3EKJA

Calcium-free gcamp2 (calcium binding deficient mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
301
Chain Sequence
LENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGGITTKQLGTVMRSLGQNPTEAELQDMINEVGGTIDFPQFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 78
structure length 301
sequence length 318
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekjA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekjA01
4JQ0D 1R2UA 2OJKA 5HKWA 1AVSA 2AUCA 3WHTB 2F3YA 1SCMB 2MRDA 2E6WA 4HQCA 2Z6YA 3E5WA 3SRYA 2M7LA 2F33A 1W7SA 5LTRA 1DTLA 2F3ZA 4JRBA 1MF8B 2E30A 3SG2A 4E68A 5AANA 1LA0A 4WQ2A 2JT3A 3SSKA 5DY6A 3PN7C 1KSOA 1NP8A 4MBEA 1QVIY 1CFDA 2G6EA 5H88A 3CGAA 1MWNA 5AERA 3SVDA 2O29A 1TNXA 1BJFA 2AMIA 4N1GA 2MJWB 1QX5B 1JWDA 4YGDB 4KW9A 2ZN9A 4J8AA 3DQAA 1SR6C 1K8UA 1TN4A 2QPTA 4OCIA 1KK7Z 3VRRA 1M31A 2OTGC 5KU1A 1KYPA 3ST4A 1N65A 3EVRA 4B30A 5CSFA 2NCPA 2CTNA 3UG0A 3IF7A 1U5IB 2LUCA 1BOCA 2MBXA 5LTQA 1ZGQA 2PSRA 4L13A 1J1EA 2WISA 4W6MA 2GW4B 2PXSA 1F71A 4WQ3A 4OVNF 2DUHA 3SVRA 4W73A 1QASA 5DPGA 1Z1PA 1IQ3A 1UWOA 3E5VA 4XOWA 2FOTA 3DQJA 5EB7A 3OGOA 1WDCB 2HRSA 1NCYA 1SMGA 3PJ5A 3U0NA 1B8LA 4HE4A 2BCXA 2EGDA 1QV0A 4MEWA 4KW8A 1J7PA 4I5NB 1CNPA 3KO0A 1CDLA 4ZF3A 2K7BA 2WCBA 3F45A 2H9WA 4BDUA 4TNCA 1F8HA 1CLBA 5CSNA 1KFXL 3I5IC 2M49B 5AFPA 1G4YR 3ST3A 1Y1AA 2KQ6A 3BOWB 3WXAA 2H5QA 1G33A 1R6PA 1BR4B 3KEVA 4P76A 2BKIB 3OP0A 3AI5A 1JUOA 1B1GA 1UUSA 3ZTFA 3DQHA 1B9CA 3DQOA 3VRPA 2EC6C 3SVUA 2H61C 1QS7A 4FQOA 1EMFA 1D1OA 1EXRA 1SBJA 1B4CA 2DUIA 3G9AA 2KAXA 5K89A 2AWMA 1SW8A 4M2OA 1Z1QA 1Q4AA 3I5IB 4Q04A 1L2OC 2LANA 2KYFA 3A8RA 3BUOB 4OY4A 1ALVA 4DXNA 4C0JA 1DJHA 5DTXA 1QY3A 4W6KA 3U8CA 1HCJA 3H4SE 3KF9A 1CTRA 5LTPA 4GF6B 1AJ4A 4ANJA 1YFPA 4PHKA 1N0YA 3SSHA 2POXA 3DVEA 1UP5A 1IKUA 1GFLA 4W6FA 5G08A 4NDDA 3NF0A 4HRHA 4I5LB 4PDZA 3CGLA 1ZMZA 1ZGOA 3GK4X 3LVCA 2JTTA 4W7RA 2CXJA 2IS9A 4MZLA 1B8RA 2HETA 4L1IA 2V4EC 3NSKA 3DQ6A 4DKNA 3BQ3A 4YGBB 3M0WA 2ZNDA 3EKHA 4PE0A 3JTDB 1XA9A 4YI8A 2Z1OA 5I8NA 2QLIA 3CR5X 3O2PA 1EMBA 2LHIA 1SYMA 2MLFC 1KYSA 2RH7A 1IQ5A 1JF0A 3FWBA 4JF9A 2LUXA 4W6NA 4OQWA 1QJTA 2DD7A 3CTNA 4M2QA 3PJ7A 1EMKA 2K7DA 3LK0A 1MXEA 2HF5A 1A2XA 1L7ZA 4NDBA 1RECA 3RM1A 2LLTA 3AKOA 1TCOB 1RMPA 1CMFA 4GGFC 5FVIA 1V1GA 4MLWA 1LA3A 5J3XA 2GGMA 2CNPA 2H5RA 1VRKA 3BX9A 3ZUFA 2WORA 3OB1B 5B8IB 2LCPA 1UHHA 2YE0A 4AOMA 3EK7A 2HGYA 1UISA 2Q6PA 1GGZA 3GEXA 2L51A 2V4EA 2NLNA 2KBMA 3I5GC 3DF0B 4ETOA 4A4CA 4YRUA 4YI9A 1S6ZA 2V53A 2O60A 1JC1A 1OZSA 1K2HA 1CKKA 2M7NA 1NCZA 2M1UA 3TMTA 2O2BA 5PALA 3TZ1A 5EHUA 4PFEA 2LP2A 5HKYA 2M1KB 1TNPA 4GGNA 5DPIA 2OKYA 2MHHA 5I2LA 2A48A 4W74A 3TUYC 1XA5A 2L0PA 1C4FA 1S5GY 1DGVA 1KSMA 1YUSA 1PRWA 4WRIA 3IQOA 3BUXB 3VRNA 1XFYO 2LMTA 1BODA 3PJBA 1XFVO 1AHRA 2M9GA 2MA2A 3CZTX 4PE1A 2EMDA 3NSOA 2LP3A 4HRGA 2GX0A 1MR8A 1YVHA 3O77A 3A4UB 3V3DA 2BKHB 3AKBA 3FWCA 4OHSA 3JTDC 3CLNA 2LC5A 3TUYB 4LJCA 4IK3A 3DQ1A 4XL5A 1KWOC 4H3NA 4DXIA 5EXCI 1S6IA 3DQCA 1F70A 2ARLA 1WLZA 1SCVA 5CPVA 3C1VA 1IJ6A 2Q91A 2KYCA 2QACA 1YJ2A 1YUUA 1QVIZ 1RTP1 1PVAA 2G9BA 2G2BA 3ST0A 3LVDA 2DDDA 1ZUXA 1CB1A 1H4BA 1GQMA 4B5YA 1YHIA 3CWGA 3SG4A 3JVTB 5HZTA 2BL0B 2FWQA 3NSLA 1OSAA 3ADFA 2ZMUA 1K9KA 1K93D 2JTZA 4RTCA 4W75A 4LW5A 1CFPA 3O6BA 2LVKA 3DPXA 2Z6XA 2H6VA 4KPIA 5KTGA 2LAPA 5FVGA 2A50B 1QYFA 4W6TA 1QXPA 1BF5A 1KK8B 3DVKA 1XFUO 1ZFSA 3ZWHA 1OZOA 3GJ2A 2HQZA 1H6RA 3SVSA 1KQVA 3DVJA 4EN1A 5D69A 4I2YA 1ZUZA 5DQBA 1ZACA 3JVTC 3PM8A 2H61A 1RRXA 4W7DA 4W6DA 5DRGA 3PATA 3AI4A 2IOVA 4YGEB 4GUKA 4F0ZB 2NCOA 1XFXO 2KI6D 3I5HC 3E5TA 4ORBB 2ZN8A 2H5PA 4AS8A 2A52B 3BXCA 2F2OA 4PHJA 3ZNIA 4BY4A 3LSAA 4W7EA 1F09A 4Z4KA 2WSNA 5DKNA 2KSPA 2PXWA 4N3DA 1S5GZ 3BUWB 2VVHA 3K1KA 2H2KA 4LJDA 1EMLA 1B7TY 4GOBA 1XK4A 5FVFA 4P1QA 1J55A 2KGBC 3O4YA 2OGRA 5IBWA 2O24A 4W6RA 1ALWA 2EMOA 3DPZA 4QJ3B 1FI6A 1AJ5A 1NX2A 3S05A 4XGYA 3VGOA 4LJDC 3CFHA 1FF1A 2ZRTA 3ICBA 3DQKA 3NEDA 4CLNA 3OX5A 2CCMA 4JC2A 3IP2A 1IG5A 5HLVA 3EVUA 1MXLC 3OHMB 4NWSA 2R2IA 1WRLA 2WHSA 2O5GA 4ZIOA 2CT9A 1WRZA 2TN4A 1NUBA 2AWLA 1XFWO 1RMMA 3BXBA 4DKMA 5BT0A 1SRAA 3BOWA 1DF0A 2M3WA 3EK4A 1Q80A 1KK8C 4NDCA 5DU0A 2F2PA 4Q7TA 1SL8A 2G6YA 2KBIA 3EK8A 1XVJA 1YR5A 3M22A 3SG5A 4ZF5A 4Z4MA 2LVIA 1G7KA 5BTTB 3LA1A 3A8SA 1OXFA 4JPZB 5DTZA 5I2QA 1UHKA 2WCEA 2M0RA 5DQMA 3SSLA 2DOQA 2BBNA 1SCMC 2BE6A 4GAOA 3RLZA 4DUQA 1EG3A 2K61A 1YHGA 1NIWA 1GL4A 3TMRA 2KHNA 3DQ8A 2QZ0A 3OSQA 4I5KA 4OKHA 3IR8A 3SG7A 3WLCA 2FCDA 2A47A 1OMRA 2PMYA 2OS8C 3EKJA 1MOUA 1QYQA 2KQYA 2H8QA 1NYAA 2K7OA 1EL4A 3DVMA 3PSRA 3NXAA 2BCBA 1U5IA 1Y1UA 4OR9B 3D0YA 2Q57A 4W7CA 1OQPA 3I5HB 4MRYA 3LK1A 1BLQA 1KK7Y 1E8AA 3GOFA 1EH2A 3I19A 4YBHB 3WHUB 1RM9A 1CM1A 2PALA 1L2OB 2JQ6A 4EMQA 1MHOA 2VVJA 2HJOA 1QIVA 1WY9A 2L5XB 1WDCC 4H48A 2VRGA 2OTEA 4CPVA 2BCAA 3GJ1A 3AAKA 1B7TZ 5AXIA 4U2VA 2MLEC 1FI5A 2WHUA 2JRFA 3VROA 3SSTA 1F0BA 5EXUA 2B3PA 3W1DA 1Q4CA 4W6SA 3ZULA 1LINA 4Q9WA 1YURA 5EXBA 1RJVA 4W6IA 4R6BA 2JPTA 1YRTB 5CSJA 2L4IA 3LCPC 2IB6A 4W69A 2V4EB 4H3MA 1S26D 3SVCA 2LE9B 1BR1B 1MOVA 2WHTA 5ER5A 3WCKA 2K7CA 2L50A 4W7FA 1SNLA 2VAEA 4RYWA 1JBZA 4MSPA 1A75A 1Q73A 1JC2A 1GGWA 4GPLB 1QTXA 3P8UA 2Y0GA 1DMOA 1OXEA 1CDPA 1Y1XA 1HUYA 2DUGA 4UTSA 3DD4A 3LVAA 1TCFA 1TRFA 4ZFSA 1JSAA 4HVFA 4XVPA 1XQMA 5EJUA 4M2PA 3ST2A 1EMMA 2AWJA 3SVNA 3QRXA 5HZUA 3H1RA 3P28A 5F9GA 2QT2A 3BUMB 3I5FB 1Y6WA 5F6TA 4KF5A 4PPJA 1WRKA 2QLGB 5HW9A 1BMOA 4AR7A 1F4QA 1CLLA 2VADA 1MUXA 4W72A 1EMGA 4KW4A 2VVIA 1YTZC 1LVCD 2ZFDA 2KI6C 4DRWA 2QRFA 4ICBA 1YRUB 2DUEA 5DTYA 4Q7RA 1A03A 3DQMA 2Y5IA 3GB3A 3VHTB 3SVBA 1S1EA 1CFFA 1QATA 1DJZA 5H89A 3WNXB 5DKRA 3BUNB 1J1DA 1JFJA 4C0LA 1ODBA 3PALA 4L9MA 3I5FC 5EBJA 2LLSA 3DQ5A 2DUFA 2JXCA 3GK1A 1CV7A 1FBVA 1CMGA 1NWDA 2WNDA 4GNKB 3TS5B 2OPOA 3D10A 1RK9A 1C07A 4TZAA 1KFUS 1DT7B 1H8BA 3LS3A 4EDOA 3CD9A 5DPHA 2KDHA 1YZWA 2KNEA 2MAZA 1ZOTB 3BYAA 4W6BA 1EJ3A 1F55A 3DQ7A 1SL9A 5DKQA 1AK8A 2KFGA 5BTTA 3PN7B 1K95A 5HZOA 2RGIA 1UURA 3TS5C 1ZGPA 4A4BA 5LK4A 1JFKA 3VHTA 2CBLA 1UHNA 5EB6A 2WC8A 3NT3A 2Y1NA 2KFHA 2I18A 2KFFA 1N2DA 3DQNA 4TZGA 4IZNA 2M8UA 1W7JB 1MQ1A 2LLUA 3H1OA 1IRJA 5HLOA 2M97A 1M46A 1QX7A 2YFPA 1OMVA 1RMOA 1IH0A 3OSRA 4KEXA 1JBYA 4W6AA 2JZIA 3CR2A 2Z6ZA 3E3RA 4MZJA 4OJ0A 2F8PA 1K96A 2OKWA 2ICRA 1QX2A 1DJYA 2Y4QA 4LQTA 1IJ5A 1J7OA 1YX7A 2IB5A 3DQEA 2LNKA 3BXAA 4GESB 2K2AA 1EMEA 1TNQA 1WLMA 1IWQA 1Q4BA 2FJUB 2ISDA 1GGXA 2K8MB 2NXQA 1S36A 1K9PA 4W7AA 2G3DB 1TTXA 2FCEA 4OGSA 1YHHA 4ZF4A 3SVEA 2Q4UA 2BTJA 2OTGB 2BL0C 1YJFA 1DJGA 2VZXA 4IK4A 2AWKA 3W1CA 4HQ8A 5AEQA 5H87A 1PK0D 2L2EA 4BY5A 2LHLA 4ZCVA 1KYRA 3BXKA 4U8DA 3O78A 1XO5A 1CM4A 3DQUA 3U8PA 2FZUA 1FW4A 1QIWA 2A54B 1QV1A 2DDCA 2A56B 2JU0A 2G3OA 2QLGA 4MVFA 2QLEA 1JF2A 2I94A 4PPKA 1OE9B 4PE7A 4Q7UA 4W6LA 4DXOA 2L98A 2WURA 4ORCB 4PALA 1NX1A 2P4MA 1X02A 1AUIB 1XFZO 3GL4A 1EMAA 3UFZA 2HCGA 2EHBA 4W6JA 4W76A 4P2YB 1CDNA 2OS8B 1EMCA 1LKJA 3SIAA 1OXDA 1IGVA 3MSEB 1B47A 3DQ9A 3LLEA 5AQBB 1J7RA 4W6GA 3U0LA 4KF4A 2AHAA 1BU3A 3VRQA 4Q9XA 3DQ4A 2JADA 4PE4A 4ZBLA 2WIQA 3RWAA 1K94A 4ORNA 3DF0A 3D0YB 1DVIA 3SIBA 4LQUA 2WCFA 1RWYA 3SVOA 3K21A 4QJ4B 4IK1A 4EDSA 3NT9A 1PSRA 4PPLA 4I5JA 2M29A 5KSZA 5T3IA 1HT9A 4MRXA 5KTYA 1QLSA 5JOLA 1V1FA 1K90D 4N5XA 4R6DA 4R1EA 1DJXA 2I7AA 4IK8A 1KQMB 3SG6A 2LMUA 2AAOA 1A29A 3SJSA 1S3PA 1J7QA 1SPYA 5HGEA 3FS7A 4ZB1A 4USLA 5CSIA 3PLFB 1SR6B 2JXLA 3U0MA 1JBAA 4OV2A 2LVJA 2C9IA 4JFGA 3KCTA 3SSYA 4HQ9A 3DQLA 2ZO7A 5ER4X 4JGEA 2C9JA 1YUTA 3DQIA 1KQMC 1OMDA 5HZSA 2KAVA 3DQ3A 2BBMA 3DQDA 1YX8A 1SKTA 2L4HA 3U0KA 4XYNA 2A46A 1M39A 3HCMA 2HQ8A 3CB9A 3MGFA 2AH8A 3CS1A 4YGAA 4B30B 2G2SB 4W7XA 2ZRSA 2LVVA 1PSBA 2IE2A 2JT0A 4P5OE 4W6CA 1NCXA 3U8AA 2DD9A 2HFCA 1LXFC 1K9UA 1HQVA 4D1EA 2LMVA 3DPWA 4IL1A 3CFFA 2HPSA 2NZ0A 1BG1A 1JC0A 4KGEA 1Q4EA 2JC2A 2EC6B 3TDIA 2QLHA 2WOSA 1W7UA 1F54A 4AQJA 5FYXA 1PALA 5J2OA 1SK6D 1G8IA 2G5ZB 2GGZA 2LV7A 1RFJA 3ED8A 1TOPA 4DCKA 4PHMA 2K2FA 4KGFA 4JWQA 3VK1A 3CD1A 1XSSA 1B8CA 1QYOA 2YDZA 1XYDA 1GJYA 3CBEA 4FTGA 4W6OA 2BECA 1H4UA 1DJWA 2B1UA 2I2RE 1QLKA 1TNWA 4W77A 3IQQA 1UHJA 1AP4A 4J88A 2D8NA 1BT6A 2K0JA 5TNCA 1C7WA 2HQKA 4CFRA 1KWOB 4HSZA 1W7IB 4C0KA 1B9AA 2COLB 4YGCB 3VICA 4DXQA 2H5OA 4XJKA 1KP5A 2GW3A 3OX6A 2KI4B 1NX3A 4UPGA 4W6PA 5D7FA 3SSVA 5JJGA 3OB2B 1TIZA 3SSPA 4CIDA 1QXTA 3DQFA 5HKZA 4GGFA 4W6UA 4PCWA 1BFPA 5GQQC 2BE4A 1PVBA 2GX2A 1C7VA 1OOJA 2KI4C 3TDZA 2KAYA 4MZKA 2P6BB 1XMZA 2QU1A 3AKAA 5FHVA 4H3LA 4GFTA 1Y0VH 3KHEA 1DGUA 2ZMWA 4DS7A 3ZUJA 4IK5A 4EULA 3HX4A 1MYWA 4JEOA 3NEZA 3I5GB 1SY9A 1XAEA 2WSOA 2HPWA 3NSIA 2G6XA 4KF5C 3LF4B 4QJ5B 1CFCA 5HYDA 2PVBA 4W6HA 4NQGA 5I2OA 5BPJA 2Y1MA 1RROA 1M63B 4H47A 3SS0A 4XJKB 2OTBA 3LF3A 2JWWA 2YE1A 2KOTA 5DPJA 2JT8A 3LL8B 1XK4C 1KFUL 2PASA 4DIRA 1CLMA 2LM5A 1KCYA 1UHIA 4ZINA 1KFXS 2JNXA 2EMNA 2PRUA 1YVLA 3GK2A 1DF0B 2A53B 2G16B 2ZO6A 4GBAA 2FL1A 4HREE 1NX0A 1FPWA 4L12A 1NPQA 5DRFA 4KAGA 4ZCUA 3M24A 4AQIA 2HQWA 3EVVA 1SL7A 2ZKMX 4PHNA 3SV5A 1NSHA 2HGDA 4KA9A 3WLDA 1A4PA 4MN0A 4IK9A 4CFQA 4ORAB 3RWTA 4N1FA 2KGRA 3AAJA 1W7TA 4RYSA 3EVPA 4XOVA 2JULA 5DTLA 1PULA 2ZNEA 1S6JA 1Q4DA 1A75B 3KCSA 3SG3A 4J89A 2GV5A 2JOJA 3CFAA 4DXPA 1CDMA 3DQ2A 3KPXA 5BQLA 3PFVA 1EG4A 1DJIA 1F4OA 3FIAA 5HBDA 3TDUA 2JNFA 3CR4X 4LJBA 1S6CA 1M45A 2SCPA 3PIBA 4DXMA 2B3QA 2SASA 2A4JA
chains in the Genus database with same CATH superfamily
4JQ0D 1R2UA 2OJKA 5HKWA 1AVSA 1OOHA 2AUCA 3WHTB 2QEVA 2F3YA 1SCMB 1Z2CB 2MRDA 2E6WA 4HQCA 2Z6YA 3E5WA 3SRYA 2M7LA 2F33A 1W7SA 5LTRA 1DTLA 2F3ZA 3FE8A 4INWA 4JRBA 1MF8B 2E30A 3SG2A 4E68A 5AANA 1LA0A 4WQ2A 2JT3A 3SSKA 5DY6A 3PN7C 1KSOA 1NP8A 2JPOA 3D75A 4MBEA 1QVIY 1CFDA 2G6EA 5H88A 3CGAA 1MWNA 5AERA 3SVDA 2O29A 3BFHA 1TNXA 1BJFA 2AMIA 4N1GA 2MJWB 3NHIA 1QX5B 3R72A 1JWDA 4YGDB 4KW9A 2ZN9A 4J8AA 3DQAA 1SR6C 1K8UA 1TN4A 2QPTA 4OCIA 1KK7Z 3VRRA 1M31A 2OTGC 5KU1A 1KYPA 3ST4A 1N65A 3EVRA 4B30A 5CSFA 2NCPA 2CTNA 3UG0A 3IF7A 1U5IB 2LUCA 1BOCA 2MBXA 5LTQA 1GM0A 1ZGQA 1LS8A 2PSRA 4L13A 1J1EA 1P28A 2WISA 4W6MA 2GW4B 2PXSA 1F71A 4WQ3A 4OVNF 2DUHA 3SVRA 4W73A 1QASA 3S0GA 5DPGA 1Z1PA 1IQ3A 1UWOA 3E5VA 4XOWA 2FOTA 3B86A 3DQJA 5EB7A 1T14A 3OGOA 1OOGA 1WDCB 2HRSA 3CYZA 1NCYA 1SMGA 3PJ5A 3U0NA 1B8LA 4HE4A 2BCXA 2EGDA 1QV0A 4MEWA 4KW8A 3B7AA 1J7PA 4I5NB 1CNPA 3KO0A 1CDLA 2ERBA 4ZF3A 2K7BA 2WCBA 3F45A 2H9WA 4BDUA 3SS4A 4TNCA 1F8HA 1CLBA 5CSNA 1KFXL 3I5IC 2M49B 2WCMA 5AFPA 1G4YR 3ST3A 1Y1AA 2KQ6A 3BOWB 3WXAA 2H5QA 1G33A 1R6PA 1BR4B 3KEVA 3FE9A 4P76A 2BKIB 3OP0A 3AI5A 1JUOA 1B1GA 1UUSA 3ZTFA 3DQHA 1B9CA 3DQOA 3VRPA 2EC6C 3SVUA 2H61C 1QS7A 4FQOA 1EMFA 1D1OA 1EXRA 1SBJA 3O4XA 1B4CA 2DUIA 3G9AA 2KAXA 5K89A 2AWMA 1SW8A 4M2OA 1Z1QA 1Q4AA 3I5IB 4Q04A 1L2OC 3RZSA 2LANA 2KYFA 3A8RA 3BUOB 4OY4A 1ALVA 4DXNA 4C0JA 1DJHA 5DTXA 1QY3A 4W6KA 3U8CA 1HCJA 3H4SE 1DQEA 3KF9A 1CTRA 5LTPA 4GF6B 1AJ4A 4ANJA 1YFPA 4PHKA 1N0YA 3SSHA 2POXA 3DVEA 1UP5A 3NGVA 1IKUA 1GFLA 4W6FA 5G08A 4NDDA 3NF0A 4HRHA 4I5LB 4PDZA 3CGLA 1ZMZA 1ZGOA 3GK4X 3LVCA 2JTTA 4W7RA 2CXJA 3CABA 2IS9A 4MZLA 1B8RA 2HETA 4L1IA 2V4EC 3NSKA 3DQ6A 4DKNA 3BQ3A 4YGBB 3M0WA 2ZNDA 3EKHA 4PE0A 3JTDB 1XA9A 3QMEA 4YI8A 2Z1OA 5I8NA 2QLIA 3CR5X 3O2PA 2WCKA 1EMBA 2LHIA 1SYMA 2MLFC 1KYSA 2RH7A 1IQ5A 1JF0A 3FWBA 3VB1A 4JF9A 2LUXA 4W6NA 4OQWA 1QJTA 2DD7A 2WCJA 3CTNA 4M2QA 3PJ7A 1EMKA 2K7DA 3LK0A 1MXEA 2HF5A 1A2XA 1L7ZA 4NDBA 1RECA 3RM1A 2LLTA 3AKOA 1TCOB 1RMPA 1CMFA 4GGFC 5FVIA 1V1GA 4MLWA 1LA3A 5J3XA 2GGMA 2K60A 2CNPA 2H5RA 1VRKA 3BX9A 3ZUFA 2WORA 3OB1B 5B8IB 2LCPA 1UHHA 2YE0A 4AOMA 3EK7A 2HGYA 1UISA 2Q6PA 1GGZA 3GEXA 2L51A 2V4EA 2NLNA 2KBMA 3I5GC 3DF0B 4ETOA 4A4CA 4YRUA 4YI9A 1S6ZA 2V53A 2O60A 1JC1A 1OZSA 1K2HA 1CKKA 2M7NA 1NCZA 2M1UA 3TMTA 2O2BA 5PALA 3TZ1A 5EHUA 4PFEA 2LP2A 5HKYA 2M1KB 1TNPA 4GGNA 5DPIA 2OKYA 2MHHA 5I2LA 2A48A 4W74A 3TUYC 1XA5A 2L0PA 1C4FA 1S5GY 1DGVA 1KSMA 1YUSA 1PRWA 4WRIA 3IQOA 3BUXB 3VRNA 1XFYO 2LMTA 1BODA 3PJBA 1XFVO 1AHRA 2M9GA 5D3OA 2MA2A 3CZTX 4PE1A 2QEHA 2EMDA 3CDNA 3NSOA 2LP3A 4HRGA 2GX0A 1MR8A 1YVHA 3O77A 2QEBA 3A4UB 3D74A 3V3DA 2BKHB 3AKBA 3FWCA 4OHSA 3JTDC 3CLNA 2LC5A 3TUYB 4LJCA 4IJ7A 4IK3A 3CZ0A 3DQ1A 4XL5A 1KWOC 4H3NA 4DXIA 5EXCI 1S6IA 3DQCA 1F70A 2ARLA 3S0BA 5FI7A 1WLZA 1SCVA 5CPVA 3C1VA 1IJ6A 2Q91A 2KYCA 2QACA 1YJ2A 1YUUA 1QVIZ 1RTP1 1PVAA 2G9BA 2G2BA 3ST0A 3LVDA 2DDDA 1ZUXA 1CB1A 1H4BA 1GQMA 3L47A 4B5YA 1YHIA 3CWGA 3SG4A 3JVTB 5HZTA 2BL0B 2FWQA 3NSLA 1OSAA 3ADFA 2ZMUA 1K9KA 1K93D 2JTZA 4RTCA 4W75A 4LW5A 1CFPA 3O6BA 2LVKA 4PT1A 1C3YA 3DPXA 2Z6XA 2L2CA 2H6VA 4KPIA 5KTGA 2LAPA 5FVGA 2A50B 1QYFA 4W6TA 1QXPA 1BF5A 1KK8B 3DVKA 1XFUO 1ZFSA 3ZWHA 1OZOA 3GJ2A 2HQZA 1H6RA 3SVSA 1KQVA 3DVJA 4EN1A 5D69A 4I2YA 1ZUZA 5DQBA 1ZACA 3JVTC 3PM8A 2H61A 1RRXA 4W7DA 4W6DA 3PATA 5DRGA 3AI4A 2IOVA 4YGEB 4GUKA 3IVTA 4F0ZB 2NCOA 1XFXO 2KI6D 3I5HC 3E5TA 3DXLA 4ORBB 2ZN8A 2H5PA 4AS8A 2A52B 3BXCA 2F2OA 4PHJA 3ZNIA 4BY4A 3LSAA 4W7EA 1F09A 4Z4KA 2WSNA 3EG5B 5DKNA 2KSPA 2PXWA 4N3DA 1S5GZ 3BUWB 2VVHA 3K1KA 2H2KA 4LJDA 1EMLA 1B7TY 4GOBA 1XK4A 5FVFA 4P1QA 1J55A 2KGBC 3R1OA 3O4YA 2OGRA 5IBWA 2O24A 4W6RA 1ALWA 2EMOA 3DPZA 4QJ3B 1FI6A 2WC6A 1AJ5A 1NX2A 3S05A 4XGYA 3VGOA 4LJDC 3CFHA 1FF1A 2ZRTA 3ICBA 3DQKA 3NEDA 4CLNA 3OX5A 2CCMA 4JC2A 3IP2A 1IG5A 5HLVA 3EVUA 1MXLC 3OHMB 4NWSA 2R2IA 1WRLA 2WHSA 2O5GA 4ZIOA 4JKTA 2CT9A 1WRZA 2TN4A 1NUBA 2AWLA 1XFWO 1RMMA 3BXBA 4DKMA 5BT0A 1SRAA 3BOWA 1DF0A 2M3WA 3EK4A 1Q80A 1KK8C 4NDCA 5DU0A 2F2PA 4Q7TA 1SL8A 2G6YA 3PJIA 2KBIA 3EK8A 1XVJA 1YR5A 2BAPA 3M22A 3SG5A 4ZF5A 4Z4MA 2LVIA 1G7KA 5BTTB 3LA1A 3A8SA 1OXFA 4JPZB 5DTZA 5I2QA 1C3ZA 1UHKA 3BFBA 2WCEA 2M0RA 5DQMA 3SSLA 2DOQA 2BBNA 1OW4A 1SCMC 2BE6A 4GAOA 3RLZA 4DUQA 1EG3A 2H8VA 2K61A 1YHGA 1NIWA 1GL4A 3TMRA 2KHNA 3DQ8A 2QZ0A 3OSQA 4I5KA 4OKHA 3IR8A 3SG7A 2FCDA 3WLCA 2A47A 1OMRA 2PMYA 2OS8C 3EKJA 1MOUA 1QYQA 2KQYA 2H8QA 1NYAA 2K7OA 1EL4A 3DVMA 3PSRA 3NXAA 2BCBA 1U5IA 1Y1UA 4OR9B 3D0YA 2Q57A 4W7CA 1OQPA 3I5HB 4MRYA 3LK1A 1BLQA 1KK7Y 1E8AA 3GOFA 1EH2A 3I19A 4YBHB 3WHUB 1RM9A 1CM1A 2PALA 1L2OB 2JQ6A 3N7HA 4EMQA 1MHOA 2VVJA 2HJOA 1QIVA 1WY9A 2L5XB 1WDCC 4H48A 2VRGA 2OTEA 4CPVA 2BCAA 3GJ1A 3AAKA 1B7TZ 5FI2A 5AXIA 4U2VA 2MLEC 1FI5A 2WHUA 2JRFA 3VROA 3SSTA 1F0BA 5EXUA 2KLEA 2B3PA 3W1DA 3R1VA 1Q4CA 4W6SA 3ZULA 1LINA 4Q9WA 3D73A 1YURA 3D77A 5EXBA 1OOIX 1RJVA 4W6IA 4R6BA 2JPTA 1YRTB 5CSJA 2L4IA 3LCPC 2IB6A 4W69A 2V4EB 4H3MA 2P71A 1S26D 3SVCA 2LE9B 1BR1B 1MOVA 2BNXA 2WHTA 5ER5A 3WCKA 2K7CA 2L50A 4W7FA 1SNLA 2VAEA 4RYWA 4FQTA 1JBZA 4MSPA 1A75A 3L4LA 1Q73A 1JC2A 1GGWA 1DC1A 4GPLB 1QTXA 3P8UA 2Y0GA 1DMOA 1OXEA 1CDPA 1Y1XA 1HUYA 2DUGA 4UTSA 3K1EA 3DD4A 2FJYA 3DYEA 3LVAA 1Z4HA 1TCFA 1TRFA 4ZFSA 1JSAA 4HVFA 4XVPA 3B87A 1XQMA 5EJUA 4M2PA 3ST2A 1EMMA 2AWJA 3SVNA 3QRXA 5HZUA 3H1RA 3P28A 5F9GA 2QT2A 3BUMB 3BJHA 3I5FB 1Y6WA 5F6TA 4KF5A 4PPJA 1WRKA 2QLGB 5HW9A 1BMOA 4AR7A 1F4QA 1CLLA 2VADA 1MUXA 4W72A 1EMGA 4KW4A 2VVIA 1YTZC 1LVCD 2ZFDA 3UNWA 2KI6C 4DRWA 2QRFA 4ICBA 1YRUB 2DUEA 5DTYA 4Q7RA 1A03A 3DQMA 2Y5IA 3GB3A 3VHTB 3SVBA 1S1EA 2PQLA 4KYNA 1CFFA 1QATA 1DJZA 5H89A 3WNXB 5DKRA 3BUNB 1J1DA 1JFJA 4C0LA 1ODBA 3PALA 4L9MA 4OZDA 3I5FC 5EBJA 2LLSA 3DQ5A 2DUFA 2JXCA 3GK1A 1CV7A 1FBVA 1CMGA 1NWDA 2WNDA 4GNKB 2WCLA 3DZTA 3TS5B 2OPOA 3D10A 1RK9A 3NHTA 1C07A 4TZAA 1KFUS 1DT7B 1H8BA 3LS3A 4EDOA 3CD9A 5DPHA 2KDHA 1YZWA 2KNEA 2MAZA 1ZOTB 3BYAA 4W6BA 1EJ3A 1F55A 3DQ7A 1SL9A 5DKQA 1ORGA 1AK8A 2KFGA 5BTTA 3PN7B 2YGUA 1K95A 5HZOA 2RGIA 1UURA 3TS5C 1ZGPA 4A4BA 5LK4A 1JFKA 3VHTA 2CBLA 1UHNA 5EB6A 2WC8A 3NT3A 3B88A 2Y1NA 2KFHA 2I18A 2KFFA 2QDIA 1N2DA 3DQNA 4TZGA 4IZNA 1W9ZA 2M8UA 1W7JB 1MQ1A 2LLUA 3H1OA 1IRJA 5HLOA 2M97A 1M46A 1QX7A 5FI6A 2YFPA 1OMVA 1RMOA 1IH0A 3OSRA 4KEXA 1JBYA 4W6AA 2JZIA 3CR2A 2Z6ZA 3E3RA 4MZJA 4OJ0A 2F8PA 1K96A 2OKWA 2ICRA 1QX2A 1DJYA 3B6XA 2Y4QA 4LQTA 1IJ5A 1J7OA 1YX7A 2IB5A 3DQEA 2LNKA 3BXAA 4GESB 2K2AA 1EMEA 1TNQA 1WLMA 1IWQA 1Q4BA 2FJUB 2ISDA 1GGXA 2K8MB 2NXQA 1S36A 1K9PA 4W7AA 2G3DB 1TTXA 2FCEA 3S0AA 4OGSA 1YHHA 4ZF4A 3SVEA 2Q4UA 2BTJA 2OTGB 1XFRA 2BL0C 1YJFA 1DJGA 2VZXA 4IK4A 3FE6A 2AWKA 3W1CA 4HQ8A 5AEQA 3OGNA 5H87A 1PK0D 2L2EA 3UO9A 4BY5A 2LHLA 4ZCVA 1KYRA 3BXKA 5HL1A 4U8DA 3O78A 1XO5A 1CM4A 3V2LA 3DQUA 3U8PA 2FZUA 1FW4A 1QIWA 2A54B 1QV1A 2DDCA 2A56B 2JU0A 2G3OA 2QLGA 4MVFA 2QLEA 1JF2A 2I94A 4PPKA 1OE9B 4PE7A 4Q7UA 4W6LA 4DXOA 2L98A 3SS5A 2WURA 4ORCB 4PALA 1NX1A 2P4MA 1X02A 1AUIB 1XFZO 3GL4A 1EMAA 3UFZA 2HCGA 2EHBA 4W6JA 4W76A 4P2YB 1CDNA 2OS8B 2GTEA 1EMCA 1LKJA 3S0FA 3SIAA 1OXDA 1IGVA 3MSEB 1B47A 3DQ9A 3LLEA 5AQBB 1J7RA 4W6GA 3U0LA 4KF4A 2AHAA 1BU3A 3VRQA 4Q9XA 3DQ4A 2JADA 4PE4A 2L5YA 4ZBLA 2WIQA 3RWAA 1K94A 4ORNA 3DF0A 3D0YB 1DVIA 3SIBA 4LQUA 3BFAA 2WCFA 1RWYA 3SVOA 3R1PA 3K21A 4QJ4B 4IK1A 4EDSA 3NT9A 1PSRA 4PPLA 4I5JA 2M29A 5KSZA 3DY9A 5T3IA 1HT9A 4MRXA 5KTYA 1QLSA 5JOLA 5EL2A 1V1FA 1K90D 4N5XA 1TWOA 4R6DA 4R1EA 1DJXA 2I7AA 4IK8A 1KQMB 3SG6A 2LMUA 2AAOA 1A29A 1DELA 3SJSA 1S3PA 1J7QA 1SPYA 5HGEA 2P70A 3FS7A 1QWVA 4ZB1A 4USLA 5CSIA 3PLFB 1SR6B 2JXLA 3U0MA 1JBAA 4OV2A 2LVJA 2C9IA 4JFGA 3KCTA 3SSYA 4HQ9A 3DQLA 2ZO7A 5ER4X 4JGEA 2C9JA 1YUTA 3DQIA 1KQMC 1OMDA 5HZSA 2KAVA 3DQ3A 2BBMA 3DQDA 1YX8A 1SKTA 2L4HA 3U0KA 4XYNA 2A46A 1M39A 3HCMA 2HQ8A 3CB9A 1SSEB 3MGFA 2AH8A 3CS1A 3PM2A 4YGAA 4B30B 3S0DA 2G2SB 4W7XA 2ZRSA 2LVVA 1PSBA 2IE2A 3L4AA 2JT0A 4P5OE 4W6CA 1NCXA 3U8AA 2DD9A 2HFCA 1LXFC 1K9UA 1HQVA 4D1EA 2LMVA 3DPWA 4IL1A 3CFFA 2HPSA 3CZ2A 2NZ0A 1BG1A 1JC0A 4KGEA 1Q4EA 2JC2A 2EC6B 3TDIA 2QLHA 2WOSA 1W7UA 1F54A 4AQJA 5FYXA 1PALA 5J2OA 1SK6D 1G8IA 2G5ZB 2PYQA 2GGZA 2LV7A 1RFJA 3ED8A 1TOPA 4DCKA 4PHMA 2K2FA 4KGFA 4JWQA 3VK1A 3CD1A 1XSSA 1B8CA 1QYOA 2YDZA 1XYDA 1GJYA 2KLDA 4FTGA 3CBEA 4W6OA 2BECA 1DEKA 1H4UA 1DJWA 2B1UA 2I2RE 1QLKA 2WC5A 1TNWA 4W77A 3SS3A 3IQQA 1UHJA 1AP4A 4J88A 2KPHA 2D8NA 1BT6A 2K0JA 5TNCA 1C7WA 2HQKA 4CFRA 1KWOB 4HSZA 1W7IB 4C0KA 1B9AA 2COLB 4YGCB 3VICA 4DXQA 2H5OA 4XJKA 1KP5A 2GW3A 3OX6A 2QEOA 2KI4B 1NX3A 4UPGA 4W6PA 5D7FA 3SSVA 5JJGA 3OB2B 1TIZA 3SSPA 4CIDA 1QXTA 3DQFA 5HKZA 4GGFA 4W6UA 4JD9A 4PCWA 1BFPA 5GQQC 2BE4A 1PVBA 2GX2A 1C7VA 1OOJA 2KI4C 3TDZA 2KAYA 4MZKA 2P6BB 1XMZA 2QU1A 3AKAA 5FHVA 4H3LA 4GFTA 1Y0VH 3KHEA 1DGUA 2ZMWA 4DS7A 3ZUJA 4IK5A 4EULA 3HX4A 5DICA 1MYWA 4JEOA 3NEZA 3I5GB 1SY9A 1XAEA 2WSOA 2HPWA 3NSIA 2G6XA 4KF5C 3LF4B 4QJ5B 1CFCA 5HYDA 2PVBA 1OOFA 4W6HA 4NQGA 5I2OA 5BPJA 2Y1MA 1RROA 1M63B 3CZ1A 4H47A 3SS0A 4XJKB 2OTBA 3LF3A 2JWWA 2YE1A 2KOTA 5DPJA 2JT8A 3LL8B 1XK4C 1KFUL 2PASA 4DIRA 1CLMA 2LM5A 1KCYA 1UHIA 4ZINA 1KFXS 2JNXA 2EMNA 2PRUA 1YVLA 2WCHA 3GK2A 1DF0B 3D78A 2A53B 2G16B 2ZO6A 4GBAA 2FL1A 1IIOA 4HREE 1NX0A 1FPWA 4L12A 1NPQA 5DRFA 4KAGA 3Q8IA 4ZCUA 3M24A 4AQIA 4F7FA 2HQWA 3EVVA 1SL7A 2ZKMX 4PHNA 3SV5A 1NSHA 2HGDA 4KA9A 3WLDA 1A4PA 3OBVA 4INXA 4MN0A 4IK9A 4CFQA 4ORAB 3RWTA 4N1FA 2KGRA 3AAJA 1W7TA 4RYSA 3EVPA 3S0EA 4XOVA 2JULA 5DTLA 1PULA 2ZNEA 1S6JA 1Q4DA 1A75B 5I94A 3KCSA 3SG3A 4J89A 2GV5A 2JOJA 3CFAA 4DXPA 1CDMA 3DQ2A 3KPXA 3D76A 5BQLA 3PFVA 1EG4A 1DJIA 1F4OA 3FIAA 1TUJA 5HBDA 1TUZA 3TDUA 2JNFA 3CR4X 4LJBA 1S6CA 1M45A 2SCPA 3PIBA 4DXMA 2B3QA 2SASA 2A4JA
chains in the Genus database with same CATH topology
4JQ0D 1R2UA 2OJKA 5HKWA 1AVSA 2AUCA 3WHTB 2F3YA 1SCMB 2MRDA 2E6WA 4HQCA 2Z6YA 3E5WA 3SRYA 2M7LA 2F33A 1W7SA 5LTRA 1DTLA 2F3ZA 4JRBA 1MF8B 2E30A 3SG2A 4E68A 5AANA 1LA0A 4WQ2A 2JT3A 3SSKA 5DY6A 3PN7C 1KSOA 1NP8A 4MBEA 1QVIY 1CFDA 2G6EA 5H88A 3CGAA 1MWNA 5AERA 3SVDA 2O29A 1TNXA 1BJFA 2AMIA 4N1GA 2MJWB 1QX5B 1JWDA 4YGDB 4KW9A 2ZN9A 4J8AA 3DQAA 1SR6C 1K8UA 1TN4A 2QPTA 4OCIA 1KK7Z 3VRRA 1M31A 2OTGC 5KU1A 1KYPA 3ST4A 1N65A 3EVRA 4B30A 5CSFA 2NCPA 2CTNA 3UG0A 3IF7A 1U5IB 2LUCA 1BOCA 2MBXA 5LTQA 1ZGQA 2PSRA 4L13A 1J1EA 2WISA 4W6MA 2GW4B 2PXSA 1F71A 4WQ3A 4OVNF 2DUHA 3SVRA 4W73A 1QASA 5DPGA 1Z1PA 1IQ3A 1UWOA 3E5VA 4XOWA 2FOTA 3DQJA 5EB7A 3OGOA 1WDCB 2HRSA 1NCYA 1SMGA 3PJ5A 3U0NA 1B8LA 4HE4A 2BCXA 2EGDA 1QV0A 4MEWA 4KW8A 1J7PA 4I5NB 1CNPA 3KO0A 1CDLA 4ZF3A 2K7BA 2WCBA 3F45A 2H9WA 4BDUA 4TNCA 1F8HA 1CLBA 5CSNA 1KFXL 3I5IC 2M49B 5AFPA 1G4YR 3ST3A 1Y1AA 2KQ6A 3BOWB 3WXAA 2H5QA 1G33A 1R6PA 1BR4B 3KEVA 4P76A 2BKIB 3OP0A 3AI5A 1JUOA 1B1GA 1UUSA 3ZTFA 3DQHA 1B9CA 3DQOA 3VRPA 2EC6C 3SVUA 2H61C 1QS7A 4FQOA 1EMFA 1D1OA 1EXRA 1SBJA 1B4CA 2DUIA 3G9AA 2KAXA 5K89A 2AWMA 1SW8A 4M2OA 1Z1QA 1Q4AA 3I5IB 4Q04A 1L2OC 2LANA 2KYFA 3A8RA 3BUOB 4OY4A 1ALVA 4DXNA 4C0JA 1DJHA 5DTXA 1QY3A 4W6KA 3U8CA 1HCJA 3H4SE 3KF9A 1CTRA 5LTPA 4GF6B 1AJ4A 4ANJA 1YFPA 4PHKA 1N0YA 3SSHA 2POXA 3DVEA 1UP5A 1IKUA 1GFLA 4W6FA 5G08A 4NDDA 3NF0A 4HRHA 4I5LB 4PDZA 3CGLA 1ZMZA 1ZGOA 3GK4X 3LVCA 2JTTA 4W7RA 2CXJA 2IS9A 4MZLA 1B8RA 2HETA 4L1IA 2V4EC 3NSKA 3DQ6A 4DKNA 3BQ3A 4YGBB 3M0WA 2ZNDA 3EKHA 4PE0A 3JTDB 1XA9A 4YI8A 2Z1OA 5I8NA 2QLIA 3CR5X 3O2PA 1EMBA 2LHIA 1SYMA 2MLFC 1KYSA 2RH7A 1IQ5A 1JF0A 3FWBA 4JF9A 2LUXA 4W6NA 4OQWA 1QJTA 2DD7A 3CTNA 4M2QA 3PJ7A 1EMKA 2K7DA 3LK0A 1MXEA 2HF5A 1A2XA 1L7ZA 4NDBA 1RECA 3RM1A 2LLTA 3AKOA 1TCOB 1RMPA 1CMFA 4GGFC 5FVIA 1V1GA 4MLWA 1LA3A 5J3XA 2GGMA 2CNPA 2H5RA 1VRKA 3BX9A 3ZUFA 2WORA 3OB1B 5B8IB 2LCPA 1UHHA 2YE0A 4AOMA 3EK7A 2HGYA 1UISA 2Q6PA 1GGZA 3GEXA 2L51A 2V4EA 2NLNA 2KBMA 3I5GC 3DF0B 4ETOA 4A4CA 4YRUA 4YI9A 1S6ZA 2V53A 2O60A 1JC1A 1OZSA 1K2HA 1CKKA 2M7NA 1NCZA 2M1UA 3TMTA 2O2BA 5PALA 3TZ1A 5EHUA 4PFEA 2LP2A 5HKYA 2M1KB 1TNPA 4GGNA 5DPIA 2OKYA 2MHHA 5I2LA 2A48A 4W74A 3TUYC 1XA5A 2L0PA 1C4FA 1S5GY 1DGVA 1KSMA 1YUSA 1PRWA 4WRIA 3IQOA 3BUXB 3VRNA 1XFYO 2LMTA 1BODA 3PJBA 1XFVO 1AHRA 2M9GA 2MA2A 3CZTX 4PE1A 2EMDA 3NSOA 2LP3A 4HRGA 2GX0A 1MR8A 1YVHA 3O77A 3A4UB 3V3DA 2BKHB 3AKBA 3FWCA 4OHSA 3JTDC 3CLNA 2LC5A 3TUYB 4LJCA 4IK3A 3DQ1A 4XL5A 1KWOC 4H3NA 4DXIA 5EXCI 1S6IA 3DQCA 1F70A 2ARLA 1WLZA 1SCVA 5CPVA 3C1VA 1IJ6A 2Q91A 2KYCA 2QACA 1YJ2A 1YUUA 1QVIZ 1RTP1 1PVAA 2G9BA 2G2BA 3ST0A 3LVDA 2DDDA 1ZUXA 1CB1A 1H4BA 1GQMA 4B5YA 1YHIA 3CWGA 3SG4A 3JVTB 5HZTA 2BL0B 2FWQA 3NSLA 1OSAA 3ADFA 2ZMUA 1K9KA 1K93D 2JTZA 4RTCA 4W75A 4LW5A 1CFPA 3O6BA 2LVKA 3DPXA 2Z6XA 2H6VA 4KPIA 5KTGA 2LAPA 5FVGA 2A50B 1QYFA 4W6TA 1QXPA 1BF5A 1KK8B 3DVKA 1XFUO 1ZFSA 3ZWHA 1OZOA 3GJ2A 2HQZA 1H6RA 3SVSA 1KQVA 3DVJA 4EN1A 5D69A 4I2YA 1ZUZA 5DQBA 1ZACA 3JVTC 3PM8A 2H61A 1RRXA 4W7DA 4W6DA 5DRGA 3PATA 3AI4A 2IOVA 4YGEB 4GUKA 4F0ZB 2NCOA 1XFXO 2KI6D 3I5HC 3E5TA 4ORBB 2ZN8A 2H5PA 4AS8A 2A52B 3BXCA 2F2OA 4PHJA 3ZNIA 4BY4A 3LSAA 4W7EA 1F09A 4Z4KA 2WSNA 5DKNA 2KSPA 2PXWA 4N3DA 1S5GZ 3BUWB 2VVHA 3K1KA 2H2KA 4LJDA 1EMLA 1B7TY 4GOBA 1XK4A 5FVFA 4P1QA 1J55A 2KGBC 3O4YA 2OGRA 5IBWA 2O24A 4W6RA 1ALWA 2EMOA 3DPZA 4QJ3B 1FI6A 1AJ5A 1NX2A 3S05A 4XGYA 3VGOA 4LJDC 3CFHA 1FF1A 2ZRTA 3ICBA 3DQKA 3NEDA 4CLNA 3OX5A 2CCMA 4JC2A 3IP2A 1IG5A 5HLVA 3EVUA 1MXLC 3OHMB 4NWSA 2R2IA 1WRLA 2WHSA 2O5GA 4ZIOA 2CT9A 1WRZA 2TN4A 1NUBA 2AWLA 1XFWO 1RMMA 3BXBA 4DKMA 5BT0A 1SRAA 3BOWA 1DF0A 2M3WA 3EK4A 1Q80A 1KK8C 4NDCA 5DU0A 2F2PA 4Q7TA 1SL8A 2G6YA 2KBIA 3EK8A 1XVJA 1YR5A 3M22A 3SG5A 4ZF5A 4Z4MA 2LVIA 1G7KA 5BTTB 3LA1A 3A8SA 1OXFA 4JPZB 5DTZA 5I2QA 1UHKA 2WCEA 2M0RA 5DQMA 3SSLA 2DOQA 2BBNA 1SCMC 2BE6A 4GAOA 3RLZA 4DUQA 1EG3A 2K61A 1YHGA 1NIWA 1GL4A 3TMRA 2KHNA 3DQ8A 2QZ0A 3OSQA 4I5KA 4OKHA 3IR8A 3SG7A 3WLCA 2FCDA 2A47A 1OMRA 2PMYA 2OS8C 3EKJA 1MOUA 1QYQA 2KQYA 2H8QA 1NYAA 2K7OA 1EL4A 3DVMA 3PSRA 3NXAA 2BCBA 1U5IA 1Y1UA 4OR9B 3D0YA 2Q57A 4W7CA 1OQPA 3I5HB 4MRYA 3LK1A 1BLQA 1KK7Y 1E8AA 3GOFA 1EH2A 3I19A 4YBHB 3WHUB 1RM9A 1CM1A 2PALA 1L2OB 2JQ6A 4EMQA 1MHOA 2VVJA 2HJOA 1QIVA 1WY9A 2L5XB 1WDCC 4H48A 2VRGA 2OTEA 4CPVA 2BCAA 3GJ1A 3AAKA 1B7TZ 5AXIA 4U2VA 2MLEC 1FI5A 2WHUA 2JRFA 3VROA 3SSTA 1F0BA 5EXUA 2B3PA 3W1DA 1Q4CA 4W6SA 3ZULA 1LINA 4Q9WA 1YURA 5EXBA 1RJVA 4W6IA 4R6BA 2JPTA 1YRTB 5CSJA 2L4IA 3LCPC 2IB6A 4W69A 2V4EB 4H3MA 1S26D 3SVCA 2LE9B 1BR1B 1MOVA 2WHTA 5ER5A 3WCKA 2K7CA 2L50A 4W7FA 1SNLA 2VAEA 4RYWA 1JBZA 4MSPA 1A75A 1Q73A 1JC2A 1GGWA 4GPLB 1QTXA 3P8UA 2Y0GA 1DMOA 1OXEA 1CDPA 1Y1XA 1HUYA 2DUGA 4UTSA 3DD4A 3LVAA 1TCFA 1TRFA 4ZFSA 1JSAA 4HVFA 4XVPA 1XQMA 5EJUA 4M2PA 3ST2A 1EMMA 2AWJA 3SVNA 3QRXA 5HZUA 3H1RA 3P28A 5F9GA 2QT2A 3BUMB 3I5FB 1Y6WA 5F6TA 4KF5A 4PPJA 1WRKA 2QLGB 5HW9A 1BMOA 4AR7A 1F4QA 1CLLA 2VADA 1MUXA 4W72A 1EMGA 4KW4A 2VVIA 1YTZC 1LVCD 2ZFDA 2KI6C 4DRWA 2QRFA 4ICBA 1YRUB 2DUEA 5DTYA 4Q7RA 1A03A 3DQMA 2Y5IA 3GB3A 3VHTB 3SVBA 1S1EA 1CFFA 1QATA 1DJZA 5H89A 3WNXB 5DKRA 3BUNB 1J1DA 1JFJA 4C0LA 1ODBA 3PALA 4L9MA 3I5FC 5EBJA 2LLSA 3DQ5A 2DUFA 2JXCA 3GK1A 1CV7A 1FBVA 1CMGA 1NWDA 2WNDA 4GNKB 3TS5B 2OPOA 3D10A 1RK9A 1C07A 4TZAA 1KFUS 1DT7B 1H8BA 3LS3A 4EDOA 3CD9A 5DPHA 2KDHA 1YZWA 2KNEA 2MAZA 1ZOTB 3BYAA 4W6BA 1EJ3A 1F55A 3DQ7A 1SL9A 5DKQA 1AK8A 2KFGA 5BTTA 3PN7B 1K95A 5HZOA 2RGIA 1UURA 3TS5C 1ZGPA 4A4BA 5LK4A 1JFKA 3VHTA 2CBLA 1UHNA 5EB6A 2WC8A 3NT3A 2Y1NA 2KFHA 2I18A 2KFFA 1N2DA 3DQNA 4TZGA 4IZNA 2M8UA 1W7JB 1MQ1A 2LLUA 3H1OA 1IRJA 5HLOA 2M97A 1M46A 1QX7A 2YFPA 1OMVA 1RMOA 1IH0A 3OSRA 4KEXA 1JBYA 4W6AA 2JZIA 3CR2A 2Z6ZA 3E3RA 4MZJA 4OJ0A 2F8PA 1K96A 2OKWA 2ICRA 1QX2A 1DJYA 2Y4QA 4LQTA 1IJ5A 1J7OA 1YX7A 2IB5A 3DQEA 2LNKA 3BXAA 4GESB 2K2AA 1EMEA 1TNQA 1WLMA 1IWQA 1Q4BA 2FJUB 2ISDA 1GGXA 2K8MB 2NXQA 1S36A 1K9PA 4W7AA 2G3DB 1TTXA 2FCEA 4OGSA 1YHHA 4ZF4A 3SVEA 2Q4UA 2BTJA 2OTGB 2BL0C 1YJFA 1DJGA 2VZXA 4IK4A 2AWKA 3W1CA 4HQ8A 5AEQA 5H87A 1PK0D 2L2EA 4BY5A 2LHLA 4ZCVA 1KYRA 3BXKA 4U8DA 3O78A 1XO5A 1CM4A 3DQUA 3U8PA 2FZUA 1FW4A 1QIWA 2A54B 1QV1A 2DDCA 2A56B 2JU0A 2G3OA 2QLGA 4MVFA 2QLEA 1JF2A 2I94A 4PPKA 1OE9B 4PE7A 4Q7UA 4W6LA 4DXOA 2L98A 2WURA 4ORCB 4PALA 1NX1A 2P4MA 1X02A 1AUIB 1XFZO 3GL4A 1EMAA 3UFZA 2HCGA 2EHBA 4W6JA 4W76A 4P2YB 1CDNA 2OS8B 1EMCA 1LKJA 3SIAA 1OXDA 1IGVA 3MSEB 1B47A 3DQ9A 3LLEA 5AQBB 1J7RA 4W6GA 3U0LA 4KF4A 2AHAA 1BU3A 3VRQA 4Q9XA 3DQ4A 2JADA 4PE4A 4ZBLA 2WIQA 3RWAA 1K94A 4ORNA 3DF0A 3D0YB 1DVIA 3SIBA 4LQUA 2WCFA 1RWYA 3SVOA 3K21A 4QJ4B 4IK1A 4EDSA 3NT9A 1PSRA 4PPLA 4I5JA 2M29A 5KSZA 5T3IA 1HT9A 4MRXA 5KTYA 1QLSA 5JOLA 1V1FA 1K90D 4N5XA 4R6DA 4R1EA 1DJXA 2I7AA 4IK8A 1KQMB 3SG6A 2LMUA 2AAOA 1A29A 3SJSA 1S3PA 1J7QA 1SPYA 5HGEA 3FS7A 4ZB1A 4USLA 5CSIA 3PLFB 1SR6B 2JXLA 3U0MA 1JBAA 4OV2A 2LVJA 2C9IA 4JFGA 3KCTA 3SSYA 4HQ9A 3DQLA 2ZO7A 5ER4X 4JGEA 2C9JA 1YUTA 3DQIA 1KQMC 1OMDA 5HZSA 2KAVA 3DQ3A 2BBMA 3DQDA 1YX8A 1SKTA 2L4HA 3U0KA 4XYNA 2A46A 1M39A 3HCMA 2HQ8A 3CB9A 3MGFA 2AH8A 3CS1A 4YGAA 4B30B 2G2SB 4W7XA 2ZRSA 2LVVA 1PSBA 2IE2A 2JT0A 4P5OE 4W6CA 1NCXA 3U8AA 2DD9A 2HFCA 1LXFC 1K9UA 1HQVA 4D1EA 2LMVA 3DPWA 4IL1A 3CFFA 2HPSA 2NZ0A 1BG1A 1JC0A 4KGEA 1Q4EA 2JC2A 2EC6B 3TDIA 2QLHA 2WOSA 1W7UA 1F54A 4AQJA 5FYXA 1PALA 5J2OA 1SK6D 1G8IA 2G5ZB 2GGZA 2LV7A 1RFJA 3ED8A 1TOPA 4DCKA 4PHMA 2K2FA 4KGFA 4JWQA 3VK1A 3CD1A 1XSSA 1B8CA 1QYOA 2YDZA 1XYDA 1GJYA 3CBEA 4FTGA 4W6OA 2BECA 1H4UA 1DJWA 2B1UA 2I2RE 1QLKA 1TNWA 4W77A 3IQQA 1UHJA 1AP4A 4J88A 2D8NA 1BT6A 2K0JA 5TNCA 1C7WA 2HQKA 4CFRA 1KWOB 4HSZA 1W7IB 4C0KA 1B9AA 2COLB 4YGCB 3VICA 4DXQA 2H5OA 4XJKA 1KP5A 2GW3A 3OX6A 2KI4B 1NX3A 4UPGA 4W6PA 5D7FA 3SSVA 5JJGA 3OB2B 1TIZA 3SSPA 4CIDA 1QXTA 3DQFA 5HKZA 4GGFA 4W6UA 4PCWA 1BFPA 5GQQC 2BE4A 1PVBA 2GX2A 1C7VA 1OOJA 2KI4C 3TDZA 2KAYA 4MZKA 2P6BB 1XMZA 2QU1A 3AKAA 5FHVA 4H3LA 4GFTA 1Y0VH 3KHEA 1DGUA 2ZMWA 4DS7A 3ZUJA 4IK5A 4EULA 3HX4A 1MYWA 4JEOA 3NEZA 3I5GB 1SY9A 1XAEA 2WSOA 2HPWA 3NSIA 2G6XA 4KF5C 3LF4B 4QJ5B 1CFCA 5HYDA 2PVBA 4W6HA 4NQGA 5I2OA 5BPJA 2Y1MA 1RROA 1M63B 4H47A 3SS0A 4XJKB 2OTBA 3LF3A 2JWWA 2YE1A 2KOTA 5DPJA 2JT8A 3LL8B 1XK4C 1KFUL 2PASA 4DIRA 1CLMA 2LM5A 1KCYA 1UHIA 4ZINA 1KFXS 2JNXA 2EMNA 2PRUA 1YVLA 3GK2A 1DF0B 2A53B 2G16B 2ZO6A 4GBAA 2FL1A 4HREE 1NX0A 1FPWA 4L12A 1NPQA 5DRFA 4KAGA 4ZCUA 3M24A 4AQIA 2HQWA 3EVVA 1SL7A 2ZKMX 4PHNA 3SV5A 1NSHA 2HGDA 4KA9A 3WLDA 1A4PA 4MN0A 4IK9A 4CFQA 4ORAB 3RWTA 4N1FA 2KGRA 3AAJA 1W7TA 4RYSA 3EVPA 4XOVA 2JULA 5DTLA 1PULA 2ZNEA 1S6JA 1Q4DA 1A75B 3KCSA 3SG3A 4J89A 2GV5A 2JOJA 3CFAA 4DXPA 1CDMA 3DQ2A 3KPXA 5BQLA 3PFVA 1EG4A 1DJIA 1F4OA 3FIAA 5HBDA 3TDUA 2JNFA 3CR4X 4LJBA 1S6CA 1M45A 2SCPA 3PIBA 4DXMA 2B3QA 2SASA 2A4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JQ0 D;  1R2U A;  2OJK A;  5HKW A;  1AVS A;  2AUC A;  3WHT B;  2F3Y A;  1SCM B;  2MRD A;  2E6W A;  4HQC A;  2Z6Y A;  3E5W A;  3SRY A;  2M7L A;  2F33 A;  1W7S A;  5LTR A;  1DTL A;  2F3Z A;  4JRB A;  1MF8 B;  2E30 A;  3SG2 A;  4E68 A;  5AAN A;  1LA0 A;  4WQ2 A;  2JT3 A;  3SSK A;  5DY6 A;  3PN7 C;  1KSO A;  1NP8 A;  4MBE A;  1QVI Y;  1CFD A;  2G6E A;  5H88 A;  3CGA A;  1MWN A;  5AER A;  3SVD A;  2O29 A;  1TNX A;  1BJF A;  2AMI A;  4N1G A;  2MJW B;  1QX5 B;  1JWD A;  4YGD B;  4KW9 A;  2ZN9 A;  4J8A A;  3DQA A;  1SR6 C;  1K8U A;  1TN4 A;  2QPT A;  4OCI A;  1KK7 Z;  3VRR A;  1M31 A;  2OTG C;  5KU1 A;  1KYP A;  3ST4 A;  1N65 A;  3EVR A;  4B30 A;  5CSF A;  2NCP A;  2CTN A;  3UG0 A;  3IF7 A;  1U5I B;  2LUC A;  1BOC A;  2MBX A;  5LTQ A;  1ZGQ A;  2PSR A;  4L13 A;  1J1E A;  2WIS A;  4W6M A;  2GW4 B;  2PXS A;  1F71 A;  4WQ3 A;  4OVN F;  2DUH A;  3SVR A;  4W73 A;  1QAS A;  5DPG A;  1Z1P A;  1IQ3 A;  1UWO A;  3E5V A;  4XOW A;  2FOT A;  3DQJ A;  5EB7 A;  3OGO A;  1WDC B;  2HRS A;  1NCY A;  1SMG A;  3PJ5 A;  3U0N A;  1B8L A;  4HE4 A;  2BCX A;  2EGD A;  1QV0 A;  4MEW A;  4KW8 A;  1J7P A;  4I5N B;  1CNP A;  3KO0 A;  1CDL A;  4ZF3 A;  2K7B A;  2WCB A;  3F45 A;  2H9W A;  4BDU A;  4TNC A;  1F8H A;  1CLB A;  5CSN A;  1KFX L;  3I5I C;  2M49 B;  5AFP A;  1G4Y R;  3ST3 A;  1Y1A A;  2KQ6 A;  3BOW B;  3WXA A;  2H5Q A;  1G33 A;  1R6P A;  1BR4 B;  3KEV A;  4P76 A;  2BKI B;  3OP0 A;  3AI5 A;  1JUO A;  1B1G A;  1UUS A;  3ZTF A;  3DQH A;  1B9C A;  3DQO A;  3VRP A;  2EC6 C;  3SVU A;  2H61 C;  1QS7 A;  4FQO A;  1EMF A;  1D1O A;  1EXR A;  1SBJ A;  1B4C A;  2DUI A;  3G9A A;  2KAX A;  5K89 A;  2AWM A;  1SW8 A;  4M2O A;  1Z1Q A;  1Q4A A;  3I5I B;  4Q04 A;  1L2O C;  2LAN A;  2KYF A;  3A8R A;  3BUO B;  4OY4 A;  1ALV A;  4DXN A;  4C0J A;  1DJH A;  5DTX A;  1QY3 A;  4W6K A;  3U8C A;  1HCJ A;  3H4S E;  3KF9 A;  1CTR A;  5LTP A;  4GF6 B;  1AJ4 A;  4ANJ A;  1YFP A;  4PHK A;  1N0Y A;  3SSH A;  2POX A;  3DVE A;  1UP5 A;  1IKU A;  1GFL A;  4W6F A;  5G08 A;  4NDD A;  3NF0 A;  4HRH A;  4I5L B;  4PDZ A;  3CGL A;  1ZMZ A;  1ZGO A;  3GK4 X;  3LVC A;  2JTT A;  4W7R A;  2CXJ A;  2IS9 A;  4MZL A;  1B8R A;  2HET A;  4L1I A;  2V4E C;  3NSK A;  3DQ6 A;  4DKN A;  3BQ3 A;  4YGB B;  3M0W A;  2ZND A;  3EKH A;  4PE0 A;  3JTD B;  1XA9 A;  4YI8 A;  2Z1O A;  5I8N A;  2QLI A;  3CR5 X;  3O2P A;  1EMB A;  2LHI A;  1SYM A;  2MLF C;  1KYS A;  2RH7 A;  1IQ5 A;  1JF0 A;  3FWB A;  4JF9 A;  2LUX A;  4W6N A;  4OQW A;  1QJT A;  2DD7 A;  3CTN A;  4M2Q A;  3PJ7 A;  1EMK A;  2K7D A;  3LK0 A;  1MXE A;  2HF5 A;  1A2X A;  1L7Z A;  4NDB A;  1REC A;  3RM1 A;  2LLT A;  3AKO A;  1TCO B;  1RMP A;  1CMF A;  4GGF C;  5FVI A;  1V1G A;  4MLW A;  1LA3 A;  5J3X A;  2GGM A;  2CNP A;  2H5R A;  1VRK A;  3BX9 A;  3ZUF A;  2WOR A;  3OB1 B;  5B8I B;  2LCP A;  1UHH A;  2YE0 A;  4AOM A;  3EK7 A;  2HGY A;  1UIS A;  2Q6P A;  1GGZ A;  3GEX A;  2L51 A;  2V4E A;  2NLN A;  2KBM A;  3I5G C;  3DF0 B;  4ETO A;  4A4C A;  4YRU A;  4YI9 A;  1S6Z A;  2V53 A;  2O60 A;  1JC1 A;  1OZS A;  1K2H A;  1CKK A;  2M7N A;  1NCZ A;  2M1U A;  3TMT A;  2O2B A;  5PAL A;  3TZ1 A;  5EHU A;  4PFE A;  2LP2 A;  5HKY A;  2M1K B;  1TNP A;  4GGN A;  5DPI A;  2OKY A;  2MHH A;  5I2L A;  2A48 A;  4W74 A;  3TUY C;  1XA5 A;  2L0P A;  1C4F A;  1S5G Y;  1DGV A;  1KSM A;  1YUS A;  1PRW A;  4WRI A;  3IQO A;  3BUX B;  3VRN A;  1XFY O;  2LMT A;  1BOD A;  3PJB A;  1XFV O;  1AHR A;  2M9G A;  2MA2 A;  3CZT X;  4PE1 A;  2EMD A;  3NSO A;  2LP3 A;  4HRG A;  2GX0 A;  1MR8 A;  1YVH A;  3O77 A;  3A4U B;  3V3D A;  2BKH B;  3AKB A;  3FWC A;  4OHS A;  3JTD C;  3CLN A;  2LC5 A;  3TUY B;  4LJC A;  4IK3 A;  3DQ1 A;  4XL5 A;  1KWO C;  4H3N A;  4DXI A;  5EXC I;  1S6I A;  3DQC A;  1F70 A;  2ARL A;  1WLZ A;  1SCV A;  5CPV A;  3C1V A;  1IJ6 A;  2Q91 A;  2KYC A;  2QAC A;  1YJ2 A;  1YUU A;  1QVI Z;  1RTP 1;  1PVA A;  2G9B A;  2G2B A;  3ST0 A;  3LVD A;  2DDD A;  1ZUX A;  1CB1 A;  1H4B A;  1GQM A;  4B5Y A;  1YHI A;  3CWG A;  3SG4 A;  3JVT B;  5HZT A;  2BL0 B;  2FWQ A;  3NSL A;  1OSA A;  3ADF A;  2ZMU A;  1K9K A;  1K93 D;  2JTZ A;  4RTC A;  4W75 A;  4LW5 A;  1CFP A;  3O6B A;  2LVK A;  3DPX A;  2Z6X A;  2H6V A;  4KPI A;  5KTG A;  2LAP A;  5FVG A;  2A50 B;  1QYF A;  4W6T A;  1QXP A;  1BF5 A;  1KK8 B;  3DVK A;  1XFU O;  1ZFS A;  3ZWH A;  1OZO A;  3GJ2 A;  2HQZ A;  1H6R A;  3SVS A;  1KQV A;  3DVJ A;  4EN1 A;  5D69 A;  4I2Y A;  1ZUZ A;  5DQB A;  1ZAC A;  3JVT C;  3PM8 A;  2H61 A;  1RRX A;  4W7D A;  4W6D A;  5DRG A;  3PAT A;  3AI4 A;  2IOV A;  4YGE B;  4GUK A;  4F0Z B;  2NCO A;  1XFX O;  2KI6 D;  3I5H C;  3E5T A;  4ORB B;  2ZN8 A;  2H5P A;  4AS8 A;  2A52 B;  3BXC A;  2F2O A;  4PHJ A;  3ZNI A;  4BY4 A;  3LSA A;  4W7E A;  1F09 A;  4Z4K A;  2WSN A;  5DKN A;  2KSP A;  2PXW A;  4N3D A;  1S5G Z;  3BUW B;  2VVH A;  3K1K A;  2H2K A;  4LJD A;  1EML A;  1B7T Y;  4GOB A;  1XK4 A;  5FVF A;  4P1Q A;  1J55 A;  2KGB C;  3O4Y A;  2OGR A;  5IBW A;  2O24 A;  4W6R A;  1ALW A;  2EMO A;  3DPZ A;  4QJ3 B;  1FI6 A;  1AJ5 A;  1NX2 A;  3S05 A;  4XGY A;  3VGO A;  4LJD C;  3CFH A;  1FF1 A;  2ZRT A;  3ICB A;  3DQK A;  3NED A;  4CLN A;  3OX5 A;  2CCM A;  4JC2 A;  3IP2 A;  1IG5 A;  5HLV A;  3EVU A;  1MXL C;  3OHM B;  4NWS A;  2R2I A;  1WRL A;  2WHS A;  2O5G A;  4ZIO A;  2CT9 A;  1WRZ A;  2TN4 A;  1NUB A;  2AWL A;  1XFW O;  1RMM A;  3BXB A;  4DKM A;  5BT0 A;  1SRA A;  3BOW A;  1DF0 A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  4NDC A;  5DU0 A;  2F2P A;  4Q7T A;  1SL8 A;  2G6Y A;  2KBI A;  3EK8 A;  1XVJ A;  1YR5 A;  3M22 A;  3SG5 A;  4ZF5 A;  4Z4M A;  2LVI A;  1G7K A;  5BTT B;  3LA1 A;  3A8S A;  1OXF A;  4JPZ B;  5DTZ A;  5I2Q A;  1UHK A;  2WCE A;  2M0R A;  5DQM A;  3SSL A;  2DOQ A;  2BBN A;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  4DUQ A;  1EG3 A;  2K61 A;  1YHG A;  1NIW A;  1GL4 A;  3TMR A;  2KHN A;  3DQ8 A;  2QZ0 A;  3OSQ A;  4I5K A;  4OKH A;  3IR8 A;  3SG7 A;  3WLC A;  2FCD A;  2A47 A;  1OMR A;  2PMY A;  2OS8 C;  3EKJ A;  1MOU A;  1QYQ A;  2KQY A;  2H8Q A;  1NYA A;  2K7O A;  1EL4 A;  3DVM A;  3PSR A;  3NXA A;  2BCB A;  1U5I A;  1Y1U A;  4OR9 B;  3D0Y A;  2Q57 A;  4W7C A;  1OQP A;  3I5H B;  4MRY A;  3LK1 A;  1BLQ A;  1KK7 Y;  1E8A A;  3GOF A;  1EH2 A;  3I19 A;  4YBH B;  3WHU B;  1RM9 A;  1CM1 A;  2PAL A;  1L2O B;  2JQ6 A;  4EMQ A;  1MHO A;  2VVJ A;  2HJO A;  1QIV A;  1WY9 A;  2L5X B;  1WDC C;  4H48 A;  2VRG A;  2OTE A;  4CPV A;  2BCA A;  3GJ1 A;  3AAK A;  1B7T Z;  5AXI A;  4U2V A;  2MLE C;  1FI5 A;  2WHU A;  2JRF A;  3VRO A;  3SST A;  1F0B A;  5EXU A;  2B3P A;  3W1D A;  1Q4C A;  4W6S A;  3ZUL A;  1LIN A;  4Q9W A;  1YUR A;  5EXB A;  1RJV A;  4W6I A;  4R6B A;  2JPT A;  1YRT B;  5CSJ A;  2L4I A;  3LCP C;  2IB6 A;  4W69 A;  2V4E B;  4H3M A;  1S26 D;  3SVC A;  2LE9 B;  1BR1 B;  1MOV A;  2WHT A;  5ER5 A;  3WCK A;  2K7C A;  2L50 A;  4W7F A;  1SNL A;  2VAE A;  4RYW A;  1JBZ A;  4MSP A;  1A75 A;  1Q73 A;  1JC2 A;  1GGW A;  4GPL B;  1QTX A;  3P8U A;  2Y0G A;  1DMO A;  1OXE A;  1CDP A;  1Y1X A;  1HUY A;  2DUG A;  4UTS A;  3DD4 A;  3LVA A;  1TCF A;  1TRF A;  4ZFS A;  1JSA A;  4HVF A;  4XVP A;  1XQM A;  5EJU A;  4M2P A;  3ST2 A;  1EMM A;  2AWJ A;  3SVN A;  3QRX A;  5HZU A;  3H1R A;  3P28 A;  5F9G A;  2QT2 A;  3BUM B;  3I5F B;  1Y6W A;  5F6T A;  4KF5 A;  4PPJ A;  1WRK A;  2QLG B;  5HW9 A;  1BMO A;  4AR7 A;  1F4Q A;  1CLL A;  2VAD A;  1MUX A;  4W72 A;  1EMG A;  4KW4 A;  2VVI A;  1YTZ C;  1LVC D;  2ZFD A;  2KI6 C;  4DRW A;  2QRF A;  4ICB A;  1YRU B;  2DUE A;  5DTY A;  4Q7R A;  1A03 A;  3DQM A;  2Y5I A;  3GB3 A;  3VHT B;  3SVB A;  1S1E A;  1CFF A;  1QAT A;  1DJZ A;  5H89 A;  3WNX B;  5DKR A;  3BUN B;  1J1D A;  1JFJ A;  4C0L A;  1ODB A;  3PAL A;  4L9M A;  3I5F C;  5EBJ A;  2LLS A;  3DQ5 A;  2DUF A;  2JXC A;  3GK1 A;  1CV7 A;  1FBV A;  1CMG A;  1NWD A;  2WND A;  4GNK B;  3TS5 B;  2OPO A;  3D10 A;  1RK9 A;  1C07 A;  4TZA A;  1KFU S;  1DT7 B;  1H8B A;  3LS3 A;  4EDO A;  3CD9 A;  5DPH A;  2KDH A;  1YZW A;  2KNE A;  2MAZ A;  1ZOT B;  3BYA A;  4W6B A;  1EJ3 A;  1F55 A;  3DQ7 A;  1SL9 A;  5DKQ A;  1AK8 A;  2KFG A;  5BTT A;  3PN7 B;  1K95 A;  5HZO A;  2RGI A;  1UUR A;  3TS5 C;  1ZGP A;  4A4B A;  5LK4 A;  1JFK A;  3VHT A;  2CBL A;  1UHN A;  5EB6 A;  2WC8 A;  3NT3 A;  2Y1N A;  2KFH A;  2I18 A;  2KFF A;  1N2D A;  3DQN A;  4TZG A;  4IZN A;  2M8U A;  1W7J B;  1MQ1 A;  2LLU A;  3H1O A;  1IRJ A;  5HLO A;  2M97 A;  1M46 A;  1QX7 A;  2YFP A;  1OMV A;  1RMO A;  1IH0 A;  3OSR A;  4KEX A;  1JBY A;  4W6A A;  2JZI A;  3CR2 A;  2Z6Z A;  3E3R A;  4MZJ A;  4OJ0 A;  2F8P A;  1K96 A;  2OKW A;  2ICR A;  1QX2 A;  1DJY A;  2Y4Q A;  4LQT A;  1IJ5 A;  1J7O A;  1YX7 A;  2IB5 A;  3DQE A;  2LNK A;  3BXA A;  4GES B;  2K2A A;  1EME A;  1TNQ A;  1WLM A;  1IWQ A;  1Q4B A;  2FJU B;  2ISD A;  1GGX A;  2K8M B;  2NXQ A;  1S36 A;  1K9P A;  4W7A A;  2G3D B;  1TTX A;  2FCE A;  4OGS A;  1YHH A;  4ZF4 A;  3SVE A;  2Q4U A;  2BTJ A;  2OTG B;  2BL0 C;  1YJF A;  1DJG A;  2VZX A;  4IK4 A;  2AWK A;  3W1C A;  4HQ8 A;  5AEQ A;  5H87 A;  1PK0 D;  2L2E A;  4BY5 A;  2LHL A;  4ZCV A;  1KYR A;  3BXK A;  4U8D A;  3O78 A;  1XO5 A;  1CM4 A;  3DQU A;  3U8P A;  2FZU A;  1FW4 A;  1QIW A;  2A54 B;  1QV1 A;  2DDC A;  2A56 B;  2JU0 A;  2G3O A;  2QLG A;  4MVF A;  2QLE A;  1JF2 A;  2I94 A;  4PPK A;  1OE9 B;  4PE7 A;  4Q7U A;  4W6L A;  4DXO A;  2L98 A;  2WUR A;  4ORC B;  4PAL A;  1NX1 A;  2P4M A;  1X02 A;  1AUI B;  1XFZ O;  3GL4 A;  1EMA A;  3UFZ A;  2HCG A;  2EHB A;  4W6J A;  4W76 A;  4P2Y B;  1CDN A;  2OS8 B;  1EMC A;  1LKJ A;  3SIA A;  1OXD A;  1IGV A;  3MSE B;  1B47 A;  3DQ9 A;  3LLE A;  5AQB B;  1J7R A;  4W6G A;  3U0L A;  4KF4 A;  2AHA A;  1BU3 A;  3VRQ A;  4Q9X A;  3DQ4 A;  2JAD A;  4PE4 A;  4ZBL A;  2WIQ A;  3RWA A;  1K94 A;  4ORN A;  3DF0 A;  3D0Y B;  1DVI A;  3SIB A;  4LQU A;  2WCF A;  1RWY A;  3SVO A;  3K21 A;  4QJ4 B;  4IK1 A;  4EDS A;  3NT9 A;  1PSR A;  4PPL A;  4I5J A;  2M29 A;  5KSZ A;  5T3I A;  1HT9 A;  4MRX A;  5KTY A;  1QLS A;  5JOL A;  1V1F A;  1K90 D;  4N5X A;  4R6D A;  4R1E A;  1DJX A;  2I7A A;  4IK8 A;  1KQM B;  3SG6 A;  2LMU A;  2AAO A;  1A29 A;  3SJS A;  1S3P A;  1J7Q A;  1SPY A;  5HGE A;  3FS7 A;  4ZB1 A;  4USL A;  5CSI A;  3PLF B;  1SR6 B;  2JXL A;  3U0M A;  1JBA A;  4OV2 A;  2LVJ A;  2C9I A;  4JFG A;  3KCT A;  3SSY A;  4HQ9 A;  3DQL A;  2ZO7 A;  5ER4 X;  4JGE A;  2C9J A;  1YUT A;  3DQI A;  1KQM C;  1OMD A;  5HZS A;  2KAV A;  3DQ3 A;  2BBM A;  3DQD A;  1YX8 A;  1SKT A;  2L4H A;  3U0K A;  4XYN A;  2A46 A;  1M39 A;  3HCM A;  2HQ8 A;  3CB9 A;  3MGF A;  2AH8 A;  3CS1 A;  4YGA A;  4B30 B;  2G2S B;  4W7X A;  2ZRS A;  2LVV A;  1PSB A;  2IE2 A;  2JT0 A;  4P5O E;  4W6C A;  1NCX A;  3U8A A;  2DD9 A;  2HFC A;  1LXF C;  1K9U A;  1HQV A;  4D1E A;  2LMV A;  3DPW A;  4IL1 A;  3CFF A;  2HPS A;  2NZ0 A;  1BG1 A;  1JC0 A;  4KGE A;  1Q4E A;  2JC2 A;  2EC6 B;  3TDI A;  2QLH A;  2WOS A;  1W7U A;  1F54 A;  4AQJ A;  5FYX A;  1PAL A;  5J2O A;  1SK6 D;  1G8I A;  2G5Z B;  2GGZ A;  2LV7 A;  1RFJ A;  3ED8 A;  1TOP A;  4DCK A;  4PHM A;  2K2F A;  4KGF A;  4JWQ A;  3VK1 A;  3CD1 A;  1XSS A;  1B8C A;  1QYO A;  2YDZ A;  1XYD A;  1GJY A;  3CBE A;  4FTG A;  4W6O A;  2BEC A;  1H4U A;  1DJW A;  2B1U A;  2I2R E;  1QLK A;  1TNW A;  4W77 A;  3IQQ A;  1UHJ A;  1AP4 A;  4J88 A;  2D8N A;  1BT6 A;  2K0J A;  5TNC A;  1C7W A;  2HQK A;  4CFR A;  1KWO B;  4HSZ A;  1W7I B;  4C0K A;  1B9A A;  2COL B;  4YGC B;  3VIC A;  4DXQ A;  2H5O A;  4XJK A;  1KP5 A;  2GW3 A;  3OX6 A;  2KI4 B;  1NX3 A;  4UPG A;  4W6P A;  5D7F A;  3SSV A;  5JJG A;  3OB2 B;  1TIZ A;  3SSP A;  4CID A;  1QXT A;  3DQF A;  5HKZ A;  4GGF A;  4W6U A;  4PCW A;  1BFP A;  5GQQ C;  2BE4 A;  1PVB A;  2GX2 A;  1C7V A;  1OOJ A;  2KI4 C;  3TDZ A;  2KAY A;  4MZK A;  2P6B B;  1XMZ A;  2QU1 A;  3AKA A;  5FHV A;  4H3L A;  4GFT A;  1Y0V H;  3KHE A;  1DGU A;  2ZMW A;  4DS7 A;  3ZUJ A;  4IK5 A;  4EUL A;  3HX4 A;  1MYW A;  4JEO A;  3NEZ A;  3I5G B;  1SY9 A;  1XAE A;  2WSO A;  2HPW A;  3NSI A;  2G6X A;  4KF5 C;  3LF4 B;  4QJ5 B;  1CFC A;  5HYD A;  2PVB A;  4W6H A;  4NQG A;  5I2O A;  5BPJ A;  2Y1M A;  1RRO A;  1M63 B;  4H47 A;  3SS0 A;  4XJK B;  2OTB A;  3LF3 A;  2JWW A;  2YE1 A;  2KOT A;  5DPJ A;  2JT8 A;  3LL8 B;  1XK4 C;  1KFU L;  2PAS A;  4DIR A;  1CLM A;  2LM5 A;  1KCY A;  1UHI A;  4ZIN A;  1KFX S;  2JNX A;  2EMN A;  2PRU A;  1YVL A;  3GK2 A;  1DF0 B;  2A53 B;  2G16 B;  2ZO6 A;  4GBA A;  2FL1 A;  4HRE E;  1NX0 A;  1FPW A;  4L12 A;  1NPQ A;  5DRF A;  4KAG A;  4ZCU A;  3M24 A;  4AQI A;  2HQW A;  3EVV A;  1SL7 A;  2ZKM X;  4PHN A;  3SV5 A;  1NSH A;  2HGD A;  4KA9 A;  3WLD A;  1A4P A;  4MN0 A;  4IK9 A;  4CFQ A;  4ORA B;  3RWT A;  4N1F A;  2KGR A;  3AAJ A;  1W7T A;  4RYS A;  3EVP A;  4XOV A;  2JUL A;  5DTL A;  1PUL A;  2ZNE A;  1S6J A;  1Q4D A;  1A75 B;  3KCS A;  3SG3 A;  4J89 A;  2GV5 A;  2JOJ A;  3CFA A;  4DXP A;  1CDM A;  3DQ2 A;  3KPX A;  5BQL A;  3PFV A;  1EG4 A;  1DJI A;  1F4O A;  3FIA A;  5HBD A;  3TDU A;  2JNF A;  3CR4 X;  4LJB A;  1S6C A;  1M45 A;  2SCP A;  3PIB A;  4DXM A;  2B3Q A;  2SAS A;  2A4J A; 
#chains in the Genus database with same CATH topology
 4JQ0 D;  1R2U A;  2OJK A;  5HKW A;  1AVS A;  1OOH A;  2AUC A;  3WHT B;  2QEV A;  2F3Y A;  1SCM B;  1Z2C B;  2MRD A;  2E6W A;  4HQC A;  2Z6Y A;  3E5W A;  3SRY A;  2M7L A;  2F33 A;  1W7S A;  5LTR A;  1DTL A;  2F3Z A;  3FE8 A;  4INW A;  4JRB A;  1MF8 B;  2E30 A;  3SG2 A;  4E68 A;  5AAN A;  1LA0 A;  4WQ2 A;  2JT3 A;  3SSK A;  5DY6 A;  3PN7 C;  1KSO A;  1NP8 A;  2JPO A;  3D75 A;  4MBE A;  1QVI Y;  1CFD A;  2G6E A;  5H88 A;  3CGA A;  1MWN A;  5AER A;  3SVD A;  2O29 A;  3BFH A;  1TNX A;  1BJF A;  2AMI A;  4N1G A;  2MJW B;  3NHI A;  1QX5 B;  3R72 A;  1JWD A;  4YGD B;  4KW9 A;  2ZN9 A;  4J8A A;  3DQA A;  1SR6 C;  1K8U A;  1TN4 A;  2QPT A;  4OCI A;  1KK7 Z;  3VRR A;  1M31 A;  2OTG C;  5KU1 A;  1KYP A;  3ST4 A;  1N65 A;  3EVR A;  4B30 A;  5CSF A;  2NCP A;  2CTN A;  3UG0 A;  3IF7 A;  1U5I B;  2LUC A;  1BOC A;  2MBX A;  5LTQ A;  1GM0 A;  1ZGQ A;  1LS8 A;  2PSR A;  4L13 A;  1J1E A;  1P28 A;  2WIS A;  4W6M A;  2GW4 B;  2PXS A;  1F71 A;  4WQ3 A;  4OVN F;  2DUH A;  3SVR A;  4W73 A;  1QAS A;  3S0G A;  5DPG A;  1Z1P A;  1IQ3 A;  1UWO A;  3E5V A;  4XOW A;  2FOT A;  3B86 A;  3DQJ A;  5EB7 A;  1T14 A;  3OGO A;  1OOG A;  1WDC B;  2HRS A;  3CYZ A;  1NCY A;  1SMG A;  3PJ5 A;  3U0N A;  1B8L A;  4HE4 A;  2BCX A;  2EGD A;  1QV0 A;  4MEW A;  4KW8 A;  3B7A A;  1J7P A;  4I5N B;  1CNP A;  3KO0 A;  1CDL A;  2ERB A;  4ZF3 A;  2K7B A;  2WCB A;  3F45 A;  2H9W A;  4BDU A;  3SS4 A;  4TNC A;  1F8H A;  1CLB A;  5CSN A;  1KFX L;  3I5I C;  2M49 B;  2WCM A;  5AFP A;  1G4Y R;  3ST3 A;  1Y1A A;  2KQ6 A;  3BOW B;  3WXA A;  2H5Q A;  1G33 A;  1R6P A;  1BR4 B;  3KEV A;  3FE9 A;  4P76 A;  2BKI B;  3OP0 A;  3AI5 A;  1JUO A;  1B1G A;  1UUS A;  3ZTF A;  3DQH A;  1B9C A;  3DQO A;  3VRP A;  2EC6 C;  3SVU A;  2H61 C;  1QS7 A;  4FQO A;  1EMF A;  1D1O A;  1EXR A;  1SBJ A;  3O4X A;  1B4C A;  2DUI A;  3G9A A;  2KAX A;  5K89 A;  2AWM A;  1SW8 A;  4M2O A;  1Z1Q A;  1Q4A A;  3I5I B;  4Q04 A;  1L2O C;  3RZS A;  2LAN A;  2KYF A;  3A8R A;  3BUO B;  4OY4 A;  1ALV A;  4DXN A;  4C0J A;  1DJH A;  5DTX A;  1QY3 A;  4W6K A;  3U8C A;  1HCJ A;  3H4S E;  1DQE A;  3KF9 A;  1CTR A;  5LTP A;  4GF6 B;  1AJ4 A;  4ANJ A;  1YFP A;  4PHK A;  1N0Y A;  3SSH A;  2POX A;  3DVE A;  1UP5 A;  3NGV A;  1IKU A;  1GFL A;  4W6F A;  5G08 A;  4NDD A;  3NF0 A;  4HRH A;  4I5L B;  4PDZ A;  3CGL A;  1ZMZ A;  1ZGO A;  3GK4 X;  3LVC A;  2JTT A;  4W7R A;  2CXJ A;  3CAB A;  2IS9 A;  4MZL A;  1B8R A;  2HET A;  4L1I A;  2V4E C;  3NSK A;  3DQ6 A;  4DKN A;  3BQ3 A;  4YGB B;  3M0W A;  2ZND A;  3EKH A;  4PE0 A;  3JTD B;  1XA9 A;  3QME A;  4YI8 A;  2Z1O A;  5I8N A;  2QLI A;  3CR5 X;  3O2P A;  2WCK A;  1EMB A;  2LHI A;  1SYM A;  2MLF C;  1KYS A;  2RH7 A;  1IQ5 A;  1JF0 A;  3FWB A;  3VB1 A;  4JF9 A;  2LUX A;  4W6N A;  4OQW A;  1QJT A;  2DD7 A;  2WCJ A;  3CTN A;  4M2Q A;  3PJ7 A;  1EMK A;  2K7D A;  3LK0 A;  1MXE A;  2HF5 A;  1A2X A;  1L7Z A;  4NDB A;  1REC A;  3RM1 A;  2LLT A;  3AKO A;  1TCO B;  1RMP A;  1CMF A;  4GGF C;  5FVI A;  1V1G A;  4MLW A;  1LA3 A;  5J3X A;  2GGM A;  2K60 A;  2CNP A;  2H5R A;  1VRK A;  3BX9 A;  3ZUF A;  2WOR A;  3OB1 B;  5B8I B;  2LCP A;  1UHH A;  2YE0 A;  4AOM A;  3EK7 A;  2HGY A;  1UIS A;  2Q6P A;  1GGZ A;  3GEX A;  2L51 A;  2V4E A;  2NLN A;  2KBM A;  3I5G C;  3DF0 B;  4ETO A;  4A4C A;  4YRU A;  4YI9 A;  1S6Z A;  2V53 A;  2O60 A;  1JC1 A;  1OZS A;  1K2H A;  1CKK A;  2M7N A;  1NCZ A;  2M1U A;  3TMT A;  2O2B A;  5PAL A;  3TZ1 A;  5EHU A;  4PFE A;  2LP2 A;  5HKY A;  2M1K B;  1TNP A;  4GGN A;  5DPI A;  2OKY A;  2MHH A;  5I2L A;  2A48 A;  4W74 A;  3TUY C;  1XA5 A;  2L0P A;  1C4F A;  1S5G Y;  1DGV A;  1KSM A;  1YUS A;  1PRW A;  4WRI A;  3IQO A;  3BUX B;  3VRN A;  1XFY O;  2LMT A;  1BOD A;  3PJB A;  1XFV O;  1AHR A;  2M9G A;  5D3O A;  2MA2 A;  3CZT X;  4PE1 A;  2QEH A;  2EMD A;  3CDN A;  3NSO A;  2LP3 A;  4HRG A;  2GX0 A;  1MR8 A;  1YVH A;  3O77 A;  2QEB A;  3A4U B;  3D74 A;  3V3D A;  2BKH B;  3AKB A;  3FWC A;  4OHS A;  3JTD C;  3CLN A;  2LC5 A;  3TUY B;  4LJC A;  4IJ7 A;  4IK3 A;  3CZ0 A;  3DQ1 A;  4XL5 A;  1KWO C;  4H3N A;  4DXI A;  5EXC I;  1S6I A;  3DQC A;  1F70 A;  2ARL A;  3S0B A;  5FI7 A;  1WLZ A;  1SCV A;  5CPV A;  3C1V A;  1IJ6 A;  2Q91 A;  2KYC A;  2QAC A;  1YJ2 A;  1YUU A;  1QVI Z;  1RTP 1;  1PVA A;  2G9B A;  2G2B A;  3ST0 A;  3LVD A;  2DDD A;  1ZUX A;  1CB1 A;  1H4B A;  1GQM A;  3L47 A;  4B5Y A;  1YHI A;  3CWG A;  3SG4 A;  3JVT B;  5HZT A;  2BL0 B;  2FWQ A;  3NSL A;  1OSA A;  3ADF A;  2ZMU A;  1K9K A;  1K93 D;  2JTZ A;  4RTC A;  4W75 A;  4LW5 A;  1CFP A;  3O6B A;  2LVK A;  4PT1 A;  1C3Y A;  3DPX A;  2Z6X A;  2L2C A;  2H6V A;  4KPI A;  5KTG A;  2LAP A;  5FVG A;  2A50 B;  1QYF A;  4W6T A;  1QXP A;  1BF5 A;  1KK8 B;  3DVK A;  1XFU O;  1ZFS A;  3ZWH A;  1OZO A;  3GJ2 A;  2HQZ A;  1H6R A;  3SVS A;  1KQV A;  3DVJ A;  4EN1 A;  5D69 A;  4I2Y A;  1ZUZ A;  5DQB A;  1ZAC A;  3JVT C;  3PM8 A;  2H61 A;  1RRX A;  4W7D A;  4W6D A;  3PAT A;  5DRG A;  3AI4 A;  2IOV A;  4YGE B;  4GUK A;  3IVT A;  4F0Z B;  2NCO A;  1XFX O;  2KI6 D;  3I5H C;  3E5T A;  3DXL A;  4ORB B;  2ZN8 A;  2H5P A;  4AS8 A;  2A52 B;  3BXC A;  2F2O A;  4PHJ A;  3ZNI A;  4BY4 A;  3LSA A;  4W7E A;  1F09 A;  4Z4K A;  2WSN A;  3EG5 B;  5DKN A;  2KSP A;  2PXW A;  4N3D A;  1S5G Z;  3BUW B;  2VVH A;  3K1K A;  2H2K A;  4LJD A;  1EML A;  1B7T Y;  4GOB A;  1XK4 A;  5FVF A;  4P1Q A;  1J55 A;  2KGB C;  3R1O A;  3O4Y A;  2OGR A;  5IBW A;  2O24 A;  4W6R A;  1ALW A;  2EMO A;  3DPZ A;  4QJ3 B;  1FI6 A;  2WC6 A;  1AJ5 A;  1NX2 A;  3S05 A;  4XGY A;  3VGO A;  4LJD C;  3CFH A;  1FF1 A;  2ZRT A;  3ICB A;  3DQK A;  3NED A;  4CLN A;  3OX5 A;  2CCM A;  4JC2 A;  3IP2 A;  1IG5 A;  5HLV A;  3EVU A;  1MXL C;  3OHM B;  4NWS A;  2R2I A;  1WRL A;  2WHS A;  2O5G A;  4ZIO A;  4JKT A;  2CT9 A;  1WRZ A;  2TN4 A;  1NUB A;  2AWL A;  1XFW O;  1RMM A;  3BXB A;  4DKM A;  5BT0 A;  1SRA A;  3BOW A;  1DF0 A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  4NDC A;  5DU0 A;  2F2P A;  4Q7T A;  1SL8 A;  2G6Y A;  3PJI A;  2KBI A;  3EK8 A;  1XVJ A;  1YR5 A;  2BAP A;  3M22 A;  3SG5 A;  4ZF5 A;  4Z4M A;  2LVI A;  1G7K A;  5BTT B;  3LA1 A;  3A8S A;  1OXF A;  4JPZ B;  5DTZ A;  5I2Q A;  1C3Z A;  1UHK A;  3BFB A;  2WCE A;  2M0R A;  5DQM A;  3SSL A;  2DOQ A;  2BBN A;  1OW4 A;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  4DUQ A;  1EG3 A;  2H8V A;  2K61 A;  1YHG A;  1NIW A;  1GL4 A;  3TMR A;  2KHN A;  3DQ8 A;  2QZ0 A;  3OSQ A;  4I5K A;  4OKH A;  3IR8 A;  3SG7 A;  2FCD A;  3WLC A;  2A47 A;  1OMR A;  2PMY A;  2OS8 C;  3EKJ A;  1MOU A;  1QYQ A;  2KQY A;  2H8Q A;  1NYA A;  2K7O A;  1EL4 A;  3DVM A;  3PSR A;  3NXA A;  2BCB A;  1U5I A;  1Y1U A;  4OR9 B;  3D0Y A;  2Q57 A;  4W7C A;  1OQP A;  3I5H B;  4MRY A;  3LK1 A;  1BLQ A;  1KK7 Y;  1E8A A;  3GOF A;  1EH2 A;  3I19 A;  4YBH B;  3WHU B;  1RM9 A;  1CM1 A;  2PAL A;  1L2O B;  2JQ6 A;  3N7H A;  4EMQ A;  1MHO A;  2VVJ A;  2HJO A;  1QIV A;  1WY9 A;  2L5X B;  1WDC C;  4H48 A;  2VRG A;  2OTE A;  4CPV A;  2BCA A;  3GJ1 A;  3AAK A;  1B7T Z;  5FI2 A;  5AXI A;  4U2V A;  2MLE C;  1FI5 A;  2WHU A;  2JRF A;  3VRO A;  3SST A;  1F0B A;  5EXU A;  2KLE A;  2B3P A;  3W1D A;  3R1V A;  1Q4C A;  4W6S A;  3ZUL A;  1LIN A;  4Q9W A;  3D73 A;  1YUR A;  3D77 A;  5EXB A;  1OOI X;  1RJV A;  4W6I A;  4R6B A;  2JPT A;  1YRT B;  5CSJ A;  2L4I A;  3LCP C;  2IB6 A;  4W69 A;  2V4E B;  4H3M A;  2P71 A;  1S26 D;  3SVC A;  2LE9 B;  1BR1 B;  1MOV A;  2BNX A;  2WHT A;  5ER5 A;  3WCK A;  2K7C A;  2L50 A;  4W7F A;  1SNL A;  2VAE A;  4RYW A;  4FQT A;  1JBZ A;  4MSP A;  1A75 A;  3L4L A;  1Q73 A;  1JC2 A;  1GGW A;  1DC1 A;  4GPL B;  1QTX A;  3P8U A;  2Y0G A;  1DMO A;  1OXE A;  1CDP A;  1Y1X A;  1HUY A;  2DUG A;  4UTS A;  3K1E A;  3DD4 A;  2FJY A;  3DYE A;  3LVA A;  1Z4H A;  1TCF A;  1TRF A;  4ZFS A;  1JSA A;  4HVF A;  4XVP A;  3B87 A;  1XQM A;  5EJU A;  4M2P A;  3ST2 A;  1EMM A;  2AWJ A;  3SVN A;  3QRX A;  5HZU A;  3H1R A;  3P28 A;  5F9G A;  2QT2 A;  3BUM B;  3BJH A;  3I5F B;  1Y6W A;  5F6T A;  4KF5 A;  4PPJ A;  1WRK A;  2QLG B;  5HW9 A;  1BMO A;  4AR7 A;  1F4Q A;  1CLL A;  2VAD A;  1MUX A;  4W72 A;  1EMG A;  4KW4 A;  2VVI A;  1YTZ C;  1LVC D;  2ZFD A;  3UNW A;  2KI6 C;  4DRW A;  2QRF A;  4ICB A;  1YRU B;  2DUE A;  5DTY A;  4Q7R A;  1A03 A;  3DQM A;  2Y5I A;  3GB3 A;  3VHT B;  3SVB A;  1S1E A;  2PQL A;  4KYN A;  1CFF A;  1QAT A;  1DJZ A;  5H89 A;  3WNX B;  5DKR A;  3BUN B;  1J1D A;  1JFJ A;  4C0L A;  1ODB A;  3PAL A;  4L9M A;  4OZD A;  3I5F C;  5EBJ A;  2LLS A;  3DQ5 A;  2DUF A;  2JXC A;  3GK1 A;  1CV7 A;  1FBV A;  1CMG A;  1NWD A;  2WND A;  4GNK B;  2WCL A;  3DZT A;  3TS5 B;  2OPO A;  3D10 A;  1RK9 A;  3NHT A;  1C07 A;  4TZA A;  1KFU S;  1DT7 B;  1H8B A;  3LS3 A;  4EDO A;  3CD9 A;  5DPH A;  2KDH A;  1YZW A;  2KNE A;  2MAZ A;  1ZOT B;  3BYA A;  4W6B A;  1EJ3 A;  1F55 A;  3DQ7 A;  1SL9 A;  5DKQ A;  1ORG A;  1AK8 A;  2KFG A;  5BTT A;  3PN7 B;  2YGU A;  1K95 A;  5HZO A;  2RGI A;  1UUR A;  3TS5 C;  1ZGP A;  4A4B A;  5LK4 A;  1JFK A;  3VHT A;  2CBL A;  1UHN A;  5EB6 A;  2WC8 A;  3NT3 A;  3B88 A;  2Y1N A;  2KFH A;  2I18 A;  2KFF A;  2QDI A;  1N2D A;  3DQN A;  4TZG A;  4IZN A;  1W9Z A;  2M8U A;  1W7J B;  1MQ1 A;  2LLU A;  3H1O A;  1IRJ A;  5HLO A;  2M97 A;  1M46 A;  1QX7 A;  5FI6 A;  2YFP A;  1OMV A;  1RMO A;  1IH0 A;  3OSR A;  4KEX A;  1JBY A;  4W6A A;  2JZI A;  3CR2 A;  2Z6Z A;  3E3R A;  4MZJ A;  4OJ0 A;  2F8P A;  1K96 A;  2OKW A;  2ICR A;  1QX2 A;  1DJY A;  3B6X A;  2Y4Q A;  4LQT A;  1IJ5 A;  1J7O A;  1YX7 A;  2IB5 A;  3DQE A;  2LNK A;  3BXA A;  4GES B;  2K2A A;  1EME A;  1TNQ A;  1WLM A;  1IWQ A;  1Q4B A;  2FJU B;  2ISD A;  1GGX A;  2K8M B;  2NXQ A;  1S36 A;  1K9P A;  4W7A A;  2G3D B;  1TTX A;  2FCE A;  3S0A A;  4OGS A;  1YHH A;  4ZF4 A;  3SVE A;  2Q4U A;  2BTJ A;  2OTG B;  1XFR A;  2BL0 C;  1YJF A;  1DJG A;  2VZX A;  4IK4 A;  3FE6 A;  2AWK A;  3W1C A;  4HQ8 A;  5AEQ A;  3OGN A;  5H87 A;  1PK0 D;  2L2E A;  3UO9 A;  4BY5 A;  2LHL A;  4ZCV A;  1KYR A;  3BXK A;  5HL1 A;  4U8D A;  3O78 A;  1XO5 A;  1CM4 A;  3V2L A;  3DQU A;  3U8P A;  2FZU A;  1FW4 A;  1QIW A;  2A54 B;  1QV1 A;  2DDC A;  2A56 B;  2JU0 A;  2G3O A;  2QLG A;  4MVF A;  2QLE A;  1JF2 A;  2I94 A;  4PPK A;  1OE9 B;  4PE7 A;  4Q7U A;  4W6L A;  4DXO A;  2L98 A;  3SS5 A;  2WUR A;  4ORC B;  4PAL A;  1NX1 A;  2P4M A;  1X02 A;  1AUI B;  1XFZ O;  3GL4 A;  1EMA A;  3UFZ A;  2HCG A;  2EHB A;  4W6J A;  4W76 A;  4P2Y B;  1CDN A;  2OS8 B;  2GTE A;  1EMC A;  1LKJ A;  3S0F A;  3SIA A;  1OXD A;  1IGV A;  3MSE B;  1B47 A;  3DQ9 A;  3LLE A;  5AQB B;  1J7R A;  4W6G A;  3U0L A;  4KF4 A;  2AHA A;  1BU3 A;  3VRQ A;  4Q9X A;  3DQ4 A;  2JAD A;  4PE4 A;  2L5Y A;  4ZBL A;  2WIQ A;  3RWA A;  1K94 A;  4ORN A;  3DF0 A;  3D0Y B;  1DVI A;  3SIB A;  4LQU A;  3BFA A;  2WCF A;  1RWY A;  3SVO A;  3R1P A;  3K21 A;  4QJ4 B;  4IK1 A;  4EDS A;  3NT9 A;  1PSR A;  4PPL A;  4I5J A;  2M29 A;  5KSZ A;  3DY9 A;  5T3I A;  1HT9 A;  4MRX A;  5KTY A;  1QLS A;  5JOL A;  5EL2 A;  1V1F A;  1K90 D;  4N5X A;  1TWO A;  4R6D A;  4R1E A;  1DJX A;  2I7A A;  4IK8 A;  1KQM B;  3SG6 A;  2LMU A;  2AAO A;  1A29 A;  1DEL A;  3SJS A;  1S3P A;  1J7Q A;  1SPY A;  5HGE A;  2P70 A;  3FS7 A;  1QWV A;  4ZB1 A;  4USL A;  5CSI A;  3PLF B;  1SR6 B;  2JXL A;  3U0M A;  1JBA A;  4OV2 A;  2LVJ A;  2C9I A;  4JFG A;  3KCT A;  3SSY A;  4HQ9 A;  3DQL A;  2ZO7 A;  5ER4 X;  4JGE A;  2C9J A;  1YUT A;  3DQI A;  1KQM C;  1OMD A;  5HZS A;  2KAV A;  3DQ3 A;  2BBM A;  3DQD A;  1YX8 A;  1SKT A;  2L4H A;  3U0K A;  4XYN A;  2A46 A;  1M39 A;  3HCM A;  2HQ8 A;  3CB9 A;  1SSE B;  3MGF A;  2AH8 A;  3CS1 A;  3PM2 A;  4YGA A;  4B30 B;  3S0D A;  2G2S B;  4W7X A;  2ZRS A;  2LVV A;  1PSB A;  2IE2 A;  3L4A A;  2JT0 A;  4P5O E;  4W6C A;  1NCX A;  3U8A A;  2DD9 A;  2HFC A;  1LXF C;  1K9U A;  1HQV A;  4D1E A;  2LMV A;  3DPW A;  4IL1 A;  3CFF A;  2HPS A;  3CZ2 A;  2NZ0 A;  1BG1 A;  1JC0 A;  4KGE A;  1Q4E A;  2JC2 A;  2EC6 B;  3TDI A;  2QLH A;  2WOS A;  1W7U A;  1F54 A;  4AQJ A;  5FYX A;  1PAL A;  5J2O A;  1SK6 D;  1G8I A;  2G5Z B;  2PYQ A;  2GGZ A;  2LV7 A;  1RFJ A;  3ED8 A;  1TOP A;  4DCK A;  4PHM A;  2K2F A;  4KGF A;  4JWQ A;  3VK1 A;  3CD1 A;  1XSS A;  1B8C A;  1QYO A;  2YDZ A;  1XYD A;  1GJY A;  2KLD A;  4FTG A;  3CBE A;  4W6O A;  2BEC A;  1DEK A;  1H4U A;  1DJW A;  2B1U A;  2I2R E;  1QLK A;  2WC5 A;  1TNW A;  4W77 A;  3SS3 A;  3IQQ A;  1UHJ A;  1AP4 A;  4J88 A;  2KPH A;  2D8N A;  1BT6 A;  2K0J A;  5TNC A;  1C7W A;  2HQK A;  4CFR A;  1KWO B;  4HSZ A;  1W7I B;  4C0K A;  1B9A A;  2COL B;  4YGC B;  3VIC A;  4DXQ A;  2H5O A;  4XJK A;  1KP5 A;  2GW3 A;  3OX6 A;  2QEO A;  2KI4 B;  1NX3 A;  4UPG A;  4W6P A;  5D7F A;  3SSV A;  5JJG A;  3OB2 B;  1TIZ A;  3SSP A;  4CID A;  1QXT A;  3DQF A;  5HKZ A;  4GGF A;  4W6U A;  4JD9 A;  4PCW A;  1BFP A;  5GQQ C;  2BE4 A;  1PVB A;  2GX2 A;  1C7V A;  1OOJ A;  2KI4 C;  3TDZ A;  2KAY A;  4MZK A;  2P6B B;  1XMZ A;  2QU1 A;  3AKA A;  5FHV A;  4H3L A;  4GFT A;  1Y0V H;  3KHE A;  1DGU A;  2ZMW A;  4DS7 A;  3ZUJ A;  4IK5 A;  4EUL A;  3HX4 A;  5DIC A;  1MYW A;  4JEO A;  3NEZ A;  3I5G B;  1SY9 A;  1XAE A;  2WSO A;  2HPW A;  3NSI A;  2G6X A;  4KF5 C;  3LF4 B;  4QJ5 B;  1CFC A;  5HYD A;  2PVB A;  1OOF A;  4W6H A;  4NQG A;  5I2O A;  5BPJ A;  2Y1M A;  1RRO A;  1M63 B;  3CZ1 A;  4H47 A;  3SS0 A;  4XJK B;  2OTB A;  3LF3 A;  2JWW A;  2YE1 A;  2KOT A;  5DPJ A;  2JT8 A;  3LL8 B;  1XK4 C;  1KFU L;  2PAS A;  4DIR A;  1CLM A;  2LM5 A;  1KCY A;  1UHI A;  4ZIN A;  1KFX S;  2JNX A;  2EMN A;  2PRU A;  1YVL A;  2WCH A;  3GK2 A;  1DF0 B;  3D78 A;  2A53 B;  2G16 B;  2ZO6 A;  4GBA A;  2FL1 A;  1IIO A;  4HRE E;  1NX0 A;  1FPW A;  4L12 A;  1NPQ A;  5DRF A;  4KAG A;  3Q8I A;  4ZCU A;  3M24 A;  4AQI A;  4F7F A;  2HQW A;  3EVV A;  1SL7 A;  2ZKM X;  4PHN A;  3SV5 A;  1NSH A;  2HGD A;  4KA9 A;  3WLD A;  1A4P A;  3OBV A;  4INX A;  4MN0 A;  4IK9 A;  4CFQ A;  4ORA B;  3RWT A;  4N1F A;  2KGR A;  3AAJ A;  1W7T A;  4RYS A;  3EVP A;  3S0E A;  4XOV A;  2JUL A;  5DTL A;  1PUL A;  2ZNE A;  1S6J A;  1Q4D A;  1A75 B;  5I94 A;  3KCS A;  3SG3 A;  4J89 A;  2GV5 A;  2JOJ A;  3CFA A;  4DXP A;  1CDM A;  3DQ2 A;  3KPX A;  3D76 A;  5BQL A;  3PFV A;  1EG4 A;  1DJI A;  1F4O A;  3FIA A;  1TUJ A;  5HBD A;  1TUZ A;  3TDU A;  2JNF A;  3CR4 X;  4LJB A;  1S6C A;  1M45 A;  2SCP A;  3PIB A;  4DXM A;  2B3Q A;  2SAS A;  2A4J A; 
#chains in the Genus database with same CATH homology
 4JQ0 D;  1R2U A;  2OJK A;  5HKW A;  1AVS A;  2AUC A;  3WHT B;  2F3Y A;  1SCM B;  2MRD A;  2E6W A;  4HQC A;  2Z6Y A;  3E5W A;  3SRY A;  2M7L A;  2F33 A;  1W7S A;  5LTR A;  1DTL A;  2F3Z A;  4JRB A;  1MF8 B;  2E30 A;  3SG2 A;  4E68 A;  5AAN A;  1LA0 A;  4WQ2 A;  2JT3 A;  3SSK A;  5DY6 A;  3PN7 C;  1KSO A;  1NP8 A;  4MBE A;  1QVI Y;  1CFD A;  2G6E A;  5H88 A;  3CGA A;  1MWN A;  5AER A;  3SVD A;  2O29 A;  1TNX A;  1BJF A;  2AMI A;  4N1G A;  2MJW B;  1QX5 B;  1JWD A;  4YGD B;  4KW9 A;  2ZN9 A;  4J8A A;  3DQA A;  1SR6 C;  1K8U A;  1TN4 A;  2QPT A;  4OCI A;  1KK7 Z;  3VRR A;  1M31 A;  2OTG C;  5KU1 A;  1KYP A;  3ST4 A;  1N65 A;  3EVR A;  4B30 A;  5CSF A;  2NCP A;  2CTN A;  3UG0 A;  3IF7 A;  1U5I B;  2LUC A;  1BOC A;  2MBX A;  5LTQ A;  1ZGQ A;  2PSR A;  4L13 A;  1J1E A;  2WIS A;  4W6M A;  2GW4 B;  2PXS A;  1F71 A;  4WQ3 A;  4OVN F;  2DUH A;  3SVR A;  4W73 A;  1QAS A;  5DPG A;  1Z1P A;  1IQ3 A;  1UWO A;  3E5V A;  4XOW A;  2FOT A;  3DQJ A;  5EB7 A;  3OGO A;  1WDC B;  2HRS A;  1NCY A;  1SMG A;  3PJ5 A;  3U0N A;  1B8L A;  4HE4 A;  2BCX A;  2EGD A;  1QV0 A;  4MEW A;  4KW8 A;  1J7P A;  4I5N B;  1CNP A;  3KO0 A;  1CDL A;  4ZF3 A;  2K7B A;  2WCB A;  3F45 A;  2H9W A;  4BDU A;  4TNC A;  1F8H A;  1CLB A;  5CSN A;  1KFX L;  3I5I C;  2M49 B;  5AFP A;  1G4Y R;  3ST3 A;  1Y1A A;  2KQ6 A;  3BOW B;  3WXA A;  2H5Q A;  1G33 A;  1R6P A;  1BR4 B;  3KEV A;  4P76 A;  2BKI B;  3OP0 A;  3AI5 A;  1JUO A;  1B1G A;  1UUS A;  3ZTF A;  3DQH A;  1B9C A;  3DQO A;  3VRP A;  2EC6 C;  3SVU A;  2H61 C;  1QS7 A;  4FQO A;  1EMF A;  1D1O A;  1EXR A;  1SBJ A;  1B4C A;  2DUI A;  3G9A A;  2KAX A;  5K89 A;  2AWM A;  1SW8 A;  4M2O A;  1Z1Q A;  1Q4A A;  3I5I B;  4Q04 A;  1L2O C;  2LAN A;  2KYF A;  3A8R A;  3BUO B;  4OY4 A;  1ALV A;  4DXN A;  4C0J A;  1DJH A;  5DTX A;  1QY3 A;  4W6K A;  3U8C A;  1HCJ A;  3H4S E;  3KF9 A;  1CTR A;  5LTP A;  4GF6 B;  1AJ4 A;  4ANJ A;  1YFP A;  4PHK A;  1N0Y A;  3SSH A;  2POX A;  3DVE A;  1UP5 A;  1IKU A;  1GFL A;  4W6F A;  5G08 A;  4NDD A;  3NF0 A;  4HRH A;  4I5L B;  4PDZ A;  3CGL A;  1ZMZ A;  1ZGO A;  3GK4 X;  3LVC A;  2JTT A;  4W7R A;  2CXJ A;  2IS9 A;  4MZL A;  1B8R A;  2HET A;  4L1I A;  2V4E C;  3NSK A;  3DQ6 A;  4DKN A;  3BQ3 A;  4YGB B;  3M0W A;  2ZND A;  3EKH A;  4PE0 A;  3JTD B;  1XA9 A;  4YI8 A;  2Z1O A;  5I8N A;  2QLI A;  3CR5 X;  3O2P A;  1EMB A;  2LHI A;  1SYM A;  2MLF C;  1KYS A;  2RH7 A;  1IQ5 A;  1JF0 A;  3FWB A;  4JF9 A;  2LUX A;  4W6N A;  4OQW A;  1QJT A;  2DD7 A;  3CTN A;  4M2Q A;  3PJ7 A;  1EMK A;  2K7D A;  3LK0 A;  1MXE A;  2HF5 A;  1A2X A;  1L7Z A;  4NDB A;  1REC A;  3RM1 A;  2LLT A;  3AKO A;  1TCO B;  1RMP A;  1CMF A;  4GGF C;  5FVI A;  1V1G A;  4MLW A;  1LA3 A;  5J3X A;  2GGM A;  2CNP A;  2H5R A;  1VRK A;  3BX9 A;  3ZUF A;  2WOR A;  3OB1 B;  5B8I B;  2LCP A;  1UHH A;  2YE0 A;  4AOM A;  3EK7 A;  2HGY A;  1UIS A;  2Q6P A;  1GGZ A;  3GEX A;  2L51 A;  2V4E A;  2NLN A;  2KBM A;  3I5G C;  3DF0 B;  4ETO A;  4A4C A;  4YRU A;  4YI9 A;  1S6Z A;  2V53 A;  2O60 A;  1JC1 A;  1OZS A;  1K2H A;  1CKK A;  2M7N A;  1NCZ A;  2M1U A;  3TMT A;  2O2B A;  5PAL A;  3TZ1 A;  5EHU A;  4PFE A;  2LP2 A;  5HKY A;  2M1K B;  1TNP A;  4GGN A;  5DPI A;  2OKY A;  2MHH A;  5I2L A;  2A48 A;  4W74 A;  3TUY C;  1XA5 A;  2L0P A;  1C4F A;  1S5G Y;  1DGV A;  1KSM A;  1YUS A;  1PRW A;  4WRI A;  3IQO A;  3BUX B;  3VRN A;  1XFY O;  2LMT A;  1BOD A;  3PJB A;  1XFV O;  1AHR A;  2M9G A;  2MA2 A;  3CZT X;  4PE1 A;  2EMD A;  3NSO A;  2LP3 A;  4HRG A;  2GX0 A;  1MR8 A;  1YVH A;  3O77 A;  3A4U B;  3V3D A;  2BKH B;  3AKB A;  3FWC A;  4OHS A;  3JTD C;  3CLN A;  2LC5 A;  3TUY B;  4LJC A;  4IK3 A;  3DQ1 A;  4XL5 A;  1KWO C;  4H3N A;  4DXI A;  5EXC I;  1S6I A;  3DQC A;  1F70 A;  2ARL A;  1WLZ A;  1SCV A;  5CPV A;  3C1V A;  1IJ6 A;  2Q91 A;  2KYC A;  2QAC A;  1YJ2 A;  1YUU A;  1QVI Z;  1RTP 1;  1PVA A;  2G9B A;  2G2B A;  3ST0 A;  3LVD A;  2DDD A;  1ZUX A;  1CB1 A;  1H4B A;  1GQM A;  4B5Y A;  1YHI A;  3CWG A;  3SG4 A;  3JVT B;  5HZT A;  2BL0 B;  2FWQ A;  3NSL A;  1OSA A;  3ADF A;  2ZMU A;  1K9K A;  1K93 D;  2JTZ A;  4RTC A;  4W75 A;  4LW5 A;  1CFP A;  3O6B A;  2LVK A;  3DPX A;  2Z6X A;  2H6V A;  4KPI A;  5KTG A;  2LAP A;  5FVG A;  2A50 B;  1QYF A;  4W6T A;  1QXP A;  1BF5 A;  1KK8 B;  3DVK A;  1XFU O;  1ZFS A;  3ZWH A;  1OZO A;  3GJ2 A;  2HQZ A;  1H6R A;  3SVS A;  1KQV A;  3DVJ A;  4EN1 A;  5D69 A;  4I2Y A;  1ZUZ A;  5DQB A;  1ZAC A;  3JVT C;  3PM8 A;  2H61 A;  1RRX A;  4W7D A;  4W6D A;  5DRG A;  3PAT A;  3AI4 A;  2IOV A;  4YGE B;  4GUK A;  4F0Z B;  2NCO A;  1XFX O;  2KI6 D;  3I5H C;  3E5T A;  4ORB B;  2ZN8 A;  2H5P A;  4AS8 A;  2A52 B;  3BXC A;  2F2O A;  4PHJ A;  3ZNI A;  4BY4 A;  3LSA A;  4W7E A;  1F09 A;  4Z4K A;  2WSN A;  5DKN A;  2KSP A;  2PXW A;  4N3D A;  1S5G Z;  3BUW B;  2VVH A;  3K1K A;  2H2K A;  4LJD A;  1EML A;  1B7T Y;  4GOB A;  1XK4 A;  5FVF A;  4P1Q A;  1J55 A;  2KGB C;  3O4Y A;  2OGR A;  5IBW A;  2O24 A;  4W6R A;  1ALW A;  2EMO A;  3DPZ A;  4QJ3 B;  1FI6 A;  1AJ5 A;  1NX2 A;  3S05 A;  4XGY A;  3VGO A;  4LJD C;  3CFH A;  1FF1 A;  2ZRT A;  3ICB A;  3DQK A;  3NED A;  4CLN A;  3OX5 A;  2CCM A;  4JC2 A;  3IP2 A;  1IG5 A;  5HLV A;  3EVU A;  1MXL C;  3OHM B;  4NWS A;  2R2I A;  1WRL A;  2WHS A;  2O5G A;  4ZIO A;  2CT9 A;  1WRZ A;  2TN4 A;  1NUB A;  2AWL A;  1XFW O;  1RMM A;  3BXB A;  4DKM A;  5BT0 A;  1SRA A;  3BOW A;  1DF0 A;  2M3W A;  3EK4 A;  1Q80 A;  1KK8 C;  4NDC A;  5DU0 A;  2F2P A;  4Q7T A;  1SL8 A;  2G6Y A;  2KBI A;  3EK8 A;  1XVJ A;  1YR5 A;  3M22 A;  3SG5 A;  4ZF5 A;  4Z4M A;  2LVI A;  1G7K A;  5BTT B;  3LA1 A;  3A8S A;  1OXF A;  4JPZ B;  5DTZ A;  5I2Q A;  1UHK A;  2WCE A;  2M0R A;  5DQM A;  3SSL A;  2DOQ A;  2BBN A;  1SCM C;  2BE6 A;  4GAO A;  3RLZ A;  4DUQ A;  1EG3 A;  2K61 A;  1YHG A;  1NIW A;  1GL4 A;  3TMR A;  2KHN A;  3DQ8 A;  2QZ0 A;  3OSQ A;  4I5K A;  4OKH A;  3IR8 A;  3SG7 A;  3WLC A;  2FCD A;  2A47 A;  1OMR A;  2PMY A;  2OS8 C;  3EKJ A;  1MOU A;  1QYQ A;  2KQY A;  2H8Q A;  1NYA A;  2K7O A;  1EL4 A;  3DVM A;  3PSR A;  3NXA A;  2BCB A;  1U5I A;  1Y1U A;  4OR9 B;  3D0Y A;  2Q57 A;  4W7C A;  1OQP A;  3I5H B;  4MRY A;  3LK1 A;  1BLQ A;  1KK7 Y;  1E8A A;  3GOF A;  1EH2 A;  3I19 A;  4YBH B;  3WHU B;  1RM9 A;  1CM1 A;  2PAL A;  1L2O B;  2JQ6 A;  4EMQ A;  1MHO A;  2VVJ A;  2HJO A;  1QIV A;  1WY9 A;  2L5X B;  1WDC C;  4H48 A;  2VRG A;  2OTE A;  4CPV A;  2BCA A;  3GJ1 A;  3AAK A;  1B7T Z;  5AXI A;  4U2V A;  2MLE C;  1FI5 A;  2WHU A;  2JRF A;  3VRO A;  3SST A;  1F0B A;  5EXU A;  2B3P A;  3W1D A;  1Q4C A;  4W6S A;  3ZUL A;  1LIN A;  4Q9W A;  1YUR A;  5EXB A;  1RJV A;  4W6I A;  4R6B A;  2JPT A;  1YRT B;  5CSJ A;  2L4I A;  3LCP C;  2IB6 A;  4W69 A;  2V4E B;  4H3M A;  1S26 D;  3SVC A;  2LE9 B;  1BR1 B;  1MOV A;  2WHT A;  5ER5 A;  3WCK A;  2K7C A;  2L50 A;  4W7F A;  1SNL A;  2VAE A;  4RYW A;  1JBZ A;  4MSP A;  1A75 A;  1Q73 A;  1JC2 A;  1GGW A;  4GPL B;  1QTX A;  3P8U A;  2Y0G A;  1DMO A;  1OXE A;  1CDP A;  1Y1X A;  1HUY A;  2DUG A;  4UTS A;  3DD4 A;  3LVA A;  1TCF A;  1TRF A;  4ZFS A;  1JSA A;  4HVF A;  4XVP A;  1XQM A;  5EJU A;  4M2P A;  3ST2 A;  1EMM A;  2AWJ A;  3SVN A;  3QRX A;  5HZU A;  3H1R A;  3P28 A;  5F9G A;  2QT2 A;  3BUM B;  3I5F B;  1Y6W A;  5F6T A;  4KF5 A;  4PPJ A;  1WRK A;  2QLG B;  5HW9 A;  1BMO A;  4AR7 A;  1F4Q A;  1CLL A;  2VAD A;  1MUX A;  4W72 A;  1EMG A;  4KW4 A;  2VVI A;  1YTZ C;  1LVC D;  2ZFD A;  2KI6 C;  4DRW A;  2QRF A;  4ICB A;  1YRU B;  2DUE A;  5DTY A;  4Q7R A;  1A03 A;  3DQM A;  2Y5I A;  3GB3 A;  3VHT B;  3SVB A;  1S1E A;  1CFF A;  1QAT A;  1DJZ A;  5H89 A;  3WNX B;  5DKR A;  3BUN B;  1J1D A;  1JFJ A;  4C0L A;  1ODB A;  3PAL A;  4L9M A;  3I5F C;  5EBJ A;  2LLS A;  3DQ5 A;  2DUF A;  2JXC A;  3GK1 A;  1CV7 A;  1FBV A;  1CMG A;  1NWD A;  2WND A;  4GNK B;  3TS5 B;  2OPO A;  3D10 A;  1RK9 A;  1C07 A;  4TZA A;  1KFU S;  1DT7 B;  1H8B A;  3LS3 A;  4EDO A;  3CD9 A;  5DPH A;  2KDH A;  1YZW A;  2KNE A;  2MAZ A;  1ZOT B;  3BYA A;  4W6B A;  1EJ3 A;  1F55 A;  3DQ7 A;  1SL9 A;  5DKQ A;  1AK8 A;  2KFG A;  5BTT A;  3PN7 B;  1K95 A;  5HZO A;  2RGI A;  1UUR A;  3TS5 C;  1ZGP A;  4A4B A;  5LK4 A;  1JFK A;  3VHT A;  2CBL A;  1UHN A;  5EB6 A;  2WC8 A;  3NT3 A;  2Y1N A;  2KFH A;  2I18 A;  2KFF A;  1N2D A;  3DQN A;  4TZG A;  4IZN A;  2M8U A;  1W7J B;  1MQ1 A;  2LLU A;  3H1O A;  1IRJ A;  5HLO A;  2M97 A;  1M46 A;  1QX7 A;  2YFP A;  1OMV A;  1RMO A;  1IH0 A;  3OSR A;  4KEX A;  1JBY A;  4W6A A;  2JZI A;  3CR2 A;  2Z6Z A;  3E3R A;  4MZJ A;  4OJ0 A;  2F8P A;  1K96 A;  2OKW A;  2ICR A;  1QX2 A;  1DJY A;  2Y4Q A;  4LQT A;  1IJ5 A;  1J7O A;  1YX7 A;  2IB5 A;  3DQE A;  2LNK A;  3BXA A;  4GES B;  2K2A A;  1EME A;  1TNQ A;  1WLM A;  1IWQ A;  1Q4B A;  2FJU B;  2ISD A;  1GGX A;  2K8M B;  2NXQ A;  1S36 A;  1K9P A;  4W7A A;  2G3D B;  1TTX A;  2FCE A;  4OGS A;  1YHH A;  4ZF4 A;  3SVE A;  2Q4U A;  2BTJ A;  2OTG B;  2BL0 C;  1YJF A;  1DJG A;  2VZX A;  4IK4 A;  2AWK A;  3W1C A;  4HQ8 A;  5AEQ A;  5H87 A;  1PK0 D;  2L2E A;  4BY5 A;  2LHL A;  4ZCV A;  1KYR A;  3BXK A;  4U8D A;  3O78 A;  1XO5 A;  1CM4 A;  3DQU A;  3U8P A;  2FZU A;  1FW4 A;  1QIW A;  2A54 B;  1QV1 A;  2DDC A;  2A56 B;  2JU0 A;  2G3O A;  2QLG A;  4MVF A;  2QLE A;  1JF2 A;  2I94 A;  4PPK A;  1OE9 B;  4PE7 A;  4Q7U A;  4W6L A;  4DXO A;  2L98 A;  2WUR A;  4ORC B;  4PAL A;  1NX1 A;  2P4M A;  1X02 A;  1AUI B;  1XFZ O;  3GL4 A;  1EMA A;  3UFZ A;  2HCG A;  2EHB A;  4W6J A;  4W76 A;  4P2Y B;  1CDN A;  2OS8 B;  1EMC A;  1LKJ A;  3SIA A;  1OXD A;  1IGV A;  3MSE B;  1B47 A;  3DQ9 A;  3LLE A;  5AQB B;  1J7R A;  4W6G A;  3U0L A;  4KF4 A;  2AHA A;  1BU3 A;  3VRQ A;  4Q9X A;  3DQ4 A;  2JAD A;  4PE4 A;  4ZBL A;  2WIQ A;  3RWA A;  1K94 A;  4ORN A;  3DF0 A;  3D0Y B;  1DVI A;  3SIB A;  4LQU A;  2WCF A;  1RWY A;  3SVO A;  3K21 A;  4QJ4 B;  4IK1 A;  4EDS A;  3NT9 A;  1PSR A;  4PPL A;  4I5J A;  2M29 A;  5KSZ A;  5T3I A;  1HT9 A;  4MRX A;  5KTY A;  1QLS A;  5JOL A;  1V1F A;  1K90 D;  4N5X A;  4R6D A;  4R1E A;  1DJX A;  2I7A A;  4IK8 A;  1KQM B;  3SG6 A;  2LMU A;  2AAO A;  1A29 A;  3SJS A;  1S3P A;  1J7Q A;  1SPY A;  5HGE A;  3FS7 A;  4ZB1 A;  4USL A;  5CSI A;  3PLF B;  1SR6 B;  2JXL A;  3U0M A;  1JBA A;  4OV2 A;  2LVJ A;  2C9I A;  4JFG A;  3KCT A;  3SSY A;  4HQ9 A;  3DQL A;  2ZO7 A;  5ER4 X;  4JGE A;  2C9J A;  1YUT A;  3DQI A;  1KQM C;  1OMD A;  5HZS A;  2KAV A;  3DQ3 A;  2BBM A;  3DQD A;  1YX8 A;  1SKT A;  2L4H A;  3U0K A;  4XYN A;  2A46 A;  1M39 A;  3HCM A;  2HQ8 A;  3CB9 A;  3MGF A;  2AH8 A;  3CS1 A;  4YGA A;  4B30 B;  2G2S B;  4W7X A;  2ZRS A;  2LVV A;  1PSB A;  2IE2 A;  2JT0 A;  4P5O E;  4W6C A;  1NCX A;  3U8A A;  2DD9 A;  2HFC A;  1LXF C;  1K9U A;  1HQV A;  4D1E A;  2LMV A;  3DPW A;  4IL1 A;  3CFF A;  2HPS A;  2NZ0 A;  1BG1 A;  1JC0 A;  4KGE A;  1Q4E A;  2JC2 A;  2EC6 B;  3TDI A;  2QLH A;  2WOS A;  1W7U A;  1F54 A;  4AQJ A;  5FYX A;  1PAL A;  5J2O A;  1SK6 D;  1G8I A;  2G5Z B;  2GGZ A;  2LV7 A;  1RFJ A;  3ED8 A;  1TOP A;  4DCK A;  4PHM A;  2K2F A;  4KGF A;  4JWQ A;  3VK1 A;  3CD1 A;  1XSS A;  1B8C A;  1QYO A;  2YDZ A;  1XYD A;  1GJY A;  3CBE A;  4FTG A;  4W6O A;  2BEC A;  1H4U A;  1DJW A;  2B1U A;  2I2R E;  1QLK A;  1TNW A;  4W77 A;  3IQQ A;  1UHJ A;  1AP4 A;  4J88 A;  2D8N A;  1BT6 A;  2K0J A;  5TNC A;  1C7W A;  2HQK A;  4CFR A;  1KWO B;  4HSZ A;  1W7I B;  4C0K A;  1B9A A;  2COL B;  4YGC B;  3VIC A;  4DXQ A;  2H5O A;  4XJK A;  1KP5 A;  2GW3 A;  3OX6 A;  2KI4 B;  1NX3 A;  4UPG A;  4W6P A;  5D7F A;  3SSV A;  5JJG A;  3OB2 B;  1TIZ A;  3SSP A;  4CID A;  1QXT A;  3DQF A;  5HKZ A;  4GGF A;  4W6U A;  4PCW A;  1BFP A;  5GQQ C;  2BE4 A;  1PVB A;  2GX2 A;  1C7V A;  1OOJ A;  2KI4 C;  3TDZ A;  2KAY A;  4MZK A;  2P6B B;  1XMZ A;  2QU1 A;  3AKA A;  5FHV A;  4H3L A;  4GFT A;  1Y0V H;  3KHE A;  1DGU A;  2ZMW A;  4DS7 A;  3ZUJ A;  4IK5 A;  4EUL A;  3HX4 A;  1MYW A;  4JEO A;  3NEZ A;  3I5G B;  1SY9 A;  1XAE A;  2WSO A;  2HPW A;  3NSI A;  2G6X A;  4KF5 C;  3LF4 B;  4QJ5 B;  1CFC A;  5HYD A;  2PVB A;  4W6H A;  4NQG A;  5I2O A;  5BPJ A;  2Y1M A;  1RRO A;  1M63 B;  4H47 A;  3SS0 A;  4XJK B;  2OTB A;  3LF3 A;  2JWW A;  2YE1 A;  2KOT A;  5DPJ A;  2JT8 A;  3LL8 B;  1XK4 C;  1KFU L;  2PAS A;  4DIR A;  1CLM A;  2LM5 A;  1KCY A;  1UHI A;  4ZIN A;  1KFX S;  2JNX A;  2EMN A;  2PRU A;  1YVL A;  3GK2 A;  1DF0 B;  2A53 B;  2G16 B;  2ZO6 A;  4GBA A;  2FL1 A;  4HRE E;  1NX0 A;  1FPW A;  4L12 A;  1NPQ A;  5DRF A;  4KAG A;  4ZCU A;  3M24 A;  4AQI A;  2HQW A;  3EVV A;  1SL7 A;  2ZKM X;  4PHN A;  3SV5 A;  1NSH A;  2HGD A;  4KA9 A;  3WLD A;  1A4P A;  4MN0 A;  4IK9 A;  4CFQ A;  4ORA B;  3RWT A;  4N1F A;  2KGR A;  3AAJ A;  1W7T A;  4RYS A;  3EVP A;  4XOV A;  2JUL A;  5DTL A;  1PUL A;  2ZNE A;  1S6J A;  1Q4D A;  1A75 B;  3KCS A;  3SG3 A;  4J89 A;  2GV5 A;  2JOJ A;  3CFA A;  4DXP A;  1CDM A;  3DQ2 A;  3KPX A;  5BQL A;  3PFV A;  1EG4 A;  1DJI A;  1F4O A;  3FIA A;  5HBD A;  3TDU A;  2JNF A;  3CR4 X;  4LJB A;  1S6C A;  1M45 A;  2SCP A;  3PIB A;  4DXM A;  2B3Q A;  2SAS A;  2A4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...