A 1EMBA 4OY4A 2A47A 1S6ZA 4YI9A 4XOWA 2HFCA 1YHHA 1M31A 3DVMA 3S0BA 4W72A 1TUJA 4N1GA 2ISDA 4U2VA 5EXBA 1MOVA 1CDNA 4OQWA 3O4XA 4DXMA 2DUEA 3GK1A 1HUYA 1KK8B 4DXIA 4GPLB 3EVRA 1OQPA 2G6EA 3R1PA 4KPIA 2MHHA 3LVDA 1MYWA 5DPHA 4LQTA 2O5GA 2QDIA 2VADA 3EKHA 4YGDB 1RM9A 1C07A 3PN7C 3DPWA 1XFWO 4OVNF 3DF0B 3DQUA 1SK6D 5KU1A 1HT9A 1L7ZA 3M0WA 1YJ2A 5I94A 4CIDA 1IWQA 2M9GA 3DQHA 3DQ4A 4ORCB 1XK4C 1FI5A 3BUNB 5LTQA 3DQ6A 4W6UA 4P1QA 1M45A 1YFPA 3NEDA 3K1EA 2LVIA 4JKTA 2YDZA 1QTXA 3I5HC 4OGSA 2F3YA 3VRPA 4W7EA 4PPJA 1Q4EA 4PE7A 1QIVA 2HPWA 1F09A 2ZFDA 4YGCB 2WCJA 1YHIA 3ST2A 3LA1A 4PE0A 1Z1PA 1CFPA 2LP3A 2FJYA 1ODBA 1CMFA 3BUWB 5DPJA 2M1UA 3A8RA 2KI4B 2LV7A 4MRYA 3D74A 4USLA 1ZGPA 5DTZA 3FWBA 2WOSA 2KLEA 2JXLA 3K21A 4I5KA 2LLSA 1TN4A 3CWGA 4MZKA 2Q57A 2KDHA 1IH0A 3V2LA 4CFQA 1NX0A 4CPVA 1NX2A 2AUCA 3BX9A 1D1OA 4EULA 3M22A 1M63B 5EJUA 2NCOA 1Y1UA 1OMRA 4KGEA 3DVKA 5HZTA 3UNWA 1YVHA 2WHSA 3CYZA 4DXNA 1U5IA 1ZUXA 4MLWA 3DZTA 1NCZA 1LS8A 1W9ZA 5AEQA 1K8UA 3O77A 4PT1A 4DS7A 1TOPA 2A53B 3LS3A 2JULA 1RMPA 2VZXA 2F33A 1KWOB 1BF5A 2WISA 1GL4A 4I5JA 4R1EA 1T14A 2QU1A 1CNPA 1GGWA 2G16B 2QLHA 3G9AA 4EN1A 1Y6WA 2IB5A 4ZCUA 3AI4A 1M39A 1KSMA 5DRGA 1DVIA 1F0BA 5HZUA 3U0LA 3SVDA 2P71A 5AERA 2B1UA 2DDCA 3NF0A 3KCTA 4KGFA 2H6VA 2AWLA 1QASA 4W6HA 5J2OA 3RWAA 2H2KA 2ZRTA 3D0YA 4AS8A 1WRLA 1XVJA 3P28A 2VVIA 3O2PA 1OSAA 2JT8A 2OS8B 2RGIA 4DCKA 4H48A 1OXFA 4XL5A 3GK4X 5FI7A 3CBEA 2SCPA 2BCAA 2CT9A 4KAGA 4LJDA 4W7AA 4A4BA 2Z1OA 2AH8A 1K94A 3RZSA 4GESB 2G6YA 4MZJA 2WORA 1XK4A 4P5OE 1S6JA 5GQQC 3SG4A 5EB7A 1EMKA 1W7JB 5DKQA 2Z6ZA 1YRUB 1TIZA 4ORNA 2KAXA 2WCKA 2MLEC 2AAOA 5DICA 1PK0D 2B3QA 1JBAA 1DMOA 4RYSA 4YGAA 2WCBA 4KF4A 3BQ3A 3PIBA 3LL8B 2O29A 2ZMUA 2K0JA 3DQJA 3CB9A 4JEOA 3EK7A 1NUBA 3CZ2A 3KPXA 3CFFA 2JNFA 4OCIA 3AAKA 3PJ7A 1M46A 1K2HA 5DTLA 5FVFA 5DTXA 2KLDA 5I2LA 1GQMA 1DJYA 2SASA 5D3OA 2C9IA 4W6CA 1QVIY 1DJIA 4PHMA 1XYDA 1G8IA 2EMDA 4KF5C 1KK8C 2M7LA 1XAEA 3S0EA 1Q80A 2L5YA 3Q8IA 4IZNA 1CM4A 1PULA 2ERBA 4GNKB 2G6XA 2A56B 3ZUJA 4NDBA 1P28A 2F8PA 2JT3A 4L13A 2P70A 2WCFA 5DTYA 2NLNA 1BFPA 3RM1A 1E8AA 4I2YA 3GOFA 4W6JA 5BT0A 1A29A 4GUKA 1AK8A 3DD4A 1Y0VH 4H3NA 1DJGA 1ZMZA 1A4PA 2QEVA 2BKIB 3I19A 4XYNA 2V4EB 1MR8A 4MSPA 2KBIA 3O4YA 3SVCA 4GF6B 3B7AA 5CSFA 3CABA 1AJ5A 5LTRA 5I2OA 3VRNA 2R2IA 2L51A 4EMQA 2E30A 5FI6A 5AFPA 3OSQA 4W7FA 1SY9A 2HQWA 2K7CA 3WXAA 1W7SA 2DUIA 2V53A 3SG2A 4PALA 3PJBA 2KI4C 4TNCA 2Q4UA 4N3DA 4B30B 3KCSA 3NT9A 3FIAA 1XFYO 4W77A 1NIWA 2K2AA 5JOLA 3DY9A 1FBVA 1LINA 2WURA 2H5QA 2EGDA 4W73A 1Q4BA 5EXCI 1G7KA 1LA0A 1MOUA 4OHSA 3EK4A 3O6BA 5HZOA 4IK8A 2JTTA 4W6OA 1DGVA 3DQIA 5JJGA 1XFXO 3TDIA 3NT3A 1C3ZA 3HCMA 2K8MB 2QEBA 4KA9A 3UO9A 3BXKA 1B8LA 3BOWB 2BE4A 4R6DA 3WHUB 1B8RA 2DOQA 4IK9A 3OX6A 5CSIA 4DXOA 3PFVA 4IK3A 2C9JA 4XGYA 1N0YA 5BTTA 1L2OB 3BOWA 3NGVA 1KWOC 5HL1A 3PM8A 3CZTX 3FS7A 3DQOA 2K7OA 2LP2A 1CDPA 4RTCA 1AHRA 1YHGA 1V1FA 3IF7A 3KO0A 4JWQA 4YGBB 1KFUL 3DQ3A 4W75A 4KW4A 2KYFA 3I5FC 4MRXA 4W7DA 2LMTA 3TMRA 1MUXA 3DQNA 3DQAA 3FE8A 3ADFA 1W7TA 1QYFA 3ZWHA 3U8CA 1JC2A 3E3RA 2MAZA 3OX5A 5HLOA 4W6MA 2MJWB 1KSOA 2JPTA 3AKBA 3VK1A 2WC5A 1IIOA 3FWCA 2FOTA 2JT0A 1OOFA 5DPIA 1KP5A 4IK5A 1DELA 4IJ7A 4DKNA 5EHUA 2L5XB 1H8BA 1PVBA 1WLMA 4LJDC 1DT7B 4KF5A 2L4HA 1Y1AA 1S6CA 3SIBA 2OS8C 2BAPA 4AOMA 4HQCA 1BR1B 3NSKA 3D77A 2G9BA 3SVSA 3WHTB 3BFBA 3LVAA 3ST0A 3V3DA 1A03A 2NCPA 2ZMWA 1S5GZ 3DF0A 3CD1A 3DQ9A 2P4MA 1EG4A 4ICBA 2M8UA 4PPKA 2POXA 1XA9A 3IVTA 1XSSA 2KSPA 3NSIA 3SS3A 1J1DA 4ZF4A 1B47A 1TTXA 1SL7A 1NCYA 2PQLA 2PXWA 2Z6XA 2PYQA 1JF2A 4ORBB 2OTBA 4W6LA 2COLB 1CMGA 3PSRA 1RJVA 3SG7A 1F70A 3QRXA 1UHJA 3LCPC 3DQ2A 2PALA 2FCEA 2L98A 4W7RA 1B4CA 1SSEB 1LA3A 1WDCB 1FPWA 1KFUS 1H6RA 2HRSA 3BXAA 3WLDA 2M3WA 4BY4A 1AP4A 2EMNA 3W1DA 2MLFC 2JPOA 2GGMA 3GJ2A 1RECA 3JVTB 1RWYA 4JC2A 3D78A 3K1KA 3E5WA 3ST4A 3CZ1A 3SG6A 4P76A 1QX5B 5HKWA 4HRHA 3SVBA 1N65A 4WRIA 1XFRA 2FWQA 1RFJA 3W1CA 5BPJA 4HSZA 2HQ8A 1BT6A 4I5NB 2KFGA 3D76A 2FJUB 2A54B 4JF9A 4UPGA 1TNXA 1VRKA 3ST3A 2CBLA 3SVUA 1MHOA 2PRUA 1EMFA 2QEOA 4KYNA 1QJTA 1KYRA 2GV5A 3VROA 1CFDA 1DGUA 4H3MA 1WLZA 1CKKA 2A4JA 3H4SE 4M2OA 1YX7A 4ZBLA 1RMOA 1IGVA 1QXTA 2Q6PA 2L4IA 3SS0A 2YGUA 3TS5C 1OZSA 2M29A 3BJHA 1NSHA 3BUOB 4YBHB 1ZUZA 2F3ZA 3SSLA 5EL2A 1PSBA 1K96A 3LLEA 3CZ0A 4NQGA 3B6XA 4R6BA 4H47A 5F6TA 2PSRA 2ZO7A 3MSEB 4ZFSA 2HPSA 1SR6B 1CFFA 4DXPA 1GGZA 3ED8A 4W6TA 1S1EA 3JTDB 1DJXA 4EDOA 4OJ0A 1ZFSA 3IQQA 1KQVA 3B88A 2G3DB 3DQ1A 1DC1A 1UWOA 3ZUFA 3PJ5A 3AAJA 3CR2A 1OOGA 2G2SB 1CB1A 3AKAA 1EMGA 5HZSA 2JXCA 1FF1A 2L50A 2JC2A 1JBYA 4ZF3A 2HF5A 1SL8A 2CCMA 2IB6A 3GEXA 4INXA 1CLBA 2BTJA 3PJIA 3B87A 1K9UA 1C3YA 3PN7B 1MF8B 2QLGB 1A2XA 4HQ9A 1B9AA 4JPZB 2QLEA 1QV1A 1OOIX 2LVJA 4PE4A 4PCWA 3OHMB 3TUYB 2ZN9A 4QJ5B 3NEZA 5CPVA 1RRXA 5HW9A 2HJOA 1NX3A 4JD9A 1OZOA 2VRGA 4L12A 1Y1XA 4W7CA 1TWOA 4W6NA 2PMYA 2OGRA 4J88A 1DJWA 1MWNA 2GGZA 4AQIA 2WCHA 1H4BA 1SMGA 1LVCD 5HKYA 2JTZA 4LQUA 1CDMA 3BXBA 5FVIA 4PHKA 3D75A 4XVPA 3SIAA 4AQJA 2ARLA 1IKUA 1NYAA 4ETOA 3TDZA 2WC8A 4HRGA 1G33A 1YJFA 2WC6A 2WSNA 1YR5A 5FHVA 1KK7Z 1BLQA 1UHHA 2H9WA 2KQ6A 4W6KA 4C0KA 1RMMA 4W6GA 4WQ3A 1NP8A 2IE2A 2FCDA 3SS5A 4Q9XA 1NX1A 3LK1A 2H5PA 1GJYA 2MRDA 1Q73A 1Q4CA 1ALVA 2OPOA 2BCXA 1SCMB 4KEXA 1ALWA 1F71A 5CSNA 2GW3A 4FQTA 3DPXA 4NWSA 5HYDA 2EC6B 1PVAA 3SVRA 5EB6A 2CNPA 3EVVA 4CFRA 3SS4A 1H4UA 4ZB1A 5J3XA 4YRUA 5K89A 2Y4QA 1WY9A 3KF9A 4OV2A 1RROA 2WHTA 3WNXB 2DDDA 1IQ5A 3N7HA 2MBXA 1A75B 2BBNA 2HGYA 3M24A 3VICA 4DRWA 2KBMA 2JZIA 5BQLA 3CS1A 1PALA 4W6DA 1B1GA 4LW5A 5I8NA 2H8VA 3GB3A 5HKZA 4HVFA 4Q04A 1QYOA 4W6PA 5FYXA 1GM0A 1QYQA 5TNCA 1A75A 2QLIA 3KEVA 1SCVA 1F54A 3OBVA 4J89A 3DVJA 4JRBA 1EMLA 1KK7Y 2BCBA 1CM1A 3SVEA 2IOVA 5PALA 1LKJA 1OOHA 3A8SA 3LF3A 3VRRA 5B8IB 2FZUA 2Y0GA 3I5IB 5CSJA 2WIQA 5LK4A 3GK2A 1KFXL 1F4OA 1R6PA 1SBJA 2V4EA 2LE9B 4H3LA 2I7AA 3BFHA 4P2YB 1BR4B 2F2PA 2DD7A 1QXPA 2A46A 2LC5A 2QRFA 5D69A 2H5RA 4F7FA 1Q4AA 3EK8A 2KQYA 2HGDA 1WDCC 2I94A 1HQVA 3SSPA 3SVNA 4ZIOA 2YE1A 4PHJA 4NDCA 1NCXA 3LSAA 1S26D 2LAPA 2GX2A 3JVTC 4Q7TA 4B30A 4XJKB 2LHLA 3E5VA 3QMEA 3D10A 4GOBA 1YVLA 4TZAA 3DQ7A 4DXQA 5DQBA 1KQMB 1FW4A 3SSYA 3ZNIA 2JOJA 3SSKA 1J55A 4PPLA 2KGBC 3NSLA 1YUSA 2Y1NA 2HQKA 3SSVA 5G08A 2G5ZB 4ZCVA 5DRFA 4KW8A 1DF0B 4PDZA 1C7VA 2FL1A 2L2CA 1SNLA 3OGOA 5HBDA 2Q91A 2Y1MA 1CLMA 2LHIA 2IS9A 1EMMA 3H1OA 5AQBB 3SG3A 1IJ6A 1AJ4A 1TRFA 1YRTB 1EMEA 3TMTA 3ZULA 4LJCA 3I5GB 3HX4A 5FI2A 2DUHA 5EXUA 2K7BA 2WHUA 1KFXS 2KI6C 4A4CA 4W6FA 3S0GA 4Q9WA 1SR6C 1OW4A 5AXIA 4ZF5A 1QX2A 3H1RA 3CGAA 1JFKA 3R1OA 4EDSA 2BL0B 3CFAA 2BE6A 5DQMA 1KCYA 3JTDC 3DQCA 2L0PA 2P6BB 2G2BA 4PHNA 2LANA 1TCFA 1BJFA 4I5LB 2LLTA 4W6BA 1JWDA 3RWTA 1K90D 1TNWA 1YTZC 1QLSA 1SPYA 2K61A 1CLLA 2F2OA 2M97A 2KI6D 1C4FA 1DEKA 2E6WA 2M1KB 1SW8A 5DU0A 3SRYA 2A50B 3AKOA 1BOCA 4DUQA 4BDUA 4GGFA 2PXSA 2OTGB 2H8QA 2KNEA 2RH7A 3VGOA 2KFHA 2AWJA 2KPHA 2QZ0A 1QATA 3U0MA 3DQ8A 3D73A 1X02A 3PATA 3TUYC 1CV7A 2KFFA 3RLZA 1KYSA 4QJ4B 5KTGA 1IG5A 5FVGA 1TUZA 2VVJA 4W74A 2M0RA 1WRZA 5ER5A 2I18A 2GTEA 3DQFA 1CFCA 3P8UA 3SSTA 3LF4B 2JRFA 2DUFA 2KOTA 4KW9A 4M2PA 1IJ5A 2LVVA 1UHIA 5DKNA 4B5YA 2WSOA 1DTLA 1OMDA 3DQDA 1NWDA 1C7WA 2DUGA 4L9MA 1SL9A 5H87A 4DIRA 4W6SA 2GW4B 4MEWA 4IL1A 2Y5IA 1IRJA 2AMIA 2QEHA 2TN4A 4RYWA 4GAOA 4XOVA 2ZNDA 5KSZA 1J7OA 5T3IA 1SCMC 2LVKA 1S5GY 2OTEA 1XFVO 2ICRA 2K60A 2QT2A 2EC6C 5HGEA 1K95A 3UFZA 2M49B 2JQ6A 2ZO6A 5DPGA 1DJHA 1MXEA 1U5IB 3BYAA 1OE9B 1F4QA 1JSAA 1CTRA 2EMOA 3CD9A 5DKRA 3S05A 1QY3A 2L2EA 1TCOB 2YFPA 2CTNA 1FI6A 1XFUO 1SKTA 5H89A 3IR8A 4NDDA 1EL4A 1JBZA 1JUOA 1QWVA 1N2DA 2OKWA 2PVBA 4W69A 3TZ1A 2LUXA 1PSRA 3CLNA 3EVUA 1S6IA 1S36A 3S0FA 4HQ8A 3DQKA 2K2FA 1UUSA 5F9GA 3SV5A 2YE0A 2KHNA 1CDLA 1Q4DA 2K7DA 4JFGA 2V4EC 2BECA 3SVOA 2JNXA 3NHTA 4C0LA 2EHBA 1UHKA 1QX7A 3I5FB 3D0YB 3I5IC 3U0KA 1EMCA 3L4AA 5KTYA 4M2QA 3NHIA 4OKHA 4YI8A 3VRQA 3E5TA 4WQ2A 2AHAA 1TNPA 1XQMA 1J7RA 1ZACA 3C1VA 4LJBA 1JC0A 4GBAA 1XO5A 3B86A 3IP2A 2HETA 2A48A 1ZGQA 1YUUA 1J7PA 2WCLA 3SSHA 2LCPA 2DD9A 2KAVA 1DJZA 1OXEA 5AANA 3VB1A 1UP5A 1QIWA 1QVIZ 2H61C 2M7NA 1KQMC 2QLGA
chains in the Genus database with same CATH topology
2BKHB 5I2QA 3I5HB 2ZNEA 3CFHA 3SJSA 1G4YR 4W76A 3SG5A 1LXFC 4UTSA 4OR9B 3VHTB 1XA5A 2JWWA 4ANJA 2HCGA 1AUIB 5IBWA 4Z4KA 1L2OC 1RK9A 4CLNA 5D7FA 4ORAB 3U8PA 1UHNA 2D8NA 3OB2B 2LNKA 4MVFA 3VHTA 1OXDA 3DQLA 3LK0A 3WLCA 4QJ3B 3TDUA 4AR7A 2NZ0A 1B7TZ 2O24A 1EJ3A 4HE4A 3I5GC 2ZKMX 1YURA 3ZTFA 1W7UA 3U0NA 4FTGA 1JC1A 1BU3A 2PASA 1YZWA 2BBMA 4JQ0D 4MN0A 5DY6A 1XFZO 2LLUA 1KYPA 1UISA 2BL0C 1F55A 1W7IB 3BUXB 1K9KA 4FQOA 1JF0A 1IQ3A 1HCJA 3ICBA 4GGFC 3O78A 3NXAA 2JADA 3EKJA 1R2UA 1SRAA 3NSOA 4W7XA 1J1EA 3WCKA 4MBEA 2MA2A 3BUMB 2ZN8A 3AI5A 3KHEA 1K9PA 4IK1A 5LTPA 1QLKA 2Z6YA 4IK4A 2OTGC 4Q7UA 4W6AA 4BY5A 4N1FA 1B8CA 2O60A 4F0ZB 3BXCA 3DPZA 4C0JA 4Z4MA 3CTNA 1GFLA 3U8AA 2G3OA 3EVPA 2OKYA 4GGNA 3TS5B 2GX0A 4W6RA 4PE1A 4MZLA 2A52B 1MQ1A 3GL4A 4W6IA 5HLVA 4ZINA 3OB1B 1EG3A 1B7TY 3DQ5A 1YUTA 1RTP1 1QS7A 3IQOA 3OP0A 4PFEA 2LM5A 1MXLC 1J7QA 1F8HA 4HREE 3LVCA 2KYCA 4N5XA 2H5OA 1UURA 4DKMA 1K93D 2LUCA 1ZGOA 4Q7RA 2OJKA 1OMVA 1BMOA 1ZOTB 1WRKA 2NXQA 3PALA 3UG0A 2QACA 4TZGA 2VAEA 3F45A 2WNDA 1AVSA 4YGEB 2VVHA 1EMAA 4J8AA 1Z1QA 1OOJA 2KAYA 3DQEA 2AWKA 5H88A 4XJKA 2B3PA 3OSRA 3CGLA 1TNQA 4JGEA 4U8DA 2CXJA 5EBJA 4D1EA 3PLFB 2JU0A 2LMVA 2H61A 3GJ1A 3CR4X 1QV0A 1PRWA 1S3PA 1XMZA 2HQZA 2WCEA 1BG1A 3DVEA 1YX8A 5BTTB 3A4UB 2LMUA 2QPTA 2O2BA 1BODA 1EXRA 1GGXA 1DF0A 2ZRSA 1V1GA 2I2RE 1SYMA 4L1IA 3MGFA 1JFJA 4GFTA 4E68A 3CR5X 1NPQA 2AWMA 1B9CA 3DQMA 5ER4X 2KGRA 1EH2A 1EMBA 4OY4A 2A47A 1S6ZA 4YI9A 4XOWA 2HFCA 1YHHA 1M31A 3DVMA 4W72A 4N1GA 2ISDA 4U2VA 5EXBA 1MOVA 1CDNA 4OQWA 4DXMA 2DUEA 3GK1A 1HUYA 1KK8B 4DXIA 4GPLB 3EVRA 1OQPA 2G6EA 4KPIA 2MHHA 3LVDA 1MYWA 5DPHA 4LQTA 2O5GA 2VADA 3EKHA 4YGDB 1RM9A 1C07A 3PN7C 3DPWA 1XFWO 4OVNF 3DF0B 3DQUA 1SK6D 5KU1A 1HT9A 1L7ZA 3M0WA 1YJ2A 4CIDA 1IWQA 2M9GA 3DQHA 3DQ4A 4ORCB 1XK4C 1FI5A 3BUNB 5LTQA 3DQ6A 4W6UA 4P1QA 1M45A 1YFPA 3NEDA 2LVIA 2YDZA 1QTXA 3I5HC 4OGSA 2F3YA 3VRPA 4W7EA 4PPJA 1Q4EA 4PE7A 1QIVA 2HPWA 1F09A 2ZFDA 4YGCB 1YHIA 3ST2A 3LA1A 4PE0A 1Z1PA 1CFPA 2LP3A 1CMFA 1ODBA 3BUWB 5DPJA 2M1UA 3A8RA 2KI4B 2LV7A 4MRYA 4USLA 1ZGPA 5DTZA 3FWBA 2WOSA 2JXLA 3K21A 4I5KA 2LLSA 1TN4A 3CWGA 4MZKA 2Q57A 2KDHA 1IH0A 4CFQA 1NX0A 4CPVA 1NX2A 2AUCA 3BX9A 1D1OA 4EULA 3M22A 1M63B 5EJUA 2NCOA 1Y1UA 1OMRA 4KGEA 3DVKA 5HZTA 1YVHA 2WHSA 4DXNA 1U5IA 1ZUXA 4MLWA 1NCZA 5AEQA 1K8UA 3O77A 4DS7A 1TOPA 2A53B 3LS3A 2JULA 1RMPA 2VZXA 2F33A 1KWOB 1BF5A 2WISA 1GL4A 4I5JA 4R1EA 2QU1A 1CNPA 1GGWA 2G16B 2QLHA 3G9AA 4EN1A 1Y6WA 2IB5A 4ZCUA 3AI4A 1M39A 1KSMA 5DRGA 1DVIA 1F0BA 5HZUA 3U0LA 3SVDA 5AERA 2B1UA 2DDCA 3NF0A 3KCTA 4KGFA 2H6VA 2AWLA 1QASA 4W6HA 5J2OA 3RWAA 2H2KA 2ZRTA 3D0YA 4AS8A 1WRLA 1XVJA 3P28A 2VVIA 3O2PA 1OSAA 2JT8A 2OS8B 2RGIA 4DCKA 4H48A 1OXFA 4XL5A 3GK4X 3CBEA 2SCPA 2BCAA 2CT9A 4KAGA 4LJDA 4W7AA 4A4BA 2Z1OA 2AH8A 1K94A 4GESB 2G6YA 4MZJA 2WORA 1XK4A 4P5OE 1S6JA 5GQQC 3SG4A 5EB7A 1EMKA 1W7JB 5DKQA 2Z6ZA 1YRUB 1TIZA 4ORNA 2KAXA 2MLEC 2AAOA 1PK0D 2B3QA 1JBAA 1DMOA 4RYSA 4YGAA 2WCBA 4KF4A 3BQ3A 3PIBA 3LL8B 2O29A 2ZMUA 2K0JA 3DQJA 3CB9A 4JEOA 3EK7A 1NUBA 3KPXA 3CFFA 2JNFA 4OCIA 3AAKA 3PJ7A 1M46A 1K2HA 5DTLA 5FVFA 5DTXA 5I2LA 1GQMA 1DJYA 2SASA 2C9IA 4W6CA 1QVIY 1DJIA 4PHMA 1XYDA 1G8IA 2EMDA 4KF5C 1KK8C 2M7LA 1XAEA 1Q80A 4IZNA 1CM4A 1PULA 4GNKB 2G6XA 2A56B 3ZUJA 4NDBA 2F8PA 2JT3A 4L13A 2WCFA 5DTYA 2NLNA 1BFPA 3RM1A 1E8AA 4I2YA 3GOFA 4W6JA 5BT0A 1A29A 4GUKA 1AK8A 3DD4A 1Y0VH 4H3NA 1DJGA 1ZMZA 1A4PA 2BKIB 3I19A 4XYNA 2V4EB 1MR8A 4MSPA 2KBIA 3O4YA 3SVCA 4GF6B 5CSFA 1AJ5A 5LTRA 5I2OA 3VRNA 2R2IA 2L51A 4EMQA 2E30A 5AFPA 3OSQA 4W7FA 1SY9A 2HQWA 2K7CA 3WXAA 1W7SA 2DUIA 2V53A 3SG2A 4PALA 3PJBA 2KI4C 4TNCA 2Q4UA 4N3DA 4B30B 3KCSA 3NT9A 3FIAA 1XFYO 4W77A 1NIWA 2K2AA 5JOLA 1FBVA 1LINA 2WURA 2H5QA 2EGDA 4W73A 1Q4BA 5EXCI 1G7KA 1LA0A 1MOUA 4OHSA 3EK4A 3O6BA 5HZOA 4IK8A 2JTTA 4W6OA 1DGVA 3DQIA 5JJGA 1XFXO 3TDIA 3NT3A 3HCMA 2K8MB 4KA9A 3BXKA 1B8LA 3BOWB 2BE4A 4R6DA 3WHUB 1B8RA 2DOQA 4IK9A 3OX6A 5CSIA 4DXOA 3PFVA 4IK3A 2C9JA 4XGYA 1N0YA 5BTTA 1L2OB 3BOWA 1KWOC 3PM8A 3CZTX 3FS7A 3DQOA 2K7OA 2LP2A 1CDPA 4RTCA 1AHRA 1YHGA 1V1FA 3IF7A 3KO0A 4JWQA 4YGBB 1KFUL 3DQ3A 4W75A 4KW4A 2KYFA 3I5FC 4MRXA 4W7DA 2LMTA 3TMRA 1MUXA 3DQNA 3DQAA 3ADFA 1W7TA 1QYFA 3ZWHA 3U8CA 1JC2A 3E3RA 2MAZA 3OX5A 5HLOA 4W6MA 2MJWB 1KSOA 2JPTA 3AKBA 3VK1A 3FWCA 2FOTA 2JT0A 5DPIA 1KP5A 4IK5A 4DKNA 5EHUA 2L5XB 1H8BA 1PVBA 1WLMA 4LJDC 1DT7B 4KF5A 2L4HA 1Y1AA 1S6CA 3SIBA 2OS8C 4AOMA 4HQCA 1BR1B 3NSKA 2G9BA 3SVSA 3WHTB 3LVAA 3ST0A 3V3DA 1A03A 2NCPA 2ZMWA 1S5GZ 3DF0A 3CD1A 3DQ9A 2P4MA 1EG4A 4ICBA 2M8UA 4PPKA 2POXA 1XA9A 1XSSA 2KSPA 3NSIA 1J1DA 4ZF4A 1B47A 1TTXA 1SL7A 1NCYA 2PXWA 2Z6XA 1JF2A 4ORBB 2OTBA 4W6LA 2COLB 1CMGA 3PSRA 1RJVA 3SG7A 1F70A 3QRXA 1UHJA 3LCPC 3DQ2A 2PALA 2FCEA 2L98A 4W7RA 1B4CA 1LA3A 1WDCB 1FPWA 1KFUS 1H6RA 2HRSA 3BXAA 3WLDA 2M3WA 4BY4A 1AP4A 2EMNA 3W1DA 2MLFC 2GGMA 3GJ2A 1RECA 3JVTB 1RWYA 4JC2A 3K1KA 3E5WA 3ST4A 3SG6A 4P76A 1QX5B 5HKWA 4HRHA 3SVBA 1N65A 4WRIA 2FWQA 1RFJA 3W1CA 5BPJA 4HSZA 2HQ8A 1BT6A 4I5NB 2KFGA 2FJUB 2A54B 4JF9A 4UPGA 1TNXA 1VRKA 3ST3A 2CBLA 3SVUA 1MHOA 2PRUA 1EMFA 1QJTA 1KYRA 2GV5A 3VROA 1CFDA 1DGUA 4H3MA 1WLZA 1CKKA 2A4JA 3H4SE 4M2OA 1YX7A 4ZBLA 1RMOA 1IGVA 1QXTA 2Q6PA 2L4IA 3SS0A 3TS5C 1OZSA 2M29A 1NSHA 3BUOB 4YBHB 1ZUZA 2F3ZA 3SSLA 1PSBA 1K96A 3LLEA 4NQGA 4R6BA 4H47A 5F6TA 2PSRA 2ZO7A 3MSEB 4ZFSA 2HPSA 1SR6B 1CFFA 4DXPA 1GGZA 3ED8A 4W6TA 1S1EA 3JTDB 1DJXA 4EDOA 4OJ0A 1ZFSA 3IQQA 1KQVA 2G3DB 3DQ1A 1UWOA 3ZUFA 3PJ5A 3AAJA 3CR2A 2G2SB 1CB1A 3AKAA 1EMGA 5HZSA 2JXCA 1FF1A 2L50A 2JC2A 1JBYA 4ZF3A 2HF5A 1SL8A 2CCMA 2IB6A 3GEXA 1CLBA 2BTJA 1K9UA 3PN7B 1MF8B 2QLGB 1A2XA 4HQ9A 1B9AA 4JPZB 2QLEA 1QV1A 2LVJA 4PE4A 4PCWA 3OHMB 3TUYB 2ZN9A 4QJ5B 3NEZA 5CPVA 1RRXA 5HW9A 2HJOA 1NX3A 1OZOA 2VRGA 4L12A 1Y1XA 4W7CA 4W6NA 2PMYA 2OGRA 4J88A 1DJWA 1MWNA 2GGZA 4AQIA 1H4BA 1SMGA 1LVCD 5HKYA 2JTZA 4LQUA 1CDMA 3BXBA 5FVIA 4PHKA 4XVPA 3SIAA 4AQJA 2ARLA 1IKUA 1NYAA 4ETOA 3TDZA 2WC8A 4HRGA 1G33A 1YJFA 2WSNA 1YR5A 5FHVA 1KK7Z 1BLQA 1UHHA 2H9WA 2KQ6A 4W6KA 4C0KA 1RMMA 4W6GA 4WQ3A 1NP8A 2IE2A 2FCDA 4Q9XA 1NX1A 3LK1A 2H5PA 1GJYA 2MRDA 1Q73A 1Q4CA 1ALVA 2OPOA 2BCXA 1SCMB 4KEXA 1ALWA 1F71A 5CSNA 2GW3A 3DPXA 4NWSA 5HYDA 2EC6B 1PVAA 3SVRA 5EB6A 2CNPA 3EVVA 4CFRA 1H4UA 4ZB1A 5J3XA 4YRUA 5K89A 2Y4QA 1WY9A 3KF9A 4OV2A 1RROA 2WHTA 3WNXB 2DDDA 1IQ5A 2MBXA 1A75B 2BBNA 2HGYA 3M24A 3VICA 4DRWA 2KBMA 2JZIA 5BQLA 3CS1A 1PALA 4W6DA 1B1GA 4LW5A 5I8NA 3GB3A 5HKZA 4HVFA 4Q04A 1QYOA 4W6PA 5FYXA 1QYQA 5TNCA 1A75A 2QLIA 3KEVA 1SCVA 1F54A 4J89A 3DVJA 4JRBA 1EMLA 1KK7Y 2BCBA 1CM1A 3SVEA 2IOVA 5PALA 1LKJA 3A8SA 3LF3A 3VRRA 5B8IB 2FZUA 2Y0GA 3I5IB 5CSJA 2WIQA 5LK4A 3GK2A 1KFXL 1F4OA 1R6PA 1SBJA 2V4EA 2LE9B 4H3LA 2I7AA 4P2YB 1BR4B 2F2PA 2DD7A 1QXPA 2A46A 2LC5A 2QRFA 5D69A 2H5RA 1Q4AA 3EK8A 2KQYA 2HGDA 1WDCC 2I94A 1HQVA 3SSPA 3SVNA 4ZIOA 2YE1A 4PHJA 4NDCA 1NCXA 3LSAA 1S26D 2LAPA 2GX2A 3JVTC 4Q7TA 4B30A 4XJKB 2LHLA 3E5VA 3D10A 4GOBA 1YVLA 4TZAA 3DQ7A 4DXQA 5DQBA 1KQMB 1FW4A 3SSYA 3ZNIA 2JOJA 3SSKA 1J55A 4PPLA 2KGBC 3NSLA 1YUSA 2Y1NA 2HQKA 3SSVA 5G08A 2G5ZB 4ZCVA 5DRFA 4KW8A 1DF0B 4PDZA 1C7VA 2FL1A 1SNLA 3OGOA 5HBDA 2Q91A 2Y1MA 1CLMA 2LHIA 2IS9A 1EMMA 3H1OA 5AQBB 3SG3A 1IJ6A 1AJ4A 1TRFA 1YRTB 1EMEA 3TMTA 3ZULA 4LJCA 3I5GB 3HX4A 2DUHA 5EXUA 2K7BA 2WHUA 1KFXS 2KI6C 4A4CA 4W6FA 4Q9WA 1SR6C 5AXIA 4ZF5A 1QX2A 3H1RA 3CGAA 1JFKA 4EDSA 2BL0B 3CFAA 2BE6A 5DQMA 1KCYA 3JTDC 3DQCA 2L0PA 2P6BB 2G2BA 4PHNA 2LANA 1TCFA 1BJFA 4I5LB 2LLTA 4W6BA 1JWDA 3RWTA 1K90D 1TNWA 1YTZC 1QLSA 1SPYA 2K61A 1CLLA 2F2OA 2M97A 2KI6D 1C4FA 2E6WA 2M1KB 1SW8A 5DU0A 3SRYA 2A50B 3AKOA 1BOCA 4DUQA 4BDUA 4GGFA 2PXSA 2OTGB 2H8QA 2KNEA 2RH7A 3VGOA 2KFHA 2AWJA 2QZ0A 1QATA 3U0MA 3DQ8A 3TUYC 1X02A 3PATA 1CV7A 2KFFA 3RLZA 1KYSA 4QJ4B 5KTGA 1IG5A 5FVGA 2VVJA 4W74A 2M0RA 1WRZA 5ER5A 2I18A 3DQFA 1CFCA 3P8UA 3SSTA 3LF4B 2JRFA 2DUFA 2KOTA 4KW9A 4M2PA 1IJ5A 2LVVA 1UHIA 5DKNA 4B5YA 2WSOA 1DTLA 1OMDA 3DQDA 1NWDA 1C7WA 2DUGA 4L9MA 1SL9A 5H87A 4DIRA 4W6SA 2GW4B 4MEWA 4IL1A 2Y5IA 1IRJA 2AMIA 2TN4A 4RYWA 4GAOA 4XOVA 2ZNDA 5KSZA 1J7OA 5T3IA 1SCMC 2LVKA 1S5GY 2OTEA 1XFVO 2ICRA 2QT2A 2EC6C 5HGEA 1K95A 3UFZA 2M49B 2JQ6A 2ZO6A 5DPGA 1DJHA 1MXEA 1U5IB 3BYAA 1OE9B 1F4QA 1JSAA 1CTRA 2EMOA 3CD9A 5DKRA 3S05A 1QY3A 2L2EA 1TCOB 2YFPA 2CTNA 1FI6A 1XFUO 1SKTA 5H89A 3IR8A 4NDDA 1EL4A 1JBZA 1JUOA 1N2DA 2OKWA 2PVBA 4W69A 3TZ1A 2LUXA 1PSRA 3CLNA 3EVUA 1S6IA 1S36A 4HQ8A 3DQKA 2K2FA 1UUSA 5F9GA 3SV5A 2YE0A 2KHNA 1CDLA 1Q4DA 2K7DA 4JFGA 2V4EC 2BECA 3SVOA 2JNXA 4C0LA 2EHBA 1UHKA 1QX7A 3I5FB 3D0YB 3I5IC 3U0KA 1EMCA 5KTYA 4M2QA 4OKHA 4YI8A 3VRQA 3E5TA 4WQ2A 2AHAA 1TNPA 1XQMA 1J7RA 1ZACA 3C1VA 4LJBA 4GBAA 1XO5A 1JC0A 3IP2A 2HETA 2A48A 1ZGQA 1YUUA 1J7PA 3SSHA 2LCPA 2DD9A 2KAVA 1DJZA 1OXEA 5AANA 1UP5A 1QIWA 1QVIZ 2H61C 2M7NA 1KQMC 2QLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKH B;  5I2Q A;  3I5H B;  2ZNE A;  3CFH A;  3SJS A;  1G4Y R;  4W76 A;  3SG5 A;  1LXF C;  4UTS A;  4OR9 B;  3VHT B;  1XA5 A;  2JWW A;  4ANJ A;  2HCG A;  1AUI B;  5IBW A;  4Z4K A;  1L2O C;  1RK9 A;  4CLN A;  5D7F A;  4ORA B;  3U8P A;  1UHN A;  2D8N A;  3OB2 B;  2LNK A;  4MVF A;  3VHT A;  1OXD A;  3DQL A;  3LK0 A;  3WLC A;  4QJ3 B;  3TDU A;  4AR7 A;  2NZ0 A;  1B7T Z;  2O24 A;  1EJ3 A;  4HE4 A;  3I5G C;  2ZKM X;  1YUR A;  3ZTF A;  1W7U A;  3U0N A;  4FTG A;  1JC1 A;  1BU3 A;  2PAS A;  1YZW A;  2BBM A;  4JQ0 D;  4MN0 A;  5DY6 A;  1XFZ O;  2LLU A;  1KYP A;  1UIS A;  2BL0 C;  1F55 A;  1W7I B;  3BUX B;  1K9K A;  4FQO A;  1JF0 A;  1IQ3 A;  1HCJ A;  3ICB A;  4GGF C;  3O78 A;  3NXA A;  2JAD A;  3EKJ A;  1R2U A;  1SRA A;  3NSO A;  4W7X A;  1J1E A;  3WCK A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  3AI5 A;  3KHE A;  1K9P A;  4IK1 A;  5LTP A;  1QLK A;  2Z6Y A;  4IK4 A;  2OTG C;  4Q7U A;  4W6A A;  4BY5 A;  4N1F A;  1B8C A;  2O60 A;  4F0Z B;  3BXC A;  3DPZ A;  4C0J A;  4Z4M A;  3CTN A;  1GFL A;  3U8A A;  2G3O A;  3EVP A;  2OKY A;  4GGN A;  3TS5 B;  2GX0 A;  4W6R A;  4PE1 A;  4MZL A;  2A52 B;  1MQ1 A;  3GL4 A;  4W6I A;  5HLV A;  4ZIN A;  3OB1 B;  1EG3 A;  1B7T Y;  3DQ5 A;  1YUT A;  1RTP 1;  1QS7 A;  3IQO A;  3OP0 A;  4PFE A;  2LM5 A;  1MXL C;  1J7Q A;  1F8H A;  4HRE E;  3LVC A;  2KYC A;  4N5X A;  2H5O A;  1UUR A;  4DKM A;  1K93 D;  2LUC A;  1ZGO A;  4Q7R A;  2OJK A;  1OMV A;  1BMO A;  1ZOT B;  1WRK A;  2NXQ A;  3PAL A;  3UG0 A;  2QAC A;  4TZG A;  2VAE A;  3F45 A;  2WND A;  1AVS A;  4YGE B;  2VVH A;  1EMA A;  4J8A A;  1Z1Q A;  1OOJ A;  2KAY A;  3DQE A;  2AWK A;  5H88 A;  4XJK A;  2B3P A;  3OSR A;  3CGL A;  1TNQ A;  4JGE A;  4U8D A;  2CXJ A;  5EBJ A;  4D1E A;  3PLF B;  2JU0 A;  2LMV A;  2H61 A;  3GJ1 A;  3CR4 X;  1QV0 A;  1PRW A;  1S3P A;  1XMZ A;  2HQZ A;  2WCE A;  1BG1 A;  3DVE A;  1YX8 A;  5BTT B;  3A4U B;  2LMU A;  2QPT A;  2O2B A;  1BOD A;  1EXR A;  1GGX A;  1DF0 A;  2ZRS A;  1V1G A;  2I2R E;  1SYM A;  4L1I A;  3MGF A;  1JFJ A;  4GFT A;  4E68 A;  3CR5 X;  1NPQ A;  2AWM A;  1B9C A;  3DQM A;  5ER4 X;  2KGR A;  1EH2 A;  1EMB A;  4OY4 A;  2A47 A;  1S6Z A;  4YI9 A;  4XOW A;  2HFC A;  1YHH A;  1M31 A;  3DVM A;  4W72 A;  4N1G A;  2ISD A;  4U2V A;  5EXB A;  1MOV A;  1CDN A;  4OQW A;  4DXM A;  2DUE A;  3GK1 A;  1HUY A;  1KK8 B;  4DXI A;  4GPL B;  3EVR A;  1OQP A;  2G6E A;  4KPI A;  2MHH A;  3LVD A;  1MYW A;  5DPH A;  4LQT A;  2O5G A;  2VAD A;  3EKH A;  4YGD B;  1RM9 A;  1C07 A;  3PN7 C;  3DPW A;  1XFW O;  4OVN F;  3DF0 B;  3DQU A;  1SK6 D;  5KU1 A;  1HT9 A;  1L7Z A;  3M0W A;  1YJ2 A;  4CID A;  1IWQ A;  2M9G A;  3DQH A;  3DQ4 A;  4ORC B;  1XK4 C;  1FI5 A;  3BUN B;  5LTQ A;  3DQ6 A;  4W6U A;  4P1Q A;  1M45 A;  1YFP A;  3NED A;  2LVI A;  2YDZ A;  1QTX A;  3I5H C;  4OGS A;  2F3Y A;  3VRP A;  4W7E A;  4PPJ A;  1Q4E A;  4PE7 A;  1QIV A;  2HPW A;  1F09 A;  2ZFD A;  4YGC B;  1YHI A;  3ST2 A;  3LA1 A;  4PE0 A;  1Z1P A;  1CFP A;  2LP3 A;  1CMF A;  1ODB A;  3BUW B;  5DPJ A;  2M1U A;  3A8R A;  2KI4 B;  2LV7 A;  4MRY A;  4USL A;  1ZGP A;  5DTZ A;  3FWB A;  2WOS A;  2JXL A;  3K21 A;  4I5K A;  2LLS A;  1TN4 A;  3CWG A;  4MZK A;  2Q57 A;  2KDH A;  1IH0 A;  4CFQ A;  1NX0 A;  4CPV A;  1NX2 A;  2AUC A;  3BX9 A;  1D1O A;  4EUL A;  3M22 A;  1M63 B;  5EJU A;  2NCO A;  1Y1U A;  1OMR A;  4KGE A;  3DVK A;  5HZT A;  1YVH A;  2WHS A;  4DXN A;  1U5I A;  1ZUX A;  4MLW A;  1NCZ A;  5AEQ A;  1K8U A;  3O77 A;  4DS7 A;  1TOP A;  2A53 B;  3LS3 A;  2JUL A;  1RMP A;  2VZX A;  2F33 A;  1KWO B;  1BF5 A;  2WIS A;  1GL4 A;  4I5J A;  4R1E A;  2QU1 A;  1CNP A;  1GGW A;  2G16 B;  2QLH A;  3G9A A;  4EN1 A;  1Y6W A;  2IB5 A;  4ZCU A;  3AI4 A;  1M39 A;  1KSM A;  5DRG A;  1DVI A;  1F0B A;  5HZU A;  3U0L A;  3SVD A;  5AER A;  2B1U A;  2DDC A;  3NF0 A;  3KCT A;  4KGF A;  2H6V A;  2AWL A;  1QAS A;  4W6H A;  5J2O A;  3RWA A;  2H2K A;  2ZRT A;  3D0Y A;  4AS8 A;  1WRL A;  1XVJ A;  3P28 A;  2VVI A;  3O2P A;  1OSA A;  2JT8 A;  2OS8 B;  2RGI A;  4DCK A;  4H48 A;  1OXF A;  4XL5 A;  3GK4 X;  3CBE A;  2SCP A;  2BCA A;  2CT9 A;  4KAG A;  4LJD A;  4W7A A;  4A4B A;  2Z1O A;  2AH8 A;  1K94 A;  4GES B;  2G6Y A;  4MZJ A;  2WOR A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3SG4 A;  5EB7 A;  1EMK A;  1W7J B;  5DKQ A;  2Z6Z A;  1YRU B;  1TIZ A;  4ORN A;  2KAX A;  2MLE C;  2AAO A;  1PK0 D;  2B3Q A;  1JBA A;  1DMO A;  4RYS A;  4YGA A;  2WCB A;  4KF4 A;  3BQ3 A;  3PIB A;  3LL8 B;  2O29 A;  2ZMU A;  2K0J A;  3DQJ A;  3CB9 A;  4JEO A;  3EK7 A;  1NUB A;  3KPX A;  3CFF A;  2JNF A;  4OCI A;  3AAK A;  3PJ7 A;  1M46 A;  1K2H A;  5DTL A;  5FVF A;  5DTX A;  5I2L A;  1GQM A;  1DJY A;  2SAS A;  2C9I A;  4W6C A;  1QVI Y;  1DJI A;  4PHM A;  1XYD A;  1G8I A;  2EMD A;  4KF5 C;  1KK8 C;  2M7L A;  1XAE A;  1Q80 A;  4IZN A;  1CM4 A;  1PUL A;  4GNK B;  2G6X A;  2A56 B;  3ZUJ A;  4NDB A;  2F8P A;  2JT3 A;  4L13 A;  2WCF A;  5DTY A;  2NLN A;  1BFP A;  3RM1 A;  1E8A A;  4I2Y A;  3GOF A;  4W6J A;  5BT0 A;  1A29 A;  4GUK A;  1AK8 A;  3DD4 A;  1Y0V H;  4H3N A;  1DJG A;  1ZMZ A;  1A4P A;  2BKI B;  3I19 A;  4XYN A;  2V4E B;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  3SVC A;  4GF6 B;  5CSF A;  1AJ5 A;  5LTR A;  5I2O A;  3VRN A;  2R2I A;  2L51 A;  4EMQ A;  2E30 A;  5AFP A;  3OSQ A;  4W7F A;  1SY9 A;  2HQW A;  2K7C A;  3WXA A;  1W7S A;  2DUI A;  2V53 A;  3SG2 A;  4PAL A;  3PJB A;  2KI4 C;  4TNC A;  2Q4U A;  4N3D A;  4B30 B;  3KCS A;  3NT9 A;  3FIA A;  1XFY O;  4W77 A;  1NIW A;  2K2A A;  5JOL A;  1FBV A;  1LIN A;  2WUR A;  2H5Q A;  2EGD A;  4W73 A;  1Q4B A;  5EXC I;  1G7K A;  1LA0 A;  1MOU A;  4OHS A;  3EK4 A;  3O6B A;  5HZO A;  4IK8 A;  2JTT A;  4W6O A;  1DGV A;  3DQI A;  5JJG A;  1XFX O;  3TDI A;  3NT3 A;  3HCM A;  2K8M B;  4KA9 A;  3BXK A;  1B8L A;  3BOW B;  2BE4 A;  4R6D A;  3WHU B;  1B8R A;  2DOQ A;  4IK9 A;  3OX6 A;  5CSI A;  4DXO A;  3PFV A;  4IK3 A;  2C9J A;  4XGY A;  1N0Y A;  5BTT A;  1L2O B;  3BOW A;  1KWO C;  3PM8 A;  3CZT X;  3FS7 A;  3DQO A;  2K7O A;  2LP2 A;  1CDP A;  4RTC A;  1AHR A;  1YHG A;  1V1F A;  3IF7 A;  3KO0 A;  4JWQ A;  4YGB B;  1KFU L;  3DQ3 A;  4W75 A;  4KW4 A;  2KYF A;  3I5F C;  4MRX A;  4W7D A;  2LMT A;  3TMR A;  1MUX A;  3DQN A;  3DQA A;  3ADF A;  1W7T A;  1QYF A;  3ZWH A;  3U8C A;  1JC2 A;  3E3R A;  2MAZ A;  3OX5 A;  5HLO A;  4W6M A;  2MJW B;  1KSO A;  2JPT A;  3AKB A;  3VK1 A;  3FWC A;  2FOT A;  2JT0 A;  5DPI A;  1KP5 A;  4IK5 A;  4DKN A;  5EHU A;  2L5X B;  1H8B A;  1PVB A;  1WLM A;  4LJD C;  1DT7 B;  4KF5 A;  2L4H A;  1Y1A A;  1S6C A;  3SIB A;  2OS8 C;  4AOM A;  4HQC A;  1BR1 B;  3NSK A;  2G9B A;  3SVS A;  3WHT B;  3LVA A;  3ST0 A;  3V3D A;  1A03 A;  2NCP A;  2ZMW A;  1S5G Z;  3DF0 A;  3CD1 A;  3DQ9 A;  2P4M A;  1EG4 A;  4ICB A;  2M8U A;  4PPK A;  2POX A;  1XA9 A;  1XSS A;  2KSP A;  3NSI A;  1J1D A;  4ZF4 A;  1B47 A;  1TTX A;  1SL7 A;  1NCY A;  2PXW A;  2Z6X A;  1JF2 A;  4ORB B;  2OTB A;  4W6L A;  2COL B;  1CMG A;  3PSR A;  1RJV A;  3SG7 A;  1F70 A;  3QRX A;  1UHJ A;  3LCP C;  3DQ2 A;  2PAL A;  2FCE A;  2L98 A;  4W7R A;  1B4C A;  1LA3 A;  1WDC B;  1FPW A;  1KFU S;  1H6R A;  2HRS A;  3BXA A;  3WLD A;  2M3W A;  4BY4 A;  1AP4 A;  2EMN A;  3W1D A;  2MLF C;  2GGM A;  3GJ2 A;  1REC A;  3JVT B;  1RWY A;  4JC2 A;  3K1K A;  3E5W A;  3ST4 A;  3SG6 A;  4P76 A;  1QX5 B;  5HKW A;  4HRH A;  3SVB A;  1N65 A;  4WRI A;  2FWQ A;  1RFJ A;  3W1C A;  5BPJ A;  4HSZ A;  2HQ8 A;  1BT6 A;  4I5N B;  2KFG A;  2FJU B;  2A54 B;  4JF9 A;  4UPG A;  1TNX A;  1VRK A;  3ST3 A;  2CBL A;  3SVU A;  1MHO A;  2PRU A;  1EMF A;  1QJT A;  1KYR A;  2GV5 A;  3VRO A;  1CFD A;  1DGU A;  4H3M A;  1WLZ A;  1CKK A;  2A4J A;  3H4S E;  4M2O A;  1YX7 A;  4ZBL A;  1RMO A;  1IGV A;  1QXT A;  2Q6P A;  2L4I A;  3SS0 A;  3TS5 C;  1OZS A;  2M29 A;  1NSH A;  3BUO B;  4YBH B;  1ZUZ A;  2F3Z A;  3SSL A;  1PSB A;  1K96 A;  3LLE A;  4NQG A;  4R6B A;  4H47 A;  5F6T A;  2PSR A;  2ZO7 A;  3MSE B;  4ZFS A;  2HPS A;  1SR6 B;  1CFF A;  4DXP A;  1GGZ A;  3ED8 A;  4W6T A;  1S1E A;  3JTD B;  1DJX A;  4EDO A;  4OJ0 A;  1ZFS A;  3IQQ A;  1KQV A;  2G3D B;  3DQ1 A;  1UWO A;  3ZUF A;  3PJ5 A;  3AAJ A;  3CR2 A;  2G2S B;  1CB1 A;  3AKA A;  1EMG A;  5HZS A;  2JXC A;  1FF1 A;  2L50 A;  2JC2 A;  1JBY A;  4ZF3 A;  2HF5 A;  1SL8 A;  2CCM A;  2IB6 A;  3GEX A;  1CLB A;  2BTJ A;  1K9U A;  3PN7 B;  1MF8 B;  2QLG B;  1A2X A;  4HQ9 A;  1B9A A;  4JPZ B;  2QLE A;  1QV1 A;  2LVJ A;  4PE4 A;  4PCW A;  3OHM B;  3TUY B;  2ZN9 A;  4QJ5 B;  3NEZ A;  5CPV A;  1RRX A;  5HW9 A;  2HJO A;  1NX3 A;  1OZO A;  2VRG A;  4L12 A;  1Y1X A;  4W7C A;  4W6N A;  2PMY A;  2OGR A;  4J88 A;  1DJW A;  1MWN A;  2GGZ A;  4AQI A;  1H4B A;  1SMG A;  1LVC D;  5HKY A;  2JTZ A;  4LQU A;  1CDM A;  3BXB A;  5FVI A;  4PHK A;  4XVP A;  3SIA A;  4AQJ A;  2ARL A;  1IKU A;  1NYA A;  4ETO A;  3TDZ A;  2WC8 A;  4HRG A;  1G33 A;  1YJF A;  2WSN A;  1YR5 A;  5FHV A;  1KK7 Z;  1BLQ A;  1UHH A;  2H9W A;  2KQ6 A;  4W6K A;  4C0K A;  1RMM A;  4W6G A;  4WQ3 A;  1NP8 A;  2IE2 A;  2FCD A;  4Q9X A;  1NX1 A;  3LK1 A;  2H5P A;  1GJY A;  2MRD A;  1Q73 A;  1Q4C A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  4KEX A;  1ALW A;  1F71 A;  5CSN A;  2GW3 A;  3DPX A;  4NWS A;  5HYD A;  2EC6 B;  1PVA A;  3SVR A;  5EB6 A;  2CNP A;  3EVV A;  4CFR A;  1H4U A;  4ZB1 A;  5J3X A;  4YRU A;  5K89 A;  2Y4Q A;  1WY9 A;  3KF9 A;  4OV2 A;  1RRO A;  2WHT A;  3WNX B;  2DDD A;  1IQ5 A;  2MBX A;  1A75 B;  2BBN A;  2HGY A;  3M24 A;  3VIC A;  4DRW A;  2KBM A;  2JZI A;  5BQL A;  3CS1 A;  1PAL A;  4W6D A;  1B1G A;  4LW5 A;  5I8N A;  3GB3 A;  5HKZ A;  4HVF A;  4Q04 A;  1QYO A;  4W6P A;  5FYX A;  1QYQ A;  5TNC A;  1A75 A;  2QLI A;  3KEV A;  1SCV A;  1F54 A;  4J89 A;  3DVJ A;  4JRB A;  1EML A;  1KK7 Y;  2BCB A;  1CM1 A;  3SVE A;  2IOV A;  5PAL A;  1LKJ A;  3A8S A;  3LF3 A;  3VRR A;  5B8I B;  2FZU A;  2Y0G A;  3I5I B;  5CSJ A;  2WIQ A;  5LK4 A;  3GK2 A;  1KFX L;  1F4O A;  1R6P A;  1SBJ A;  2V4E A;  2LE9 B;  4H3L A;  2I7A A;  4P2Y B;  1BR4 B;  2F2P A;  2DD7 A;  1QXP A;  2A46 A;  2LC5 A;  2QRF A;  5D69 A;  2H5R A;  1Q4A A;  3EK8 A;  2KQY A;  2HGD A;  1WDC C;  2I94 A;  1HQV A;  3SSP A;  3SVN A;  4ZIO A;  2YE1 A;  4PHJ A;  4NDC A;  1NCX A;  3LSA A;  1S26 D;  2LAP A;  2GX2 A;  3JVT C;  4Q7T A;  4B30 A;  4XJK B;  2LHL A;  3E5V A;  3D10 A;  4GOB A;  1YVL A;  4TZA A;  3DQ7 A;  4DXQ A;  5DQB A;  1KQM B;  1FW4 A;  3SSY A;  3ZNI A;  2JOJ A;  3SSK A;  1J55 A;  4PPL A;  2KGB C;  3NSL A;  1YUS A;  2Y1N A;  2HQK A;  3SSV A;  5G08 A;  2G5Z B;  4ZCV A;  5DRF A;  4KW8 A;  1DF0 B;  4PDZ A;  1C7V A;  2FL1 A;  1SNL A;  3OGO A;  5HBD A;  2Q91 A;  2Y1M A;  1CLM A;  2LHI A;  2IS9 A;  1EMM A;  3H1O A;  5AQB B;  3SG3 A;  1IJ6 A;  1AJ4 A;  1TRF A;  1YRT B;  1EME A;  3TMT A;  3ZUL A;  4LJC A;  3I5G B;  3HX4 A;  2DUH A;  5EXU A;  2K7B A;  2WHU A;  1KFX S;  2KI6 C;  4A4C A;  4W6F A;  4Q9W A;  1SR6 C;  5AXI A;  4ZF5 A;  1QX2 A;  3H1R A;  3CGA A;  1JFK A;  4EDS A;  2BL0 B;  3CFA A;  2BE6 A;  5DQM A;  1KCY A;  3JTD C;  3DQC A;  2L0P A;  2P6B B;  2G2B A;  4PHN A;  2LAN A;  1TCF A;  1BJF A;  4I5L B;  2LLT A;  4W6B A;  1JWD A;  3RWT A;  1K90 D;  1TNW A;  1YTZ C;  1QLS A;  1SPY A;  2K61 A;  1CLL A;  2F2O A;  2M97 A;  2KI6 D;  1C4F A;  2E6W A;  2M1K B;  1SW8 A;  5DU0 A;  3SRY A;  2A50 B;  3AKO A;  1BOC A;  4DUQ A;  4BDU A;  4GGF A;  2PXS A;  2OTG B;  2H8Q A;  2KNE A;  2RH7 A;  3VGO A;  2KFH A;  2AWJ A;  2QZ0 A;  1QAT A;  3U0M A;  3DQ8 A;  3TUY C;  1X02 A;  3PAT A;  1CV7 A;  2KFF A;  3RLZ A;  1KYS A;  4QJ4 B;  5KTG A;  1IG5 A;  5FVG A;  2VVJ A;  4W74 A;  2M0R A;  1WRZ A;  5ER5 A;  2I18 A;  3DQF A;  1CFC A;  3P8U A;  3SST A;  3LF4 B;  2JRF A;  2DUF A;  2KOT A;  4KW9 A;  4M2P A;  1IJ5 A;  2LVV A;  1UHI A;  5DKN A;  4B5Y A;  2WSO A;  1DTL A;  1OMD A;  3DQD A;  1NWD A;  1C7W A;  2DUG A;  4L9M A;  1SL9 A;  5H87 A;  4DIR A;  4W6S A;  2GW4 B;  4MEW A;  4IL1 A;  2Y5I A;  1IRJ A;  2AMI A;  2TN4 A;  4RYW A;  4GAO A;  4XOV A;  2ZND A;  5KSZ A;  1J7O A;  5T3I A;  1SCM C;  2LVK A;  1S5G Y;  2OTE A;  1XFV O;  2ICR A;  2QT2 A;  2EC6 C;  5HGE A;  1K95 A;  3UFZ A;  2M49 B;  2JQ6 A;  2ZO6 A;  5DPG A;  1DJH A;  1MXE A;  1U5I B;  3BYA A;  1OE9 B;  1F4Q A;  1JSA A;  1CTR A;  2EMO A;  3CD9 A;  5DKR A;  3S05 A;  1QY3 A;  2L2E A;  1TCO B;  2YFP A;  2CTN A;  1FI6 A;  1XFU O;  1SKT A;  5H89 A;  3IR8 A;  4NDD A;  1EL4 A;  1JBZ A;  1JUO A;  1N2D A;  2OKW A;  2PVB A;  4W69 A;  3TZ1 A;  2LUX A;  1PSR A;  3CLN A;  3EVU A;  1S6I A;  1S36 A;  4HQ8 A;  3DQK A;  2K2F A;  1UUS A;  5F9G A;  3SV5 A;  2YE0 A;  2KHN A;  1CDL A;  1Q4D A;  2K7D A;  4JFG A;  2V4E C;  2BEC A;  3SVO A;  2JNX A;  4C0L A;  2EHB A;  1UHK A;  1QX7 A;  3I5F B;  3D0Y B;  3I5I C;  3U0K A;  1EMC A;  5KTY A;  4M2Q A;  4OKH A;  4YI8 A;  3VRQ A;  3E5T A;  4WQ2 A;  2AHA A;  1TNP A;  1XQM A;  1J7R A;  1ZAC A;  3C1V A;  4LJB A;  4GBA A;  1XO5 A;  1JC0 A;  3IP2 A;  2HET A;  2A48 A;  1ZGQ A;  1YUU A;  1J7P A;  3SSH A;  2LCP A;  2DD9 A;  2KAV A;  1DJZ A;  1OXE A;  5AAN A;  1UP5 A;  1QIW A;  1QVI Z;  2H61 C;  2M7N A;  1KQM C;  2QLG A; 
#chains in the Genus database with same CATH topology
 2BKH B;  5I2Q A;  3I5H B;  2ZNE A;  3CFH A;  3PM2 A;  3SJS A;  1G4Y R;  4W76 A;  3SG5 A;  1LXF C;  4UTS A;  4OR9 B;  3VHT B;  1XA5 A;  2JWW A;  3L47 A;  4ANJ A;  4OZD A;  2HCG A;  1AUI B;  5IBW A;  4Z4K A;  1L2O C;  1RK9 A;  4CLN A;  1ORG A;  5D7F A;  4ORA B;  3U8P A;  1UHN A;  2D8N A;  3OB2 B;  2LNK A;  4MVF A;  3VHT A;  3S0A A;  1OXD A;  3DQL A;  3LK0 A;  3WLC A;  4QJ3 B;  3TDU A;  4AR7 A;  2NZ0 A;  3FE9 A;  1B7T Z;  2O24 A;  1EJ3 A;  4HE4 A;  3I5G C;  2ZKM X;  1YUR A;  3ZTF A;  1W7U A;  3U0N A;  4FTG A;  1JC1 A;  1BU3 A;  2PAS A;  1YZW A;  3L4L A;  2BBM A;  4JQ0 D;  4MN0 A;  5DY6 A;  1XFZ O;  2LLU A;  1KYP A;  1UIS A;  2BL0 C;  1F55 A;  1W7I B;  3BUX B;  1K9K A;  4FQO A;  1JF0 A;  1IQ3 A;  1HCJ A;  3ICB A;  4GGF C;  3O78 A;  3NXA A;  2JAD A;  3EKJ A;  1R2U A;  1SRA A;  3NSO A;  4W7X A;  3R1V A;  1J1E A;  3WCK A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  3EG5 B;  3AI5 A;  3KHE A;  1K9P A;  4IK1 A;  5LTP A;  1QLK A;  2Z6Y A;  4IK4 A;  2OTG C;  4Q7U A;  4INW A;  4W6A A;  4BY5 A;  1Z4H A;  4N1F A;  1B8C A;  2WCM A;  2O60 A;  4F0Z B;  3BXC A;  3DPZ A;  4C0J A;  4Z4M A;  3CTN A;  1GFL A;  3U8A A;  2G3O A;  3EVP A;  2OKY A;  4GGN A;  3CDN A;  3TS5 B;  2GX0 A;  4W6R A;  4PE1 A;  3DYE A;  4MZL A;  2A52 B;  1MQ1 A;  3DXL A;  3GL4 A;  4W6I A;  5HLV A;  4ZIN A;  3OB1 B;  1EG3 A;  1B7T Y;  3DQ5 A;  1YUT A;  1RTP 1;  1QS7 A;  3IQO A;  3OP0 A;  4PFE A;  2LM5 A;  1DQE A;  1MXL C;  1J7Q A;  1F8H A;  4HRE E;  3LVC A;  2KYC A;  4N5X A;  2H5O A;  1UUR A;  4DKM A;  1K93 D;  1Z2C B;  2LUC A;  1ZGO A;  4Q7R A;  2OJK A;  1OMV A;  1BMO A;  1ZOT B;  1WRK A;  2NXQ A;  3PAL A;  3UG0 A;  2QAC A;  4TZG A;  2VAE A;  3BFA A;  3F45 A;  2WND A;  1AVS A;  4YGE B;  2VVH A;  1EMA A;  4J8A A;  1Z1Q A;  1OOJ A;  2KAY A;  3DQE A;  2AWK A;  5H88 A;  4XJK A;  2B3P A;  3FE6 A;  3OSR A;  3CGL A;  1TNQ A;  4JGE A;  4U8D A;  2CXJ A;  5EBJ A;  4D1E A;  3PLF B;  2JU0 A;  2LMV A;  2H61 A;  3GJ1 A;  3CR4 X;  1QV0 A;  1PRW A;  1S3P A;  1XMZ A;  2HQZ A;  2WCE A;  1BG1 A;  3DVE A;  1YX8 A;  5BTT B;  3A4U B;  2LMU A;  2QPT A;  2O2B A;  1BOD A;  1EXR A;  1GGX A;  1DF0 A;  2ZRS A;  1V1G A;  2I2R E;  1SYM A;  4L1I A;  3MGF A;  1JFJ A;  4GFT A;  4E68 A;  3CR5 X;  2BNX A;  3OGN A;  1NPQ A;  2AWM A;  1B9C A;  3R72 A;  3S0D A;  3DQM A;  5ER4 X;  2KGR A;  1EH2 A;  1EMB A;  4OY4 A;  2A47 A;  1S6Z A;  4YI9 A;  4XOW A;  2HFC A;  1YHH A;  1M31 A;  3DVM A;  3S0B A;  4W72 A;  1TUJ A;  4N1G A;  2ISD A;  4U2V A;  5EXB A;  1MOV A;  1CDN A;  4OQW A;  3O4X A;  4DXM A;  2DUE A;  3GK1 A;  1HUY A;  1KK8 B;  4DXI A;  4GPL B;  3EVR A;  1OQP A;  2G6E A;  3R1P A;  4KPI A;  2MHH A;  3LVD A;  1MYW A;  5DPH A;  4LQT A;  2O5G A;  2QDI A;  2VAD A;  3EKH A;  4YGD B;  1RM9 A;  1C07 A;  3PN7 C;  3DPW A;  1XFW O;  4OVN F;  3DF0 B;  3DQU A;  1SK6 D;  5KU1 A;  1HT9 A;  1L7Z A;  3M0W A;  1YJ2 A;  5I94 A;  4CID A;  1IWQ A;  2M9G A;  3DQH A;  3DQ4 A;  4ORC B;  1XK4 C;  1FI5 A;  3BUN B;  5LTQ A;  3DQ6 A;  4W6U A;  4P1Q A;  1M45 A;  1YFP A;  3NED A;  3K1E A;  2LVI A;  4JKT A;  2YDZ A;  1QTX A;  3I5H C;  4OGS A;  2F3Y A;  3VRP A;  4W7E A;  4PPJ A;  1Q4E A;  4PE7 A;  1QIV A;  2HPW A;  1F09 A;  2ZFD A;  4YGC B;  2WCJ A;  1YHI A;  3ST2 A;  3LA1 A;  4PE0 A;  1Z1P A;  1CFP A;  2LP3 A;  2FJY A;  1ODB A;  1CMF A;  3BUW B;  5DPJ A;  2M1U A;  3A8R A;  2KI4 B;  2LV7 A;  4MRY A;  3D74 A;  4USL A;  1ZGP A;  5DTZ A;  3FWB A;  2WOS A;  2KLE A;  2JXL A;  3K21 A;  4I5K A;  2LLS A;  1TN4 A;  3CWG A;  4MZK A;  2Q57 A;  2KDH A;  1IH0 A;  3V2L A;  4CFQ A;  1NX0 A;  4CPV A;  1NX2 A;  2AUC A;  3BX9 A;  1D1O A;  4EUL A;  3M22 A;  1M63 B;  5EJU A;  2NCO A;  1Y1U A;  1OMR A;  4KGE A;  3DVK A;  5HZT A;  3UNW A;  1YVH A;  2WHS A;  3CYZ A;  4DXN A;  1U5I A;  1ZUX A;  4MLW A;  3DZT A;  1NCZ A;  1LS8 A;  1W9Z A;  5AEQ A;  1K8U A;  3O77 A;  4PT1 A;  4DS7 A;  1TOP A;  2A53 B;  3LS3 A;  2JUL A;  1RMP A;  2VZX A;  2F33 A;  1KWO B;  1BF5 A;  2WIS A;  1GL4 A;  4I5J A;  4R1E A;  1T14 A;  2QU1 A;  1CNP A;  1GGW A;  2G16 B;  2QLH A;  3G9A A;  4EN1 A;  1Y6W A;  2IB5 A;  4ZCU A;  3AI4 A;  1M39 A;  1KSM A;  5DRG A;  1DVI A;  1F0B A;  5HZU A;  3U0L A;  3SVD A;  2P71 A;  5AER A;  2B1U A;  2DDC A;  3NF0 A;  3KCT A;  4KGF A;  2H6V A;  2AWL A;  1QAS A;  4W6H A;  5J2O A;  3RWA A;  2H2K A;  2ZRT A;  3D0Y A;  4AS8 A;  1WRL A;  1XVJ A;  3P28 A;  2VVI A;  3O2P A;  1OSA A;  2JT8 A;  2OS8 B;  2RGI A;  4DCK A;  4H48 A;  1OXF A;  4XL5 A;  3GK4 X;  5FI7 A;  3CBE A;  2SCP A;  2BCA A;  2CT9 A;  4KAG A;  4LJD A;  4W7A A;  4A4B A;  2Z1O A;  2AH8 A;  1K94 A;  3RZS A;  4GES B;  2G6Y A;  4MZJ A;  2WOR A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3SG4 A;  5EB7 A;  1EMK A;  1W7J B;  5DKQ A;  2Z6Z A;  1YRU B;  1TIZ A;  4ORN A;  2KAX A;  2WCK A;  2MLE C;  2AAO A;  5DIC A;  1PK0 D;  2B3Q A;  1JBA A;  1DMO A;  4RYS A;  4YGA A;  2WCB A;  4KF4 A;  3BQ3 A;  3PIB A;  3LL8 B;  2O29 A;  2ZMU A;  2K0J A;  3DQJ A;  3CB9 A;  4JEO A;  3EK7 A;  1NUB A;  3CZ2 A;  3KPX A;  3CFF A;  2JNF A;  4OCI A;  3AAK A;  3PJ7 A;  1M46 A;  1K2H A;  5DTL A;  5FVF A;  5DTX A;  2KLD A;  5I2L A;  1GQM A;  1DJY A;  2SAS A;  5D3O A;  2C9I A;  4W6C A;  1QVI Y;  1DJI A;  4PHM A;  1XYD A;  1G8I A;  2EMD A;  4KF5 C;  1KK8 C;  2M7L A;  1XAE A;  3S0E A;  1Q80 A;  2L5Y A;  3Q8I A;  4IZN A;  1CM4 A;  1PUL A;  2ERB A;  4GNK B;  2G6X A;  2A56 B;  3ZUJ A;  4NDB A;  1P28 A;  2F8P A;  2JT3 A;  4L13 A;  2P70 A;  2WCF A;  5DTY A;  2NLN A;  1BFP A;  3RM1 A;  1E8A A;  4I2Y A;  3GOF A;  4W6J A;  5BT0 A;  1A29 A;  4GUK A;  1AK8 A;  3DD4 A;  1Y0V H;  4H3N A;  1DJG A;  1ZMZ A;  1A4P A;  2QEV A;  2BKI B;  3I19 A;  4XYN A;  2V4E B;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  3SVC A;  4GF6 B;  3B7A A;  5CSF A;  3CAB A;  1AJ5 A;  5LTR A;  5I2O A;  3VRN A;  2R2I A;  2L51 A;  4EMQ A;  2E30 A;  5FI6 A;  5AFP A;  3OSQ A;  4W7F A;  1SY9 A;  2HQW A;  2K7C A;  3WXA A;  1W7S A;  2DUI A;  2V53 A;  3SG2 A;  4PAL A;  3PJB A;  2KI4 C;  4TNC A;  2Q4U A;  4N3D A;  4B30 B;  3KCS A;  3NT9 A;  3FIA A;  1XFY O;  4W77 A;  1NIW A;  2K2A A;  5JOL A;  3DY9 A;  1FBV A;  1LIN A;  2WUR A;  2H5Q A;  2EGD A;  4W73 A;  1Q4B A;  5EXC I;  1G7K A;  1LA0 A;  1MOU A;  4OHS A;  3EK4 A;  3O6B A;  5HZO A;  4IK8 A;  2JTT A;  4W6O A;  1DGV A;  3DQI A;  5JJG A;  1XFX O;  3TDI A;  3NT3 A;  1C3Z A;  3HCM A;  2K8M B;  2QEB A;  4KA9 A;  3UO9 A;  3BXK A;  1B8L A;  3BOW B;  2BE4 A;  4R6D A;  3WHU B;  1B8R A;  2DOQ A;  4IK9 A;  3OX6 A;  5CSI A;  4DXO A;  3PFV A;  4IK3 A;  2C9J A;  4XGY A;  1N0Y A;  5BTT A;  1L2O B;  3BOW A;  3NGV A;  1KWO C;  5HL1 A;  3PM8 A;  3CZT X;  3FS7 A;  3DQO A;  2K7O A;  2LP2 A;  1CDP A;  4RTC A;  1AHR A;  1YHG A;  1V1F A;  3IF7 A;  3KO0 A;  4JWQ A;  4YGB B;  1KFU L;  3DQ3 A;  4W75 A;  4KW4 A;  2KYF A;  3I5F C;  4MRX A;  4W7D A;  2LMT A;  3TMR A;  1MUX A;  3DQN A;  3DQA A;  3FE8 A;  3ADF A;  1W7T A;  1QYF A;  3ZWH A;  3U8C A;  1JC2 A;  3E3R A;  2MAZ A;  3OX5 A;  5HLO A;  4W6M A;  2MJW B;  1KSO A;  2JPT A;  3AKB A;  3VK1 A;  2WC5 A;  1IIO A;  3FWC A;  2FOT A;  2JT0 A;  1OOF A;  5DPI A;  1KP5 A;  4IK5 A;  1DEL A;  4IJ7 A;  4DKN A;  5EHU A;  2L5X B;  1H8B A;  1PVB A;  1WLM A;  4LJD C;  1DT7 B;  4KF5 A;  2L4H A;  1Y1A A;  1S6C A;  3SIB A;  2OS8 C;  2BAP A;  4AOM A;  4HQC A;  1BR1 B;  3NSK A;  3D77 A;  2G9B A;  3SVS A;  3WHT B;  3BFB A;  3LVA A;  3ST0 A;  3V3D A;  1A03 A;  2NCP A;  2ZMW A;  1S5G Z;  3DF0 A;  3CD1 A;  3DQ9 A;  2P4M A;  1EG4 A;  4ICB A;  2M8U A;  4PPK A;  2POX A;  1XA9 A;  3IVT A;  1XSS A;  2KSP A;  3NSI A;  3SS3 A;  1J1D A;  4ZF4 A;  1B47 A;  1TTX A;  1SL7 A;  1NCY A;  2PQL A;  2PXW A;  2Z6X A;  2PYQ A;  1JF2 A;  4ORB B;  2OTB A;  4W6L A;  2COL B;  1CMG A;  3PSR A;  1RJV A;  3SG7 A;  1F70 A;  3QRX A;  1UHJ A;  3LCP C;  3DQ2 A;  2PAL A;  2FCE A;  2L98 A;  4W7R A;  1B4C A;  1SSE B;  1LA3 A;  1WDC B;  1FPW A;  1KFU S;  1H6R A;  2HRS A;  3BXA A;  3WLD A;  2M3W A;  4BY4 A;  1AP4 A;  2EMN A;  3W1D A;  2MLF C;  2JPO A;  2GGM A;  3GJ2 A;  1REC A;  3JVT B;  1RWY A;  4JC2 A;  3D78 A;  3K1K A;  3E5W A;  3ST4 A;  3CZ1 A;  3SG6 A;  4P76 A;  1QX5 B;  5HKW A;  4HRH A;  3SVB A;  1N65 A;  4WRI A;  1XFR A;  2FWQ A;  1RFJ A;  3W1C A;  5BPJ A;  4HSZ A;  2HQ8 A;  1BT6 A;  4I5N B;  2KFG A;  3D76 A;  2FJU B;  2A54 B;  4JF9 A;  4UPG A;  1TNX A;  1VRK A;  3ST3 A;  2CBL A;  3SVU A;  1MHO A;  2PRU A;  1EMF A;  2QEO A;  4KYN A;  1QJT A;  1KYR A;  2GV5 A;  3VRO A;  1CFD A;  1DGU A;  4H3M A;  1WLZ A;  1CKK A;  2A4J A;  3H4S E;  4M2O A;  1YX7 A;  4ZBL A;  1RMO A;  1IGV A;  1QXT A;  2Q6P A;  2L4I A;  3SS0 A;  2YGU A;  3TS5 C;  1OZS A;  2M29 A;  3BJH A;  1NSH A;  3BUO B;  4YBH B;  1ZUZ A;  2F3Z A;  3SSL A;  5EL2 A;  1PSB A;  1K96 A;  3LLE A;  3CZ0 A;  4NQG A;  3B6X A;  4R6B A;  4H47 A;  5F6T A;  2PSR A;  2ZO7 A;  3MSE B;  4ZFS A;  2HPS A;  1SR6 B;  1CFF A;  4DXP A;  1GGZ A;  3ED8 A;  4W6T A;  1S1E A;  3JTD B;  1DJX A;  4EDO A;  4OJ0 A;  1ZFS A;  3IQQ A;  1KQV A;  3B88 A;  2G3D B;  3DQ1 A;  1DC1 A;  1UWO A;  3ZUF A;  3PJ5 A;  3AAJ A;  3CR2 A;  1OOG A;  2G2S B;  1CB1 A;  3AKA A;  1EMG A;  5HZS A;  2JXC A;  1FF1 A;  2L50 A;  2JC2 A;  1JBY A;  4ZF3 A;  2HF5 A;  1SL8 A;  2CCM A;  2IB6 A;  3GEX A;  4INX A;  1CLB A;  2BTJ A;  3PJI A;  3B87 A;  1K9U A;  1C3Y A;  3PN7 B;  1MF8 B;  2QLG B;  1A2X A;  4HQ9 A;  1B9A A;  4JPZ B;  2QLE A;  1QV1 A;  1OOI X;  2LVJ A;  4PE4 A;  4PCW A;  3OHM B;  3TUY B;  2ZN9 A;  4QJ5 B;  3NEZ A;  5CPV A;  1RRX A;  5HW9 A;  2HJO A;  1NX3 A;  4JD9 A;  1OZO A;  2VRG A;  4L12 A;  1Y1X A;  4W7C A;  1TWO A;  4W6N A;  2PMY A;  2OGR A;  4J88 A;  1DJW A;  1MWN A;  2GGZ A;  4AQI A;  2WCH A;  1H4B A;  1SMG A;  1LVC D;  5HKY A;  2JTZ A;  4LQU A;  1CDM A;  3BXB A;  5FVI A;  4PHK A;  3D75 A;  4XVP A;  3SIA A;  4AQJ A;  2ARL A;  1IKU A;  1NYA A;  4ETO A;  3TDZ A;  2WC8 A;  4HRG A;  1G33 A;  1YJF A;  2WC6 A;  2WSN A;  1YR5 A;  5FHV A;  1KK7 Z;  1BLQ A;  1UHH A;  2H9W A;  2KQ6 A;  4W6K A;  4C0K A;  1RMM A;  4W6G A;  4WQ3 A;  1NP8 A;  2IE2 A;  2FCD A;  3SS5 A;  4Q9X A;  1NX1 A;  3LK1 A;  2H5P A;  1GJY A;  2MRD A;  1Q73 A;  1Q4C A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  4KEX A;  1ALW A;  1F71 A;  5CSN A;  2GW3 A;  4FQT A;  3DPX A;  4NWS A;  5HYD A;  2EC6 B;  1PVA A;  3SVR A;  5EB6 A;  2CNP A;  3EVV A;  4CFR A;  3SS4 A;  1H4U A;  4ZB1 A;  5J3X A;  4YRU A;  5K89 A;  2Y4Q A;  1WY9 A;  3KF9 A;  4OV2 A;  1RRO A;  2WHT A;  3WNX B;  2DDD A;  1IQ5 A;  3N7H A;  2MBX A;  1A75 B;  2BBN A;  2HGY A;  3M24 A;  3VIC A;  4DRW A;  2KBM A;  2JZI A;  5BQL A;  3CS1 A;  1PAL A;  4W6D A;  1B1G A;  4LW5 A;  5I8N A;  2H8V A;  3GB3 A;  5HKZ A;  4HVF A;  4Q04 A;  1QYO A;  4W6P A;  5FYX A;  1GM0 A;  1QYQ A;  5TNC A;  1A75 A;  2QLI A;  3KEV A;  1SCV A;  1F54 A;  3OBV A;  4J89 A;  3DVJ A;  4JRB A;  1EML A;  1KK7 Y;  2BCB A;  1CM1 A;  3SVE A;  2IOV A;  5PAL A;  1LKJ A;  1OOH A;  3A8S A;  3LF3 A;  3VRR A;  5B8I B;  2FZU A;  2Y0G A;  3I5I B;  5CSJ A;  2WIQ A;  5LK4 A;  3GK2 A;  1KFX L;  1F4O A;  1R6P A;  1SBJ A;  2V4E A;  2LE9 B;  4H3L A;  2I7A A;  3BFH A;  4P2Y B;  1BR4 B;  2F2P A;  2DD7 A;  1QXP A;  2A46 A;  2LC5 A;  2QRF A;  5D69 A;  2H5R A;  4F7F A;  1Q4A A;  3EK8 A;  2KQY A;  2HGD A;  1WDC C;  2I94 A;  1HQV A;  3SSP A;  3SVN A;  4ZIO A;  2YE1 A;  4PHJ A;  4NDC A;  1NCX A;  3LSA A;  1S26 D;  2LAP A;  2GX2 A;  3JVT C;  4Q7T A;  4B30 A;  4XJK B;  2LHL A;  3E5V A;  3QME A;  3D10 A;  4GOB A;  1YVL A;  4TZA A;  3DQ7 A;  4DXQ A;  5DQB A;  1KQM B;  1FW4 A;  3SSY A;  3ZNI A;  2JOJ A;  3SSK A;  1J55 A;  4PPL A;  2KGB C;  3NSL A;  1YUS A;  2Y1N A;  2HQK A;  3SSV A;  5G08 A;  2G5Z B;  4ZCV A;  5DRF A;  4KW8 A;  1DF0 B;  4PDZ A;  1C7V A;  2FL1 A;  2L2C A;  1SNL A;  3OGO A;  5HBD A;  2Q91 A;  2Y1M A;  1CLM A;  2LHI A;  2IS9 A;  1EMM A;  3H1O A;  5AQB B;  3SG3 A;  1IJ6 A;  1AJ4 A;  1TRF A;  1YRT B;  1EME A;  3TMT A;  3ZUL A;  4LJC A;  3I5G B;  3HX4 A;  5FI2 A;  2DUH A;  5EXU A;  2K7B A;  2WHU A;  1KFX S;  2KI6 C;  4A4C A;  4W6F A;  3S0G A;  4Q9W A;  1SR6 C;  1OW4 A;  5AXI A;  4ZF5 A;  1QX2 A;  3H1R A;  3CGA A;  1JFK A;  3R1O A;  4EDS A;  2BL0 B;  3CFA A;  2BE6 A;  5DQM A;  1KCY A;  3JTD C;  3DQC A;  2L0P A;  2P6B B;  2G2B A;  4PHN A;  2LAN A;  1TCF A;  1BJF A;  4I5L B;  2LLT A;  4W6B A;  1JWD A;  3RWT A;  1K90 D;  1TNW A;  1YTZ C;  1QLS A;  1SPY A;  2K61 A;  1CLL A;  2F2O A;  2M97 A;  2KI6 D;  1C4F A;  1DEK A;  2E6W A;  2M1K B;  1SW8 A;  5DU0 A;  3SRY A;  2A50 B;  3AKO A;  1BOC A;  4DUQ A;  4BDU A;  4GGF A;  2PXS A;  2OTG B;  2H8Q A;  2KNE A;  2RH7 A;  3VGO A;  2KFH A;  2AWJ A;  2KPH A;  2QZ0 A;  1QAT A;  3U0M A;  3DQ8 A;  3D73 A;  1X02 A;  3PAT A;  3TUY C;  1CV7 A;  2KFF A;  3RLZ A;  1KYS A;  4QJ4 B;  5KTG A;  1IG5 A;  5FVG A;  1TUZ A;  2VVJ A;  4W74 A;  2M0R A;  1WRZ A;  5ER5 A;  2I18 A;  2GTE A;  3DQF A;  1CFC A;  3P8U A;  3SST A;  3LF4 B;  2JRF A;  2DUF A;  2KOT A;  4KW9 A;  4M2P A;  1IJ5 A;  2LVV A;  1UHI A;  5DKN A;  4B5Y A;  2WSO A;  1DTL A;  1OMD A;  3DQD A;  1NWD A;  1C7W A;  2DUG A;  4L9M A;  1SL9 A;  5H87 A;  4DIR A;  4W6S A;  2GW4 B;  4MEW A;  4IL1 A;  2Y5I A;  1IRJ A;  2AMI A;  2QEH A;  2TN4 A;  4RYW A;  4GAO A;  4XOV A;  2ZND A;  5KSZ A;  1J7O A;  5T3I A;  1SCM C;  2LVK A;  1S5G Y;  2OTE A;  1XFV O;  2ICR A;  2K60 A;  2QT2 A;  2EC6 C;  5HGE A;  1K95 A;  3UFZ A;  2M49 B;  2JQ6 A;  2ZO6 A;  5DPG A;  1DJH A;  1MXE A;  1U5I B;  3BYA A;  1OE9 B;  1F4Q A;  1JSA A;  1CTR A;  2EMO A;  3CD9 A;  5DKR A;  3S05 A;  1QY3 A;  2L2E A;  1TCO B;  2YFP A;  2CTN A;  1FI6 A;  1XFU O;  1SKT A;  5H89 A;  3IR8 A;  4NDD A;  1EL4 A;  1JBZ A;  1JUO A;  1QWV A;  1N2D A;  2OKW A;  2PVB A;  4W69 A;  3TZ1 A;  2LUX A;  1PSR A;  3CLN A;  3EVU A;  1S6I A;  1S36 A;  3S0F A;  4HQ8 A;  3DQK A;  2K2F A;  1UUS A;  5F9G A;  3SV5 A;  2YE0 A;  2KHN A;  1CDL A;  1Q4D A;  2K7D A;  4JFG A;  2V4E C;  2BEC A;  3SVO A;  2JNX A;  3NHT A;  4C0L A;  2EHB A;  1UHK A;  1QX7 A;  3I5F B;  3D0Y B;  3I5I C;  3U0K A;  1EMC A;  3L4A A;  5KTY A;  4M2Q A;  3NHI A;  4OKH A;  4YI8 A;  3VRQ A;  3E5T A;  4WQ2 A;  2AHA A;  1TNP A;  1XQM A;  1J7R A;  1ZAC A;  3C1V A;  4LJB A;  1JC0 A;  4GBA A;  1XO5 A;  3B86 A;  3IP2 A;  2HET A;  2A48 A;  1ZGQ A;  1YUU A;  1J7P A;  2WCL A;  3SSH A;  2LCP A;  2DD9 A;  2KAV A;  1DJZ A;  1OXE A;  5AAN A;  3VB1 A;  1UP5 A;  1QIW A;  1QVI Z;  2H61 C;  2M7N A;  1KQM C;  2QLG A; 
#chains in the Genus database with same CATH homology
 2BKH B;  5I2Q A;  3I5H B;  2ZNE A;  3CFH A;  3SJS A;  1G4Y R;  4W76 A;  3SG5 A;  1LXF C;  4UTS A;  4OR9 B;  3VHT B;  1XA5 A;  2JWW A;  4ANJ A;  2HCG A;  1AUI B;  5IBW A;  4Z4K A;  1L2O C;  1RK9 A;  4CLN A;  5D7F A;  4ORA B;  3U8P A;  1UHN A;  2D8N A;  3OB2 B;  2LNK A;  4MVF A;  3VHT A;  1OXD A;  3DQL A;  3LK0 A;  3WLC A;  4QJ3 B;  3TDU A;  4AR7 A;  2NZ0 A;  1B7T Z;  2O24 A;  1EJ3 A;  4HE4 A;  3I5G C;  2ZKM X;  1YUR A;  3ZTF A;  1W7U A;  3U0N A;  4FTG A;  1JC1 A;  1BU3 A;  2PAS A;  1YZW A;  2BBM A;  4JQ0 D;  4MN0 A;  5DY6 A;  1XFZ O;  2LLU A;  1KYP A;  1UIS A;  2BL0 C;  1F55 A;  1W7I B;  3BUX B;  1K9K A;  4FQO A;  1JF0 A;  1IQ3 A;  1HCJ A;  3ICB A;  4GGF C;  3O78 A;  3NXA A;  2JAD A;  3EKJ A;  1R2U A;  1SRA A;  3NSO A;  4W7X A;  1J1E A;  3WCK A;  4MBE A;  2MA2 A;  3BUM B;  2ZN8 A;  3AI5 A;  3KHE A;  1K9P A;  4IK1 A;  5LTP A;  1QLK A;  2Z6Y A;  4IK4 A;  2OTG C;  4Q7U A;  4W6A A;  4BY5 A;  4N1F A;  1B8C A;  2O60 A;  4F0Z B;  3BXC A;  3DPZ A;  4C0J A;  4Z4M A;  3CTN A;  1GFL A;  3U8A A;  2G3O A;  3EVP A;  2OKY A;  4GGN A;  3TS5 B;  2GX0 A;  4W6R A;  4PE1 A;  4MZL A;  2A52 B;  1MQ1 A;  3GL4 A;  4W6I A;  5HLV A;  4ZIN A;  3OB1 B;  1EG3 A;  1B7T Y;  3DQ5 A;  1YUT A;  1RTP 1;  1QS7 A;  3IQO A;  3OP0 A;  4PFE A;  2LM5 A;  1MXL C;  1J7Q A;  1F8H A;  4HRE E;  3LVC A;  2KYC A;  4N5X A;  2H5O A;  1UUR A;  4DKM A;  1K93 D;  2LUC A;  1ZGO A;  4Q7R A;  2OJK A;  1OMV A;  1BMO A;  1ZOT B;  1WRK A;  2NXQ A;  3PAL A;  3UG0 A;  2QAC A;  4TZG A;  2VAE A;  3F45 A;  2WND A;  1AVS A;  4YGE B;  2VVH A;  1EMA A;  4J8A A;  1Z1Q A;  1OOJ A;  2KAY A;  3DQE A;  2AWK A;  5H88 A;  4XJK A;  2B3P A;  3OSR A;  3CGL A;  1TNQ A;  4JGE A;  4U8D A;  2CXJ A;  5EBJ A;  4D1E A;  3PLF B;  2JU0 A;  2LMV A;  2H61 A;  3GJ1 A;  3CR4 X;  1QV0 A;  1PRW A;  1S3P A;  1XMZ A;  2HQZ A;  2WCE A;  1BG1 A;  3DVE A;  1YX8 A;  5BTT B;  3A4U B;  2LMU A;  2QPT A;  2O2B A;  1BOD A;  1EXR A;  1GGX A;  1DF0 A;  2ZRS A;  1V1G A;  2I2R E;  1SYM A;  4L1I A;  3MGF A;  1JFJ A;  4GFT A;  4E68 A;  3CR5 X;  1NPQ A;  2AWM A;  1B9C A;  3DQM A;  5ER4 X;  2KGR A;  1EH2 A;  1EMB A;  4OY4 A;  2A47 A;  1S6Z A;  4YI9 A;  4XOW A;  2HFC A;  1YHH A;  1M31 A;  3DVM A;  4W72 A;  4N1G A;  2ISD A;  4U2V A;  5EXB A;  1MOV A;  1CDN A;  4OQW A;  4DXM A;  2DUE A;  3GK1 A;  1HUY A;  1KK8 B;  4DXI A;  4GPL B;  3EVR A;  1OQP A;  2G6E A;  4KPI A;  2MHH A;  3LVD A;  1MYW A;  5DPH A;  4LQT A;  2O5G A;  2VAD A;  3EKH A;  4YGD B;  1RM9 A;  1C07 A;  3PN7 C;  3DPW A;  1XFW O;  4OVN F;  3DF0 B;  3DQU A;  1SK6 D;  5KU1 A;  1HT9 A;  1L7Z A;  3M0W A;  1YJ2 A;  4CID A;  1IWQ A;  2M9G A;  3DQH A;  3DQ4 A;  4ORC B;  1XK4 C;  1FI5 A;  3BUN B;  5LTQ A;  3DQ6 A;  4W6U A;  4P1Q A;  1M45 A;  1YFP A;  3NED A;  2LVI A;  2YDZ A;  1QTX A;  3I5H C;  4OGS A;  2F3Y A;  3VRP A;  4W7E A;  4PPJ A;  1Q4E A;  4PE7 A;  1QIV A;  2HPW A;  1F09 A;  2ZFD A;  4YGC B;  1YHI A;  3ST2 A;  3LA1 A;  4PE0 A;  1Z1P A;  1CFP A;  2LP3 A;  1CMF A;  1ODB A;  3BUW B;  5DPJ A;  2M1U A;  3A8R A;  2KI4 B;  2LV7 A;  4MRY A;  4USL A;  1ZGP A;  5DTZ A;  3FWB A;  2WOS A;  2JXL A;  3K21 A;  4I5K A;  2LLS A;  1TN4 A;  3CWG A;  4MZK A;  2Q57 A;  2KDH A;  1IH0 A;  4CFQ A;  1NX0 A;  4CPV A;  1NX2 A;  2AUC A;  3BX9 A;  1D1O A;  4EUL A;  3M22 A;  1M63 B;  5EJU A;  2NCO A;  1Y1U A;  1OMR A;  4KGE A;  3DVK A;  5HZT A;  1YVH A;  2WHS A;  4DXN A;  1U5I A;  1ZUX A;  4MLW A;  1NCZ A;  5AEQ A;  1K8U A;  3O77 A;  4DS7 A;  1TOP A;  2A53 B;  3LS3 A;  2JUL A;  1RMP A;  2VZX A;  2F33 A;  1KWO B;  1BF5 A;  2WIS A;  1GL4 A;  4I5J A;  4R1E A;  2QU1 A;  1CNP A;  1GGW A;  2G16 B;  2QLH A;  3G9A A;  4EN1 A;  1Y6W A;  2IB5 A;  4ZCU A;  3AI4 A;  1M39 A;  1KSM A;  5DRG A;  1DVI A;  1F0B A;  5HZU A;  3U0L A;  3SVD A;  5AER A;  2B1U A;  2DDC A;  3NF0 A;  3KCT A;  4KGF A;  2H6V A;  2AWL A;  1QAS A;  4W6H A;  5J2O A;  3RWA A;  2H2K A;  2ZRT A;  3D0Y A;  4AS8 A;  1WRL A;  1XVJ A;  3P28 A;  2VVI A;  3O2P A;  1OSA A;  2JT8 A;  2OS8 B;  2RGI A;  4DCK A;  4H48 A;  1OXF A;  4XL5 A;  3GK4 X;  3CBE A;  2SCP A;  2BCA A;  2CT9 A;  4KAG A;  4LJD A;  4W7A A;  4A4B A;  2Z1O A;  2AH8 A;  1K94 A;  4GES B;  2G6Y A;  4MZJ A;  2WOR A;  1XK4 A;  4P5O E;  1S6J A;  5GQQ C;  3SG4 A;  5EB7 A;  1EMK A;  1W7J B;  5DKQ A;  2Z6Z A;  1YRU B;  1TIZ A;  4ORN A;  2KAX A;  2MLE C;  2AAO A;  1PK0 D;  2B3Q A;  1JBA A;  1DMO A;  4RYS A;  4YGA A;  2WCB A;  4KF4 A;  3BQ3 A;  3PIB A;  3LL8 B;  2O29 A;  2ZMU A;  2K0J A;  3DQJ A;  3CB9 A;  4JEO A;  3EK7 A;  1NUB A;  3KPX A;  3CFF A;  2JNF A;  4OCI A;  3AAK A;  3PJ7 A;  1M46 A;  1K2H A;  5DTL A;  5FVF A;  5DTX A;  5I2L A;  1GQM A;  1DJY A;  2SAS A;  2C9I A;  4W6C A;  1QVI Y;  1DJI A;  4PHM A;  1XYD A;  1G8I A;  2EMD A;  4KF5 C;  1KK8 C;  2M7L A;  1XAE A;  1Q80 A;  4IZN A;  1CM4 A;  1PUL A;  4GNK B;  2G6X A;  2A56 B;  3ZUJ A;  4NDB A;  2F8P A;  2JT3 A;  4L13 A;  2WCF A;  5DTY A;  2NLN A;  1BFP A;  3RM1 A;  1E8A A;  4I2Y A;  3GOF A;  4W6J A;  5BT0 A;  1A29 A;  4GUK A;  1AK8 A;  3DD4 A;  1Y0V H;  4H3N A;  1DJG A;  1ZMZ A;  1A4P A;  2BKI B;  3I19 A;  4XYN A;  2V4E B;  1MR8 A;  4MSP A;  2KBI A;  3O4Y A;  3SVC A;  4GF6 B;  5CSF A;  1AJ5 A;  5LTR A;  5I2O A;  3VRN A;  2R2I A;  2L51 A;  4EMQ A;  2E30 A;  5AFP A;  3OSQ A;  4W7F A;  1SY9 A;  2HQW A;  2K7C A;  3WXA A;  1W7S A;  2DUI A;  2V53 A;  3SG2 A;  4PAL A;  3PJB A;  2KI4 C;  4TNC A;  2Q4U A;  4N3D A;  4B30 B;  3KCS A;  3NT9 A;  3FIA A;  1XFY O;  4W77 A;  1NIW A;  2K2A A;  5JOL A;  1FBV A;  1LIN A;  2WUR A;  2H5Q A;  2EGD A;  4W73 A;  1Q4B A;  5EXC I;  1G7K A;  1LA0 A;  1MOU A;  4OHS A;  3EK4 A;  3O6B A;  5HZO A;  4IK8 A;  2JTT A;  4W6O A;  1DGV A;  3DQI A;  5JJG A;  1XFX O;  3TDI A;  3NT3 A;  3HCM A;  2K8M B;  4KA9 A;  3BXK A;  1B8L A;  3BOW B;  2BE4 A;  4R6D A;  3WHU B;  1B8R A;  2DOQ A;  4IK9 A;  3OX6 A;  5CSI A;  4DXO A;  3PFV A;  4IK3 A;  2C9J A;  4XGY A;  1N0Y A;  5BTT A;  1L2O B;  3BOW A;  1KWO C;  3PM8 A;  3CZT X;  3FS7 A;  3DQO A;  2K7O A;  2LP2 A;  1CDP A;  4RTC A;  1AHR A;  1YHG A;  1V1F A;  3IF7 A;  3KO0 A;  4JWQ A;  4YGB B;  1KFU L;  3DQ3 A;  4W75 A;  4KW4 A;  2KYF A;  3I5F C;  4MRX A;  4W7D A;  2LMT A;  3TMR A;  1MUX A;  3DQN A;  3DQA A;  3ADF A;  1W7T A;  1QYF A;  3ZWH A;  3U8C A;  1JC2 A;  3E3R A;  2MAZ A;  3OX5 A;  5HLO A;  4W6M A;  2MJW B;  1KSO A;  2JPT A;  3AKB A;  3VK1 A;  3FWC A;  2FOT A;  2JT0 A;  5DPI A;  1KP5 A;  4IK5 A;  4DKN A;  5EHU A;  2L5X B;  1H8B A;  1PVB A;  1WLM A;  4LJD C;  1DT7 B;  4KF5 A;  2L4H A;  1Y1A A;  1S6C A;  3SIB A;  2OS8 C;  4AOM A;  4HQC A;  1BR1 B;  3NSK A;  2G9B A;  3SVS A;  3WHT B;  3LVA A;  3ST0 A;  3V3D A;  1A03 A;  2NCP A;  2ZMW A;  1S5G Z;  3DF0 A;  3CD1 A;  3DQ9 A;  2P4M A;  1EG4 A;  4ICB A;  2M8U A;  4PPK A;  2POX A;  1XA9 A;  1XSS A;  2KSP A;  3NSI A;  1J1D A;  4ZF4 A;  1B47 A;  1TTX A;  1SL7 A;  1NCY A;  2PXW A;  2Z6X A;  1JF2 A;  4ORB B;  2OTB A;  4W6L A;  2COL B;  1CMG A;  3PSR A;  1RJV A;  3SG7 A;  1F70 A;  3QRX A;  1UHJ A;  3LCP C;  3DQ2 A;  2PAL A;  2FCE A;  2L98 A;  4W7R A;  1B4C A;  1LA3 A;  1WDC B;  1FPW A;  1KFU S;  1H6R A;  2HRS A;  3BXA A;  3WLD A;  2M3W A;  4BY4 A;  1AP4 A;  2EMN A;  3W1D A;  2MLF C;  2GGM A;  3GJ2 A;  1REC A;  3JVT B;  1RWY A;  4JC2 A;  3K1K A;  3E5W A;  3ST4 A;  3SG6 A;  4P76 A;  1QX5 B;  5HKW A;  4HRH A;  3SVB A;  1N65 A;  4WRI A;  2FWQ A;  1RFJ A;  3W1C A;  5BPJ A;  4HSZ A;  2HQ8 A;  1BT6 A;  4I5N B;  2KFG A;  2FJU B;  2A54 B;  4JF9 A;  4UPG A;  1TNX A;  1VRK A;  3ST3 A;  2CBL A;  3SVU A;  1MHO A;  2PRU A;  1EMF A;  1QJT A;  1KYR A;  2GV5 A;  3VRO A;  1CFD A;  1DGU A;  4H3M A;  1WLZ A;  1CKK A;  2A4J A;  3H4S E;  4M2O A;  1YX7 A;  4ZBL A;  1RMO A;  1IGV A;  1QXT A;  2Q6P A;  2L4I A;  3SS0 A;  3TS5 C;  1OZS A;  2M29 A;  1NSH A;  3BUO B;  4YBH B;  1ZUZ A;  2F3Z A;  3SSL A;  1PSB A;  1K96 A;  3LLE A;  4NQG A;  4R6B A;  4H47 A;  5F6T A;  2PSR A;  2ZO7 A;  3MSE B;  4ZFS A;  2HPS A;  1SR6 B;  1CFF A;  4DXP A;  1GGZ A;  3ED8 A;  4W6T A;  1S1E A;  3JTD B;  1DJX A;  4EDO A;  4OJ0 A;  1ZFS A;  3IQQ A;  1KQV A;  2G3D B;  3DQ1 A;  1UWO A;  3ZUF A;  3PJ5 A;  3AAJ A;  3CR2 A;  2G2S B;  1CB1 A;  3AKA A;  1EMG A;  5HZS A;  2JXC A;  1FF1 A;  2L50 A;  2JC2 A;  1JBY A;  4ZF3 A;  2HF5 A;  1SL8 A;  2CCM A;  2IB6 A;  3GEX A;  1CLB A;  2BTJ A;  1K9U A;  3PN7 B;  1MF8 B;  2QLG B;  1A2X A;  4HQ9 A;  1B9A A;  4JPZ B;  2QLE A;  1QV1 A;  2LVJ A;  4PE4 A;  4PCW A;  3OHM B;  3TUY B;  2ZN9 A;  4QJ5 B;  3NEZ A;  5CPV A;  1RRX A;  5HW9 A;  2HJO A;  1NX3 A;  1OZO A;  2VRG A;  4L12 A;  1Y1X A;  4W7C A;  4W6N A;  2PMY A;  2OGR A;  4J88 A;  1DJW A;  1MWN A;  2GGZ A;  4AQI A;  1H4B A;  1SMG A;  1LVC D;  5HKY A;  2JTZ A;  4LQU A;  1CDM A;  3BXB A;  5FVI A;  4PHK A;  4XVP A;  3SIA A;  4AQJ A;  2ARL A;  1IKU A;  1NYA A;  4ETO A;  3TDZ A;  2WC8 A;  4HRG A;  1G33 A;  1YJF A;  2WSN A;  1YR5 A;  5FHV A;  1KK7 Z;  1BLQ A;  1UHH A;  2H9W A;  2KQ6 A;  4W6K A;  4C0K A;  1RMM A;  4W6G A;  4WQ3 A;  1NP8 A;  2IE2 A;  2FCD A;  4Q9X A;  1NX1 A;  3LK1 A;  2H5P A;  1GJY A;  2MRD A;  1Q73 A;  1Q4C A;  1ALV A;  2OPO A;  2BCX A;  1SCM B;  4KEX A;  1ALW A;  1F71 A;  5CSN A;  2GW3 A;  3DPX A;  4NWS A;  5HYD A;  2EC6 B;  1PVA A;  3SVR A;  5EB6 A;  2CNP A;  3EVV A;  4CFR A;  1H4U A;  4ZB1 A;  5J3X A;  4YRU A;  5K89 A;  2Y4Q A;  1WY9 A;  3KF9 A;  4OV2 A;  1RRO A;  2WHT A;  3WNX B;  2DDD A;  1IQ5 A;  2MBX A;  1A75 B;  2BBN A;  2HGY A;  3M24 A;  3VIC A;  4DRW A;  2KBM A;  2JZI A;  5BQL A;  3CS1 A;  1PAL A;  4W6D A;  1B1G A;  4LW5 A;  5I8N A;  3GB3 A;  5HKZ A;  4HVF A;  4Q04 A;  1QYO A;  4W6P A;  5FYX A;  1QYQ A;  5TNC A;  1A75 A;  2QLI A;  3KEV A;  1SCV A;  1F54 A;  4J89 A;  3DVJ A;  4JRB A;  1EML A;  1KK7 Y;  2BCB A;  1CM1 A;  3SVE A;  2IOV A;  5PAL A;  1LKJ A;  3A8S A;  3LF3 A;  3VRR A;  5B8I B;  2FZU A;  2Y0G A;  3I5I B;  5CSJ A;  2WIQ A;  5LK4 A;  3GK2 A;  1KFX L;  1F4O A;  1R6P A;  1SBJ A;  2V4E A;  2LE9 B;  4H3L A;  2I7A A;  4P2Y B;  1BR4 B;  2F2P A;  2DD7 A;  1QXP A;  2A46 A;  2LC5 A;  2QRF A;  5D69 A;  2H5R A;  1Q4A A;  3EK8 A;  2KQY A;  2HGD A;  1WDC C;  2I94 A;  1HQV A;  3SSP A;  3SVN A;  4ZIO A;  2YE1 A;  4PHJ A;  4NDC A;  1NCX A;  3LSA A;  1S26 D;  2LAP A;  2GX2 A;  3JVT C;  4Q7T A;  4B30 A;  4XJK B;  2LHL A;  3E5V A;  3D10 A;  4GOB A;  1YVL A;  4TZA A;  3DQ7 A;  4DXQ A;  5DQB A;  1KQM B;  1FW4 A;  3SSY A;  3ZNI A;  2JOJ A;  3SSK A;  1J55 A;  4PPL A;  2KGB C;  3NSL A;  1YUS A;  2Y1N A;  2HQK A;  3SSV A;  5G08 A;  2G5Z B;  4ZCV A;  5DRF A;  4KW8 A;  1DF0 B;  4PDZ A;  1C7V A;  2FL1 A;  1SNL A;  3OGO A;  5HBD A;  2Q91 A;  2Y1M A;  1CLM A;  2LHI A;  2IS9 A;  1EMM A;  3H1O A;  5AQB B;  3SG3 A;  1IJ6 A;  1AJ4 A;  1TRF A;  1YRT B;  1EME A;  3TMT A;  3ZUL A;  4LJC A;  3I5G B;  3HX4 A;  2DUH A;  5EXU A;  2K7B A;  2WHU A;  1KFX S;  2KI6 C;  4A4C A;  4W6F A;  4Q9W A;  1SR6 C;  5AXI A;  4ZF5 A;  1QX2 A;  3H1R A;  3CGA A;  1JFK A;  4EDS A;  2BL0 B;  3CFA A;  2BE6 A;  5DQM A;  1KCY A;  3JTD C;  3DQC A;  2L0P A;  2P6B B;  2G2B A;  4PHN A;  2LAN A;  1TCF A;  1BJF A;  4I5L B;  2LLT A;  4W6B A;  1JWD A;  3RWT A;  1K90 D;  1TNW A;  1YTZ C;  1QLS A;  1SPY A;  2K61 A;  1CLL A;  2F2O A;  2M97 A;  2KI6 D;  1C4F A;  2E6W A;  2M1K B;  1SW8 A;  5DU0 A;  3SRY A;  2A50 B;  3AKO A;  1BOC A;  4DUQ A;  4BDU A;  4GGF A;  2PXS A;  2OTG B;  2H8Q A;  2KNE A;  2RH7 A;  3VGO A;  2KFH A;  2AWJ A;  2QZ0 A;  1QAT A;  3U0M A;  3DQ8 A;  3TUY C;  1X02 A;  3PAT A;  1CV7 A;  2KFF A;  3RLZ A;  1KYS A;  4QJ4 B;  5KTG A;  1IG5 A;  5FVG A;  2VVJ A;  4W74 A;  2M0R A;  1WRZ A;  5ER5 A;  2I18 A;  3DQF A;  1CFC A;  3P8U A;  3SST A;  3LF4 B;  2JRF A;  2DUF A;  2KOT A;  4KW9 A;  4M2P A;  1IJ5 A;  2LVV A;  1UHI A;  5DKN A;  4B5Y A;  2WSO A;  1DTL A;  1OMD A;  3DQD A;  1NWD A;  1C7W A;  2DUG A;  4L9M A;  1SL9 A;  5H87 A;  4DIR A;  4W6S A;  2GW4 B;  4MEW A;  4IL1 A;  2Y5I A;  1IRJ A;  2AMI A;  2TN4 A;  4RYW A;  4GAO A;  4XOV A;  2ZND A;  5KSZ A;  1J7O A;  5T3I A;  1SCM C;  2LVK A;  1S5G Y;  2OTE A;  1XFV O;  2ICR A;  2QT2 A;  2EC6 C;  5HGE A;  1K95 A;  3UFZ A;  2M49 B;  2JQ6 A;  2ZO6 A;  5DPG A;  1DJH A;  1MXE A;  1U5I B;  3BYA A;  1OE9 B;  1F4Q A;  1JSA A;  1CTR A;  2EMO A;  3CD9 A;  5DKR A;  3S05 A;  1QY3 A;  2L2E A;  1TCO B;  2YFP A;  2CTN A;  1FI6 A;  1XFU O;  1SKT A;  5H89 A;  3IR8 A;  4NDD A;  1EL4 A;  1JBZ A;  1JUO A;  1N2D A;  2OKW A;  2PVB A;  4W69 A;  3TZ1 A;  2LUX A;  1PSR A;  3CLN A;  3EVU A;  1S6I A;  1S36 A;  4HQ8 A;  3DQK A;  2K2F A;  1UUS A;  5F9G A;  3SV5 A;  2YE0 A;  2KHN A;  1CDL A;  1Q4D A;  2K7D A;  4JFG A;  2V4E C;  2BEC A;  3SVO A;  2JNX A;  4C0L A;  2EHB A;  1UHK A;  1QX7 A;  3I5F B;  3D0Y B;  3I5I C;  3U0K A;  1EMC A;  5KTY A;  4M2Q A;  4OKH A;  4YI8 A;  3VRQ A;  3E5T A;  4WQ2 A;  2AHA A;  1TNP A;  1XQM A;  1J7R A;  1ZAC A;  3C1V A;  4LJB A;  4GBA A;  1XO5 A;  1JC0 A;  3IP2 A;  2HET A;  2A48 A;  1ZGQ A;  1YUU A;  1J7P A;  3SSH A;  2LCP A;  2DD9 A;  2KAV A;  1DJZ A;  1OXE A;  5AAN A;  1UP5 A;  1QIW A;  1QVI Z;  2H61 C;  2M7N A;  1KQM C;  2QLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...