3EKJA

Calcium-free gcamp2 (calcium binding deficient mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
301
Chain Sequence
LENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGGITTKQLGTVMRSLGQNPTEAELQDMINEVGGTIDFPQFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
total genus 78
structure length 301
sequence length 318
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekjA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekjA01
4I2YA 3OGOA 3JVTC 2JZIA 3ST4A 2ARLA 2MJWB 1LA0A 4PE0A 1WLZA 3DQ2A 2HPSA 1ODBA 1Y6WA 2A52B 3ST0A 4W7RA 5AQBB 2PVBA 3VRPA 1IJ5A 2EGDA 2MLEC 2GW3A 4OQWA 1EMBA 3BXAA 1SNLA 1QLSA 1TNXA 3F45A 1SCMB 4YGEB 3SG3A 5GQQC 1EXRA 3AAJA 2ZO7A 4PE7A 3A8RA 2A54B 3GOFA 1L2OC 5F6TA 3O6BA 2BKIB 2NZ0A 2ZN9A 4MVFA 1XFUO 4W6CA 1F71A 1YJFA 5J2OA 1TN4A 2A48A 1W7TA 1EJ3A 4GUKA 3I5GB 3FIAA 3IP2A 3CTNA 4TZAA 2KHNA 4OY4A 2BKHB 2CTNA 1RFJA 4ORNA 1CB1A 4B5YA 5DRFA 5KTGA 1BMOA 2JC2A 3BOWB 1EMFA 4I5LB 3CR2A 1B4CA 1SCVA 1D1OA 3NSOA 3CS1A 4W7EA 1IJ6A 1SCMC 4BY4A 2HPWA 4MRYA 5BT0A 4KPIA 5LTPA 3RWTA 1OMDA 4FQOA 1N65A 2ZO6A 2K61A 1FF1A 3OP0A 1K9UA 2AHAA 2ZN8A 1RRXA 2QLHA 2COLB 1LVCD 4IK8A 3I5FB 1JFKA 2DD7A 3I5GC 3VRQA 1DF0B 2V53A 1JF2A 1K9PA 1PVAA 1MXEA 3PALA 3SSTA 4XL5A 1KYPA 5HYDA 1H4UA 2BBMA 4AOMA 2LVKA 2WC8A 3CLNA 1ZUZA 4GESB 2AWKA 1BJFA 2HFCA 1BFPA 2H5PA 2TN4A 1RMPA 5DPHA 2K2AA 4JPZB 3NT3A 3SRYA 4W6GA 3CWGA 2G16B 4LJCA 4ANJA 3ZWHA 5IBWA 1Q73A 3SVOA 2NLNA 1AK8A 1UISA 2QZ0A 3NT9A 3BUWB 1HCJA 4ZFSA 2H6VA 1SL8A 1YRUB 3OX5A 3BXKA 5PALA 2QLIA 2LAPA 3SVNA 2DUHA 2M7LA 3I5FC 1AJ4A 2WCFA 2PASA 1RMOA 4H48A 4ZBLA 3ZULA 1BODA 5HZOA 2G5ZB 2DDDA 2DUEA 4Q7TA 2KGRA 1KCYA 4FTGA 2HRSA 4UPGA 2L50A 5T3IA 1Y1AA 1PSRA 2MBXA 5KU1A 3EKHA 1KFXL 4A4BA 3DQOA 1A03A 2PSRA 2P4MA 2M9GA 1RK9A 2LUCA 1IG5A 3CZTX 4DS7A 2V4EC 4PHNA 1XSSA 2Q4UA 2JXCA 4JEOA 5DU0A 3TDIA 1BU3A 2ZMUA 1BR1B 2CCMA 1F4OA 4HQCA 3SSHA 1SKTA 1QYQA 4ZCUA 4M2OA 1GL4A 2GW4B 1OQPA 2LMTA 3SSVA 1ZACA 1QVIZ 1WRLA 4TNCA 5CSFA 2WHUA 4W69A 1QVIY 4WQ2A 1KP5A 3RLZA 4RYSA 5KSZA 2AWMA 2JQ6A 2LC5A 2AH8A 2FJUB 2H2KA 1DGVA 3CR4X 2K7DA 2AWLA 2LMVA 1YUUA 5HGEA 1YR5A 3SG4A 3AKOA 1WY9A 4P5OE 4IL1A 2WHSA 1EMMA 3DVKA 4TZGA 2IS9A 3SVDA 2DOQA 1OXFA 4Z4MA 5AERA 1EMLA 4DXNA 3UFZA 5AANA 2PALA 4XOWA 2LP2A 4W6AA 5EBJA 4PHMA 2YFPA 4AQJA 2GV5A 4LJBA 1FW4A 5FVIA 2K7BA 1CLLA 3ADFA 4Q9WA 4EDOA 1NX2A 1KFXS 3QRXA 2WURA 4YGAA 2A50B 1W7JB 2O60A 1NCYA 4JFGA 1SMGA 2PRUA 1B8RA 2LVIA 3I19A 4ZF3A 1CM1A 4MBEA 4Q04A 3TDZA 5HZUA 4USLA 4OGSA 4YGDB 2RH7A 2BECA 4EULA 3EVPA 1K9KA 3E5VA 1DJZA 3LF4B 1QXPA 5HKZA 1U5IA 2LMUA 1TNWA 2JOJA 3BOWA 4W7DA 4PPLA 2QLEA 4W7CA 2WORA 2IE2A 3LVAA 4PPKA 2I94A 1SYMA 3WHUB 1QV1A 4IK3A 2G2BA 2E30A 3U8AA 1XFVO 3SJSA 1KK8C 3U0MA 3TMRA 3AKBA 1UHHA 2G2SB 1K95A 3OSRA 3ST2A 1CDPA 5BPJA 3O4YA 1DF0A 2LM5A 4W6HA 4W7XA 5DKQA 3AKAA 3VK1A 3LF3A 1X02A 3AI4A 3JTDB 2FL1A 3PIBA 3EVVA 3TZ1A 4AR7A 4R6DA 3JVTB 2LUXA 1CFCA 1QIWA 1EMKA 1OXEA 2I2RE 4ZINA 4W6DA 4LW5A 3DPWA 4P1QA 1K96A 4NDCA 1UHNA 2OS8C 2HCGA 2MHHA 2MLFC 1QLKA 1DJWA 1OSAA 3I5HB 3GJ1A 3ICBA 5HKYA 2L98A 2JWWA 1LINA 3SSLA 1FPWA 1Y1UA 2Z6ZA 5F9GA 4ZF4A 1YUSA 3ED8A 2JT8A 5DY6A 2GGMA 4KW4A 1SL7A 1QY3A 2KI4B 2KQYA 1ZOTB 1Q4EA 2Q91A 3I5IC 2WISA 2HGDA 1CFPA 4W7AA 2O2BA 4PPJA 4YI9A 3LLEA 4IK1A 1A75B 2B3PA 3SV5A 1EMAA 1F8HA 2KFHA 1DJXA 5LTRA 5HZSA 3JTDC 1K8UA 5I2QA 2K2FA 3GEXA 1NWDA 3PN7B 2WHTA 1N0YA 1EL4A 4I5JA 3IQOA 3TDUA 5ER4X 1B7TY 1YVHA 4EMQA 3O78A 2IOVA 2L0PA 1Y1XA 1G33A 1NPQA 3AI5A 1B8CA 4HSZA 2WCEA 3BX9A 2WOSA 4W75A 4C0LA 4OCIA 1H8BA 1OXDA 4HRGA 1QJTA 3I5HC 3O77A 5ER5A 1YZWA 3GK2A 4NQGA 1OZSA 1GGXA 3BUMB 1UWOA 3P28A 4W6PA 4PCWA 3V3DA 2CT9A 4N1FA 1CLBA 4L1IA 2KI4C 3VHTB 4W6NA 1AUIB 4DRWA 4W74A 3BUXB 3PATA 2DUIA 1OMRA 3VGOA 4DXQA 4LJDC 1GFLA 3LA1A 3PN7C 4HQ9A 2HGYA 4NDDA 4CPVA 3SIBA 1R6PA 1Q4BA 1QX5B 1U5IB 1XFXO 2VRGA 4JC2A 3U0NA 4MEWA 4W7FA 3PM8A 3DQ4A 4PE1A 2DUGA 1SRAA 4RTCA 4R1EA 3SG2A 5AXIA 2OTEA 3P8UA 3GJ2A 2M0RA 2JTTA 3AAKA 2L2EA 2IB5A 4XGYA 3CFFA 4P76A 2JXLA 4YGCB 2ZKMX 2FCDA 2VADA 1H4BA 1NP8A 1F55A 3ZUJA 5H87A 1EH2A 3NSLA 2LNKA 4XJKA 1KFUL 2LVJA 1J7OA 1CMFA 4R6BA 2K8MB 3K21A 3DQHA 2HQ8A 3PJ5A 3VRNA 1K90D 1HUYA 3DQCA 3DPZA 2F8PA 5G08A 3BQ3A 4H3NA 1KK7Y 3CFAA 2A46A 1S1EA 1CDLA 3PJBA 4Z4KA 5HLVA 4OR9B 2JNXA 3LVDA 4W6OA 2V4EB 1RJVA 1SPYA 1MWNA 3WNXB 4DKMA 3DQUA 1NIWA 2L5XB 3DQ9A 1LKJA 4U8DA 2LHIA 3GK4X 3HX4A 3DQFA 4W76A 2BCAA 1Q4DA 1EMGA 1A29A 1TIZA 2WNDA 1RROA 4J88A 1MF8B 3FWCA 2ZRSA 2F3ZA 3ZNIA 1UURA 2A53B 4B30B 3E3RA 4GGNA 1C7WA 3OB1B 5DTXA 3K1KA 1CDMA 1PK0D 4PHJA 2K0JA 3EKJA 1DT7B 1PULA 1DMOA 1Q80A 4Q7UA 3E5TA 2HQWA 2EMOA 2DD9A 1KFUS 2KOTA 2CXJA 4MLWA 1XA5A 1DTLA 1UHIA 5DKRA 2KI6D 2M97A 3H1OA 4MZLA 5DTYA 1YHIA 4ZCVA 5HLOA 2KGBC 1TRFA 3WHTB 3SG6A 3ZUFA 2HF5A 1HT9A 1QTXA 3SVUA 3DQ6A 3DQAA 4CFQA 1VRKA 2KFGA 2LE9B 1YHGA 1OOJA 3KF9A 1NYAA 5AEQA 1YHHA 2QLGB 1S26D 2JT0A 3CD1A 1K94A 4NDBA 1JBAA 4DXOA 1ZFSA 1A75A 4LJDA 2WCBA 4N1GA 4OHSA 4DXIA 4GPLB 4MRXA 3D0YB 1EG3A 5EB7A 1QYOA 3S05A 2F2OA 1K2HA 3SVCA 2KSPA 4KW8A 2G9BA 4JGEA 2M29A 2D8NA 1Y0VH 4KA9A 4L13A 4H3LA 4YBHB 1G7KA 2ZNDA 5EXBA 4ORBB 3EK4A 2DDCA 2G3OA 1MXLC 2Z6YA 2OGRA 2JTZA 5BTTB 1E8AA 2YDZA 1IGVA 2OKYA 1JUOA 5EB6A 3TS5C 1KK8B 2Z6XA 3E5WA 5DPGA 3EVRA 4XJKB 1JC2A 2QU1A 1JF0A 3VHTA 2FCEA 1NSHA 4KW9A 1XFWO 3DQJA 3WXAA 3U8CA 1GGWA 1S6IA 2QPTA 2JULA 2RGIA 1S5GY 3KEVA 4JF9A 1KSMA 3SSYA 2CNPA 4M2PA 4W6JA 5EXCI 5DRGA 1F0BA 4PALA 1L7ZA 1XYDA 4E68A 3IQQA 1IH0A 5I2LA 4HVFA 4LQUA 4W6LA 2OS8B 5EXUA 2KNEA 2F33A 4H3MA 2BCBA 2LVVA 1QX7A 5DPIA 5KTYA 4XOVA 2ZRTA 3ZTFA 1NX3A 1BOCA 4EDSA 1TNPA 4W6RA 3DQNA 1FI6A 2QACA 2L51A 1B9AA 1TTXA 2H5OA 2Y0GA 4QJ3B 5TNCA 2G6EA 1SK6D 1EMEA 2BTJA 2KYFA 3KO0A 2EMDA 3EK8A 2JNFA 3I5IB 1M31A 4KAGA 2AAOA 2Y5IA 1XAEA 1XFYO 1J1DA 4GBAA 5JOLA 1YFPA 2LP3A 3DQ5A 4UTSA 3NSIA 5FVGA 1YJ2A 4DCKA 3BUNB 1XK4C 1RWYA 4PDZA 5HW9A 4EN1A 4QJ5B 1A2XA 2HETA 4JWQA 1XFZO 3KCTA 2ICRA 2SASA 3SSKA 1XMZA 5EHUA 2Y1NA 4ORCB 2VAEA 2SCPA 1BT6A 3SIAA 1G8IA 2PXWA 2V4EA 2H8QA 1JFJA 1C7VA 1DJYA 4C0KA 3PFVA 4W6SA 1CFDA 4LQTA 2ZMWA 3VRRA 1QV0A 1LXFC 1M39A 1QS7A 1PALA 5FHVA 1IKUA 2P6BB 3SS0A 1Z1QA 4OVNF 1F54A 1PVBA 3PJ7A 1A4PA 2KAVA 1TOPA 4W6UA 1KQMB 5EJUA 1PSBA 1GJYA 4ICBA 2A47A 1M45A 2AWJA 1ALVA 1Z1PA 5D69A 2BL0B 1BLQA 1JC1A 4B30A 5I8NA 3NEZA 1GQMA 1B7TZ 2KYCA 2NCOA 3DQLA 3DQIA 3BUOB 4DXMA 2MRDA 1MUXA 2H61C 4KEXA 3NXAA 3SVBA 1ZMZA 4D1EA 4YI8A 3KHEA 3DQKA 4KGEA 3M0WA 2H5RA 1MHOA 2KQ6A 1IQ5A 3CGAA 3OSQA 4W6IA 1TCFA 3KCSA 2LLSA 4W6MA 1J7RA 4OJ0A 3TUYB 1G4YR 1RMMA 5FVFA 1F70A 4XYNA 1MYWA 1KQMC 1V1FA 2GGZA 4ETOA 4N5XA 2EC6B 1XA9A 2QLGA 2WSNA 4IK9A 3PLFB 1DJIA 1YX7A 4CFRA 4W6TA 2BL0C 4F0ZB 4PFEA 2O5GA 3D0YA 1R2UA 2VVIA 4HREE 3GB3A 4J89A 2OJKA 3DQ1A 4QJ4B 5HZTA 3DF0B 4GNKB 2L4IA 1MOUA 2MAZA 1OE9B 1K93D 2KFFA 1IWQA 2JRFA 5JJGA 2WIQA 2OTGB 2GX2A 1BF5A 4U2VA 1YX8A 1XVJA 2EHBA 3SG5A 3IF7A 2E6WA 5B8IB 4GOBA 1WLMA 1DJGA 2KDHA 4GFTA 5BTTA 2M49B 2PXSA 3TUYC 1EMCA 1Q4CA 2M1UA 5CPVA 1YUTA 1CFFA 2KBIA 4PE4A 2EC6C 3U0LA 3WLDA 2O24A 3SVRA 5J3XA 2JPTA 3LK1A 3CBEA 5CSJA 1KK7Z 1XQMA 3PSRA 1W7IB 1UHKA 1XK4A 2Q57A 3M22A 2LV7A 1C4FA 5LTQA 2YE0A 3EK7A 1S36A 3FS7A 3DQ3A 2AMIA 4KGFA 4WRIA 1S6JA 2OTGC 1AVSA 2BE4A 2HJOA 1SL9A 4BY5A 5AFPA 4I5KA 2G6YA 3SG7A 2OPOA 1KWOB 2B3QA 1PRWA 1QATA 3OB2B 3DVJA 4KF5C 2I18A 2M3WA 1YURA 2FWQA 2VVJA 2IB6A 5BQLA 4MSPA 3H4SE 4HRHA 3NEDA 3W1CA 2WSOA 4ZF5A 2Z1OA 1KQVA 3DQ8A 4JQ0D 3G9AA 1NCXA 1S6CA 1CV7A 1OMVA 1QX2A 5DTZA 2KI6C 1W7SA 1JBYA 4AS8A 1GGZA 1LA3A 3DD4A 3GK1A 2L4HA 3DQDA 1RECA 1TCOB 5K89A 4C0JA 1IQ3A 5H88A 1QXTA 3LK0A 2K7OA 4RYWA 1UUSA 4Q7RA 2H61A 3DQMA 2VZXA 1DVIA 2OTBA 1SW8A 3MGFA 1S6ZA 1ZUXA 1JWDA 1QYFA 1JC0A 3CR5X 2FZUA 3DVMA 1M46A 1N2DA 2M8UA 4M2QA 1KWOC 2JU0A 4N3DA 4ORAB 3NF0A 1BR4B 1H6RA 4BDUA 2KAYA 2LLTA 4KF4A 3DPXA 1M63B 4GGFC 4YGBB 3TS5B 2YE1A 3UG0A 4DKNA 4I5NB 4YRUA 1UHJA 3DVEA 1DGUA 3WLCA 2R2IA 1B47A 3U0KA 2FOTA 1TNQA 1AHRA 2M7NA 3HCMA 2G3DB 2H5QA 3GL4A 3SSPA 1B8LA 2ZNEA 3FWBA 5FYXA 1OZOA 1B9CA 4W6KA 2GX0A 1J7PA 4HQ8A 1KSOA 2EMNA 1SR6B 1Q4AA 3WCKA 1KYSA 2JADA 4JRBA 5CSIA 4WQ3A 4W77A 1ZGOA 4MZJA 4W6BA 3IR8A 4J8AA 5DPJA 1CKKA 1J1EA 5DKNA 2NXQA 1WDCB 1S3PA 1NX1A 4ZIOA 2Y4QA 1QASA 3LS3A 2CBLA 3LVCA 2LHLA 1UP5A 1JBZA 1S5GZ 4HE4A 2KAXA 4GAOA 3LSAA 5DQBA 3W1DA 5DTLA 1JSAA 2JT3A 3DQ7A 3EVUA 3KPXA 3A4UB 2H9WA 2B1UA 1W7UA 1NUBA 2KBMA 3BYAA 1CLMA 2O29A 2M1KB 3VICA 2F2PA 2C9JA 3DF0A 1RM9A 1XO5A 4W72A 2ZFDA 3M24A 1SY9A 5I2OA 1SR6C 3OHMB 3C1VA 1J55A 1WRKA 2ISDA 4CIDA 2Y1MA 2PMYA 1MOVA 2DUFA 4W73A 3MSEB 2NCPA 2Q6PA 4NWSA 2LANA 3VROA 5HBDA 3D10A 4IK5A 2QRFA 4PHKA 4H47A 1YRTB 4KF5A 2K7CA 1WDCC 3TMTA 3DQEA 3RM1A 5LK4A 1MR8A 4W6FA 1RTP1 1DJHA 1ZGPA 1NX0A 3O2PA 1ZGQA 4DXPA 2VVHA 1EG4A 3RWAA 4L12A 1FBVA 4MZKA 2MA2A 3CB9A 4IK4A 1F09A 1AP4A 1CTRA 4DUQA 1V1GA 2LCPA 1CDNA 2HQZA 1ALWA 1KYRA 3A8SA 3CGLA 3CD9A 1C07A 4OKHA 4XVPA 4P2YB 3BXCA 2HQKA 2BE6A 2AUCA 2QT2A 2A56B 3U8PA 4A4CA 3CFHA 4ZB1A 1BG1A 2I7AA 3H1RA 5D7FA 1CM4A 4GF6B 1NCZA 2C9IA 4MN0A 1YTZC 2POXA 1MQ1A 2BBNA 1B1GA 4OV2A 1F4QA 2BCXA 4L9MA 2A4JA 1J7QA 5DQMA 4GGFA 3SVSA 4AQIA 3NSKA 4CLNA 5H89A 3ST3A 1CMGA 2G6XA 1L2OB 1FI5A 2F3YA 3LCPC 5CSNA 4DIRA 4Q9XA 1QIVA 1WRZA 1SBJA 2OKWA 3BXBA 5HKWA 1HQVA 1YVLA 3OX6A 3SVEA 1AJ5A 2LLUA 3LL8B 1IRJA 4IZNA 1CNPA
chains in the Genus database with same CATH superfamily
3L47A 4I2YA 3OGOA 3JVTC 2JZIA 3ST4A 2ARLA 2MJWB 1LA0A 4PE0A 1WLZA 3DQ2A 2HPSA 1ODBA 1Y6WA 2A52B 3ST0A 4W7RA 5AQBB 2PVBA 3VRPA 1IJ5A 2EGDA 2MLEC 2GW3A 4OQWA 1EMBA 3BXAA 1SNLA 1QLSA 1TNXA 3F45A 1SCMB 4YGEB 3SG3A 3UNWA 5GQQC 1EXRA 3AAJA 2ZO7A 4PE7A 3A8RA 2A54B 3GOFA 1L2OC 5F6TA 2WCHA 3O6BA 2BKIB 2NZ0A 2ZN9A 4MVFA 1XFUO 4W6CA 1F71A 3D78A 1YJFA 5J2OA 1TN4A 2A48A 1W7TA 1EJ3A 4GUKA 3I5GB 3FIAA 3IP2A 3CTNA 4TZAA 2KHNA 4OY4A 2BKHB 2CTNA 1RFJA 4PT1A 3R72A 2ERBA 4ORNA 1CB1A 4B5YA 5DRFA 5KTGA 1BMOA 2JC2A 1Z2CB 3BOWB 1EMFA 4I5LB 3CR2A 1B4CA 1SCVA 1D1OA 5HL1A 3NSOA 3CS1A 4W7EA 1IJ6A 1SCMC 4BY4A 2HPWA 4MRYA 5BT0A 4KPIA 5LTPA 3RWTA 1OMDA 4FQOA 1N65A 2ZO6A 3DY9A 2K61A 2WC6A 1FF1A 3D75A 3OP0A 1K9UA 2AHAA 2ZN8A 2K60A 1RRXA 2QLHA 2COLB 3CYZA 1LVCD 4IK8A 3I5FB 1JFKA 2DD7A 3I5GC 3VRQA 1DF0B 2V53A 1JF2A 1K9PA 1PVAA 1MXEA 3PALA 3SSTA 4XL5A 1KYPA 5HYDA 1H4UA 2BBMA 4AOMA 2LVKA 2WC8A 3CLNA 1ZUZA 4GESB 2AWKA 1BJFA 4JD9A 5D3OA 2HFCA 1BFPA 2H5PA 2TN4A 1RMPA 5DPHA 2K2AA 4JPZB 3NT3A 3SRYA 4W6GA 3CWGA 2G16B 4LJCA 4ANJA 3ZWHA 5IBWA 1Q73A 3SVOA 2NLNA 1AK8A 1UISA 2QZ0A 3NT9A 3BUWB 1HCJA 4ZFSA 2H6VA 1SL8A 1YRUB 3CDNA 3OX5A 3BXKA 5PALA 2QLIA 2LAPA 3D74A 3SVNA 2DUHA 1TWOA 2M7LA 3I5FC 1AJ4A 2WCFA 2PASA 1RMOA 4H48A 4ZBLA 3ZULA 1BODA 5HZOA 2G5ZB 2DDDA 2DUEA 4Q7TA 2KGRA 3SS3A 1KCYA 4FTGA 2HRSA 3DXLA 2L50A 4UPGA 5T3IA 1Y1AA 1PSRA 2MBXA 5KU1A 3EKHA 1KFXL 4A4BA 3DQOA 1A03A 2PSRA 2P4MA 2M9GA 1RK9A 2LUCA 1IG5A 3CZTX 4DS7A 2V4EC 4PHNA 1XSSA 2Q4UA 2JXCA 4JEOA 5DU0A 3TDIA 1BU3A 1Z4HA 2ZMUA 2P71A 1BR1B 2CCMA 1F4OA 4HQCA 3SSHA 1SKTA 1QYQA 4ZCUA 4M2OA 1XFRA 1GL4A 2GW4B 1OQPA 2LMTA 5EL2A 3SSVA 1ZACA 1QVIZ 3BFAA 1WRLA 4TNCA 5CSFA 2WHUA 4W69A 1QVIY 4WQ2A 1KP5A 3RLZA 4RYSA 5KSZA 2AWMA 2JQ6A 2LC5A 2AH8A 2FJUB 2H2KA 1DGVA 3CR4X 2K7DA 2AWLA 2LMVA 1YUUA 5HGEA 1YR5A 3SG4A 1IIOA 3AKOA 1WY9A 4P5OE 4IL1A 2WHSA 1EMMA 3DVKA 4TZGA 2IS9A 3SVDA 2DOQA 1OXFA 4Z4MA 5AERA 1EMLA 4DXNA 3UFZA 5AANA 2PALA 4XOWA 2LP2A 4W6AA 5EBJA 2L2CA 4PHMA 2YFPA 4AQJA 2GV5A 4LJBA 1FW4A 5FVIA 2K7BA 1SSEB 1CLLA 3ADFA 3VB1A 4Q9WA 4EDOA 1NX2A 1KFXS 3QRXA 2WURA 4YGAA 2A50B 1W7JB 2O60A 3D76A 1NCYA 4JFGA 1SMGA 2PRUA 1P28A 2QEVA 1B8RA 2LVIA 3I19A 4ZF3A 1CM1A 4MBEA 4Q04A 3TDZA 5HZUA 4USLA 4OGSA 4YGDB 2RH7A 3IVTA 2H8VA 2BECA 4EULA 3EVPA 1K9KA 3E5VA 1DJZA 3LF4B 1QXPA 5HKZA 1U5IA 3R1OA 2LMUA 4INXA 1TNWA 2JOJA 3BOWA 4W7DA 4PPLA 2QLEA 4W7CA 2WORA 2IE2A 3LVAA 4PPKA 2I94A 1SYMA 2WCKA 3WHUB 1QV1A 4IK3A 2G2BA 2E30A 2QEOA 3U8AA 1XFVO 3SJSA 1KK8C 3U0MA 3TMRA 3AKBA 1UHHA 2G2SB 1K95A 3OSRA 3DYEA 3B6XA 3ST2A 1CDPA 5BPJA 3O4YA 1DF0A 2LM5A 4W6HA 4W7XA 5DKQA 3AKAA 3VK1A 3LF3A 1X02A 3AI4A 3JTDB 2FL1A 3PIBA 3EVVA 3TZ1A 4AR7A 4R6DA 3JVTB 2LUXA 3D77A 1CFCA 1QIWA 1EMKA 1OXEA 2I2RE 4ZINA 4W6DA 4LW5A 3DPWA 4P1QA 1K96A 4NDCA 1UHNA 2OS8C 2HCGA 5DICA 2MHHA 2MLFC 1QLKA 1DJWA 1OSAA 3I5HB 5FI7A 3GJ1A 3ICBA 1C3ZA 5HKYA 2L98A 2JWWA 1LINA 3SSLA 1FPWA 1Y1UA 2Z6ZA 5F9GA 2WCJA 4ZF4A 1YUSA 3SS4A 3ED8A 2JT8A 5DY6A 2GGMA 4KW4A 1SL7A 1QY3A 2KI4B 2KQYA 1ZOTB 3S0AA 1Q4EA 2Q91A 3I5IC 2WISA 2HGDA 1CFPA 4W7AA 2O2BA 4PPJA 4YI9A 3LLEA 4IK1A 1A75B 2B3PA 3B7AA 3SV5A 1EMAA 1F8HA 2KFHA 1DJXA 5LTRA 5HZSA 3JTDC 1K8UA 5I2QA 2K2FA 3GEXA 1NWDA 3PN7B 2WHTA 1TUJA 1N0YA 1EL4A 4I5JA 3IQOA 3TDUA 5ER4X 1B7TY 1YVHA 4EMQA 3O78A 2IOVA 3FE9A 2L0PA 1Y1XA 1G33A 1NPQA 3AI5A 1B8CA 4HSZA 2WCEA 3BX9A 2WOSA 4W75A 4C0LA 4OCIA 1H8BA 2KLEA 1OXDA 4HRGA 1QJTA 3I5HC 3O77A 5ER5A 1YZWA 3GK2A 4NQGA 3S0FA 1OZSA 1GGXA 3BUMB 1UWOA 3P28A 4W6PA 4PCWA 3V3DA 2CT9A 4N1FA 1CLBA 4L1IA 2KI4C 3VHTB 4W6NA 1AUIB 4DRWA 4W74A 3BUXB 3PATA 2DUIA 1OMRA 3VGOA 4DXQA 4LJDC 1GFLA 3LA1A 3PN7C 4HQ9A 3NHIA 2HGYA 4NDDA 4CPVA 3SIBA 1R6PA 1Q4BA 1QX5B 1U5IB 1XFXO 2VRGA 4JC2A 3U0NA 4MEWA 4W7FA 3PM8A 3DQ4A 4PE1A 2DUGA 3QMEA 1SRAA 4RTCA 4R1EA 3SG2A 5AXIA 2OTEA 3P8UA 3GJ2A 2M0RA 2JTTA 3AAKA 2L2EA 2IB5A 4XGYA 3CFFA 4P76A 2JXLA 4YGCB 2ZKMX 2FCDA 2VADA 1H4BA 1NP8A 1F55A 3ZUJA 1OOFA 5H87A 1EH2A 3NSLA 2LNKA 4XJKA 1OOGA 1KFUL 2LVJA 1J7OA 1CMFA 4R6BA 2K8MB 3K21A 3N7HA 3DQHA 4INWA 2HQ8A 3PJ5A 3VRNA 1K90D 1HUYA 3DQCA 1OW4A 3DPZA 2F8PA 5G08A 3BQ3A 4H3NA 1KK7Y 3CFAA 3Q8IA 2A46A 3V2LA 1S1EA 1CDLA 3PJBA 4Z4KA 5HLVA 4OR9B 2JNXA 2PYQA 3LVDA 4W6OA 2V4EB 1RJVA 3B87A 1SPYA 1MWNA 3WNXB 4DKMA 3DQUA 1NIWA 2L5XB 3DQ9A 1LKJA 4U8DA 2LHIA 3GK4X 3HX4A 4FQTA 3DQFA 4W76A 2BCAA 1Q4DA 1EMGA 1A29A 1TIZA 2WNDA 1RROA 3D73A 4J88A 1MF8B 3FWCA 2ZRSA 2F3ZA 3ZNIA 1UURA 2A53B 4B30B 3E3RA 4GGNA 1C7WA 3OB1B 5DTXA 3B88A 3K1KA 1CDMA 1PK0D 4PHJA 2K0JA 3EKJA 1DT7B 1PULA 1DMOA 1Q80A 4Q7UA 3E5TA 2HQWA 4IJ7A 2EMOA 3SS5A 2DD9A 1KFUS 2KOTA 2CXJA 4MLWA 1XA5A 1DTLA 1UHIA 5DKRA 2KI6D 2M97A 3H1OA 4MZLA 5DTYA 1YHIA 3K1EA 4ZCVA 5HLOA 2KGBC 1TRFA 3WHTB 3SG6A 3ZUFA 2HF5A 1HT9A 1QTXA 2QEHA 3SVUA 3DQ6A 3DQAA 4CFQA 1VRKA 2KFGA 2LE9B 1YHGA 1OOJA 3KF9A 1NYAA 5AEQA 1YHHA 2QLGB 1S26D 2JT0A 3CD1A 1K94A 4NDBA 1JBAA 4DXOA 1ZFSA 1A75A 4LJDA 2WCBA 4N1GA 4OHSA 1OOHA 4DXIA 4GPLB 4MRXA 3D0YB 1EG3A 5EB7A 1QYOA 4F7FA 3S05A 2F2OA 1K2HA 3SVCA 2KSPA 4KW8A 2G9BA 4JGEA 2M29A 2D8NA 1Y0VH 4KA9A 4L13A 4H3LA 4YBHB 1G7KA 2ZNDA 5EXBA 4ORBB 3EK4A 2DDCA 2G3OA 3CZ0A 1MXLC 2Z6YA 2OGRA 2JTZA 5BTTB 1E8AA 2YDZA 1IGVA 2OKYA 1JUOA 3R1VA 5EB6A 3TS5C 1KK8B 2Z6XA 3E5WA 5DPGA 3EVRA 4XJKB 1JC2A 2QU1A 1JF0A 3VHTA 2FCEA 3CABA 1NSHA 4KW9A 1XFWO 3DQJA 3WXAA 3U8CA 1GGWA 1S6IA 2QPTA 2JULA 2RGIA 1S5GY 1OOIX 3KEVA 4JF9A 1KSMA 4OZDA 3UO9A 3SSYA 1T14A 2CNPA 4M2PA 4W6JA 5EXCI 5DRGA 1F0BA 4PALA 1L7ZA 1XYDA 4E68A 3IQQA 1IH0A 5I2LA 4HVFA 4LQUA 4W6LA 2OS8B 5EXUA 2KNEA 2F33A 4H3MA 2BCBA 2LVVA 1QX7A 5DPIA 3EG5B 5KTYA 4XOVA 2ZRTA 3ZTFA 1NX3A 1BOCA 4EDSA 1TNPA 4W6RA 3DQNA 1FI6A 2QACA 2L51A 1B9AA 1TTXA 4KYNA 2H5OA 2GTEA 2Y0GA 4QJ3B 5TNCA 2G6EA 1SK6D 1EMEA 2BTJA 2KYFA 3KO0A 2EMDA 3EK8A 2JNFA 3I5IB 1M31A 4KAGA 2AAOA 2Y5IA 1XAEA 1XFYO 1J1DA 4GBAA 5JOLA 3FE6A 1YFPA 2LP3A 3DQ5A 4UTSA 1LS8A 3NSIA 5FVGA 1YJ2A 4DCKA 3BUNB 1XK4C 1RWYA 4PDZA 5HW9A 4EN1A 4QJ5B 1A2XA 2HETA 4JWQA 1XFZO 3KCTA 2ICRA 2SASA 3SSKA 1XMZA 5EHUA 1DEKA 2Y1NA 4ORCB 2VAEA 2SCPA 1BT6A 3SIAA 1G8IA 2PXWA 2V4EA 5FI6A 2H8QA 1JFJA 1C7VA 1DJYA 2YGUA 4C0KA 3PFVA 4W6SA 1CFDA 4LQTA 2ZMWA 3VRRA 1QV0A 1LXFC 1M39A 1QS7A 1PALA 5FHVA 1IKUA 2P6BB 3SS0A 1Z1QA 4OVNF 1F54A 1PVBA 3PJ7A 1A4PA 2KAVA 1TOPA 4W6UA 1KQMB 5EJUA 1PSBA 1GJYA 4ICBA 2A47A 3PM2A 1M45A 2AWJA 1ALVA 1Z1PA 5D69A 2BL0B 1BLQA 1JC1A 4B30A 5I8NA 3NEZA 1GQMA 1B7TZ 2KYCA 2NCOA 3DQLA 3DQIA 3BUOB 4DXMA 2MRDA 1MUXA 2H61C 4KEXA 3NXAA 3SVBA 1ZMZA 4D1EA 4YI8A 3KHEA 3DQKA 4KGEA 3M0WA 2H5RA 1MHOA 2KQ6A 1IQ5A 3CGAA 3OSQA 4W6IA 1TCFA 2PQLA 3KCSA 2LLSA 4W6MA 1J7RA 4OJ0A 4JKTA 3TUYB 1G4YR 1RMMA 5FVFA 5FI2A 1F70A 4XYNA 1MYWA 1KQMC 1V1FA 2GGZA 4ETOA 4N5XA 2EC6B 1XA9A 2QLGA 2WSNA 4IK9A 3PLFB 1DJIA 1YX7A 4CFRA 4W6TA 2BL0C 4F0ZB 4PFEA 2O5GA 3D0YA 1R2UA 2VVIA 4HREE 3GB3A 2L5YA 4J89A 2OJKA 3DQ1A 4QJ4B 5HZTA 3DF0B 4GNKB 2L4IA 1MOUA 1QWVA 2MAZA 1OE9B 1K93D 2KFFA 1IWQA 2JRFA 5JJGA 2WIQA 2OTGB 2GX2A 1BF5A 4U2VA 1YX8A 1XVJA 2EHBA 3SG5A 3IF7A 2E6WA 5B8IB 4GOBA 1WLMA 1DJGA 2KDHA 4GFTA 5BTTA 2M49B 2PXSA 3TUYC 1EMCA 1Q4CA 2M1UA 5CPVA 1YUTA 1CFFA 2KBIA 4PE4A 2EC6C 3U0LA 3WLDA 2O24A 3SVRA 5I94A 5J3XA 2JPTA 3LK1A 3CBEA 5CSJA 1KK7Z 1XQMA 3PSRA 1W7IB 1UHKA 1XK4A 2Q57A 3CZ1A 2QDIA 3M22A 2LV7A 1DELA 1C4FA 5LTQA 2YE0A 3EK7A 1S36A 3FS7A 3DQ3A 3L4AA 2AMIA 4KGFA 4WRIA 3CZ2A 1S6JA 2OTGC 1AVSA 2BE4A 2HJOA 2BNXA 1SL9A 4BY5A 5AFPA 4I5KA 2G6YA 3SG7A 3S0DA 2QEBA 2OPOA 1KWOB 2B3QA 1PRWA 1QATA 3OB2B 3DVJA 2JPOA 4KF5C 3BFBA 3S0EA 2I18A 2M3WA 1YURA 2WC5A 2FWQA 2VVJA 2IB6A 5BQLA 4MSPA 3H4SE 4HRHA 3NEDA 3W1CA 2WSOA 4ZF5A 2Z1OA 1KQVA 3DQ8A 4JQ0D 3G9AA 1NCXA 1W9ZA 1S6CA 1CV7A 1OMVA 1QX2A 5DTZA 2KI6C 1W7SA 1JBYA 4AS8A 1GGZA 1LA3A 3DD4A 3GK1A 2L4HA 3DQDA 3OBVA 1RECA 1TCOB 5K89A 4C0JA 1IQ3A 5H88A 2FJYA 1QXTA 3LK0A 2K7OA 4RYWA 1UUSA 4Q7RA 2H61A 3DQMA 2VZXA 1DVIA 2OTBA 1SW8A 3MGFA 1S6ZA 1ZUXA 1JWDA 1QYFA 1JC0A 3CR5X 2FZUA 3DVMA 1M46A 1N2DA 2M8UA 4M2QA 1KWOC 2JU0A 4N3DA 4ORAB 3NF0A 1BR4B 1H6RA 4BDUA 2KAYA 2LLTA 4KF4A 3DPXA 1DC1A 1M63B 4GGFC 4YGBB 3TS5B 2YE1A 3UG0A 4DKNA 4I5NB 4YRUA 1UHJA 3DVEA 1DGUA 3WLCA 2R2IA 1B47A 3OGNA 3U0KA 2FOTA 1TNQA 1AHRA 2M7NA 3HCMA 2G3DB 2H5QA 3GL4A 3SSPA 1B8LA 2KLDA 2ZNEA 3FWBA 3BJHA 5FYXA 1OZOA 1B9CA 4W6KA 2GX0A 1J7PA 4HQ8A 1KSOA 2EMNA 1SR6B 1Q4AA 3WCKA 3S0GA 1KYSA 2JADA 4JRBA 5CSIA 4WQ3A 4W77A 1ZGOA 4MZJA 4W6BA 3IR8A 4J8AA 5DPJA 1CKKA 1J1EA 5DKNA 3S0BA 2NXQA 1WDCB 1S3PA 1NX1A 4ZIOA 3O4XA 2P70A 2Y4QA 1QASA 3LS3A 2CBLA 3LVCA 2LHLA 1UP5A 3PJIA 1JBZA 1S5GZ 4HE4A 2KAXA 4GAOA 3LSAA 5DQBA 3W1DA 5DTLA 1JSAA 2JT3A 3DQ7A 3EVUA 3KPXA 3A4UB 2BAPA 2H9WA 2B1UA 1W7UA 1NUBA 2KBMA 3BYAA 1CLMA 3FE8A 2O29A 2M1KB 3VICA 2F2PA 2C9JA 3DF0A 1RM9A 1XO5A 4W72A 2ZFDA 3M24A 1SY9A 2WCMA 5I2OA 1SR6C 3OHMB 3C1VA 1GM0A 1J55A 1WRKA 2ISDA 4CIDA 2Y1MA 2PMYA 1MOVA 2DUFA 4W73A 3DZTA 3MSEB 2NCPA 2Q6PA 4NWSA 2LANA 3VROA 5HBDA 3D10A 4IK5A 2QRFA 4PHKA 4H47A 3NHTA 1YRTB 4KF5A 2K7CA 1WDCC 3TMTA 3DQEA 3RM1A 5LK4A 1MR8A 4W6FA 2KPHA 1RTP1 1DJHA 1ZGPA 1NX0A 3O2PA 1ZGQA 4DXPA 2VVHA 1EG4A 3RWAA 4L12A 1FBVA 4MZKA 2MA2A 3CB9A 4IK4A 1F09A 1AP4A 1CTRA 4DUQA 1V1GA 2LCPA 1CDNA 2HQZA 1ALWA 1KYRA 3A8SA 3CGLA 3CD9A 1C07A 4OKHA 4XVPA 4P2YB 3BXCA 2HQKA 2BE6A 2AUCA 2QT2A 2A56B 3U8PA 4A4CA 3CFHA 4ZB1A 1BG1A 2I7AA 3H1RA 5D7FA 1CM4A 4GF6B 1NCZA 2C9IA 4MN0A 3L4LA 1YTZC 2POXA 1MQ1A 2BBNA 1B1GA 4OV2A 1F4QA 2BCXA 4L9MA 2A4JA 1J7QA 5DQMA 4GGFA 3SVSA 3BFHA 3NSKA 4AQIA 3R1PA 4CLNA 1C3YA 3NGVA 5H89A 3ST3A 1CMGA 2G6XA 1L2OB 1FI5A 2WCLA 2F3YA 3LCPC 5CSNA 3B86A 4DIRA 4Q9XA 1QIVA 1WRZA 1SBJA 2OKWA 3BXBA 5HKWA 1HQVA 1YVLA 3OX6A 3SVEA 1AJ5A 2LLUA 3LL8B 1IRJA 1DQEA 1CNPA 4IZNA 1ORGA 3RZSA 1TUZA
chains in the Genus database with same CATH topology
4I2YA 3OGOA 3JVTC 2JZIA 3ST4A 2ARLA 2MJWB 1LA0A 4PE0A 1WLZA 3DQ2A 2HPSA 1ODBA 1Y6WA 2A52B 3ST0A 4W7RA 5AQBB 2PVBA 3VRPA 1IJ5A 2EGDA 2MLEC 2GW3A 4OQWA 1EMBA 3BXAA 1SNLA 1QLSA 1TNXA 3F45A 1SCMB 4YGEB 3SG3A 5GQQC 1EXRA 3AAJA 2ZO7A 4PE7A 3A8RA 2A54B 3GOFA 1L2OC 5F6TA 3O6BA 2BKIB 2NZ0A 2ZN9A 4MVFA 1XFUO 4W6CA 1F71A 1YJFA 5J2OA 1TN4A 2A48A 1W7TA 1EJ3A 4GUKA 3I5GB 3FIAA 3IP2A 3CTNA 4TZAA 2KHNA 4OY4A 2BKHB 2CTNA 1RFJA 4ORNA 1CB1A 4B5YA 5DRFA 5KTGA 1BMOA 2JC2A 3BOWB 1EMFA 4I5LB 3CR2A 1B4CA 1SCVA 1D1OA 3NSOA 3CS1A 4W7EA 1IJ6A 1SCMC 4BY4A 2HPWA 4MRYA 5BT0A 4KPIA 5LTPA 3RWTA 1OMDA 4FQOA 1N65A 2ZO6A 2K61A 1FF1A 3OP0A 1K9UA 2AHAA 2ZN8A 1RRXA 2QLHA 2COLB 1LVCD 4IK8A 3I5FB 1JFKA 2DD7A 3I5GC 3VRQA 1DF0B 2V53A 1JF2A 1K9PA 1PVAA 1MXEA 3PALA 3SSTA 4XL5A 1KYPA 5HYDA 1H4UA 2BBMA 4AOMA 2LVKA 2WC8A 3CLNA 1ZUZA 4GESB 2AWKA 1BJFA 2HFCA 1BFPA 2H5PA 2TN4A 1RMPA 5DPHA 2K2AA 4JPZB 3NT3A 3SRYA 4W6GA 3CWGA 2G16B 4LJCA 4ANJA 3ZWHA 5IBWA 1Q73A 3SVOA 2NLNA 1AK8A 1UISA 2QZ0A 3NT9A 3BUWB 1HCJA 4ZFSA 2H6VA 1SL8A 1YRUB 3OX5A 3BXKA 5PALA 2QLIA 2LAPA 3SVNA 2DUHA 2M7LA 3I5FC 1AJ4A 2WCFA 2PASA 1RMOA 4H48A 4ZBLA 3ZULA 1BODA 5HZOA 2G5ZB 2DDDA 2DUEA 4Q7TA 2KGRA 1KCYA 4FTGA 2HRSA 4UPGA 2L50A 5T3IA 1Y1AA 1PSRA 2MBXA 5KU1A 3EKHA 1KFXL 4A4BA 3DQOA 1A03A 2PSRA 2P4MA 2M9GA 1RK9A 2LUCA 1IG5A 3CZTX 4DS7A 2V4EC 4PHNA 1XSSA 2Q4UA 2JXCA 4JEOA 5DU0A 3TDIA 1BU3A 2ZMUA 1BR1B 2CCMA 1F4OA 4HQCA 3SSHA 1SKTA 1QYQA 4ZCUA 4M2OA 1GL4A 2GW4B 1OQPA 2LMTA 3SSVA 1ZACA 1QVIZ 1WRLA 4TNCA 5CSFA 2WHUA 4W69A 1QVIY 4WQ2A 1KP5A 3RLZA 4RYSA 5KSZA 2AWMA 2JQ6A 2LC5A 2AH8A 2FJUB 2H2KA 1DGVA 3CR4X 2K7DA 2AWLA 2LMVA 1YUUA 5HGEA 1YR5A 3SG4A 3AKOA 1WY9A 4P5OE 4IL1A 2WHSA 1EMMA 3DVKA 4TZGA 2IS9A 3SVDA 2DOQA 1OXFA 4Z4MA 5AERA 1EMLA 4DXNA 3UFZA 5AANA 2PALA 4XOWA 2LP2A 4W6AA 5EBJA 4PHMA 2YFPA 4AQJA 2GV5A 4LJBA 1FW4A 5FVIA 2K7BA 1CLLA 3ADFA 4Q9WA 4EDOA 1NX2A 1KFXS 3QRXA 2WURA 4YGAA 2A50B 1W7JB 2O60A 1NCYA 4JFGA 1SMGA 2PRUA 1B8RA 2LVIA 3I19A 4ZF3A 1CM1A 4MBEA 4Q04A 3TDZA 5HZUA 4USLA 4OGSA 4YGDB 2RH7A 2BECA 4EULA 3EVPA 1K9KA 3E5VA 1DJZA 3LF4B 1QXPA 5HKZA 1U5IA 2LMUA 1TNWA 2JOJA 3BOWA 4W7DA 4PPLA 2QLEA 4W7CA 2WORA 2IE2A 3LVAA 4PPKA 2I94A 1SYMA 3WHUB 1QV1A 4IK3A 2G2BA 2E30A 3U8AA 1XFVO 3SJSA 1KK8C 3U0MA 3TMRA 3AKBA 1UHHA 2G2SB 1K95A 3OSRA 3ST2A 1CDPA 5BPJA 3O4YA 1DF0A 2LM5A 4W6HA 4W7XA 5DKQA 3AKAA 3VK1A 3LF3A 1X02A 3AI4A 3JTDB 2FL1A 3PIBA 3EVVA 3TZ1A 4AR7A 4R6DA 3JVTB 2LUXA 1CFCA 1QIWA 1EMKA 1OXEA 2I2RE 4ZINA 4W6DA 4LW5A 3DPWA 4P1QA 1K96A 4NDCA 1UHNA 2OS8C 2HCGA 2MHHA 2MLFC 1QLKA 1DJWA 1OSAA 3I5HB 3GJ1A 3ICBA 5HKYA 2L98A 2JWWA 1LINA 3SSLA 1FPWA 1Y1UA 2Z6ZA 5F9GA 4ZF4A 1YUSA 3ED8A 2JT8A 5DY6A 2GGMA 4KW4A 1SL7A 1QY3A 2KI4B 2KQYA 1ZOTB 1Q4EA 2Q91A 3I5IC 2WISA 2HGDA 1CFPA 4W7AA 2O2BA 4PPJA 4YI9A 3LLEA 4IK1A 1A75B 2B3PA 3SV5A 1EMAA 1F8HA 2KFHA 1DJXA 5LTRA 5HZSA 3JTDC 1K8UA 5I2QA 2K2FA 3GEXA 1NWDA 3PN7B 2WHTA 1N0YA 1EL4A 4I5JA 3IQOA 3TDUA 5ER4X 1B7TY 1YVHA 4EMQA 3O78A 2IOVA 2L0PA 1Y1XA 1G33A 1NPQA 3AI5A 1B8CA 4HSZA 2WCEA 3BX9A 2WOSA 4W75A 4C0LA 4OCIA 1H8BA 1OXDA 4HRGA 1QJTA 3I5HC 3O77A 5ER5A 1YZWA 3GK2A 4NQGA 1OZSA 1GGXA 3BUMB 1UWOA 3P28A 4W6PA 4PCWA 3V3DA 2CT9A 4N1FA 1CLBA 4L1IA 2KI4C 3VHTB 4W6NA 1AUIB 4DRWA 4W74A 3BUXB 3PATA 2DUIA 1OMRA 3VGOA 4DXQA 4LJDC 1GFLA 3LA1A 3PN7C 4HQ9A 2HGYA 4NDDA 4CPVA 3SIBA 1R6PA 1Q4BA 1QX5B 1U5IB 1XFXO 2VRGA 4JC2A 3U0NA 4MEWA 4W7FA 3PM8A 3DQ4A 4PE1A 2DUGA 1SRAA 4RTCA 4R1EA 3SG2A 5AXIA 2OTEA 3P8UA 3GJ2A 2M0RA 2JTTA 3AAKA 2L2EA 2IB5A 4XGYA 3CFFA 4P76A 2JXLA 4YGCB 2ZKMX 2FCDA 2VADA 1H4BA 1NP8A 1F55A 3ZUJA 5H87A 1EH2A 3NSLA 2LNKA 4XJKA 1KFUL 2LVJA 1J7OA 1CMFA 4R6BA 2K8MB 3K21A 3DQHA 2HQ8A 3PJ5A 3VRNA 1K90D 1HUYA 3DQCA 3DPZA 2F8PA 5G08A 3BQ3A 4H3NA 1KK7Y 3CFAA 2A46A 1S1EA 1CDLA 3PJBA 4Z4KA 5HLVA 4OR9B 2JNXA 3LVDA 4W6OA 2V4EB 1RJVA 1SPYA 1MWNA 3WNXB 4DKMA 3DQUA 1NIWA 2L5XB 3DQ9A 1LKJA 4U8DA 2LHIA 3GK4X 3HX4A 3DQFA 4W76A 2BCAA 1Q4DA 1EMGA 1A29A 1TIZA 2WNDA 1RROA 4J88A 1MF8B 3FWCA 2ZRSA 2F3ZA 3ZNIA 1UURA 2A53B 4B30B 3E3RA 4GGNA 1C7WA 3OB1B 5DTXA 3K1KA 1CDMA 1PK0D 4PHJA 2K0JA 3EKJA 1DT7B 1PULA 1DMOA 1Q80A 4Q7UA 3E5TA 2HQWA 2EMOA 2DD9A 1KFUS 2KOTA 2CXJA 4MLWA 1XA5A 1DTLA 1UHIA 5DKRA 2KI6D 2M97A 3H1OA 4MZLA 5DTYA 1YHIA 4ZCVA 5HLOA 2KGBC 1TRFA 3WHTB 3SG6A 3ZUFA 2HF5A 1HT9A 1QTXA 3SVUA 3DQ6A 3DQAA 4CFQA 1VRKA 2KFGA 2LE9B 1YHGA 1OOJA 3KF9A 1NYAA 5AEQA 1YHHA 2QLGB 1S26D 2JT0A 3CD1A 1K94A 4NDBA 1JBAA 4DXOA 1ZFSA 1A75A 4LJDA 2WCBA 4N1GA 4OHSA 4DXIA 4GPLB 4MRXA 3D0YB 1EG3A 5EB7A 1QYOA 3S05A 2F2OA 1K2HA 3SVCA 2KSPA 4KW8A 2G9BA 4JGEA 2M29A 2D8NA 1Y0VH 4KA9A 4L13A 4H3LA 4YBHB 1G7KA 2ZNDA 5EXBA 4ORBB 3EK4A 2DDCA 2G3OA 1MXLC 2Z6YA 2OGRA 2JTZA 5BTTB 1E8AA 2YDZA 1IGVA 2OKYA 1JUOA 5EB6A 3TS5C 1KK8B 2Z6XA 3E5WA 5DPGA 3EVRA 4XJKB 1JC2A 2QU1A 1JF0A 3VHTA 2FCEA 1NSHA 4KW9A 1XFWO 3DQJA 3WXAA 3U8CA 1GGWA 1S6IA 2QPTA 2JULA 2RGIA 1S5GY 3KEVA 4JF9A 1KSMA 3SSYA 2CNPA 4M2PA 4W6JA 5EXCI 5DRGA 1F0BA 4PALA 1L7ZA 1XYDA 4E68A 3IQQA 1IH0A 5I2LA 4HVFA 4LQUA 4W6LA 2OS8B 5EXUA 2KNEA 2F33A 4H3MA 2BCBA 2LVVA 1QX7A 5DPIA 5KTYA 4XOVA 2ZRTA 3ZTFA 1NX3A 1BOCA 4EDSA 1TNPA 4W6RA 3DQNA 1FI6A 2QACA 2L51A 1B9AA 1TTXA 2H5OA 2Y0GA 4QJ3B 5TNCA 2G6EA 1SK6D 1EMEA 2BTJA 2KYFA 3KO0A 2EMDA 3EK8A 2JNFA 3I5IB 1M31A 4KAGA 2AAOA 2Y5IA 1XAEA 1XFYO 1J1DA 4GBAA 5JOLA 1YFPA 2LP3A 3DQ5A 4UTSA 3NSIA 5FVGA 1YJ2A 4DCKA 3BUNB 1XK4C 1RWYA 4PDZA 5HW9A 4EN1A 4QJ5B 1A2XA 2HETA 4JWQA 1XFZO 3KCTA 2ICRA 2SASA 3SSKA 1XMZA 5EHUA 2Y1NA 4ORCB 2VAEA 2SCPA 1BT6A 3SIAA 1G8IA 2PXWA 2V4EA 2H8QA 1JFJA 1C7VA 1DJYA 4C0KA 3PFVA 4W6SA 1CFDA 4LQTA 2ZMWA 3VRRA 1QV0A 1LXFC 1M39A 1QS7A 1PALA 5FHVA 1IKUA 2P6BB 3SS0A 1Z1QA 4OVNF 1F54A 1PVBA 3PJ7A 1A4PA 2KAVA 1TOPA 4W6UA 1KQMB 5EJUA 1PSBA 1GJYA 4ICBA 2A47A 1M45A 2AWJA 1ALVA 1Z1PA 5D69A 2BL0B 1BLQA 1JC1A 4B30A 5I8NA 3NEZA 1GQMA 1B7TZ 2KYCA 2NCOA 3DQLA 3DQIA 3BUOB 4DXMA 2MRDA 1MUXA 2H61C 4KEXA 3NXAA 3SVBA 1ZMZA 4D1EA 4YI8A 3KHEA 3DQKA 4KGEA 3M0WA 2H5RA 1MHOA 2KQ6A 1IQ5A 3CGAA 3OSQA 4W6IA 1TCFA 3KCSA 2LLSA 4W6MA 1J7RA 4OJ0A 3TUYB 1G4YR 1RMMA 5FVFA 1F70A 4XYNA 1MYWA 1KQMC 1V1FA 2GGZA 4ETOA 4N5XA 2EC6B 1XA9A 2QLGA 2WSNA 4IK9A 3PLFB 1DJIA 1YX7A 4CFRA 4W6TA 2BL0C 4F0ZB 4PFEA 2O5GA 3D0YA 1R2UA 2VVIA 4HREE 3GB3A 4J89A 2OJKA 3DQ1A 4QJ4B 5HZTA 3DF0B 4GNKB 2L4IA 1MOUA 2MAZA 1OE9B 1K93D 2KFFA 1IWQA 2JRFA 5JJGA 2WIQA 2OTGB 2GX2A 1BF5A 4U2VA 1YX8A 1XVJA 2EHBA 3SG5A 3IF7A 2E6WA 5B8IB 4GOBA 1WLMA 1DJGA 2KDHA 4GFTA 5BTTA 2M49B 2PXSA 3TUYC 1EMCA 1Q4CA 2M1UA 5CPVA 1YUTA 1CFFA 2KBIA 4PE4A 2EC6C 3U0LA 3WLDA 2O24A 3SVRA 5J3XA 2JPTA 3LK1A 3CBEA 5CSJA 1KK7Z 1XQMA 3PSRA 1W7IB 1UHKA 1XK4A 2Q57A 3M22A 2LV7A 1C4FA 5LTQA 2YE0A 3EK7A 1S36A 3FS7A 3DQ3A 2AMIA 4KGFA 4WRIA 1S6JA 2OTGC 1AVSA 2BE4A 2HJOA 1SL9A 4BY5A 5AFPA 4I5KA 2G6YA 3SG7A 2OPOA 1KWOB 2B3QA 1PRWA 1QATA 3OB2B 3DVJA 4KF5C 2I18A 2M3WA 1YURA 2FWQA 2VVJA 2IB6A 5BQLA 4MSPA 3H4SE 4HRHA 3NEDA 3W1CA 2WSOA 4ZF5A 2Z1OA 1KQVA 3DQ8A 4JQ0D 3G9AA 1NCXA 1S6CA 1CV7A 1OMVA 1QX2A 5DTZA 2KI6C 1W7SA 1JBYA 4AS8A 1GGZA 1LA3A 3DD4A 3GK1A 2L4HA 3DQDA 1RECA 1TCOB 5K89A 4C0JA 1IQ3A 5H88A 1QXTA 3LK0A 2K7OA 4RYWA 1UUSA 4Q7RA 2H61A 3DQMA 2VZXA 1DVIA 2OTBA 1SW8A 3MGFA 1S6ZA 1ZUXA 1JWDA 1QYFA 1JC0A 3CR5X 2FZUA 3DVMA 1M46A 1N2DA 2M8UA 4M2QA 1KWOC 2JU0A 4N3DA 4ORAB 3NF0A 1BR4B 1H6RA 4BDUA 2KAYA 2LLTA 4KF4A 3DPXA 1M63B 4GGFC 4YGBB 3TS5B 2YE1A 3UG0A 4DKNA 4I5NB 4YRUA 1UHJA 3DVEA 1DGUA 3WLCA 2R2IA 1B47A 3U0KA 2FOTA 1TNQA 1AHRA 2M7NA 3HCMA 2G3DB 2H5QA 3GL4A 3SSPA 1B8LA 2ZNEA 3FWBA 5FYXA 1OZOA 1B9CA 4W6KA 2GX0A 1J7PA 4HQ8A 1KSOA 2EMNA 1SR6B 1Q4AA 3WCKA 1KYSA 2JADA 4JRBA 5CSIA 4WQ3A 4W77A 1ZGOA 4MZJA 4W6BA 3IR8A 4J8AA 5DPJA 1CKKA 1J1EA 5DKNA 2NXQA 1WDCB 1S3PA 1NX1A 4ZIOA 2Y4QA 1QASA 3LS3A 2CBLA 3LVCA 2LHLA 1UP5A 1JBZA 1S5GZ 4HE4A 2KAXA 4GAOA 3LSAA 5DQBA 3W1DA 5DTLA 1JSAA 2JT3A 3DQ7A 3EVUA 3KPXA 3A4UB 2H9WA 2B1UA 1W7UA 1NUBA 2KBMA 3BYAA 1CLMA 2O29A 2M1KB 3VICA 2F2PA 2C9JA 3DF0A 1RM9A 1XO5A 4W72A 2ZFDA 3M24A 1SY9A 5I2OA 1SR6C 3OHMB 3C1VA 1J55A 1WRKA 2ISDA 4CIDA 2Y1MA 2PMYA 1MOVA 2DUFA 4W73A 3MSEB 2NCPA 2Q6PA 4NWSA 2LANA 3VROA 5HBDA 3D10A 4IK5A 2QRFA 4PHKA 4H47A 1YRTB 4KF5A 2K7CA 1WDCC 3TMTA 3DQEA 3RM1A 5LK4A 1MR8A 4W6FA 1RTP1 1DJHA 1ZGPA 1NX0A 3O2PA 1ZGQA 4DXPA 2VVHA 1EG4A 3RWAA 4L12A 1FBVA 4MZKA 2MA2A 3CB9A 4IK4A 1F09A 1AP4A 1CTRA 4DUQA 1V1GA 2LCPA 1CDNA 2HQZA 1ALWA 1KYRA 3A8SA 3CGLA 3CD9A 1C07A 4OKHA 4XVPA 4P2YB 3BXCA 2HQKA 2BE6A 2AUCA 2QT2A 2A56B 3U8PA 4A4CA 3CFHA 4ZB1A 1BG1A 2I7AA 3H1RA 5D7FA 1CM4A 4GF6B 1NCZA 2C9IA 4MN0A 1YTZC 2POXA 1MQ1A 2BBNA 1B1GA 4OV2A 1F4QA 2BCXA 4L9MA 2A4JA 1J7QA 5DQMA 4GGFA 3SVSA 4AQIA 3NSKA 4CLNA 5H89A 3ST3A 1CMGA 2G6XA 1L2OB 1FI5A 2F3YA 3LCPC 5CSNA 4DIRA 4Q9XA 1QIVA 1WRZA 1SBJA 2OKWA 3BXBA 5HKWA 1HQVA 1YVLA 3OX6A 3SVEA 1AJ5A 2LLUA 3LL8B 1IRJA 4IZNA 1CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2Y A;  3OGO A;  3JVT C;  2JZI A;  3ST4 A;  2ARL A;  2MJW B;  1LA0 A;  4PE0 A;  1WLZ A;  3DQ2 A;  2HPS A;  1ODB A;  1Y6W A;  2A52 B;  3ST0 A;  4W7R A;  5AQB B;  2PVB A;  3VRP A;  1IJ5 A;  2EGD A;  2MLE C;  2GW3 A;  4OQW A;  1EMB A;  3BXA A;  1SNL A;  1QLS A;  1TNX A;  3F45 A;  1SCM B;  4YGE B;  3SG3 A;  5GQQ C;  1EXR A;  3AAJ A;  2ZO7 A;  4PE7 A;  3A8R A;  2A54 B;  3GOF A;  1L2O C;  5F6T A;  3O6B A;  2BKI B;  2NZ0 A;  2ZN9 A;  4MVF A;  1XFU O;  4W6C A;  1F71 A;  1YJF A;  5J2O A;  1TN4 A;  2A48 A;  1W7T A;  1EJ3 A;  4GUK A;  3I5G B;  3FIA A;  3IP2 A;  3CTN A;  4TZA A;  2KHN A;  4OY4 A;  2BKH B;  2CTN A;  1RFJ A;  4ORN A;  1CB1 A;  4B5Y A;  5DRF A;  5KTG A;  1BMO A;  2JC2 A;  3BOW B;  1EMF A;  4I5L B;  3CR2 A;  1B4C A;  1SCV A;  1D1O A;  3NSO A;  3CS1 A;  4W7E A;  1IJ6 A;  1SCM C;  4BY4 A;  2HPW A;  4MRY A;  5BT0 A;  4KPI A;  5LTP A;  3RWT A;  1OMD A;  4FQO A;  1N65 A;  2ZO6 A;  2K61 A;  1FF1 A;  3OP0 A;  1K9U A;  2AHA A;  2ZN8 A;  1RRX A;  2QLH A;  2COL B;  1LVC D;  4IK8 A;  3I5F B;  1JFK A;  2DD7 A;  3I5G C;  3VRQ A;  1DF0 B;  2V53 A;  1JF2 A;  1K9P A;  1PVA A;  1MXE A;  3PAL A;  3SST A;  4XL5 A;  1KYP A;  5HYD A;  1H4U A;  2BBM A;  4AOM A;  2LVK A;  2WC8 A;  3CLN A;  1ZUZ A;  4GES B;  2AWK A;  1BJF A;  2HFC A;  1BFP A;  2H5P A;  2TN4 A;  1RMP A;  5DPH A;  2K2A A;  4JPZ B;  3NT3 A;  3SRY A;  4W6G A;  3CWG A;  2G16 B;  4LJC A;  4ANJ A;  3ZWH A;  5IBW A;  1Q73 A;  3SVO A;  2NLN A;  1AK8 A;  1UIS A;  2QZ0 A;  3NT9 A;  3BUW B;  1HCJ A;  4ZFS A;  2H6V A;  1SL8 A;  1YRU B;  3OX5 A;  3BXK A;  5PAL A;  2QLI A;  2LAP A;  3SVN A;  2DUH A;  2M7L A;  3I5F C;  1AJ4 A;  2WCF A;  2PAS A;  1RMO A;  4H48 A;  4ZBL A;  3ZUL A;  1BOD A;  5HZO A;  2G5Z B;  2DDD A;  2DUE A;  4Q7T A;  2KGR A;  1KCY A;  4FTG A;  2HRS A;  4UPG A;  2L50 A;  5T3I A;  1Y1A A;  1PSR A;  2MBX A;  5KU1 A;  3EKH A;  1KFX L;  4A4B A;  3DQO A;  1A03 A;  2PSR A;  2P4M A;  2M9G A;  1RK9 A;  2LUC A;  1IG5 A;  3CZT X;  4DS7 A;  2V4E C;  4PHN A;  1XSS A;  2Q4U A;  2JXC A;  4JEO A;  5DU0 A;  3TDI A;  1BU3 A;  2ZMU A;  1BR1 B;  2CCM A;  1F4O A;  4HQC A;  3SSH A;  1SKT A;  1QYQ A;  4ZCU A;  4M2O A;  1GL4 A;  2GW4 B;  1OQP A;  2LMT A;  3SSV A;  1ZAC A;  1QVI Z;  1WRL A;  4TNC A;  5CSF A;  2WHU A;  4W69 A;  1QVI Y;  4WQ2 A;  1KP5 A;  3RLZ A;  4RYS A;  5KSZ A;  2AWM A;  2JQ6 A;  2LC5 A;  2AH8 A;  2FJU B;  2H2K A;  1DGV A;  3CR4 X;  2K7D A;  2AWL A;  2LMV A;  1YUU A;  5HGE A;  1YR5 A;  3SG4 A;  3AKO A;  1WY9 A;  4P5O E;  4IL1 A;  2WHS A;  1EMM A;  3DVK A;  4TZG A;  2IS9 A;  3SVD A;  2DOQ A;  1OXF A;  4Z4M A;  5AER A;  1EML A;  4DXN A;  3UFZ A;  5AAN A;  2PAL A;  4XOW A;  2LP2 A;  4W6A A;  5EBJ A;  4PHM A;  2YFP A;  4AQJ A;  2GV5 A;  4LJB A;  1FW4 A;  5FVI A;  2K7B A;  1CLL A;  3ADF A;  4Q9W A;  4EDO A;  1NX2 A;  1KFX S;  3QRX A;  2WUR A;  4YGA A;  2A50 B;  1W7J B;  2O60 A;  1NCY A;  4JFG A;  1SMG A;  2PRU A;  1B8R A;  2LVI A;  3I19 A;  4ZF3 A;  1CM1 A;  4MBE A;  4Q04 A;  3TDZ A;  5HZU A;  4USL A;  4OGS A;  4YGD B;  2RH7 A;  2BEC A;  4EUL A;  3EVP A;  1K9K A;  3E5V A;  1DJZ A;  3LF4 B;  1QXP A;  5HKZ A;  1U5I A;  2LMU A;  1TNW A;  2JOJ A;  3BOW A;  4W7D A;  4PPL A;  2QLE A;  4W7C A;  2WOR A;  2IE2 A;  3LVA A;  4PPK A;  2I94 A;  1SYM A;  3WHU B;  1QV1 A;  4IK3 A;  2G2B A;  2E30 A;  3U8A A;  1XFV O;  3SJS A;  1KK8 C;  3U0M A;  3TMR A;  3AKB A;  1UHH A;  2G2S B;  1K95 A;  3OSR A;  3ST2 A;  1CDP A;  5BPJ A;  3O4Y A;  1DF0 A;  2LM5 A;  4W6H A;  4W7X A;  5DKQ A;  3AKA A;  3VK1 A;  3LF3 A;  1X02 A;  3AI4 A;  3JTD B;  2FL1 A;  3PIB A;  3EVV A;  3TZ1 A;  4AR7 A;  4R6D A;  3JVT B;  2LUX A;  1CFC A;  1QIW A;  1EMK A;  1OXE A;  2I2R E;  4ZIN A;  4W6D A;  4LW5 A;  3DPW A;  4P1Q A;  1K96 A;  4NDC A;  1UHN A;  2OS8 C;  2HCG A;  2MHH A;  2MLF C;  1QLK A;  1DJW A;  1OSA A;  3I5H B;  3GJ1 A;  3ICB A;  5HKY A;  2L98 A;  2JWW A;  1LIN A;  3SSL A;  1FPW A;  1Y1U A;  2Z6Z A;  5F9G A;  4ZF4 A;  1YUS A;  3ED8 A;  2JT8 A;  5DY6 A;  2GGM A;  4KW4 A;  1SL7 A;  1QY3 A;  2KI4 B;  2KQY A;  1ZOT B;  1Q4E A;  2Q91 A;  3I5I C;  2WIS A;  2HGD A;  1CFP A;  4W7A A;  2O2B A;  4PPJ A;  4YI9 A;  3LLE A;  4IK1 A;  1A75 B;  2B3P A;  3SV5 A;  1EMA A;  1F8H A;  2KFH A;  1DJX A;  5LTR A;  5HZS A;  3JTD C;  1K8U A;  5I2Q A;  2K2F A;  3GEX A;  1NWD A;  3PN7 B;  2WHT A;  1N0Y A;  1EL4 A;  4I5J A;  3IQO A;  3TDU A;  5ER4 X;  1B7T Y;  1YVH A;  4EMQ A;  3O78 A;  2IOV A;  2L0P A;  1Y1X A;  1G33 A;  1NPQ A;  3AI5 A;  1B8C A;  4HSZ A;  2WCE A;  3BX9 A;  2WOS A;  4W75 A;  4C0L A;  4OCI A;  1H8B A;  1OXD A;  4HRG A;  1QJT A;  3I5H C;  3O77 A;  5ER5 A;  1YZW A;  3GK2 A;  4NQG A;  1OZS A;  1GGX A;  3BUM B;  1UWO A;  3P28 A;  4W6P A;  4PCW A;  3V3D A;  2CT9 A;  4N1F A;  1CLB A;  4L1I A;  2KI4 C;  3VHT B;  4W6N A;  1AUI B;  4DRW A;  4W74 A;  3BUX B;  3PAT A;  2DUI A;  1OMR A;  3VGO A;  4DXQ A;  4LJD C;  1GFL A;  3LA1 A;  3PN7 C;  4HQ9 A;  2HGY A;  4NDD A;  4CPV A;  3SIB A;  1R6P A;  1Q4B A;  1QX5 B;  1U5I B;  1XFX O;  2VRG A;  4JC2 A;  3U0N A;  4MEW A;  4W7F A;  3PM8 A;  3DQ4 A;  4PE1 A;  2DUG A;  1SRA A;  4RTC A;  4R1E A;  3SG2 A;  5AXI A;  2OTE A;  3P8U A;  3GJ2 A;  2M0R A;  2JTT A;  3AAK A;  2L2E A;  2IB5 A;  4XGY A;  3CFF A;  4P76 A;  2JXL A;  4YGC B;  2ZKM X;  2FCD A;  2VAD A;  1H4B A;  1NP8 A;  1F55 A;  3ZUJ A;  5H87 A;  1EH2 A;  3NSL A;  2LNK A;  4XJK A;  1KFU L;  2LVJ A;  1J7O A;  1CMF A;  4R6B A;  2K8M B;  3K21 A;  3DQH A;  2HQ8 A;  3PJ5 A;  3VRN A;  1K90 D;  1HUY A;  3DQC A;  3DPZ A;  2F8P A;  5G08 A;  3BQ3 A;  4H3N A;  1KK7 Y;  3CFA A;  2A46 A;  1S1E A;  1CDL A;  3PJB A;  4Z4K A;  5HLV A;  4OR9 B;  2JNX A;  3LVD A;  4W6O A;  2V4E B;  1RJV A;  1SPY A;  1MWN A;  3WNX B;  4DKM A;  3DQU A;  1NIW A;  2L5X B;  3DQ9 A;  1LKJ A;  4U8D A;  2LHI A;  3GK4 X;  3HX4 A;  3DQF A;  4W76 A;  2BCA A;  1Q4D A;  1EMG A;  1A29 A;  1TIZ A;  2WND A;  1RRO A;  4J88 A;  1MF8 B;  3FWC A;  2ZRS A;  2F3Z A;  3ZNI A;  1UUR A;  2A53 B;  4B30 B;  3E3R A;  4GGN A;  1C7W A;  3OB1 B;  5DTX A;  3K1K A;  1CDM A;  1PK0 D;  4PHJ A;  2K0J A;  3EKJ A;  1DT7 B;  1PUL A;  1DMO A;  1Q80 A;  4Q7U A;  3E5T A;  2HQW A;  2EMO A;  2DD9 A;  1KFU S;  2KOT A;  2CXJ A;  4MLW A;  1XA5 A;  1DTL A;  1UHI A;  5DKR A;  2KI6 D;  2M97 A;  3H1O A;  4MZL A;  5DTY A;  1YHI A;  4ZCV A;  5HLO A;  2KGB C;  1TRF A;  3WHT B;  3SG6 A;  3ZUF A;  2HF5 A;  1HT9 A;  1QTX A;  3SVU A;  3DQ6 A;  3DQA A;  4CFQ A;  1VRK A;  2KFG A;  2LE9 B;  1YHG A;  1OOJ A;  3KF9 A;  1NYA A;  5AEQ A;  1YHH A;  2QLG B;  1S26 D;  2JT0 A;  3CD1 A;  1K94 A;  4NDB A;  1JBA A;  4DXO A;  1ZFS A;  1A75 A;  4LJD A;  2WCB A;  4N1G A;  4OHS A;  4DXI A;  4GPL B;  4MRX A;  3D0Y B;  1EG3 A;  5EB7 A;  1QYO A;  3S05 A;  2F2O A;  1K2H A;  3SVC A;  2KSP A;  4KW8 A;  2G9B A;  4JGE A;  2M29 A;  2D8N A;  1Y0V H;  4KA9 A;  4L13 A;  4H3L A;  4YBH B;  1G7K A;  2ZND A;  5EXB A;  4ORB B;  3EK4 A;  2DDC A;  2G3O A;  1MXL C;  2Z6Y A;  2OGR A;  2JTZ A;  5BTT B;  1E8A A;  2YDZ A;  1IGV A;  2OKY A;  1JUO A;  5EB6 A;  3TS5 C;  1KK8 B;  2Z6X A;  3E5W A;  5DPG A;  3EVR A;  4XJK B;  1JC2 A;  2QU1 A;  1JF0 A;  3VHT A;  2FCE A;  1NSH A;  4KW9 A;  1XFW O;  3DQJ A;  3WXA A;  3U8C A;  1GGW A;  1S6I A;  2QPT A;  2JUL A;  2RGI A;  1S5G Y;  3KEV A;  4JF9 A;  1KSM A;  3SSY A;  2CNP A;  4M2P A;  4W6J A;  5EXC I;  5DRG A;  1F0B A;  4PAL A;  1L7Z A;  1XYD A;  4E68 A;  3IQQ A;  1IH0 A;  5I2L A;  4HVF A;  4LQU A;  4W6L A;  2OS8 B;  5EXU A;  2KNE A;  2F33 A;  4H3M A;  2BCB A;  2LVV A;  1QX7 A;  5DPI A;  5KTY A;  4XOV A;  2ZRT A;  3ZTF A;  1NX3 A;  1BOC A;  4EDS A;  1TNP A;  4W6R A;  3DQN A;  1FI6 A;  2QAC A;  2L51 A;  1B9A A;  1TTX A;  2H5O A;  2Y0G A;  4QJ3 B;  5TNC A;  2G6E A;  1SK6 D;  1EME A;  2BTJ A;  2KYF A;  3KO0 A;  2EMD A;  3EK8 A;  2JNF A;  3I5I B;  1M31 A;  4KAG A;  2AAO A;  2Y5I A;  1XAE A;  1XFY O;  1J1D A;  4GBA A;  5JOL A;  1YFP A;  2LP3 A;  3DQ5 A;  4UTS A;  3NSI A;  5FVG A;  1YJ2 A;  4DCK A;  3BUN B;  1XK4 C;  1RWY A;  4PDZ A;  5HW9 A;  4EN1 A;  4QJ5 B;  1A2X A;  2HET A;  4JWQ A;  1XFZ O;  3KCT A;  2ICR A;  2SAS A;  3SSK A;  1XMZ A;  5EHU A;  2Y1N A;  4ORC B;  2VAE A;  2SCP A;  1BT6 A;  3SIA A;  1G8I A;  2PXW A;  2V4E A;  2H8Q A;  1JFJ A;  1C7V A;  1DJY A;  4C0K A;  3PFV A;  4W6S A;  1CFD A;  4LQT A;  2ZMW A;  3VRR A;  1QV0 A;  1LXF C;  1M39 A;  1QS7 A;  1PAL A;  5FHV A;  1IKU A;  2P6B B;  3SS0 A;  1Z1Q A;  4OVN F;  1F54 A;  1PVB A;  3PJ7 A;  1A4P A;  2KAV A;  1TOP A;  4W6U A;  1KQM B;  5EJU A;  1PSB A;  1GJY A;  4ICB A;  2A47 A;  1M45 A;  2AWJ A;  1ALV A;  1Z1P A;  5D69 A;  2BL0 B;  1BLQ A;  1JC1 A;  4B30 A;  5I8N A;  3NEZ A;  1GQM A;  1B7T Z;  2KYC A;  2NCO A;  3DQL A;  3DQI A;  3BUO B;  4DXM A;  2MRD A;  1MUX A;  2H61 C;  4KEX A;  3NXA A;  3SVB A;  1ZMZ A;  4D1E A;  4YI8 A;  3KHE A;  3DQK A;  4KGE A;  3M0W A;  2H5R A;  1MHO A;  2KQ6 A;  1IQ5 A;  3CGA A;  3OSQ A;  4W6I A;  1TCF A;  3KCS A;  2LLS A;  4W6M A;  1J7R A;  4OJ0 A;  3TUY B;  1G4Y R;  1RMM A;  5FVF A;  1F70 A;  4XYN A;  1MYW A;  1KQM C;  1V1F A;  2GGZ A;  4ETO A;  4N5X A;  2EC6 B;  1XA9 A;  2QLG A;  2WSN A;  4IK9 A;  3PLF B;  1DJI A;  1YX7 A;  4CFR A;  4W6T A;  2BL0 C;  4F0Z B;  4PFE A;  2O5G A;  3D0Y A;  1R2U A;  2VVI A;  4HRE E;  3GB3 A;  4J89 A;  2OJK A;  3DQ1 A;  4QJ4 B;  5HZT A;  3DF0 B;  4GNK B;  2L4I A;  1MOU A;  2MAZ A;  1OE9 B;  1K93 D;  2KFF A;  1IWQ A;  2JRF A;  5JJG A;  2WIQ A;  2OTG B;  2GX2 A;  1BF5 A;  4U2V A;  1YX8 A;  1XVJ A;  2EHB A;  3SG5 A;  3IF7 A;  2E6W A;  5B8I B;  4GOB A;  1WLM A;  1DJG A;  2KDH A;  4GFT A;  5BTT A;  2M49 B;  2PXS A;  3TUY C;  1EMC A;  1Q4C A;  2M1U A;  5CPV A;  1YUT A;  1CFF A;  2KBI A;  4PE4 A;  2EC6 C;  3U0L A;  3WLD A;  2O24 A;  3SVR A;  5J3X A;  2JPT A;  3LK1 A;  3CBE A;  5CSJ A;  1KK7 Z;  1XQM A;  3PSR A;  1W7I B;  1UHK A;  1XK4 A;  2Q57 A;  3M22 A;  2LV7 A;  1C4F A;  5LTQ A;  2YE0 A;  3EK7 A;  1S36 A;  3FS7 A;  3DQ3 A;  2AMI A;  4KGF A;  4WRI A;  1S6J A;  2OTG C;  1AVS A;  2BE4 A;  2HJO A;  1SL9 A;  4BY5 A;  5AFP A;  4I5K A;  2G6Y A;  3SG7 A;  2OPO A;  1KWO B;  2B3Q A;  1PRW A;  1QAT A;  3OB2 B;  3DVJ A;  4KF5 C;  2I18 A;  2M3W A;  1YUR A;  2FWQ A;  2VVJ A;  2IB6 A;  5BQL A;  4MSP A;  3H4S E;  4HRH A;  3NED A;  3W1C A;  2WSO A;  4ZF5 A;  2Z1O A;  1KQV A;  3DQ8 A;  4JQ0 D;  3G9A A;  1NCX A;  1S6C A;  1CV7 A;  1OMV A;  1QX2 A;  5DTZ A;  2KI6 C;  1W7S A;  1JBY A;  4AS8 A;  1GGZ A;  1LA3 A;  3DD4 A;  3GK1 A;  2L4H A;  3DQD A;  1REC A;  1TCO B;  5K89 A;  4C0J A;  1IQ3 A;  5H88 A;  1QXT A;  3LK0 A;  2K7O A;  4RYW A;  1UUS A;  4Q7R A;  2H61 A;  3DQM A;  2VZX A;  1DVI A;  2OTB A;  1SW8 A;  3MGF A;  1S6Z A;  1ZUX A;  1JWD A;  1QYF A;  1JC0 A;  3CR5 X;  2FZU A;  3DVM A;  1M46 A;  1N2D A;  2M8U A;  4M2Q A;  1KWO C;  2JU0 A;  4N3D A;  4ORA B;  3NF0 A;  1BR4 B;  1H6R A;  4BDU A;  2KAY A;  2LLT A;  4KF4 A;  3DPX A;  1M63 B;  4GGF C;  4YGB B;  3TS5 B;  2YE1 A;  3UG0 A;  4DKN A;  4I5N B;  4YRU A;  1UHJ A;  3DVE A;  1DGU A;  3WLC A;  2R2I A;  1B47 A;  3U0K A;  2FOT A;  1TNQ A;  1AHR A;  2M7N A;  3HCM A;  2G3D B;  2H5Q A;  3GL4 A;  3SSP A;  1B8L A;  2ZNE A;  3FWB A;  5FYX A;  1OZO A;  1B9C A;  4W6K A;  2GX0 A;  1J7P A;  4HQ8 A;  1KSO A;  2EMN A;  1SR6 B;  1Q4A A;  3WCK A;  1KYS A;  2JAD A;  4JRB A;  5CSI A;  4WQ3 A;  4W77 A;  1ZGO A;  4MZJ A;  4W6B A;  3IR8 A;  4J8A A;  5DPJ A;  1CKK A;  1J1E A;  5DKN A;  2NXQ A;  1WDC B;  1S3P A;  1NX1 A;  4ZIO A;  2Y4Q A;  1QAS A;  3LS3 A;  2CBL A;  3LVC A;  2LHL A;  1UP5 A;  1JBZ A;  1S5G Z;  4HE4 A;  2KAX A;  4GAO A;  3LSA A;  5DQB A;  3W1D A;  5DTL A;  1JSA A;  2JT3 A;  3DQ7 A;  3EVU A;  3KPX A;  3A4U B;  2H9W A;  2B1U A;  1W7U A;  1NUB A;  2KBM A;  3BYA A;  1CLM A;  2O29 A;  2M1K B;  3VIC A;  2F2P A;  2C9J A;  3DF0 A;  1RM9 A;  1XO5 A;  4W72 A;  2ZFD A;  3M24 A;  1SY9 A;  5I2O A;  1SR6 C;  3OHM B;  3C1V A;  1J55 A;  1WRK A;  2ISD A;  4CID A;  2Y1M A;  2PMY A;  1MOV A;  2DUF A;  4W73 A;  3MSE B;  2NCP A;  2Q6P A;  4NWS A;  2LAN A;  3VRO A;  5HBD A;  3D10 A;  4IK5 A;  2QRF A;  4PHK A;  4H47 A;  1YRT B;  4KF5 A;  2K7C A;  1WDC C;  3TMT A;  3DQE A;  3RM1 A;  5LK4 A;  1MR8 A;  4W6F A;  1RTP 1;  1DJH A;  1ZGP A;  1NX0 A;  3O2P A;  1ZGQ A;  4DXP A;  2VVH A;  1EG4 A;  3RWA A;  4L12 A;  1FBV A;  4MZK A;  2MA2 A;  3CB9 A;  4IK4 A;  1F09 A;  1AP4 A;  1CTR A;  4DUQ A;  1V1G A;  2LCP A;  1CDN A;  2HQZ A;  1ALW A;  1KYR A;  3A8S A;  3CGL A;  3CD9 A;  1C07 A;  4OKH A;  4XVP A;  4P2Y B;  3BXC A;  2HQK A;  2BE6 A;  2AUC A;  2QT2 A;  2A56 B;  3U8P A;  4A4C A;  3CFH A;  4ZB1 A;  1BG1 A;  2I7A A;  3H1R A;  5D7F A;  1CM4 A;  4GF6 B;  1NCZ A;  2C9I A;  4MN0 A;  1YTZ C;  2POX A;  1MQ1 A;  2BBN A;  1B1G A;  4OV2 A;  1F4Q A;  2BCX A;  4L9M A;  2A4J A;  1J7Q A;  5DQM A;  4GGF A;  3SVS A;  4AQI A;  3NSK A;  4CLN A;  5H89 A;  3ST3 A;  1CMG A;  2G6X A;  1L2O B;  1FI5 A;  2F3Y A;  3LCP C;  5CSN A;  4DIR A;  4Q9X A;  1QIV A;  1WRZ A;  1SBJ A;  2OKW A;  3BXB A;  5HKW A;  1HQV A;  1YVL A;  3OX6 A;  3SVE A;  1AJ5 A;  2LLU A;  3LL8 B;  1IRJ A;  4IZN A;  1CNP A; 
#chains in the Genus database with same CATH topology
 3L47 A;  4I2Y A;  3OGO A;  3JVT C;  2JZI A;  3ST4 A;  2ARL A;  2MJW B;  1LA0 A;  4PE0 A;  1WLZ A;  3DQ2 A;  2HPS A;  1ODB A;  1Y6W A;  2A52 B;  3ST0 A;  4W7R A;  5AQB B;  2PVB A;  3VRP A;  1IJ5 A;  2EGD A;  2MLE C;  2GW3 A;  4OQW A;  1EMB A;  3BXA A;  1SNL A;  1QLS A;  1TNX A;  3F45 A;  1SCM B;  4YGE B;  3SG3 A;  3UNW A;  5GQQ C;  1EXR A;  3AAJ A;  2ZO7 A;  4PE7 A;  3A8R A;  2A54 B;  3GOF A;  1L2O C;  5F6T A;  2WCH A;  3O6B A;  2BKI B;  2NZ0 A;  2ZN9 A;  4MVF A;  1XFU O;  4W6C A;  1F71 A;  3D78 A;  1YJF A;  5J2O A;  1TN4 A;  2A48 A;  1W7T A;  1EJ3 A;  4GUK A;  3I5G B;  3FIA A;  3IP2 A;  3CTN A;  4TZA A;  2KHN A;  4OY4 A;  2BKH B;  2CTN A;  1RFJ A;  4PT1 A;  3R72 A;  2ERB A;  4ORN A;  1CB1 A;  4B5Y A;  5DRF A;  5KTG A;  1BMO A;  2JC2 A;  1Z2C B;  3BOW B;  1EMF A;  4I5L B;  3CR2 A;  1B4C A;  1SCV A;  1D1O A;  5HL1 A;  3NSO A;  3CS1 A;  4W7E A;  1IJ6 A;  1SCM C;  4BY4 A;  2HPW A;  4MRY A;  5BT0 A;  4KPI A;  5LTP A;  3RWT A;  1OMD A;  4FQO A;  1N65 A;  2ZO6 A;  3DY9 A;  2K61 A;  2WC6 A;  1FF1 A;  3D75 A;  3OP0 A;  1K9U A;  2AHA A;  2ZN8 A;  2K60 A;  1RRX A;  2QLH A;  2COL B;  3CYZ A;  1LVC D;  4IK8 A;  3I5F B;  1JFK A;  2DD7 A;  3I5G C;  3VRQ A;  1DF0 B;  2V53 A;  1JF2 A;  1K9P A;  1PVA A;  1MXE A;  3PAL A;  3SST A;  4XL5 A;  1KYP A;  5HYD A;  1H4U A;  2BBM A;  4AOM A;  2LVK A;  2WC8 A;  3CLN A;  1ZUZ A;  4GES B;  2AWK A;  1BJF A;  4JD9 A;  5D3O A;  2HFC A;  1BFP A;  2H5P A;  2TN4 A;  1RMP A;  5DPH A;  2K2A A;  4JPZ B;  3NT3 A;  3SRY A;  4W6G A;  3CWG A;  2G16 B;  4LJC A;  4ANJ A;  3ZWH A;  5IBW A;  1Q73 A;  3SVO A;  2NLN A;  1AK8 A;  1UIS A;  2QZ0 A;  3NT9 A;  3BUW B;  1HCJ A;  4ZFS A;  2H6V A;  1SL8 A;  1YRU B;  3CDN A;  3OX5 A;  3BXK A;  5PAL A;  2QLI A;  2LAP A;  3D74 A;  3SVN A;  2DUH A;  1TWO A;  2M7L A;  3I5F C;  1AJ4 A;  2WCF A;  2PAS A;  1RMO A;  4H48 A;  4ZBL A;  3ZUL A;  1BOD A;  5HZO A;  2G5Z B;  2DDD A;  2DUE A;  4Q7T A;  2KGR A;  3SS3 A;  1KCY A;  4FTG A;  2HRS A;  3DXL A;  2L50 A;  4UPG A;  5T3I A;  1Y1A A;  1PSR A;  2MBX A;  5KU1 A;  3EKH A;  1KFX L;  4A4B A;  3DQO A;  1A03 A;  2PSR A;  2P4M A;  2M9G A;  1RK9 A;  2LUC A;  1IG5 A;  3CZT X;  4DS7 A;  2V4E C;  4PHN A;  1XSS A;  2Q4U A;  2JXC A;  4JEO A;  5DU0 A;  3TDI A;  1BU3 A;  1Z4H A;  2ZMU A;  2P71 A;  1BR1 B;  2CCM A;  1F4O A;  4HQC A;  3SSH A;  1SKT A;  1QYQ A;  4ZCU A;  4M2O A;  1XFR A;  1GL4 A;  2GW4 B;  1OQP A;  2LMT A;  5EL2 A;  3SSV A;  1ZAC A;  1QVI Z;  3BFA A;  1WRL A;  4TNC A;  5CSF A;  2WHU A;  4W69 A;  1QVI Y;  4WQ2 A;  1KP5 A;  3RLZ A;  4RYS A;  5KSZ A;  2AWM A;  2JQ6 A;  2LC5 A;  2AH8 A;  2FJU B;  2H2K A;  1DGV A;  3CR4 X;  2K7D A;  2AWL A;  2LMV A;  1YUU A;  5HGE A;  1YR5 A;  3SG4 A;  1IIO A;  3AKO A;  1WY9 A;  4P5O E;  4IL1 A;  2WHS A;  1EMM A;  3DVK A;  4TZG A;  2IS9 A;  3SVD A;  2DOQ A;  1OXF A;  4Z4M A;  5AER A;  1EML A;  4DXN A;  3UFZ A;  5AAN A;  2PAL A;  4XOW A;  2LP2 A;  4W6A A;  5EBJ A;  2L2C A;  4PHM A;  2YFP A;  4AQJ A;  2GV5 A;  4LJB A;  1FW4 A;  5FVI A;  2K7B A;  1SSE B;  1CLL A;  3ADF A;  3VB1 A;  4Q9W A;  4EDO A;  1NX2 A;  1KFX S;  3QRX A;  2WUR A;  4YGA A;  2A50 B;  1W7J B;  2O60 A;  3D76 A;  1NCY A;  4JFG A;  1SMG A;  2PRU A;  1P28 A;  2QEV A;  1B8R A;  2LVI A;  3I19 A;  4ZF3 A;  1CM1 A;  4MBE A;  4Q04 A;  3TDZ A;  5HZU A;  4USL A;  4OGS A;  4YGD B;  2RH7 A;  3IVT A;  2H8V A;  2BEC A;  4EUL A;  3EVP A;  1K9K A;  3E5V A;  1DJZ A;  3LF4 B;  1QXP A;  5HKZ A;  1U5I A;  3R1O A;  2LMU A;  4INX A;  1TNW A;  2JOJ A;  3BOW A;  4W7D A;  4PPL A;  2QLE A;  4W7C A;  2WOR A;  2IE2 A;  3LVA A;  4PPK A;  2I94 A;  1SYM A;  2WCK A;  3WHU B;  1QV1 A;  4IK3 A;  2G2B A;  2E30 A;  2QEO A;  3U8A A;  1XFV O;  3SJS A;  1KK8 C;  3U0M A;  3TMR A;  3AKB A;  1UHH A;  2G2S B;  1K95 A;  3OSR A;  3DYE A;  3B6X A;  3ST2 A;  1CDP A;  5BPJ A;  3O4Y A;  1DF0 A;  2LM5 A;  4W6H A;  4W7X A;  5DKQ A;  3AKA A;  3VK1 A;  3LF3 A;  1X02 A;  3AI4 A;  3JTD B;  2FL1 A;  3PIB A;  3EVV A;  3TZ1 A;  4AR7 A;  4R6D A;  3JVT B;  2LUX A;  3D77 A;  1CFC A;  1QIW A;  1EMK A;  1OXE A;  2I2R E;  4ZIN A;  4W6D A;  4LW5 A;  3DPW A;  4P1Q A;  1K96 A;  4NDC A;  1UHN A;  2OS8 C;  2HCG A;  5DIC A;  2MHH A;  2MLF C;  1QLK A;  1DJW A;  1OSA A;  3I5H B;  5FI7 A;  3GJ1 A;  3ICB A;  1C3Z A;  5HKY A;  2L98 A;  2JWW A;  1LIN A;  3SSL A;  1FPW A;  1Y1U A;  2Z6Z A;  5F9G A;  2WCJ A;  4ZF4 A;  1YUS A;  3SS4 A;  3ED8 A;  2JT8 A;  5DY6 A;  2GGM A;  4KW4 A;  1SL7 A;  1QY3 A;  2KI4 B;  2KQY A;  1ZOT B;  3S0A A;  1Q4E A;  2Q91 A;  3I5I C;  2WIS A;  2HGD A;  1CFP A;  4W7A A;  2O2B A;  4PPJ A;  4YI9 A;  3LLE A;  4IK1 A;  1A75 B;  2B3P A;  3B7A A;  3SV5 A;  1EMA A;  1F8H A;  2KFH A;  1DJX A;  5LTR A;  5HZS A;  3JTD C;  1K8U A;  5I2Q A;  2K2F A;  3GEX A;  1NWD A;  3PN7 B;  2WHT A;  1TUJ A;  1N0Y A;  1EL4 A;  4I5J A;  3IQO A;  3TDU A;  5ER4 X;  1B7T Y;  1YVH A;  4EMQ A;  3O78 A;  2IOV A;  3FE9 A;  2L0P A;  1Y1X A;  1G33 A;  1NPQ A;  3AI5 A;  1B8C A;  4HSZ A;  2WCE A;  3BX9 A;  2WOS A;  4W75 A;  4C0L A;  4OCI A;  1H8B A;  2KLE A;  1OXD A;  4HRG A;  1QJT A;  3I5H C;  3O77 A;  5ER5 A;  1YZW A;  3GK2 A;  4NQG A;  3S0F A;  1OZS A;  1GGX A;  3BUM B;  1UWO A;  3P28 A;  4W6P A;  4PCW A;  3V3D A;  2CT9 A;  4N1F A;  1CLB A;  4L1I A;  2KI4 C;  3VHT B;  4W6N A;  1AUI B;  4DRW A;  4W74 A;  3BUX B;  3PAT A;  2DUI A;  1OMR A;  3VGO A;  4DXQ A;  4LJD C;  1GFL A;  3LA1 A;  3PN7 C;  4HQ9 A;  3NHI A;  2HGY A;  4NDD A;  4CPV A;  3SIB A;  1R6P A;  1Q4B A;  1QX5 B;  1U5I B;  1XFX O;  2VRG A;  4JC2 A;  3U0N A;  4MEW A;  4W7F A;  3PM8 A;  3DQ4 A;  4PE1 A;  2DUG A;  3QME A;  1SRA A;  4RTC A;  4R1E A;  3SG2 A;  5AXI A;  2OTE A;  3P8U A;  3GJ2 A;  2M0R A;  2JTT A;  3AAK A;  2L2E A;  2IB5 A;  4XGY A;  3CFF A;  4P76 A;  2JXL A;  4YGC B;  2ZKM X;  2FCD A;  2VAD A;  1H4B A;  1NP8 A;  1F55 A;  3ZUJ A;  1OOF A;  5H87 A;  1EH2 A;  3NSL A;  2LNK A;  4XJK A;  1OOG A;  1KFU L;  2LVJ A;  1J7O A;  1CMF A;  4R6B A;  2K8M B;  3K21 A;  3N7H A;  3DQH A;  4INW A;  2HQ8 A;  3PJ5 A;  3VRN A;  1K90 D;  1HUY A;  3DQC A;  1OW4 A;  3DPZ A;  2F8P A;  5G08 A;  3BQ3 A;  4H3N A;  1KK7 Y;  3CFA A;  3Q8I A;  2A46 A;  3V2L A;  1S1E A;  1CDL A;  3PJB A;  4Z4K A;  5HLV A;  4OR9 B;  2JNX A;  2PYQ A;  3LVD A;  4W6O A;  2V4E B;  1RJV A;  3B87 A;  1SPY A;  1MWN A;  3WNX B;  4DKM A;  3DQU A;  1NIW A;  2L5X B;  3DQ9 A;  1LKJ A;  4U8D A;  2LHI A;  3GK4 X;  3HX4 A;  4FQT A;  3DQF A;  4W76 A;  2BCA A;  1Q4D A;  1EMG A;  1A29 A;  1TIZ A;  2WND A;  1RRO A;  3D73 A;  4J88 A;  1MF8 B;  3FWC A;  2ZRS A;  2F3Z A;  3ZNI A;  1UUR A;  2A53 B;  4B30 B;  3E3R A;  4GGN A;  1C7W A;  3OB1 B;  5DTX A;  3B88 A;  3K1K A;  1CDM A;  1PK0 D;  4PHJ A;  2K0J A;  3EKJ A;  1DT7 B;  1PUL A;  1DMO A;  1Q80 A;  4Q7U A;  3E5T A;  2HQW A;  4IJ7 A;  2EMO A;  3SS5 A;  2DD9 A;  1KFU S;  2KOT A;  2CXJ A;  4MLW A;  1XA5 A;  1DTL A;  1UHI A;  5DKR A;  2KI6 D;  2M97 A;  3H1O A;  4MZL A;  5DTY A;  1YHI A;  3K1E A;  4ZCV A;  5HLO A;  2KGB C;  1TRF A;  3WHT B;  3SG6 A;  3ZUF A;  2HF5 A;  1HT9 A;  1QTX A;  2QEH A;  3SVU A;  3DQ6 A;  3DQA A;  4CFQ A;  1VRK A;  2KFG A;  2LE9 B;  1YHG A;  1OOJ A;  3KF9 A;  1NYA A;  5AEQ A;  1YHH A;  2QLG B;  1S26 D;  2JT0 A;  3CD1 A;  1K94 A;  4NDB A;  1JBA A;  4DXO A;  1ZFS A;  1A75 A;  4LJD A;  2WCB A;  4N1G A;  4OHS A;  1OOH A;  4DXI A;  4GPL B;  4MRX A;  3D0Y B;  1EG3 A;  5EB7 A;  1QYO A;  4F7F A;  3S05 A;  2F2O A;  1K2H A;  3SVC A;  2KSP A;  4KW8 A;  2G9B A;  4JGE A;  2M29 A;  2D8N A;  1Y0V H;  4KA9 A;  4L13 A;  4H3L A;  4YBH B;  1G7K A;  2ZND A;  5EXB A;  4ORB B;  3EK4 A;  2DDC A;  2G3O A;  3CZ0 A;  1MXL C;  2Z6Y A;  2OGR A;  2JTZ A;  5BTT B;  1E8A A;  2YDZ A;  1IGV A;  2OKY A;  1JUO A;  3R1V A;  5EB6 A;  3TS5 C;  1KK8 B;  2Z6X A;  3E5W A;  5DPG A;  3EVR A;  4XJK B;  1JC2 A;  2QU1 A;  1JF0 A;  3VHT A;  2FCE A;  3CAB A;  1NSH A;  4KW9 A;  1XFW O;  3DQJ A;  3WXA A;  3U8C A;  1GGW A;  1S6I A;  2QPT A;  2JUL A;  2RGI A;  1S5G Y;  1OOI X;  3KEV A;  4JF9 A;  1KSM A;  4OZD A;  3UO9 A;  3SSY A;  1T14 A;  2CNP A;  4M2P A;  4W6J A;  5EXC I;  5DRG A;  1F0B A;  4PAL A;  1L7Z A;  1XYD A;  4E68 A;  3IQQ A;  1IH0 A;  5I2L A;  4HVF A;  4LQU A;  4W6L A;  2OS8 B;  5EXU A;  2KNE A;  2F33 A;  4H3M A;  2BCB A;  2LVV A;  1QX7 A;  5DPI A;  3EG5 B;  5KTY A;  4XOV A;  2ZRT A;  3ZTF A;  1NX3 A;  1BOC A;  4EDS A;  1TNP A;  4W6R A;  3DQN A;  1FI6 A;  2QAC A;  2L51 A;  1B9A A;  1TTX A;  4KYN A;  2H5O A;  2GTE A;  2Y0G A;  4QJ3 B;  5TNC A;  2G6E A;  1SK6 D;  1EME A;  2BTJ A;  2KYF A;  3KO0 A;  2EMD A;  3EK8 A;  2JNF A;  3I5I B;  1M31 A;  4KAG A;  2AAO A;  2Y5I A;  1XAE A;  1XFY O;  1J1D A;  4GBA A;  5JOL A;  3FE6 A;  1YFP A;  2LP3 A;  3DQ5 A;  4UTS A;  1LS8 A;  3NSI A;  5FVG A;  1YJ2 A;  4DCK A;  3BUN B;  1XK4 C;  1RWY A;  4PDZ A;  5HW9 A;  4EN1 A;  4QJ5 B;  1A2X A;  2HET A;  4JWQ A;  1XFZ O;  3KCT A;  2ICR A;  2SAS A;  3SSK A;  1XMZ A;  5EHU A;  1DEK A;  2Y1N A;  4ORC B;  2VAE A;  2SCP A;  1BT6 A;  3SIA A;  1G8I A;  2PXW A;  2V4E A;  5FI6 A;  2H8Q A;  1JFJ A;  1C7V A;  1DJY A;  2YGU A;  4C0K A;  3PFV A;  4W6S A;  1CFD A;  4LQT A;  2ZMW A;  3VRR A;  1QV0 A;  1LXF C;  1M39 A;  1QS7 A;  1PAL A;  5FHV A;  1IKU A;  2P6B B;  3SS0 A;  1Z1Q A;  4OVN F;  1F54 A;  1PVB A;  3PJ7 A;  1A4P A;  2KAV A;  1TOP A;  4W6U A;  1KQM B;  5EJU A;  1PSB A;  1GJY A;  4ICB A;  2A47 A;  3PM2 A;  1M45 A;  2AWJ A;  1ALV A;  1Z1P A;  5D69 A;  2BL0 B;  1BLQ A;  1JC1 A;  4B30 A;  5I8N A;  3NEZ A;  1GQM A;  1B7T Z;  2KYC A;  2NCO A;  3DQL A;  3DQI A;  3BUO B;  4DXM A;  2MRD A;  1MUX A;  2H61 C;  4KEX A;  3NXA A;  3SVB A;  1ZMZ A;  4D1E A;  4YI8 A;  3KHE A;  3DQK A;  4KGE A;  3M0W A;  2H5R A;  1MHO A;  2KQ6 A;  1IQ5 A;  3CGA A;  3OSQ A;  4W6I A;  1TCF A;  2PQL A;  3KCS A;  2LLS A;  4W6M A;  1J7R A;  4OJ0 A;  4JKT A;  3TUY B;  1G4Y R;  1RMM A;  5FVF A;  5FI2 A;  1F70 A;  4XYN A;  1MYW A;  1KQM C;  1V1F A;  2GGZ A;  4ETO A;  4N5X A;  2EC6 B;  1XA9 A;  2QLG A;  2WSN A;  4IK9 A;  3PLF B;  1DJI A;  1YX7 A;  4CFR A;  4W6T A;  2BL0 C;  4F0Z B;  4PFE A;  2O5G A;  3D0Y A;  1R2U A;  2VVI A;  4HRE E;  3GB3 A;  2L5Y A;  4J89 A;  2OJK A;  3DQ1 A;  4QJ4 B;  5HZT A;  3DF0 B;  4GNK B;  2L4I A;  1MOU A;  1QWV A;  2MAZ A;  1OE9 B;  1K93 D;  2KFF A;  1IWQ A;  2JRF A;  5JJG A;  2WIQ A;  2OTG B;  2GX2 A;  1BF5 A;  4U2V A;  1YX8 A;  1XVJ A;  2EHB A;  3SG5 A;  3IF7 A;  2E6W A;  5B8I B;  4GOB A;  1WLM A;  1DJG A;  2KDH A;  4GFT A;  5BTT A;  2M49 B;  2PXS A;  3TUY C;  1EMC A;  1Q4C A;  2M1U A;  5CPV A;  1YUT A;  1CFF A;  2KBI A;  4PE4 A;  2EC6 C;  3U0L A;  3WLD A;  2O24 A;  3SVR A;  5I94 A;  5J3X A;  2JPT A;  3LK1 A;  3CBE A;  5CSJ A;  1KK7 Z;  1XQM A;  3PSR A;  1W7I B;  1UHK A;  1XK4 A;  2Q57 A;  3CZ1 A;  2QDI A;  3M22 A;  2LV7 A;  1DEL A;  1C4F A;  5LTQ A;  2YE0 A;  3EK7 A;  1S36 A;  3FS7 A;  3DQ3 A;  3L4A A;  2AMI A;  4KGF A;  4WRI A;  3CZ2 A;  1S6J A;  2OTG C;  1AVS A;  2BE4 A;  2HJO A;  2BNX A;  1SL9 A;  4BY5 A;  5AFP A;  4I5K A;  2G6Y A;  3SG7 A;  3S0D A;  2QEB A;  2OPO A;  1KWO B;  2B3Q A;  1PRW A;  1QAT A;  3OB2 B;  3DVJ A;  2JPO A;  4KF5 C;  3BFB A;  3S0E A;  2I18 A;  2M3W A;  1YUR A;  2WC5 A;  2FWQ A;  2VVJ A;  2IB6 A;  5BQL A;  4MSP A;  3H4S E;  4HRH A;  3NED A;  3W1C A;  2WSO A;  4ZF5 A;  2Z1O A;  1KQV A;  3DQ8 A;  4JQ0 D;  3G9A A;  1NCX A;  1W9Z A;  1S6C A;  1CV7 A;  1OMV A;  1QX2 A;  5DTZ A;  2KI6 C;  1W7S A;  1JBY A;  4AS8 A;  1GGZ A;  1LA3 A;  3DD4 A;  3GK1 A;  2L4H A;  3DQD A;  3OBV A;  1REC A;  1TCO B;  5K89 A;  4C0J A;  1IQ3 A;  5H88 A;  2FJY A;  1QXT A;  3LK0 A;  2K7O A;  4RYW A;  1UUS A;  4Q7R A;  2H61 A;  3DQM A;  2VZX A;  1DVI A;  2OTB A;  1SW8 A;  3MGF A;  1S6Z A;  1ZUX A;  1JWD A;  1QYF A;  1JC0 A;  3CR5 X;  2FZU A;  3DVM A;  1M46 A;  1N2D A;  2M8U A;  4M2Q A;  1KWO C;  2JU0 A;  4N3D A;  4ORA B;  3NF0 A;  1BR4 B;  1H6R A;  4BDU A;  2KAY A;  2LLT A;  4KF4 A;  3DPX A;  1DC1 A;  1M63 B;  4GGF C;  4YGB B;  3TS5 B;  2YE1 A;  3UG0 A;  4DKN A;  4I5N B;  4YRU A;  1UHJ A;  3DVE A;  1DGU A;  3WLC A;  2R2I A;  1B47 A;  3OGN A;  3U0K A;  2FOT A;  1TNQ A;  1AHR A;  2M7N A;  3HCM A;  2G3D B;  2H5Q A;  3GL4 A;  3SSP A;  1B8L A;  2KLD A;  2ZNE A;  3FWB A;  3BJH A;  5FYX A;  1OZO A;  1B9C A;  4W6K A;  2GX0 A;  1J7P A;  4HQ8 A;  1KSO A;  2EMN A;  1SR6 B;  1Q4A A;  3WCK A;  3S0G A;  1KYS A;  2JAD A;  4JRB A;  5CSI A;  4WQ3 A;  4W77 A;  1ZGO A;  4MZJ A;  4W6B A;  3IR8 A;  4J8A A;  5DPJ A;  1CKK A;  1J1E A;  5DKN A;  3S0B A;  2NXQ A;  1WDC B;  1S3P A;  1NX1 A;  4ZIO A;  3O4X A;  2P70 A;  2Y4Q A;  1QAS A;  3LS3 A;  2CBL A;  3LVC A;  2LHL A;  1UP5 A;  3PJI A;  1JBZ A;  1S5G Z;  4HE4 A;  2KAX A;  4GAO A;  3LSA A;  5DQB A;  3W1D A;  5DTL A;  1JSA A;  2JT3 A;  3DQ7 A;  3EVU A;  3KPX A;  3A4U B;  2BAP A;  2H9W A;  2B1U A;  1W7U A;  1NUB A;  2KBM A;  3BYA A;  1CLM A;  3FE8 A;  2O29 A;  2M1K B;  3VIC A;  2F2P A;  2C9J A;  3DF0 A;  1RM9 A;  1XO5 A;  4W72 A;  2ZFD A;  3M24 A;  1SY9 A;  2WCM A;  5I2O A;  1SR6 C;  3OHM B;  3C1V A;  1GM0 A;  1J55 A;  1WRK A;  2ISD A;  4CID A;  2Y1M A;  2PMY A;  1MOV A;  2DUF A;  4W73 A;  3DZT A;  3MSE B;  2NCP A;  2Q6P A;  4NWS A;  2LAN A;  3VRO A;  5HBD A;  3D10 A;  4IK5 A;  2QRF A;  4PHK A;  4H47 A;  3NHT A;  1YRT B;  4KF5 A;  2K7C A;  1WDC C;  3TMT A;  3DQE A;  3RM1 A;  5LK4 A;  1MR8 A;  4W6F A;  2KPH A;  1RTP 1;  1DJH A;  1ZGP A;  1NX0 A;  3O2P A;  1ZGQ A;  4DXP A;  2VVH A;  1EG4 A;  3RWA A;  4L12 A;  1FBV A;  4MZK A;  2MA2 A;  3CB9 A;  4IK4 A;  1F09 A;  1AP4 A;  1CTR A;  4DUQ A;  1V1G A;  2LCP A;  1CDN A;  2HQZ A;  1ALW A;  1KYR A;  3A8S A;  3CGL A;  3CD9 A;  1C07 A;  4OKH A;  4XVP A;  4P2Y B;  3BXC A;  2HQK A;  2BE6 A;  2AUC A;  2QT2 A;  2A56 B;  3U8P A;  4A4C A;  3CFH A;  4ZB1 A;  1BG1 A;  2I7A A;  3H1R A;  5D7F A;  1CM4 A;  4GF6 B;  1NCZ A;  2C9I A;  4MN0 A;  3L4L A;  1YTZ C;  2POX A;  1MQ1 A;  2BBN A;  1B1G A;  4OV2 A;  1F4Q A;  2BCX A;  4L9M A;  2A4J A;  1J7Q A;  5DQM A;  4GGF A;  3SVS A;  3BFH A;  3NSK A;  4AQI A;  3R1P A;  4CLN A;  1C3Y A;  3NGV A;  5H89 A;  3ST3 A;  1CMG A;  2G6X A;  1L2O B;  1FI5 A;  2WCL A;  2F3Y A;  3LCP C;  5CSN A;  3B86 A;  4DIR A;  4Q9X A;  1QIV A;  1WRZ A;  1SBJ A;  2OKW A;  3BXB A;  5HKW A;  1HQV A;  1YVL A;  3OX6 A;  3SVE A;  1AJ5 A;  2LLU A;  3LL8 B;  1IRJ A;  1DQE A;  1CNP A;  4IZN A;  1ORG A;  3RZS A;  1TUZ A; 
#chains in the Genus database with same CATH homology
 4I2Y A;  3OGO A;  3JVT C;  2JZI A;  3ST4 A;  2ARL A;  2MJW B;  1LA0 A;  4PE0 A;  1WLZ A;  3DQ2 A;  2HPS A;  1ODB A;  1Y6W A;  2A52 B;  3ST0 A;  4W7R A;  5AQB B;  2PVB A;  3VRP A;  1IJ5 A;  2EGD A;  2MLE C;  2GW3 A;  4OQW A;  1EMB A;  3BXA A;  1SNL A;  1QLS A;  1TNX A;  3F45 A;  1SCM B;  4YGE B;  3SG3 A;  5GQQ C;  1EXR A;  3AAJ A;  2ZO7 A;  4PE7 A;  3A8R A;  2A54 B;  3GOF A;  1L2O C;  5F6T A;  3O6B A;  2BKI B;  2NZ0 A;  2ZN9 A;  4MVF A;  1XFU O;  4W6C A;  1F71 A;  1YJF A;  5J2O A;  1TN4 A;  2A48 A;  1W7T A;  1EJ3 A;  4GUK A;  3I5G B;  3FIA A;  3IP2 A;  3CTN A;  4TZA A;  2KHN A;  4OY4 A;  2BKH B;  2CTN A;  1RFJ A;  4ORN A;  1CB1 A;  4B5Y A;  5DRF A;  5KTG A;  1BMO A;  2JC2 A;  3BOW B;  1EMF A;  4I5L B;  3CR2 A;  1B4C A;  1SCV A;  1D1O A;  3NSO A;  3CS1 A;  4W7E A;  1IJ6 A;  1SCM C;  4BY4 A;  2HPW A;  4MRY A;  5BT0 A;  4KPI A;  5LTP A;  3RWT A;  1OMD A;  4FQO A;  1N65 A;  2ZO6 A;  2K61 A;  1FF1 A;  3OP0 A;  1K9U A;  2AHA A;  2ZN8 A;  1RRX A;  2QLH A;  2COL B;  1LVC D;  4IK8 A;  3I5F B;  1JFK A;  2DD7 A;  3I5G C;  3VRQ A;  1DF0 B;  2V53 A;  1JF2 A;  1K9P A;  1PVA A;  1MXE A;  3PAL A;  3SST A;  4XL5 A;  1KYP A;  5HYD A;  1H4U A;  2BBM A;  4AOM A;  2LVK A;  2WC8 A;  3CLN A;  1ZUZ A;  4GES B;  2AWK A;  1BJF A;  2HFC A;  1BFP A;  2H5P A;  2TN4 A;  1RMP A;  5DPH A;  2K2A A;  4JPZ B;  3NT3 A;  3SRY A;  4W6G A;  3CWG A;  2G16 B;  4LJC A;  4ANJ A;  3ZWH A;  5IBW A;  1Q73 A;  3SVO A;  2NLN A;  1AK8 A;  1UIS A;  2QZ0 A;  3NT9 A;  3BUW B;  1HCJ A;  4ZFS A;  2H6V A;  1SL8 A;  1YRU B;  3OX5 A;  3BXK A;  5PAL A;  2QLI A;  2LAP A;  3SVN A;  2DUH A;  2M7L A;  3I5F C;  1AJ4 A;  2WCF A;  2PAS A;  1RMO A;  4H48 A;  4ZBL A;  3ZUL A;  1BOD A;  5HZO A;  2G5Z B;  2DDD A;  2DUE A;  4Q7T A;  2KGR A;  1KCY A;  4FTG A;  2HRS A;  4UPG A;  2L50 A;  5T3I A;  1Y1A A;  1PSR A;  2MBX A;  5KU1 A;  3EKH A;  1KFX L;  4A4B A;  3DQO A;  1A03 A;  2PSR A;  2P4M A;  2M9G A;  1RK9 A;  2LUC A;  1IG5 A;  3CZT X;  4DS7 A;  2V4E C;  4PHN A;  1XSS A;  2Q4U A;  2JXC A;  4JEO A;  5DU0 A;  3TDI A;  1BU3 A;  2ZMU A;  1BR1 B;  2CCM A;  1F4O A;  4HQC A;  3SSH A;  1SKT A;  1QYQ A;  4ZCU A;  4M2O A;  1GL4 A;  2GW4 B;  1OQP A;  2LMT A;  3SSV A;  1ZAC A;  1QVI Z;  1WRL A;  4TNC A;  5CSF A;  2WHU A;  4W69 A;  1QVI Y;  4WQ2 A;  1KP5 A;  3RLZ A;  4RYS A;  5KSZ A;  2AWM A;  2JQ6 A;  2LC5 A;  2AH8 A;  2FJU B;  2H2K A;  1DGV A;  3CR4 X;  2K7D A;  2AWL A;  2LMV A;  1YUU A;  5HGE A;  1YR5 A;  3SG4 A;  3AKO A;  1WY9 A;  4P5O E;  4IL1 A;  2WHS A;  1EMM A;  3DVK A;  4TZG A;  2IS9 A;  3SVD A;  2DOQ A;  1OXF A;  4Z4M A;  5AER A;  1EML A;  4DXN A;  3UFZ A;  5AAN A;  2PAL A;  4XOW A;  2LP2 A;  4W6A A;  5EBJ A;  4PHM A;  2YFP A;  4AQJ A;  2GV5 A;  4LJB A;  1FW4 A;  5FVI A;  2K7B A;  1CLL A;  3ADF A;  4Q9W A;  4EDO A;  1NX2 A;  1KFX S;  3QRX A;  2WUR A;  4YGA A;  2A50 B;  1W7J B;  2O60 A;  1NCY A;  4JFG A;  1SMG A;  2PRU A;  1B8R A;  2LVI A;  3I19 A;  4ZF3 A;  1CM1 A;  4MBE A;  4Q04 A;  3TDZ A;  5HZU A;  4USL A;  4OGS A;  4YGD B;  2RH7 A;  2BEC A;  4EUL A;  3EVP A;  1K9K A;  3E5V A;  1DJZ A;  3LF4 B;  1QXP A;  5HKZ A;  1U5I A;  2LMU A;  1TNW A;  2JOJ A;  3BOW A;  4W7D A;  4PPL A;  2QLE A;  4W7C A;  2WOR A;  2IE2 A;  3LVA A;  4PPK A;  2I94 A;  1SYM A;  3WHU B;  1QV1 A;  4IK3 A;  2G2B A;  2E30 A;  3U8A A;  1XFV O;  3SJS A;  1KK8 C;  3U0M A;  3TMR A;  3AKB A;  1UHH A;  2G2S B;  1K95 A;  3OSR A;  3ST2 A;  1CDP A;  5BPJ A;  3O4Y A;  1DF0 A;  2LM5 A;  4W6H A;  4W7X A;  5DKQ A;  3AKA A;  3VK1 A;  3LF3 A;  1X02 A;  3AI4 A;  3JTD B;  2FL1 A;  3PIB A;  3EVV A;  3TZ1 A;  4AR7 A;  4R6D A;  3JVT B;  2LUX A;  1CFC A;  1QIW A;  1EMK A;  1OXE A;  2I2R E;  4ZIN A;  4W6D A;  4LW5 A;  3DPW A;  4P1Q A;  1K96 A;  4NDC A;  1UHN A;  2OS8 C;  2HCG A;  2MHH A;  2MLF C;  1QLK A;  1DJW A;  1OSA A;  3I5H B;  3GJ1 A;  3ICB A;  5HKY A;  2L98 A;  2JWW A;  1LIN A;  3SSL A;  1FPW A;  1Y1U A;  2Z6Z A;  5F9G A;  4ZF4 A;  1YUS A;  3ED8 A;  2JT8 A;  5DY6 A;  2GGM A;  4KW4 A;  1SL7 A;  1QY3 A;  2KI4 B;  2KQY A;  1ZOT B;  1Q4E A;  2Q91 A;  3I5I C;  2WIS A;  2HGD A;  1CFP A;  4W7A A;  2O2B A;  4PPJ A;  4YI9 A;  3LLE A;  4IK1 A;  1A75 B;  2B3P A;  3SV5 A;  1EMA A;  1F8H A;  2KFH A;  1DJX A;  5LTR A;  5HZS A;  3JTD C;  1K8U A;  5I2Q A;  2K2F A;  3GEX A;  1NWD A;  3PN7 B;  2WHT A;  1N0Y A;  1EL4 A;  4I5J A;  3IQO A;  3TDU A;  5ER4 X;  1B7T Y;  1YVH A;  4EMQ A;  3O78 A;  2IOV A;  2L0P A;  1Y1X A;  1G33 A;  1NPQ A;  3AI5 A;  1B8C A;  4HSZ A;  2WCE A;  3BX9 A;  2WOS A;  4W75 A;  4C0L A;  4OCI A;  1H8B A;  1OXD A;  4HRG A;  1QJT A;  3I5H C;  3O77 A;  5ER5 A;  1YZW A;  3GK2 A;  4NQG A;  1OZS A;  1GGX A;  3BUM B;  1UWO A;  3P28 A;  4W6P A;  4PCW A;  3V3D A;  2CT9 A;  4N1F A;  1CLB A;  4L1I A;  2KI4 C;  3VHT B;  4W6N A;  1AUI B;  4DRW A;  4W74 A;  3BUX B;  3PAT A;  2DUI A;  1OMR A;  3VGO A;  4DXQ A;  4LJD C;  1GFL A;  3LA1 A;  3PN7 C;  4HQ9 A;  2HGY A;  4NDD A;  4CPV A;  3SIB A;  1R6P A;  1Q4B A;  1QX5 B;  1U5I B;  1XFX O;  2VRG A;  4JC2 A;  3U0N A;  4MEW A;  4W7F A;  3PM8 A;  3DQ4 A;  4PE1 A;  2DUG A;  1SRA A;  4RTC A;  4R1E A;  3SG2 A;  5AXI A;  2OTE A;  3P8U A;  3GJ2 A;  2M0R A;  2JTT A;  3AAK A;  2L2E A;  2IB5 A;  4XGY A;  3CFF A;  4P76 A;  2JXL A;  4YGC B;  2ZKM X;  2FCD A;  2VAD A;  1H4B A;  1NP8 A;  1F55 A;  3ZUJ A;  5H87 A;  1EH2 A;  3NSL A;  2LNK A;  4XJK A;  1KFU L;  2LVJ A;  1J7O A;  1CMF A;  4R6B A;  2K8M B;  3K21 A;  3DQH A;  2HQ8 A;  3PJ5 A;  3VRN A;  1K90 D;  1HUY A;  3DQC A;  3DPZ A;  2F8P A;  5G08 A;  3BQ3 A;  4H3N A;  1KK7 Y;  3CFA A;  2A46 A;  1S1E A;  1CDL A;  3PJB A;  4Z4K A;  5HLV A;  4OR9 B;  2JNX A;  3LVD A;  4W6O A;  2V4E B;  1RJV A;  1SPY A;  1MWN A;  3WNX B;  4DKM A;  3DQU A;  1NIW A;  2L5X B;  3DQ9 A;  1LKJ A;  4U8D A;  2LHI A;  3GK4 X;  3HX4 A;  3DQF A;  4W76 A;  2BCA A;  1Q4D A;  1EMG A;  1A29 A;  1TIZ A;  2WND A;  1RRO A;  4J88 A;  1MF8 B;  3FWC A;  2ZRS A;  2F3Z A;  3ZNI A;  1UUR A;  2A53 B;  4B30 B;  3E3R A;  4GGN A;  1C7W A;  3OB1 B;  5DTX A;  3K1K A;  1CDM A;  1PK0 D;  4PHJ A;  2K0J A;  3EKJ A;  1DT7 B;  1PUL A;  1DMO A;  1Q80 A;  4Q7U A;  3E5T A;  2HQW A;  2EMO A;  2DD9 A;  1KFU S;  2KOT A;  2CXJ A;  4MLW A;  1XA5 A;  1DTL A;  1UHI A;  5DKR A;  2KI6 D;  2M97 A;  3H1O A;  4MZL A;  5DTY A;  1YHI A;  4ZCV A;  5HLO A;  2KGB C;  1TRF A;  3WHT B;  3SG6 A;  3ZUF A;  2HF5 A;  1HT9 A;  1QTX A;  3SVU A;  3DQ6 A;  3DQA A;  4CFQ A;  1VRK A;  2KFG A;  2LE9 B;  1YHG A;  1OOJ A;  3KF9 A;  1NYA A;  5AEQ A;  1YHH A;  2QLG B;  1S26 D;  2JT0 A;  3CD1 A;  1K94 A;  4NDB A;  1JBA A;  4DXO A;  1ZFS A;  1A75 A;  4LJD A;  2WCB A;  4N1G A;  4OHS A;  4DXI A;  4GPL B;  4MRX A;  3D0Y B;  1EG3 A;  5EB7 A;  1QYO A;  3S05 A;  2F2O A;  1K2H A;  3SVC A;  2KSP A;  4KW8 A;  2G9B A;  4JGE A;  2M29 A;  2D8N A;  1Y0V H;  4KA9 A;  4L13 A;  4H3L A;  4YBH B;  1G7K A;  2ZND A;  5EXB A;  4ORB B;  3EK4 A;  2DDC A;  2G3O A;  1MXL C;  2Z6Y A;  2OGR A;  2JTZ A;  5BTT B;  1E8A A;  2YDZ A;  1IGV A;  2OKY A;  1JUO A;  5EB6 A;  3TS5 C;  1KK8 B;  2Z6X A;  3E5W A;  5DPG A;  3EVR A;  4XJK B;  1JC2 A;  2QU1 A;  1JF0 A;  3VHT A;  2FCE A;  1NSH A;  4KW9 A;  1XFW O;  3DQJ A;  3WXA A;  3U8C A;  1GGW A;  1S6I A;  2QPT A;  2JUL A;  2RGI A;  1S5G Y;  3KEV A;  4JF9 A;  1KSM A;  3SSY A;  2CNP A;  4M2P A;  4W6J A;  5EXC I;  5DRG A;  1F0B A;  4PAL A;  1L7Z A;  1XYD A;  4E68 A;  3IQQ A;  1IH0 A;  5I2L A;  4HVF A;  4LQU A;  4W6L A;  2OS8 B;  5EXU A;  2KNE A;  2F33 A;  4H3M A;  2BCB A;  2LVV A;  1QX7 A;  5DPI A;  5KTY A;  4XOV A;  2ZRT A;  3ZTF A;  1NX3 A;  1BOC A;  4EDS A;  1TNP A;  4W6R A;  3DQN A;  1FI6 A;  2QAC A;  2L51 A;  1B9A A;  1TTX A;  2H5O A;  2Y0G A;  4QJ3 B;  5TNC A;  2G6E A;  1SK6 D;  1EME A;  2BTJ A;  2KYF A;  3KO0 A;  2EMD A;  3EK8 A;  2JNF A;  3I5I B;  1M31 A;  4KAG A;  2AAO A;  2Y5I A;  1XAE A;  1XFY O;  1J1D A;  4GBA A;  5JOL A;  1YFP A;  2LP3 A;  3DQ5 A;  4UTS A;  3NSI A;  5FVG A;  1YJ2 A;  4DCK A;  3BUN B;  1XK4 C;  1RWY A;  4PDZ A;  5HW9 A;  4EN1 A;  4QJ5 B;  1A2X A;  2HET A;  4JWQ A;  1XFZ O;  3KCT A;  2ICR A;  2SAS A;  3SSK A;  1XMZ A;  5EHU A;  2Y1N A;  4ORC B;  2VAE A;  2SCP A;  1BT6 A;  3SIA A;  1G8I A;  2PXW A;  2V4E A;  2H8Q A;  1JFJ A;  1C7V A;  1DJY A;  4C0K A;  3PFV A;  4W6S A;  1CFD A;  4LQT A;  2ZMW A;  3VRR A;  1QV0 A;  1LXF C;  1M39 A;  1QS7 A;  1PAL A;  5FHV A;  1IKU A;  2P6B B;  3SS0 A;  1Z1Q A;  4OVN F;  1F54 A;  1PVB A;  3PJ7 A;  1A4P A;  2KAV A;  1TOP A;  4W6U A;  1KQM B;  5EJU A;  1PSB A;  1GJY A;  4ICB A;  2A47 A;  1M45 A;  2AWJ A;  1ALV A;  1Z1P A;  5D69 A;  2BL0 B;  1BLQ A;  1JC1 A;  4B30 A;  5I8N A;  3NEZ A;  1GQM A;  1B7T Z;  2KYC A;  2NCO A;  3DQL A;  3DQI A;  3BUO B;  4DXM A;  2MRD A;  1MUX A;  2H61 C;  4KEX A;  3NXA A;  3SVB A;  1ZMZ A;  4D1E A;  4YI8 A;  3KHE A;  3DQK A;  4KGE A;  3M0W A;  2H5R A;  1MHO A;  2KQ6 A;  1IQ5 A;  3CGA A;  3OSQ A;  4W6I A;  1TCF A;  3KCS A;  2LLS A;  4W6M A;  1J7R A;  4OJ0 A;  3TUY B;  1G4Y R;  1RMM A;  5FVF A;  1F70 A;  4XYN A;  1MYW A;  1KQM C;  1V1F A;  2GGZ A;  4ETO A;  4N5X A;  2EC6 B;  1XA9 A;  2QLG A;  2WSN A;  4IK9 A;  3PLF B;  1DJI A;  1YX7 A;  4CFR A;  4W6T A;  2BL0 C;  4F0Z B;  4PFE A;  2O5G A;  3D0Y A;  1R2U A;  2VVI A;  4HRE E;  3GB3 A;  4J89 A;  2OJK A;  3DQ1 A;  4QJ4 B;  5HZT A;  3DF0 B;  4GNK B;  2L4I A;  1MOU A;  2MAZ A;  1OE9 B;  1K93 D;  2KFF A;  1IWQ A;  2JRF A;  5JJG A;  2WIQ A;  2OTG B;  2GX2 A;  1BF5 A;  4U2V A;  1YX8 A;  1XVJ A;  2EHB A;  3SG5 A;  3IF7 A;  2E6W A;  5B8I B;  4GOB A;  1WLM A;  1DJG A;  2KDH A;  4GFT A;  5BTT A;  2M49 B;  2PXS A;  3TUY C;  1EMC A;  1Q4C A;  2M1U A;  5CPV A;  1YUT A;  1CFF A;  2KBI A;  4PE4 A;  2EC6 C;  3U0L A;  3WLD A;  2O24 A;  3SVR A;  5J3X A;  2JPT A;  3LK1 A;  3CBE A;  5CSJ A;  1KK7 Z;  1XQM A;  3PSR A;  1W7I B;  1UHK A;  1XK4 A;  2Q57 A;  3M22 A;  2LV7 A;  1C4F A;  5LTQ A;  2YE0 A;  3EK7 A;  1S36 A;  3FS7 A;  3DQ3 A;  2AMI A;  4KGF A;  4WRI A;  1S6J A;  2OTG C;  1AVS A;  2BE4 A;  2HJO A;  1SL9 A;  4BY5 A;  5AFP A;  4I5K A;  2G6Y A;  3SG7 A;  2OPO A;  1KWO B;  2B3Q A;  1PRW A;  1QAT A;  3OB2 B;  3DVJ A;  4KF5 C;  2I18 A;  2M3W A;  1YUR A;  2FWQ A;  2VVJ A;  2IB6 A;  5BQL A;  4MSP A;  3H4S E;  4HRH A;  3NED A;  3W1C A;  2WSO A;  4ZF5 A;  2Z1O A;  1KQV A;  3DQ8 A;  4JQ0 D;  3G9A A;  1NCX A;  1S6C A;  1CV7 A;  1OMV A;  1QX2 A;  5DTZ A;  2KI6 C;  1W7S A;  1JBY A;  4AS8 A;  1GGZ A;  1LA3 A;  3DD4 A;  3GK1 A;  2L4H A;  3DQD A;  1REC A;  1TCO B;  5K89 A;  4C0J A;  1IQ3 A;  5H88 A;  1QXT A;  3LK0 A;  2K7O A;  4RYW A;  1UUS A;  4Q7R A;  2H61 A;  3DQM A;  2VZX A;  1DVI A;  2OTB A;  1SW8 A;  3MGF A;  1S6Z A;  1ZUX A;  1JWD A;  1QYF A;  1JC0 A;  3CR5 X;  2FZU A;  3DVM A;  1M46 A;  1N2D A;  2M8U A;  4M2Q A;  1KWO C;  2JU0 A;  4N3D A;  4ORA B;  3NF0 A;  1BR4 B;  1H6R A;  4BDU A;  2KAY A;  2LLT A;  4KF4 A;  3DPX A;  1M63 B;  4GGF C;  4YGB B;  3TS5 B;  2YE1 A;  3UG0 A;  4DKN A;  4I5N B;  4YRU A;  1UHJ A;  3DVE A;  1DGU A;  3WLC A;  2R2I A;  1B47 A;  3U0K A;  2FOT A;  1TNQ A;  1AHR A;  2M7N A;  3HCM A;  2G3D B;  2H5Q A;  3GL4 A;  3SSP A;  1B8L A;  2ZNE A;  3FWB A;  5FYX A;  1OZO A;  1B9C A;  4W6K A;  2GX0 A;  1J7P A;  4HQ8 A;  1KSO A;  2EMN A;  1SR6 B;  1Q4A A;  3WCK A;  1KYS A;  2JAD A;  4JRB A;  5CSI A;  4WQ3 A;  4W77 A;  1ZGO A;  4MZJ A;  4W6B A;  3IR8 A;  4J8A A;  5DPJ A;  1CKK A;  1J1E A;  5DKN A;  2NXQ A;  1WDC B;  1S3P A;  1NX1 A;  4ZIO A;  2Y4Q A;  1QAS A;  3LS3 A;  2CBL A;  3LVC A;  2LHL A;  1UP5 A;  1JBZ A;  1S5G Z;  4HE4 A;  2KAX A;  4GAO A;  3LSA A;  5DQB A;  3W1D A;  5DTL A;  1JSA A;  2JT3 A;  3DQ7 A;  3EVU A;  3KPX A;  3A4U B;  2H9W A;  2B1U A;  1W7U A;  1NUB A;  2KBM A;  3BYA A;  1CLM A;  2O29 A;  2M1K B;  3VIC A;  2F2P A;  2C9J A;  3DF0 A;  1RM9 A;  1XO5 A;  4W72 A;  2ZFD A;  3M24 A;  1SY9 A;  5I2O A;  1SR6 C;  3OHM B;  3C1V A;  1J55 A;  1WRK A;  2ISD A;  4CID A;  2Y1M A;  2PMY A;  1MOV A;  2DUF A;  4W73 A;  3MSE B;  2NCP A;  2Q6P A;  4NWS A;  2LAN A;  3VRO A;  5HBD A;  3D10 A;  4IK5 A;  2QRF A;  4PHK A;  4H47 A;  1YRT B;  4KF5 A;  2K7C A;  1WDC C;  3TMT A;  3DQE A;  3RM1 A;  5LK4 A;  1MR8 A;  4W6F A;  1RTP 1;  1DJH A;  1ZGP A;  1NX0 A;  3O2P A;  1ZGQ A;  4DXP A;  2VVH A;  1EG4 A;  3RWA A;  4L12 A;  1FBV A;  4MZK A;  2MA2 A;  3CB9 A;  4IK4 A;  1F09 A;  1AP4 A;  1CTR A;  4DUQ A;  1V1G A;  2LCP A;  1CDN A;  2HQZ A;  1ALW A;  1KYR A;  3A8S A;  3CGL A;  3CD9 A;  1C07 A;  4OKH A;  4XVP A;  4P2Y B;  3BXC A;  2HQK A;  2BE6 A;  2AUC A;  2QT2 A;  2A56 B;  3U8P A;  4A4C A;  3CFH A;  4ZB1 A;  1BG1 A;  2I7A A;  3H1R A;  5D7F A;  1CM4 A;  4GF6 B;  1NCZ A;  2C9I A;  4MN0 A;  1YTZ C;  2POX A;  1MQ1 A;  2BBN A;  1B1G A;  4OV2 A;  1F4Q A;  2BCX A;  4L9M A;  2A4J A;  1J7Q A;  5DQM A;  4GGF A;  3SVS A;  4AQI A;  3NSK A;  4CLN A;  5H89 A;  3ST3 A;  1CMG A;  2G6X A;  1L2O B;  1FI5 A;  2F3Y A;  3LCP C;  5CSN A;  4DIR A;  4Q9X A;  1QIV A;  1WRZ A;  1SBJ A;  2OKW A;  3BXB A;  5HKW A;  1HQV A;  1YVL A;  3OX6 A;  3SVE A;  1AJ5 A;  2LLU A;  3LL8 B;  1IRJ A;  4IZN A;  1CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...