3EKJA

Calcium-free gcamp2 (calcium binding deficient mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
301
Chain Sequence
LENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGGITTKQLGTVMRSLGQNPTEAELQDMINEVGGTIDFPQFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 78
structure length 301
sequence length 318
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekjA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekjA01
3DPXA 2KI4C 3NSIA 2JU0A 3GK4X 1M31A 4PE1A 1NX2A 2OTBA 2HRSA 3BUMB 4IL1A 5DKNA 4W6DA 2LLTA 4YGDB 1UHJA 2O2BA 3CD9A 4M2PA 3CB9A 1OXDA 5DRGA 1UHIA 5ER5A 2JULA 2QPTA 1BFPA 4GESB 1TNQA 3DQ1A 4KW4A 1CFDA 4GPLB 2QLGB 2HQKA 3SVSA 1F71A 3JTDC 3SSPA 1K9PA 5AFPA 2V53A 4W6SA 1F8HA 1V1FA 3SVBA 5CPVA 3DQEA 2ZKMX 3SG2A 1IQ3A 5BQLA 1PALA 4UTSA 1OQPA 1W7TA 2G6YA 4DIRA 3KHEA 1SCMB 3I5HC 1EMMA 2C9IA 4BY4A 3WNXB 4IK1A 3SG3A 3TDUA 2JC2A 2CCMA 1CLMA 5HKWA 2VRGA 4MLWA 5JOLA 1W7SA 2VAEA 4RYWA 4LW5A 4OQWA 1S1EA 4MZJA 4ZCUA 3JTDB 3LS3A 2M8UA 5EB6A 2G5ZB 4YBHB 3ZTFA 1KSMA 1DJGA 1KWOC 3DVKA 2LMUA 4I5LB 1QX5B 1A75A 1FW4A 5HZTA 3I5HB 2OKYA 5CSFA 1CM4A 3KF9A 2HCGA 1ALWA 1HCJA 1XMZA 1SCVA 4XJKB 2L2EA 1XVJA 1DJZA 3TMTA 2A48A 4JPZB 1TTXA 2FOTA 2OGRA 1KK7Y 2BTJA 3LF3A 4F0ZB 4C0JA 1BLQA 3U0MA 1JFKA 2YE1A 2FZUA 3KO0A 1NX0A 3PN7C 3H1RA 2Y5IA 2HGDA 2M97A 4NDCA 2EMNA 3PM8A 2A50B 2BKIB 3DQ7A 1F55A 4Q9XA 3TZ1A 1A4PA 4CFRA 5J2OA 2A53B 2ICRA 2F33A 2H5QA 5FVIA 1BR1B 4EULA 4W6FA 1OE9B 3RWAA 5AXIA 1GL4A 1VRKA 4OJ0A 4PHKA 1RFJA 5AQBB 3CR2A 5I2QA 5JJGA 1YUSA 4ZINA 1AVSA 3UG0A 1JBYA 3K21A 1K94A 2K2FA 2LE9B 2QU1A 5IBWA 2EC6C 1NSHA 2JXLA 3SVRA 2NZ0A 1AJ4A 2JTZA 2JNFA 4H3MA 4JC2A 1AJ5A 1YRUB 4HRGA 1QJTA 3SRYA 2HF5A 1EXRA 1AK8A 1CLLA 4A4CA 3PALA 4M2OA 2CBLA 1K90D 3BQ3A 1EMFA 4RTCA 1NCXA 2M49B 3PJ5A 1ZUXA 3IQOA 5FYXA 2MLFC 2A56B 2BCXA 4H3NA 2O24A 1Q4EA 1JF0A 1QTXA 4B30A 4B5YA 1UISA 3BOWA 5DPGA 1HUYA 2EC6B 3SVDA 1XQMA 4BY5A 2CXJA 4ETOA 3OX6A 3DQ8A 5KTGA 1B8LA 2FL1A 4W7CA 1S6CA 2MAZA 3TDZA 5D7FA 3ST2A 5CSNA 1BOCA 1Z1PA 1XFXO 2BBMA 1WRLA 4PALA 2HQZA 2POXA 3EVVA 1Y1UA 5HLVA 2KI6D 2KOTA 5HBDA 4L9MA 4HQ9A 4N5XA 1BU3A 2IB6A 3A8SA 2CT9A 3K1KA 1JFJA 1BR4B 3BXKA 2BCAA 4KA9A 1L2OC 4W6NA 4I5NB 1MUXA 5HKZA 1BJFA 2KSPA 1S3PA 1OXFA 4ZF5A 2WORA 3D0YB 1AP4A 1QIWA 3E5VA 2LC5A 1YVHA 4DXQA 1Y6WA 2VVHA 3GL4A 2G2SB 3I19A 2Q91A 3FWCA 1NUBA 2DOQA 2A54B 4YGAA 3NSLA 3CGAA 5HKYA 4DKNA 2R2IA 4KEXA 1N2DA 4N1FA 1SKTA 5EBJA 1L2OB 1IWQA 2LUXA 1ALVA 2ZNDA 2D8NA 2ZN8A 2WCBA 2PSRA 1GGZA 2GGMA 4I2YA 1A29A 3VROA 1RM9A 1BF5A 2SCPA 4GUKA 4YI9A 1DT7B 3V3DA 2SASA 2L0PA 4MEWA 1DJWA 4A4BA 2IE2A 1Y1XA 3NF0A 2K7CA 4CIDA 5DRFA 2LHIA 4Q9WA 4YGBB 1CM1A 3VRNA 3O6BA 1DF0A 1WRZA 2NXQA 5D69A 3DQNA 3LLEA 5F9GA 3ZUFA 2QACA 3PSRA 1MOVA 2H5PA 2AMIA 1PVAA 3SVUA 1G33A 1EMKA 1CFCA 1RROA 1XO5A 1SY9A 3JVTC 3ST0A 2WSNA 3SVOA 2M3WA 4GGNA 2O5GA 1NCYA 4ZBLA 1OMVA 4R6BA 5DQMA 3P28A 3NT3A 3DQCA 2C9JA 1TIZA 4ORNA 3VGOA 1MR8A 3KCTA 1UP5A 1KYPA 1B7TY 1NCZA 4MSPA 5H89A 3CFAA 1A03A 4ZCVA 1OOJA 4WQ2A 5EHUA 1DTLA 4I5KA 5KTYA 1MF8B 1Q80A 3E5WA 1KCYA 2Q57A 4JWQA 1DMOA 4W6LA 4NDBA 2K0JA 2WSOA 5BTTA 1CTRA 3BUOB 3PFVA 2IS9A 1J7PA 1B9AA 2AAOA 3DQIA 1DGVA 1KFXS 1KYRA 3JVTB 4MZKA 1CB1A 3VHTA 1TNWA 2Y4QA 2KI6C 4OHSA 4B30B 2JT8A 2JNXA 2QLEA 1CMFA 4JEOA 1QX2A 1Y1AA 4LJDC 3SSVA 1CV7A 2MRDA 2G9BA 1C4FA 1YX7A 3EK8A 1K93D 2DDCA 4MBEA 5J3XA 4NDDA 2M7NA 3AKOA 1GQMA 4DXOA 2O60A 2EHBA 2ARLA 2JPTA 1NYAA 2CTNA 4J89A 4OR9B 4U8DA 4IZNA 2KI4B 2LUCA 2F2PA 1KFUS 1TN4A 2YE0A 3U8CA 4HRHA 1CDNA 4W7AA 1B47A 5KSZA 5DKQA 2LCPA 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 2BECA 1XFZO 2ZRTA 5TNCA 3ADFA 3DQJA 1G8IA 4ZF4A 4XOVA 3WXAA 3W1DA 1MWNA 3H4SE 2DUGA 1SYMA 3RLZA 1ZGPA 4W6IA 3LSAA 3RWTA 2BKHB 3IQQA 1ZFSA 3P8UA 1XA9A 1KSOA 1R6PA 1MOUA 4W7EA 4KGFA 2PMYA 2OS8C 3LVDA 2WC8A 2ISDA 3PJBA 1KYSA 3GJ1A 1EMGA 2WNDA 3PATA 4P2YB 5FVFA 1QVIZ 5DTXA 2V4EC 2DUIA 4W73A 1RECA 4W74A 2HPWA 3AI5A 2PRUA 3O2PA 3LVAA 1OXEA 3DQUA 1DF0B 1SRAA 3SG6A 1K9UA 3SVNA 2Y1NA 3PJ7A 1LKJA 3OHMB 1SK6D 4PHJA 3ZWHA 5I2OA 1SMGA 4C0LA 4OVNF 4PCWA 4GAOA 4EN1A 1TRFA 3I5FC 4QJ4B 2JQ6A 2Z6XA 1TCOB 3EK7A 1B7TZ 2AWJA 3AKAA 3IP2A 3LK0A 4LJBA 1KWOB 2KAVA 4W6RA 1QX7A 3PIBA 4RYSA 4XOWA 3DQKA 1SR6C 2AHAA 4JFGA 1G7KA 2OS8B 3DD4A 1QYQA 1QY3A 1J7OA 4L12A 1R2UA 4DRWA 5F6TA 4PPKA 2V4EB 3GEXA 3M24A 5EXBA 3DF0B 1OMDA 3QRXA 1M46A 3NSOA 2F2OA 4D1EA 1QXPA 2PALA 5LTRA 3I5FB 1JBZA 4Q7UA 1OZOA 3FWBA 3OX5A 1XFVO 1YJ2A 1IRJA 1DJHA 2M29A 2I7AA 4U2VA 1C7VA 1SR6B 3PN7B 3OSRA 4DXMA 2Q6PA 2Z6ZA 1K8UA 1J1EA 1QV0A 4CFQA 1B4CA 1FI6A 1TNXA 1SL7A 5GQQC 3CLNA 2ZO7A 3GK1A 1JC2A 5DPIA 1SW8A 3DQ2A 1E8AA 3AAKA 2A52B 1EG4A 1S6ZA 1F4OA 4AOMA 1K95A 1ZGOA 2Y0GA 5DQBA 4GNKB 1CDMA 1TOPA 4Z4MA 2M0RA 4UPGA 2KFFA 2H6VA 4AR7A 3LL8B 3MSEB 1Q4AA 1MXLC 4MVFA 4GFTA 2NCPA 4W7DA 5DKRA 3O4YA 4W6BA 4C0KA 1H4BA 1BMOA 2LAPA 1U5IA 2KBIA 1QYOA 1K2HA 2NLNA 4OCIA 1PSBA 3WLCA 2B3PA 4DXPA 1DGUA 1YR5A 5LK4A 4HSZA 1DVIA 1OMRA 4QJ5B 2ZRSA 1RJVA 4JRBA 4W7XA 2MJWB 1RMOA 4W6PA 4WRIA 4Z4KA 1NX3A 1YVLA 2JXCA 4TNCA 3DQFA 2WCEA 2LLSA 4JQ0D 4LQUA 3O78A 2BBNA 2KFHA 2H61A 2EMDA 5CSIA 5B8IB 1YZWA 1NIWA 2L50A 3OP0A 2KQ6A 2JRFA 2LNKA 2LM5A 4NWSA 1QIVA 5DTLA 2WIQA 1BT6A 2DUFA 4MZLA 1EL4A 1KQVA 2LV7A 1YX8A 3CWGA 3VRQA 3AKBA 3NSKA 4W75A 5HYDA 1PULA 1DJXA 1A75B 4USLA 4M2QA 4PDZA 1KFXL 3GB3A 3GJ2A 2WHTA 4ORAB 2PVBA 1H8BA 1QLSA 1XFWO 1QV1A 4DXNA 2BE4A 5AEQA 1JF2A 4W6GA 2PASA 5T3IA 3KPXA 1M63B 4KW9A 4W7FA 4N1GA 5AANA 4OKHA 2K2AA 5I2LA 2G3DB 1SPYA 4H47A 3LCPC 2KQYA 3BUWB 5PALA 3DQ9A 2LP3A 2Z6YA 1QYFA 4IK8A 5DPHA 1GFLA 3HCMA 1MXEA 4YGEB 4J8AA 4MRYA 2Z1OA 1S5GZ 3OB1B 5EB7A 3NT9A 4FQOA 2E30A 4ZFSA 2HQ8A 1S6JA 4GOBA 2EMOA 4ANJA 3SSYA 1PSRA 1YUUA 1KP5A 1KFUL 1N0YA 2GX0A 4XGYA 3ST4A 2QLIA 1B9CA 4XJKA 4GGFA 3CBEA 4TZGA 3W1CA 1SNLA 2ZNEA 1GGXA 3DQ5A 1MYWA 3H1OA 3BX9A 4W7RA 2BCBA 3A8RA 3BXAA 4GF6B 1QVIY 3SSLA 1YHGA 3M0WA 3I5GC 2LP2A 1RMPA 2HGYA 2F8PA 2KAYA 1FF1A 1S36A 3SG7A 2MLEC 3SG5A 3FIAA 5H88A 3CGLA 3G9AA 2NCOA 2ZO6A 1KQMC 1B1GA 4KPIA 3TUYC 1V1GA 1ZACA 1HT9A 1M45A 2LVJA 3DQLA 1EJ3A 2RH7A 1WY9A 2PXWA 2QLHA 2H61C 1WLMA 2QZ0A 2WHSA 4ORBB 1C07A 3ST3A 2OKWA 3I5GB 1UHKA 2RGIA 4P1QA 3BOWB 1NX1A 3OB2B 2KNEA 2M9GA 1B8CA 3BUXB 1DJYA 1WDCC 2KHNA 1XA5A 2K8MB 1ZMZA 1FPWA 3EK4A 4W72A 5K89A 4KW8A 2OPOA 3WHTB 1EH2A 4ZB1A 1KQMB 4XYNA 3TUYB 1Q4CA 3CFFA 2HETA 1Q4BA 2COLB 3ZULA 2FJUB 4W6OA 4Q7TA 5DTYA 1Q73A 1UUSA 3S05A 3F45A 2P6BB 1SCMC 2WISA 2LVVA 1PK0D 2GV5A 4IK5A 2B1UA 1CFPA 5KU1A 4EMQA 2P4MA 5FHVA 4OV2A 2G16B 1A2XA 5BPJA 1WDCB 4KAGA 1LA0A 5DPJA 2FWQA 2LHLA 2M1UA 3OGOA 4Q7RA 2B3QA 2ZN9A 3SJSA 4CPVA 1W7UA 2AWLA 2MA2A 2H2KA 3SIAA 2L5XB 4HQ8A 4LQTA 4BDUA 3O77A 3EKJA 4KGEA 3OSQA 4JGEA 2K7BA 4WQ3A 4DS7A 3SSKA 3VRRA 5DY6A 2VVIA 3CZTX 3TMRA 2WHUA 1CFFA 2GX2A 2OTGC 3FS7A 2DDDA 3CR4X 2JTTA 1YUTA 4H3LA 2GW4B 1XK4A 4GGFC 1XFYO 2HFCA 1XAEA 3CTNA 1TNPA 4R6DA 1DJIA 1IG5A 1ZOTB 1ODBA 4PPJA 2E6WA 3DQAA 3DPWA 3IR8A 3D0YA 4KF5A 2G2BA 3BYAA 1BG1A 3EVRA 3U8PA 1FBVA 4ZF3A 1GJYA 4OY4A 2K61A 3GOFA 1OSAA 1AUIB 4AQJA 3EVPA 1YJFA 1EMAA 2TN4A 2OTGB 2H9WA 4EDOA 1KK8C 4PE7A 3CR5X 3DVMA 3WLDA 4J88A 5HGEA 1J7RA 2Q4UA 4PPLA 4W76A 3A4UB 3VRPA 5I8NA 2ZMUA 1RWYA 1C7WA 3LA1A 5EXCI 1EMEA 2AUCA 3BXBA 3CS1A 2DUHA 1JUOA 1SL8A 3SS0A 4L1IA 1NWDA 3WHUB 1IJ5A 1W7JB 2LMTA 1BODA 3MGFA 4HQCA 4PHNA 1Z1QA 4HE4A 4DXIA 3CD1A 2K7OA 4XL5A 1F09A 4ZIOA 4DCKA 2BL0C 4E68A 2LANA 5BT0A 1EMBA 1KK8B 2KGRA 1YHHA 4YI8A 3KCSA 2L98A 2G3OA 3C1VA 3SVCA 1S5GY 4IK3A 5BTTB 2A4JA 4H48A 2QRFA 3VHTB 3ICBA 2GW3A 3I5IC 1F0BA 4MRXA 2AWKA 4EDSA 3VICA 1JC0A 4DUQA 4L13A 1H6RA 3DPZA 3D10A 1FI5A 2BL0B 2JOJA 2FCDA 3U8AA 1LINA 1SBJA 1AHRA 4IK9A 4R1EA 1MQ1A 1S26D 2GGZA 5ER4X 3DQ6A 1YURA 4W6CA 5FVGA 2KYFA 2K7DA 1LVCD 4XVPA 1CKKA 1Q4DA 5HLOA 1XYDA 1QATA 3I5IB 1IGVA 1Y0VH 4AS8A 1GGWA 3ED8A 1JSAA 1XK4C 2KBMA 4GBAA 2I18A 5DTZA 4DKMA 3SV5A 1J55A 4I5JA 4JF9A 3NXAA 2JWWA 5H87A 5HZUA 1QS7A 5CSJA 1PVBA 4FTGA 1CDLA 3ZUJA 2JADA 4W6UA 1W7IB 1CDPA 3GK2A 1F70A 2HJOA 4KF5C 5HW9A 1SL9A 2PXSA 2G6EA 1OZSA 1S6IA 2HPSA 2KGBC 2VVJA 3SIBA 2LLUA 3LK1A 1EMLA 2IB5A 1TCFA 1UHHA 2MBXA 3SVEA 3RM1A 1CNPA 1ZGQA 2G6XA 4N3DA 4W6AA 4W6JA 2BE6A 1YFPA 2WURA 1QLKA 4W6TA 2KAXA 2QLGA 1K9KA 4W77A 1B8RA 2MHHA 3KEVA 1J7QA 2YFPA 1RK9A 4KF4A 4W6HA 3BXCA 1JC1A 2DD9A 4W69A 2Y1MA 1WLZA 3TDIA 4LJDA 3VK1A 1NP8A 1YRTB 4PFEA 2KFGA 2F3ZA 1KK7Z 1XSSA 2EGDA 3NEDA 3DQDA 3LVCA 4ORCB 3E5TA 4ICBA 2I2RE 2YDZA 1IKUA 1PRWA 2WCFA 1RMMA 3IF7A 1UURA 2AWMA 3BUNB 2H5RA 1QXTA 1RTP1 1XFUO 3NEZA 2I94A 2ZFDA 2DD7A 1IJ6A 5DU0A 5EXUA 2A46A 2L4HA 4YRUA 1LXFC 3AAJA 1M39A 5AERA 1EMCA 1LA3A 2H8QA 3DQMA 2IOVA 1UWOA 4P76A 1G4YR 3DVEA 2DUEA 1YHIA 3EVUA 2JZIA 4LJCA 2L4IA 2M7LA 1IQ5A 2QT2A 2L51A 3CFHA 3TS5C 1IH0A 4CLNA 1NPQA 4IK4A 3SSHA 4Q04A 2H5OA 4W6KA 2JT0A 1JWDA 2CNPA 1CLBA 2AH8A 5LTPA 1H4UA 1HQVA 1F4QA 3U0NA 4AQIA 3SG4A 5HZOA 2VADA 2HQWA 2A47A 2LMVA 1RRXA 2OTEA 5HZSA 3U0LA 1ZUZA 3WCKA 2JT3A 4OGSA 2F3YA 3UFZA 1QASA 1N65A 1X02A 3DQ3A 3TS5B 1J1DA 3U0KA 2WOSA 2V4EA 3AI4A 1EG3A 3DVJA 4HREE 3DQ4A 3DQHA 3SSTA 4NQGA 2LVIA 3DF0A 1D1OA 3PLFB 2O29A 2VZXA 2KDHA 4TZAA 2OJKA 4PHMA 3EKHA 4W6MA 2KYCA 3HX4A 4PE0A 4HVFA 5EJUA 5LTQA 2FCEA 3ZNIA 1JBAA 4YGCB 2ZMWA 3LF4B 1YTZC 1U5IB 4MN0A 4PE4A 4QJ3B 3DQOA 1UHNA 1MHOA 4P5OE 3M22A 3E3RA 2LVKA 1F54A 1WRKA
chains in the Genus database with same CATH superfamily
3DPXA 2KI4C 2P70A 3NSIA 2QEVA 2JU0A 3GK4X 1M31A 4PE1A 1NX2A 1XFRA 2OTBA 2HRSA 3BUMB 4IL1A 4F7FA 5DKNA 4W6DA 2LLTA 4YGDB 1UHJA 2O2BA 3CD9A 4M2PA 3CB9A 1OXDA 5DRGA 2FJYA 1UHIA 5ER5A 2JULA 2QPTA 1BFPA 4GESB 1TNQA 3DQ1A 4KW4A 1CFDA 4GPLB 2QLGB 2HQKA 3SVSA 1F71A 3JTDC 3SSPA 1K9PA 3DZTA 5AFPA 2V53A 4W6SA 1F8HA 1V1FA 3SVBA 5CPVA 3DQEA 2ZKMX 3SG2A 1IQ3A 5BQLA 1PALA 4UTSA 1OQPA 3K1EA 1W7TA 2G6YA 4DIRA 3KHEA 1SCMB 3I5HC 1EMMA 2C9IA 4BY4A 3WNXB 4IK1A 2YGUA 3SG3A 3TDUA 2JC2A 2CCMA 1CLMA 5HKWA 2VRGA 4MLWA 5JOLA 1W7SA 2VAEA 4RYWA 4LW5A 4OQWA 1S1EA 4MZJA 4ZCUA 1DEKA 3JTDB 3LS3A 2M8UA 5EB6A 2G5ZB 4YBHB 1QWVA 3ZTFA 1KSMA 1DJGA 2QEOA 1KWOC 3DVKA 2LMUA 5I94A 4I5LB 1QX5B 1A75A 1FW4A 5HZTA 3I5HB 2OKYA 5CSFA 1CM4A 3KF9A 2HCGA 1XMZA 1ALWA 1HCJA 1SCVA 4XJKB 2L2EA 1XVJA 1DJZA 3TMTA 2A48A 4JPZB 1TTXA 2FOTA 2OGRA 1KK7Y 2BTJA 3LF3A 4F0ZB 4C0JA 1BLQA 3U0MA 1JFKA 3S0BA 2YE1A 2FZUA 3KO0A 1NX0A 3PN7C 3H1RA 2Y5IA 2HGDA 2M97A 4NDCA 3R1OA 2EMNA 3PM8A 2A50B 2BKIB 3DQ7A 1F55A 4Q9XA 3TZ1A 2PQLA 1A4PA 3SS3A 4CFRA 5J2OA 2A53B 2ICRA 2F33A 2H5QA 5FVIA 1BR1B 3R1VA 4EULA 4W6FA 1OE9B 3RWAA 5AXIA 1GL4A 1VRKA 4OJ0A 4PHKA 1RFJA 5AQBB 3CR2A 5I2QA 5JJGA 3CABA 1YUSA 4ZINA 1AVSA 3UG0A 1JBYA 3K21A 1K94A 2K2FA 2LE9B 2QU1A 5IBWA 3FE9A 2EC6C 1NSHA 3B7AA 2JXLA 3SVRA 2NZ0A 1AJ4A 2JTZA 2JNFA 4H3MA 4JC2A 1AJ5A 1YRUB 4HRGA 3L4LA 3CZ2A 1QJTA 3SRYA 2HF5A 1EXRA 1AK8A 1CLLA 4A4CA 3PALA 4M2OA 2CBLA 1K90D 3BQ3A 1EMFA 4RTCA 2WCJA 1OOFA 1NCXA 2M49B 3PJ5A 1ZUXA 3IQOA 5FYXA 2MLFC 2A56B 2BCXA 4H3NA 2O24A 1Q4EA 1JF0A 1QTXA 4B30A 4B5YA 1UISA 1OOHA 3BOWA 5DPGA 1HUYA 2EC6B 3SVDA 1XQMA 4BY5A 2CXJA 4ETOA 3OX6A 3IVTA 3DQ8A 5KTGA 1B8LA 2FL1A 4W7CA 1S6CA 2MAZA 3TDZA 5D7FA 3ST2A 5CSNA 1BOCA 2KPHA 1Z1PA 1XFXO 2BBMA 1WRLA 4PALA 2HQZA 2POXA 3EVVA 1Y1UA 5HLVA 2KI6D 2KOTA 5HBDA 4L9MA 4HQ9A 3Q8IA 4N5XA 1BU3A 2IB6A 3A8SA 1P28A 2CT9A 3K1KA 1JFJA 1BR4B 3BXKA 2BCAA 4KA9A 1L2OC 3D74A 3O4XA 4W6NA 4I5NB 1MUXA 5HKZA 1BJFA 2KSPA 1S3PA 1OXFA 4ZF5A 2WORA 3D0YB 3UO9A 1AP4A 1QIWA 3E5VA 2H8VA 2LC5A 1YVHA 4DXQA 1Y6WA 2VVHA 3GL4A 2G2SB 3I19A 2Q91A 3FWCA 1NUBA 3R1PA 2DOQA 2A54B 4YGAA 2K60A 3NSLA 3CGAA 5HKYA 4DKNA 2R2IA 4KEXA 1N2DA 4N1FA 1SKTA 5EBJA 1L2OB 1IWQA 2LUXA 1ALVA 2ZNDA 3EG5B 2D8NA 2ZN8A 2WCBA 2PSRA 1GGZA 2GGMA 4I2YA 1A29A 3VROA 1RM9A 1BF5A 2SCPA 4GUKA 4YI9A 3D77A 1DT7B 3V3DA 2SASA 3BFAA 2L0PA 4MEWA 1DJWA 4A4BA 2IE2A 1Y1XA 3NF0A 2K7CA 4CIDA 5DRFA 2LHIA 4Q9WA 4YGBB 1CM1A 3VRNA 3O6BA 1DF0A 1WRZA 2NXQA 5D69A 3DQNA 3LLEA 5F9GA 3ZUFA 2QACA 2ERBA 3PSRA 1MOVA 2H5PA 2AMIA 1PVAA 3SVUA 1G33A 1EMKA 1CFCA 1RROA 1XO5A 1SY9A 3JVTC 3ST0A 2WSNA 3SVOA 2M3WA 4GGNA 2O5GA 1NCYA 4ZBLA 1OMVA 4R6BA 5DQMA 3P28A 3NT3A 3DQCA 2C9JA 1TIZA 4ORNA 3VGOA 1MR8A 3KCTA 1UP5A 1KYPA 1B7TY 1NCZA 4MSPA 5H89A 3CFAA 1A03A 4ZCVA 1OOJA 4WQ2A 5EHUA 1DTLA 4I5KA 5KTYA 1MF8B 1Q80A 3E5WA 1KCYA 2Q57A 4JWQA 1DMOA 4W6LA 4NDBA 2K0JA 2WSOA 5BTTA 1CTRA 3BUOB 3PFVA 2IS9A 1J7PA 1B9AA 2AAOA 3DQIA 1DGVA 1KFXS 1KYRA 3JVTB 4MZKA 1CB1A 3VHTA 1TNWA 2Y4QA 2KI6C 4OHSA 4B30B 2JT8A 2JNXA 2QLEA 1CMFA 4JEOA 2L5YA 1QX2A 2WCKA 1TUZA 4IJ7A 1Y1AA 4LJDC 3SSVA 1CV7A 2MRDA 2G9BA 1C4FA 1YX7A 3EK8A 3V2LA 1K93D 2DDCA 4MBEA 5J3XA 4NDDA 2M7NA 3AKOA 1GQMA 4DXOA 2O60A 2EHBA 2ARLA 2JPTA 1DELA 1NYAA 4FQTA 2L2CA 2CTNA 4J89A 3UNWA 4OR9B 4U8DA 4IZNA 2KI4B 2LUCA 2F2PA 1KFUS 1TN4A 2YE0A 3U8CA 4HRHA 1CDNA 4W7AA 1B47A 5KSZA 5DKQA 2LCPA 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 2BECA 3PM2A 1XFZO 2ZRTA 5TNCA 4JD9A 3ADFA 3DQJA 1G8IA 4ZF4A 4XOVA 3WXAA 3W1DA 1MWNA 3CYZA 3H4SE 2DUGA 1SYMA 3RLZA 3NHTA 1ZGPA 2WCLA 4W6IA 3LSAA 3RWTA 2BKHB 3IQQA 1ZFSA 3FE6A 3PJIA 3P8UA 1XA9A 1KSOA 1R6PA 4PT1A 4KYNA 1MOUA 4W7EA 4KGFA 2PMYA 2OS8C 3LVDA 2WC8A 2ISDA 3D76A 3PJBA 1KYSA 2WC6A 3GJ1A 1EMGA 2WNDA 3PATA 4P2YB 5FVFA 1QVIZ 5DTXA 2V4EC 2DUIA 4W73A 1RECA 4W74A 2HPWA 3SS5A 3AI5A 2PRUA 3O2PA 3LVAA 1OXEA 3DQUA 1DF0B 1SRAA 3SG6A 1K9UA 3SVNA 2Y1NA 3PJ7A 3B6XA 1LKJA 3OHMB 1SK6D 4PHJA 3ZWHA 5I2OA 1SMGA 4C0LA 4OVNF 4PCWA 4GAOA 4EN1A 1TRFA 3I5FC 3BJHA 4QJ4B 2JQ6A 2Z6XA 3EK7A 1TCOB 1B7TZ 2AWJA 3AKAA 3IP2A 3LK0A 5FI2A 4LJBA 1KWOB 2KAVA 4W6RA 1QX7A 3PIBA 3QMEA 4RYSA 1ORGA 4XOWA 4INWA 2QDIA 3DQKA 1SR6C 2AHAA 4JFGA 1G7KA 2OS8B 3DD4A 1QYQA 1QY3A 1J7OA 4L12A 1R2UA 3CDNA 4DRWA 5F6TA 4PPKA 2V4EB 3S0AA 3GEXA 3M24A 5EXBA 3DF0B 1OMDA 3QRXA 1M46A 3NSOA 2F2OA 4D1EA 1QXPA 2PALA 5LTRA 3I5FB 1JBZA 3D75A 4Q7UA 1OZOA 3FWBA 3OX5A 1XFVO 1YJ2A 1IRJA 1DJHA 3NHIA 2M29A 2I7AA 4U2VA 1C7VA 1SR6B 3PN7B 3OSRA 4DXMA 2Q6PA 2Z6ZA 1K8UA 1J1EA 1QV0A 4CFQA 1B4CA 1FI6A 1TNXA 1SL7A 5GQQC 3CLNA 2ZO7A 3GK1A 1JC2A 5DPIA 2KLEA 1SW8A 3DQ2A 2QEHA 1E8AA 3AAKA 2A52B 1EG4A 1S6ZA 5EL2A 4AOMA 1F4OA 1K95A 1ZGOA 2Y0GA 5DQBA 4GNKB 1CDMA 2WCMA 1TOPA 3DYEA 4Z4MA 2M0RA 4UPGA 2KFFA 3S0GA 2H6VA 4AR7A 3LL8B 3MSEB 1Q4AA 1MXLC 4MVFA 4GFTA 2NCPA 4W7DA 5DKRA 3O4YA 4W6BA 4C0KA 1H4BA 1BMOA 2LAPA 1U5IA 2KBIA 3FE8A 1QYOA 1K2HA 2NLNA 4OCIA 3S0DA 1PSBA 3WLCA 2B3PA 4DXPA 1DGUA 1YR5A 5LK4A 4HSZA 1DVIA 1OMRA 4QJ5B 2ZRSA 1RJVA 4JRBA 4W7XA 2MJWB 1RMOA 4W6PA 4WRIA 4Z4KA 1NX3A 1YVLA 2JXCA 4TNCA 3DQFA 2WCEA 2LLSA 4JQ0D 4LQUA 3O78A 2BBNA 2KFHA 2H61A 2EMDA 5CSIA 5B8IB 1YZWA 1NIWA 2L50A 3OP0A 2KQ6A 2JRFA 2LNKA 2LM5A 4NWSA 1QIVA 5DTLA 2WIQA 1BT6A 2DUFA 4MZLA 1EL4A 1KQVA 2LV7A 1YX8A 3CWGA 3VRQA 3AKBA 3NSKA 4W75A 5HYDA 1PULA 1DJXA 1A75B 4USLA 4M2QA 4PDZA 1KFXL 3GB3A 3GJ2A 5HL1A 2WHTA 4ORAB 2PVBA 2BAPA 1H8BA 1QLSA 1XFWO 1QV1A 4DXNA 2BE4A 5AEQA 1JF2A 4W6GA 2PASA 5T3IA 3KPXA 1M63B 4KW9A 4W7FA 4N1GA 5AANA 4OKHA 2K2AA 5I2LA 2G3DB 1SPYA 4H47A 3LCPC 2KQYA 3BUWB 5PALA 3DQ9A 2LP3A 2Z6YA 1QYFA 4IK8A 5DPHA 1GFLA 3HCMA 1TWOA 1MXEA 4YGEB 4J8AA 4MRYA 2Z1OA 1S5GZ 3OB1B 5EB7A 3NT9A 4FQOA 2E30A 4ZFSA 2HQ8A 1S6JA 4GOBA 2EMOA 4ANJA 3SSYA 1PSRA 1YUUA 1KP5A 1KFUL 1N0YA 2GX0A 4OZDA 4XGYA 3ST4A 2QLIA 1B9CA 3NGVA 4XJKA 4GGFA 3CBEA 4TZGA 3W1CA 1SNLA 2ZNEA 1GGXA 3DQ5A 1MYWA 3H1OA 3BX9A 4W7RA 2BCBA 3A8RA 3BXAA 4GF6B 1QVIY 3D73A 3SSLA 3OGNA 1YHGA 3M0WA 3I5GC 2LP2A 1RMPA 2HGYA 2F8PA 2KAYA 1FF1A 1S36A 3SG7A 2MLEC 3SG5A 3FIAA 5H88A 3CGLA 3G9AA 2NCOA 2P71A 2ZO6A 1KQMC 1B1GA 4KPIA 3TUYC 1V1GA 1ZACA 1HT9A 1M45A 2LVJA 3DQLA 1EJ3A 1LS8A 2RH7A 1WY9A 2PXWA 2QLHA 2H61C 1WLMA 2QZ0A 2WHSA 4ORBB 1C07A 3ST3A 2OKWA 3I5GB 1UHKA 2RGIA 4P1QA 3BOWB 1NX1A 3OB2B 2KNEA 2M9GA 1B8CA 3BUXB 1DJYA 1WDCC 2KHNA 1XA5A 2K8MB 1ZMZA 1FPWA 1DQEA 3EK4A 4W72A 5K89A 4KW8A 2OPOA 3WHTB 1EH2A 4ZB1A 3L4AA 1KQMB 4XYNA 3TUYB 1Q4CA 3CFFA 2HETA 1Q4BA 2COLB 3ZULA 2KLDA 3DXLA 2FJUB 1C3ZA 4W6OA 4Q7TA 5DTYA 1Z2CB 1Q73A 1UUSA 3S05A 3F45A 2P6BB 1SCMC 2WISA 2LVVA 1PK0D 2GV5A 4IK5A 2B1UA 1CFPA 5KU1A 4EMQA 2P4MA 5FHVA 2GTEA 4OV2A 2G16B 1A2XA 5BPJA 1WDCB 4KAGA 1LA0A 3B86A 5DPJA 2FWQA 2LHLA 2M1UA 3OGOA 4Q7RA 2B3QA 2ZN9A 3SJSA 4CPVA 1W7UA 2AWLA 2MA2A 2H2KA 3SIAA 2L5XB 4HQ8A 1TUJA 4LQTA 3L47A 4BDUA 3O77A 3EKJA 4KGEA 3OSQA 4JGEA 2K7BA 4WQ3A 4DS7A 3SSKA 3VRRA 5DY6A 2VVIA 3CZTX 3TMRA 2WHUA 1CFFA 2GX2A 2OTGC 3FS7A 2DDDA 3CR4X 2JTTA 1YUTA 4H3LA 2GW4B 1XK4A 4GGFC 1XFYO 2HFCA 2QEBA 1XAEA 3CTNA 1TNPA 4INXA 3SS4A 4R6DA 1DJIA 1IG5A 1ZOTB 1ODBA 4PPJA 2E6WA 3DQAA 3DPWA 3IR8A 3D0YA 4KF5A 2G2BA 3BYAA 1BG1A 3D78A 3EVRA 5FI7A 3U8PA 1FBVA 3CZ1A 4ZF3A 1GJYA 4OY4A 2K61A 3GOFA 1OSAA 1AUIB 4AQJA 3EVPA 1YJFA 1EMAA 2TN4A 2OTGB 2H9WA 4EDOA 1KK8C 4PE7A 3CR5X 3DVMA 3WLDA 4J88A 5HGEA 1J7RA 2Q4UA 4PPLA 4W76A 3A4UB 3VRPA 5I8NA 2ZMUA 3DY9A 1RWYA 1C7WA 3LA1A 2WCHA 5EXCI 1EMEA 2AUCA 3BXBA 3CS1A 2DUHA 1JUOA 1SL8A 3SS0A 4L1IA 1NWDA 3WHUB 1IJ5A 1W7JB 2LMTA 1BODA 3MGFA 4HQCA 4PHNA 1Z1QA 4HE4A 4DXIA 3CD1A 2K7OA 4XL5A 1F09A 4ZIOA 4DCKA 2BL0C 4E68A 2LANA 1DC1A 5BT0A 1EMBA 1KK8B 2KGRA 1YHHA 2JPOA 4YI8A 3KCSA 2L98A 2G3OA 3C1VA 3SVCA 1S5GY 4IK3A 5BTTB 2A4JA 4H48A 2QRFA 3BFHA 3VHTB 3ICBA 2GW3A 3I5IC 1F0BA 4MRXA 2AWKA 4EDSA 5FI6A 3VICA 1JC0A 4DUQA 4L13A 1OOGA 1H6RA 1OOIX 3DPZA 3D10A 1FI5A 2BL0B 2JOJA 2FCDA 3U8AA 1LINA 1SBJA 1AHRA 4IK9A 4R1EA 1MQ1A 1S26D 2GGZA 5ER4X 3DQ6A 1YURA 4W6CA 5FVGA 2KYFA 1OW4A 2K7DA 1LVCD 4XVPA 1CKKA 1Q4DA 3S0EA 5HLOA 1XYDA 1QATA 3I5IB 1IGVA 1Y0VH 4AS8A 1GGWA 3ED8A 1JSAA 3B88A 1XK4C 2KBMA 4GBAA 2I18A 5DTZA 4DKMA 3SV5A 1T14A 1J55A 4I5JA 4JF9A 3NXAA 2JWWA 3B87A 5H87A 5HZUA 1QS7A 5CSJA 1PVBA 4FTGA 1CDLA 3ZUJA 2JADA 4W6UA 1W7IB 1CDPA 3GK2A 1F70A 2HJOA 4KF5C 5HW9A 1SL9A 2PXSA 2G6EA 1OZSA 1S6IA 2HPSA 2KGBC 2VVJA 3SIBA 2LLUA 3LK1A 1EMLA 2IB5A 1TCFA 1UHHA 2MBXA 3SVEA 3RM1A 1CNPA 1ZGQA 2G6XA 4N3DA 4W6AA 4W6JA 2WC5A 2BE6A 1YFPA 2WURA 1QLKA 1GM0A 3R72A 4W6TA 2BNXA 2KAXA 2QLGA 1K9KA 4W77A 1B8RA 2MHHA 3KEVA 1J7QA 2YFPA 1RK9A 1C3YA 4KF4A 4W6HA 3BXCA 1JC1A 2DD9A 4W69A 2Y1MA 1WLZA 3TDIA 4LJDA 4JKTA 3VK1A 1W9ZA 1NP8A 1SSEB 1YRTB 4PFEA 2KFGA 2F3ZA 1KK7Z 3RZSA 1XSSA 2EGDA 3NEDA 3DQDA 3LVCA 4ORCB 3E5TA 4ICBA 2I2RE 2YDZA 1IKUA 1PRWA 2WCFA 1RMMA 3IF7A 1UURA 2AWMA 3BUNB 5D3OA 2H5RA 1QXTA 1RTP1 1XFUO 3NEZA 2I94A 2ZFDA 2DD7A 1IJ6A 5DU0A 5EXUA 2A46A 2L4HA 4YRUA 3OBVA 1LXFC 3AAJA 1M39A 5AERA 1EMCA 1LA3A 2H8QA 3DQMA 2IOVA 1UWOA 4P76A 1G4YR 3DVEA 2DUEA 1YHIA 3EVUA 2JZIA 4LJCA 2L4IA 2M7LA 1IQ5A 2QT2A 2L51A 3CFHA 3TS5C 1IH0A 4CLNA 1NPQA 2PYQA 4IK4A 3SSHA 4Q04A 2H5OA 4W6KA 2JT0A 1JWDA 2CNPA 1CLBA 2AH8A 5LTPA 1H4UA 1HQVA 1F4QA 3U0NA 4AQIA 3SG4A 5HZOA 2VADA 2HQWA 2A47A 3CZ0A 2LMVA 1RRXA 2OTEA 5HZSA 1IIOA 3U0LA 1ZUZA 3N7HA 3WCKA 2JT3A 5DICA 4OGSA 2F3YA 3UFZA 1QASA 1Z4HA 1N65A 1X02A 3DQ3A 3TS5B 1J1DA 3U0KA 2WOSA 2V4EA 3S0FA 3BFBA 3AI4A 1EG3A 3DVJA 4HREE 3DQ4A 3DQHA 3SSTA 4NQGA 2LVIA 3DF0A 1D1OA 3PLFB 2O29A 2VZXA 2KDHA 4TZAA 2OJKA 4PHMA 3EKHA 4W6MA 2KYCA 3HX4A 4PE0A 4HVFA 5EJUA 5LTQA 2FCEA 3ZNIA 1JBAA 4YGCB 2ZMWA 3LF4B 1YTZC 1U5IB 4MN0A 4PE4A 4QJ3B 3DQOA 1UHNA 1MHOA 4P5OE 3VB1A 3M22A 3E3RA 2LVKA 1F54A 1WRKA
chains in the Genus database with same CATH topology
3DPXA 2KI4C 3NSIA 2JU0A 3GK4X 1M31A 4PE1A 1NX2A 2OTBA 2HRSA 3BUMB 4IL1A 5DKNA 4W6DA 2LLTA 4YGDB 1UHJA 2O2BA 3CD9A 4M2PA 3CB9A 1OXDA 5DRGA 1UHIA 5ER5A 2JULA 2QPTA 1BFPA 4GESB 1TNQA 3DQ1A 4KW4A 1CFDA 4GPLB 2QLGB 2HQKA 3SVSA 1F71A 3JTDC 3SSPA 1K9PA 5AFPA 2V53A 4W6SA 1F8HA 1V1FA 3SVBA 5CPVA 3DQEA 2ZKMX 3SG2A 1IQ3A 5BQLA 1PALA 4UTSA 1OQPA 1W7TA 2G6YA 4DIRA 3KHEA 1SCMB 3I5HC 1EMMA 2C9IA 4BY4A 3WNXB 4IK1A 3SG3A 3TDUA 2JC2A 2CCMA 1CLMA 5HKWA 2VRGA 4MLWA 5JOLA 1W7SA 2VAEA 4RYWA 4LW5A 4OQWA 1S1EA 4MZJA 4ZCUA 3JTDB 3LS3A 2M8UA 5EB6A 2G5ZB 4YBHB 3ZTFA 1KSMA 1DJGA 1KWOC 3DVKA 2LMUA 4I5LB 1QX5B 1A75A 1FW4A 5HZTA 3I5HB 2OKYA 5CSFA 1CM4A 3KF9A 2HCGA 1ALWA 1HCJA 1XMZA 1SCVA 4XJKB 2L2EA 1XVJA 1DJZA 3TMTA 2A48A 4JPZB 1TTXA 2FOTA 2OGRA 1KK7Y 2BTJA 3LF3A 4F0ZB 4C0JA 1BLQA 3U0MA 1JFKA 2YE1A 2FZUA 3KO0A 1NX0A 3PN7C 3H1RA 2Y5IA 2HGDA 2M97A 4NDCA 2EMNA 3PM8A 2A50B 2BKIB 3DQ7A 1F55A 4Q9XA 3TZ1A 1A4PA 4CFRA 5J2OA 2A53B 2ICRA 2F33A 2H5QA 5FVIA 1BR1B 4EULA 4W6FA 1OE9B 3RWAA 5AXIA 1GL4A 1VRKA 4OJ0A 4PHKA 1RFJA 5AQBB 3CR2A 5I2QA 5JJGA 1YUSA 4ZINA 1AVSA 3UG0A 1JBYA 3K21A 1K94A 2K2FA 2LE9B 2QU1A 5IBWA 2EC6C 1NSHA 2JXLA 3SVRA 2NZ0A 1AJ4A 2JTZA 2JNFA 4H3MA 4JC2A 1AJ5A 1YRUB 4HRGA 1QJTA 3SRYA 2HF5A 1EXRA 1AK8A 1CLLA 4A4CA 3PALA 4M2OA 2CBLA 1K90D 3BQ3A 1EMFA 4RTCA 1NCXA 2M49B 3PJ5A 1ZUXA 3IQOA 5FYXA 2MLFC 2A56B 2BCXA 4H3NA 2O24A 1Q4EA 1JF0A 1QTXA 4B30A 4B5YA 1UISA 3BOWA 5DPGA 1HUYA 2EC6B 3SVDA 1XQMA 4BY5A 2CXJA 4ETOA 3OX6A 3DQ8A 5KTGA 1B8LA 2FL1A 4W7CA 1S6CA 2MAZA 3TDZA 5D7FA 3ST2A 5CSNA 1BOCA 1Z1PA 1XFXO 2BBMA 1WRLA 4PALA 2HQZA 2POXA 3EVVA 1Y1UA 5HLVA 2KI6D 2KOTA 5HBDA 4L9MA 4HQ9A 4N5XA 1BU3A 2IB6A 3A8SA 2CT9A 3K1KA 1JFJA 1BR4B 3BXKA 2BCAA 4KA9A 1L2OC 4W6NA 4I5NB 1MUXA 5HKZA 1BJFA 2KSPA 1S3PA 1OXFA 4ZF5A 2WORA 3D0YB 1AP4A 1QIWA 3E5VA 2LC5A 1YVHA 4DXQA 1Y6WA 2VVHA 3GL4A 2G2SB 3I19A 2Q91A 3FWCA 1NUBA 2DOQA 2A54B 4YGAA 3NSLA 3CGAA 5HKYA 4DKNA 2R2IA 4KEXA 1N2DA 4N1FA 1SKTA 5EBJA 1L2OB 1IWQA 2LUXA 1ALVA 2ZNDA 2D8NA 2ZN8A 2WCBA 2PSRA 1GGZA 2GGMA 4I2YA 1A29A 3VROA 1RM9A 1BF5A 2SCPA 4GUKA 4YI9A 1DT7B 3V3DA 2SASA 2L0PA 4MEWA 1DJWA 4A4BA 2IE2A 1Y1XA 3NF0A 2K7CA 4CIDA 5DRFA 2LHIA 4Q9WA 4YGBB 1CM1A 3VRNA 3O6BA 1DF0A 1WRZA 2NXQA 5D69A 3DQNA 3LLEA 5F9GA 3ZUFA 2QACA 3PSRA 1MOVA 2H5PA 2AMIA 1PVAA 3SVUA 1G33A 1EMKA 1CFCA 1RROA 1XO5A 1SY9A 3JVTC 3ST0A 2WSNA 3SVOA 2M3WA 4GGNA 2O5GA 1NCYA 4ZBLA 1OMVA 4R6BA 5DQMA 3P28A 3NT3A 3DQCA 2C9JA 1TIZA 4ORNA 3VGOA 1MR8A 3KCTA 1UP5A 1KYPA 1B7TY 1NCZA 4MSPA 5H89A 3CFAA 1A03A 4ZCVA 1OOJA 4WQ2A 5EHUA 1DTLA 4I5KA 5KTYA 1MF8B 1Q80A 3E5WA 1KCYA 2Q57A 4JWQA 1DMOA 4W6LA 4NDBA 2K0JA 2WSOA 5BTTA 1CTRA 3BUOB 3PFVA 2IS9A 1J7PA 1B9AA 2AAOA 3DQIA 1DGVA 1KFXS 1KYRA 3JVTB 4MZKA 1CB1A 3VHTA 1TNWA 2Y4QA 2KI6C 4OHSA 4B30B 2JT8A 2JNXA 2QLEA 1CMFA 4JEOA 1QX2A 1Y1AA 4LJDC 3SSVA 1CV7A 2MRDA 2G9BA 1C4FA 1YX7A 3EK8A 1K93D 2DDCA 4MBEA 5J3XA 4NDDA 2M7NA 3AKOA 1GQMA 4DXOA 2O60A 2EHBA 2ARLA 2JPTA 1NYAA 2CTNA 4J89A 4OR9B 4U8DA 4IZNA 2KI4B 2LUCA 2F2PA 1KFUS 1TN4A 2YE0A 3U8CA 4HRHA 1CDNA 4W7AA 1B47A 5KSZA 5DKQA 2LCPA 1K96A 1CMGA 1L7ZA 2M1KB 5G08A 2BECA 1XFZO 2ZRTA 5TNCA 3ADFA 3DQJA 1G8IA 4ZF4A 4XOVA 3WXAA 3W1DA 1MWNA 3H4SE 2DUGA 1SYMA 3RLZA 1ZGPA 4W6IA 3LSAA 3RWTA 2BKHB 3IQQA 1ZFSA 3P8UA 1XA9A 1KSOA 1R6PA 1MOUA 4W7EA 4KGFA 2PMYA 2OS8C 3LVDA 2WC8A 2ISDA 3PJBA 1KYSA 3GJ1A 1EMGA 2WNDA 3PATA 4P2YB 5FVFA 1QVIZ 5DTXA 2V4EC 2DUIA 4W73A 1RECA 4W74A 2HPWA 3AI5A 2PRUA 3O2PA 3LVAA 1OXEA 3DQUA 1DF0B 1SRAA 3SG6A 1K9UA 3SVNA 2Y1NA 3PJ7A 1LKJA 3OHMB 1SK6D 4PHJA 3ZWHA 5I2OA 1SMGA 4C0LA 4OVNF 4PCWA 4GAOA 4EN1A 1TRFA 3I5FC 4QJ4B 2JQ6A 2Z6XA 1TCOB 3EK7A 1B7TZ 2AWJA 3AKAA 3IP2A 3LK0A 4LJBA 1KWOB 2KAVA 4W6RA 1QX7A 3PIBA 4RYSA 4XOWA 3DQKA 1SR6C 2AHAA 4JFGA 1G7KA 2OS8B 3DD4A 1QYQA 1QY3A 1J7OA 4L12A 1R2UA 4DRWA 5F6TA 4PPKA 2V4EB 3GEXA 3M24A 5EXBA 3DF0B 1OMDA 3QRXA 1M46A 3NSOA 2F2OA 4D1EA 1QXPA 2PALA 5LTRA 3I5FB 1JBZA 4Q7UA 1OZOA 3FWBA 3OX5A 1XFVO 1YJ2A 1IRJA 1DJHA 2M29A 2I7AA 4U2VA 1C7VA 1SR6B 3PN7B 3OSRA 4DXMA 2Q6PA 2Z6ZA 1K8UA 1J1EA 1QV0A 4CFQA 1B4CA 1FI6A 1TNXA 1SL7A 5GQQC 3CLNA 2ZO7A 3GK1A 1JC2A 5DPIA 1SW8A 3DQ2A 1E8AA 3AAKA 2A52B 1EG4A 1S6ZA 1F4OA 4AOMA 1K95A 1ZGOA 2Y0GA 5DQBA 4GNKB 1CDMA 1TOPA 4Z4MA 2M0RA 4UPGA 2KFFA 2H6VA 4AR7A 3LL8B 3MSEB 1Q4AA 1MXLC 4MVFA 4GFTA 2NCPA 4W7DA 5DKRA 3O4YA 4W6BA 4C0KA 1H4BA 1BMOA 2LAPA 1U5IA 2KBIA 1QYOA 1K2HA 2NLNA 4OCIA 1PSBA 3WLCA 2B3PA 4DXPA 1DGUA 1YR5A 5LK4A 4HSZA 1DVIA 1OMRA 4QJ5B 2ZRSA 1RJVA 4JRBA 4W7XA 2MJWB 1RMOA 4W6PA 4WRIA 4Z4KA 1NX3A 1YVLA 2JXCA 4TNCA 3DQFA 2WCEA 2LLSA 4JQ0D 4LQUA 3O78A 2BBNA 2KFHA 2H61A 2EMDA 5CSIA 5B8IB 1YZWA 1NIWA 2L50A 3OP0A 2KQ6A 2JRFA 2LNKA 2LM5A 4NWSA 1QIVA 5DTLA 2WIQA 1BT6A 2DUFA 4MZLA 1EL4A 1KQVA 2LV7A 1YX8A 3CWGA 3VRQA 3AKBA 3NSKA 4W75A 5HYDA 1PULA 1DJXA 1A75B 4USLA 4M2QA 4PDZA 1KFXL 3GB3A 3GJ2A 2WHTA 4ORAB 2PVBA 1H8BA 1QLSA 1XFWO 1QV1A 4DXNA 2BE4A 5AEQA 1JF2A 4W6GA 2PASA 5T3IA 3KPXA 1M63B 4KW9A 4W7FA 4N1GA 5AANA 4OKHA 2K2AA 5I2LA 2G3DB 1SPYA 4H47A 3LCPC 2KQYA 3BUWB 5PALA 3DQ9A 2LP3A 2Z6YA 1QYFA 4IK8A 5DPHA 1GFLA 3HCMA 1MXEA 4YGEB 4J8AA 4MRYA 2Z1OA 1S5GZ 3OB1B 5EB7A 3NT9A 4FQOA 2E30A 4ZFSA 2HQ8A 1S6JA 4GOBA 2EMOA 4ANJA 3SSYA 1PSRA 1YUUA 1KP5A 1KFUL 1N0YA 2GX0A 4XGYA 3ST4A 2QLIA 1B9CA 4XJKA 4GGFA 3CBEA 4TZGA 3W1CA 1SNLA 2ZNEA 1GGXA 3DQ5A 1MYWA 3H1OA 3BX9A 4W7RA 2BCBA 3A8RA 3BXAA 4GF6B 1QVIY 3SSLA 1YHGA 3M0WA 3I5GC 2LP2A 1RMPA 2HGYA 2F8PA 2KAYA 1FF1A 1S36A 3SG7A 2MLEC 3SG5A 3FIAA 5H88A 3CGLA 3G9AA 2NCOA 2ZO6A 1KQMC 1B1GA 4KPIA 3TUYC 1V1GA 1ZACA 1HT9A 1M45A 2LVJA 3DQLA 1EJ3A 2RH7A 1WY9A 2PXWA 2QLHA 2H61C 1WLMA 2QZ0A 2WHSA 4ORBB 1C07A 3ST3A 2OKWA 3I5GB 1UHKA 2RGIA 4P1QA 3BOWB 1NX1A 3OB2B 2KNEA 2M9GA 1B8CA 3BUXB 1DJYA 1WDCC 2KHNA 1XA5A 2K8MB 1ZMZA 1FPWA 3EK4A 4W72A 5K89A 4KW8A 2OPOA 3WHTB 1EH2A 4ZB1A 1KQMB 4XYNA 3TUYB 1Q4CA 3CFFA 2HETA 1Q4BA 2COLB 3ZULA 2FJUB 4W6OA 4Q7TA 5DTYA 1Q73A 1UUSA 3S05A 3F45A 2P6BB 1SCMC 2WISA 2LVVA 1PK0D 2GV5A 4IK5A 2B1UA 1CFPA 5KU1A 4EMQA 2P4MA 5FHVA 4OV2A 2G16B 1A2XA 5BPJA 1WDCB 4KAGA 1LA0A 5DPJA 2FWQA 2LHLA 2M1UA 3OGOA 4Q7RA 2B3QA 2ZN9A 3SJSA 4CPVA 1W7UA 2AWLA 2MA2A 2H2KA 3SIAA 2L5XB 4HQ8A 4LQTA 4BDUA 3O77A 3EKJA 4KGEA 3OSQA 4JGEA 2K7BA 4WQ3A 4DS7A 3SSKA 3VRRA 5DY6A 2VVIA 3CZTX 3TMRA 2WHUA 1CFFA 2GX2A 2OTGC 3FS7A 2DDDA 3CR4X 2JTTA 1YUTA 4H3LA 2GW4B 1XK4A 4GGFC 1XFYO 2HFCA 1XAEA 3CTNA 1TNPA 4R6DA 1DJIA 1IG5A 1ZOTB 1ODBA 4PPJA 2E6WA 3DQAA 3DPWA 3IR8A 3D0YA 4KF5A 2G2BA 3BYAA 1BG1A 3EVRA 3U8PA 1FBVA 4ZF3A 1GJYA 4OY4A 2K61A 3GOFA 1OSAA 1AUIB 4AQJA 3EVPA 1YJFA 1EMAA 2TN4A 2OTGB 2H9WA 4EDOA 1KK8C 4PE7A 3CR5X 3DVMA 3WLDA 4J88A 5HGEA 1J7RA 2Q4UA 4PPLA 4W76A 3A4UB 3VRPA 5I8NA 2ZMUA 1RWYA 1C7WA 3LA1A 5EXCI 1EMEA 2AUCA 3BXBA 3CS1A 2DUHA 1JUOA 1SL8A 3SS0A 4L1IA 1NWDA 3WHUB 1IJ5A 1W7JB 2LMTA 1BODA 3MGFA 4HQCA 4PHNA 1Z1QA 4HE4A 4DXIA 3CD1A 2K7OA 4XL5A 1F09A 4ZIOA 4DCKA 2BL0C 4E68A 2LANA 5BT0A 1EMBA 1KK8B 2KGRA 1YHHA 4YI8A 3KCSA 2L98A 2G3OA 3C1VA 3SVCA 1S5GY 4IK3A 5BTTB 2A4JA 4H48A 2QRFA 3VHTB 3ICBA 2GW3A 3I5IC 1F0BA 4MRXA 2AWKA 4EDSA 3VICA 1JC0A 4DUQA 4L13A 1H6RA 3DPZA 3D10A 1FI5A 2BL0B 2JOJA 2FCDA 3U8AA 1LINA 1SBJA 1AHRA 4IK9A 4R1EA 1MQ1A 1S26D 2GGZA 5ER4X 3DQ6A 1YURA 4W6CA 5FVGA 2KYFA 2K7DA 1LVCD 4XVPA 1CKKA 1Q4DA 5HLOA 1XYDA 1QATA 3I5IB 1IGVA 1Y0VH 4AS8A 1GGWA 3ED8A 1JSAA 1XK4C 2KBMA 4GBAA 2I18A 5DTZA 4DKMA 3SV5A 1J55A 4I5JA 4JF9A 3NXAA 2JWWA 5H87A 5HZUA 1QS7A 5CSJA 1PVBA 4FTGA 1CDLA 3ZUJA 2JADA 4W6UA 1W7IB 1CDPA 3GK2A 1F70A 2HJOA 4KF5C 5HW9A 1SL9A 2PXSA 2G6EA 1OZSA 1S6IA 2HPSA 2KGBC 2VVJA 3SIBA 2LLUA 3LK1A 1EMLA 2IB5A 1TCFA 1UHHA 2MBXA 3SVEA 3RM1A 1CNPA 1ZGQA 2G6XA 4N3DA 4W6AA 4W6JA 2BE6A 1YFPA 2WURA 1QLKA 4W6TA 2KAXA 2QLGA 1K9KA 4W77A 1B8RA 2MHHA 3KEVA 1J7QA 2YFPA 1RK9A 4KF4A 4W6HA 3BXCA 1JC1A 2DD9A 4W69A 2Y1MA 1WLZA 3TDIA 4LJDA 3VK1A 1NP8A 1YRTB 4PFEA 2KFGA 2F3ZA 1KK7Z 1XSSA 2EGDA 3NEDA 3DQDA 3LVCA 4ORCB 3E5TA 4ICBA 2I2RE 2YDZA 1IKUA 1PRWA 2WCFA 1RMMA 3IF7A 1UURA 2AWMA 3BUNB 2H5RA 1QXTA 1RTP1 1XFUO 3NEZA 2I94A 2ZFDA 2DD7A 1IJ6A 5DU0A 5EXUA 2A46A 2L4HA 4YRUA 1LXFC 3AAJA 1M39A 5AERA 1EMCA 1LA3A 2H8QA 3DQMA 2IOVA 1UWOA 4P76A 1G4YR 3DVEA 2DUEA 1YHIA 3EVUA 2JZIA 4LJCA 2L4IA 2M7LA 1IQ5A 2QT2A 2L51A 3CFHA 3TS5C 1IH0A 4CLNA 1NPQA 4IK4A 3SSHA 4Q04A 2H5OA 4W6KA 2JT0A 1JWDA 2CNPA 1CLBA 2AH8A 5LTPA 1H4UA 1HQVA 1F4QA 3U0NA 4AQIA 3SG4A 5HZOA 2VADA 2HQWA 2A47A 2LMVA 1RRXA 2OTEA 5HZSA 3U0LA 1ZUZA 3WCKA 2JT3A 4OGSA 2F3YA 3UFZA 1QASA 1N65A 1X02A 3DQ3A 3TS5B 1J1DA 3U0KA 2WOSA 2V4EA 3AI4A 1EG3A 3DVJA 4HREE 3DQ4A 3DQHA 3SSTA 4NQGA 2LVIA 3DF0A 1D1OA 3PLFB 2O29A 2VZXA 2KDHA 4TZAA 2OJKA 4PHMA 3EKHA 4W6MA 2KYCA 3HX4A 4PE0A 4HVFA 5EJUA 5LTQA 2FCEA 3ZNIA 1JBAA 4YGCB 2ZMWA 3LF4B 1YTZC 1U5IB 4MN0A 4PE4A 4QJ3B 3DQOA 1UHNA 1MHOA 4P5OE 3M22A 3E3RA 2LVKA 1F54A 1WRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DPX A;  2KI4 C;  3NSI A;  2JU0 A;  3GK4 X;  1M31 A;  4PE1 A;  1NX2 A;  2OTB A;  2HRS A;  3BUM B;  4IL1 A;  5DKN A;  4W6D A;  2LLT A;  4YGD B;  1UHJ A;  2O2B A;  3CD9 A;  4M2P A;  3CB9 A;  1OXD A;  5DRG A;  1UHI A;  5ER5 A;  2JUL A;  2QPT A;  1BFP A;  4GES B;  1TNQ A;  3DQ1 A;  4KW4 A;  1CFD A;  4GPL B;  2QLG B;  2HQK A;  3SVS A;  1F71 A;  3JTD C;  3SSP A;  1K9P A;  5AFP A;  2V53 A;  4W6S A;  1F8H A;  1V1F A;  3SVB A;  5CPV A;  3DQE A;  2ZKM X;  3SG2 A;  1IQ3 A;  5BQL A;  1PAL A;  4UTS A;  1OQP A;  1W7T A;  2G6Y A;  4DIR A;  3KHE A;  1SCM B;  3I5H C;  1EMM A;  2C9I A;  4BY4 A;  3WNX B;  4IK1 A;  3SG3 A;  3TDU A;  2JC2 A;  2CCM A;  1CLM A;  5HKW A;  2VRG A;  4MLW A;  5JOL A;  1W7S A;  2VAE A;  4RYW A;  4LW5 A;  4OQW A;  1S1E A;  4MZJ A;  4ZCU A;  3JTD B;  3LS3 A;  2M8U A;  5EB6 A;  2G5Z B;  4YBH B;  3ZTF A;  1KSM A;  1DJG A;  1KWO C;  3DVK A;  2LMU A;  4I5L B;  1QX5 B;  1A75 A;  1FW4 A;  5HZT A;  3I5H B;  2OKY A;  5CSF A;  1CM4 A;  3KF9 A;  2HCG A;  1ALW A;  1HCJ A;  1XMZ A;  1SCV A;  4XJK B;  2L2E A;  1XVJ A;  1DJZ A;  3TMT A;  2A48 A;  4JPZ B;  1TTX A;  2FOT A;  2OGR A;  1KK7 Y;  2BTJ A;  3LF3 A;  4F0Z B;  4C0J A;  1BLQ A;  3U0M A;  1JFK A;  2YE1 A;  2FZU A;  3KO0 A;  1NX0 A;  3PN7 C;  3H1R A;  2Y5I A;  2HGD A;  2M97 A;  4NDC A;  2EMN A;  3PM8 A;  2A50 B;  2BKI B;  3DQ7 A;  1F55 A;  4Q9X A;  3TZ1 A;  1A4P A;  4CFR A;  5J2O A;  2A53 B;  2ICR A;  2F33 A;  2H5Q A;  5FVI A;  1BR1 B;  4EUL A;  4W6F A;  1OE9 B;  3RWA A;  5AXI A;  1GL4 A;  1VRK A;  4OJ0 A;  4PHK A;  1RFJ A;  5AQB B;  3CR2 A;  5I2Q A;  5JJG A;  1YUS A;  4ZIN A;  1AVS A;  3UG0 A;  1JBY A;  3K21 A;  1K94 A;  2K2F A;  2LE9 B;  2QU1 A;  5IBW A;  2EC6 C;  1NSH A;  2JXL A;  3SVR A;  2NZ0 A;  1AJ4 A;  2JTZ A;  2JNF A;  4H3M A;  4JC2 A;  1AJ5 A;  1YRU B;  4HRG A;  1QJT A;  3SRY A;  2HF5 A;  1EXR A;  1AK8 A;  1CLL A;  4A4C A;  3PAL A;  4M2O A;  2CBL A;  1K90 D;  3BQ3 A;  1EMF A;  4RTC A;  1NCX A;  2M49 B;  3PJ5 A;  1ZUX A;  3IQO A;  5FYX A;  2MLF C;  2A56 B;  2BCX A;  4H3N A;  2O24 A;  1Q4E A;  1JF0 A;  1QTX A;  4B30 A;  4B5Y A;  1UIS A;  3BOW A;  5DPG A;  1HUY A;  2EC6 B;  3SVD A;  1XQM A;  4BY5 A;  2CXJ A;  4ETO A;  3OX6 A;  3DQ8 A;  5KTG A;  1B8L A;  2FL1 A;  4W7C A;  1S6C A;  2MAZ A;  3TDZ A;  5D7F A;  3ST2 A;  5CSN A;  1BOC A;  1Z1P A;  1XFX O;  2BBM A;  1WRL A;  4PAL A;  2HQZ A;  2POX A;  3EVV A;  1Y1U A;  5HLV A;  2KI6 D;  2KOT A;  5HBD A;  4L9M A;  4HQ9 A;  4N5X A;  1BU3 A;  2IB6 A;  3A8S A;  2CT9 A;  3K1K A;  1JFJ A;  1BR4 B;  3BXK A;  2BCA A;  4KA9 A;  1L2O C;  4W6N A;  4I5N B;  1MUX A;  5HKZ A;  1BJF A;  2KSP A;  1S3P A;  1OXF A;  4ZF5 A;  2WOR A;  3D0Y B;  1AP4 A;  1QIW A;  3E5V A;  2LC5 A;  1YVH A;  4DXQ A;  1Y6W A;  2VVH A;  3GL4 A;  2G2S B;  3I19 A;  2Q91 A;  3FWC A;  1NUB A;  2DOQ A;  2A54 B;  4YGA A;  3NSL A;  3CGA A;  5HKY A;  4DKN A;  2R2I A;  4KEX A;  1N2D A;  4N1F A;  1SKT A;  5EBJ A;  1L2O B;  1IWQ A;  2LUX A;  1ALV A;  2ZND A;  2D8N A;  2ZN8 A;  2WCB A;  2PSR A;  1GGZ A;  2GGM A;  4I2Y A;  1A29 A;  3VRO A;  1RM9 A;  1BF5 A;  2SCP A;  4GUK A;  4YI9 A;  1DT7 B;  3V3D A;  2SAS A;  2L0P A;  4MEW A;  1DJW A;  4A4B A;  2IE2 A;  1Y1X A;  3NF0 A;  2K7C A;  4CID A;  5DRF A;  2LHI A;  4Q9W A;  4YGB B;  1CM1 A;  3VRN A;  3O6B A;  1DF0 A;  1WRZ A;  2NXQ A;  5D69 A;  3DQN A;  3LLE A;  5F9G A;  3ZUF A;  2QAC A;  3PSR A;  1MOV A;  2H5P A;  2AMI A;  1PVA A;  3SVU A;  1G33 A;  1EMK A;  1CFC A;  1RRO A;  1XO5 A;  1SY9 A;  3JVT C;  3ST0 A;  2WSN A;  3SVO A;  2M3W A;  4GGN A;  2O5G A;  1NCY A;  4ZBL A;  1OMV A;  4R6B A;  5DQM A;  3P28 A;  3NT3 A;  3DQC A;  2C9J A;  1TIZ A;  4ORN A;  3VGO A;  1MR8 A;  3KCT A;  1UP5 A;  1KYP A;  1B7T Y;  1NCZ A;  4MSP A;  5H89 A;  3CFA A;  1A03 A;  4ZCV A;  1OOJ A;  4WQ2 A;  5EHU A;  1DTL A;  4I5K A;  5KTY A;  1MF8 B;  1Q80 A;  3E5W A;  1KCY A;  2Q57 A;  4JWQ A;  1DMO A;  4W6L A;  4NDB A;  2K0J A;  2WSO A;  5BTT A;  1CTR A;  3BUO B;  3PFV A;  2IS9 A;  1J7P A;  1B9A A;  2AAO A;  3DQI A;  1DGV A;  1KFX S;  1KYR A;  3JVT B;  4MZK A;  1CB1 A;  3VHT A;  1TNW A;  2Y4Q A;  2KI6 C;  4OHS A;  4B30 B;  2JT8 A;  2JNX A;  2QLE A;  1CMF A;  4JEO A;  1QX2 A;  1Y1A A;  4LJD C;  3SSV A;  1CV7 A;  2MRD A;  2G9B A;  1C4F A;  1YX7 A;  3EK8 A;  1K93 D;  2DDC A;  4MBE A;  5J3X A;  4NDD A;  2M7N A;  3AKO A;  1GQM A;  4DXO A;  2O60 A;  2EHB A;  2ARL A;  2JPT A;  1NYA A;  2CTN A;  4J89 A;  4OR9 B;  4U8D A;  4IZN A;  2KI4 B;  2LUC A;  2F2P A;  1KFU S;  1TN4 A;  2YE0 A;  3U8C A;  4HRH A;  1CDN A;  4W7A A;  1B47 A;  5KSZ A;  5DKQ A;  2LCP A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  2BEC A;  1XFZ O;  2ZRT A;  5TNC A;  3ADF A;  3DQJ A;  1G8I A;  4ZF4 A;  4XOV A;  3WXA A;  3W1D A;  1MWN A;  3H4S E;  2DUG A;  1SYM A;  3RLZ A;  1ZGP A;  4W6I A;  3LSA A;  3RWT A;  2BKH B;  3IQQ A;  1ZFS A;  3P8U A;  1XA9 A;  1KSO A;  1R6P A;  1MOU A;  4W7E A;  4KGF A;  2PMY A;  2OS8 C;  3LVD A;  2WC8 A;  2ISD A;  3PJB A;  1KYS A;  3GJ1 A;  1EMG A;  2WND A;  3PAT A;  4P2Y B;  5FVF A;  1QVI Z;  5DTX A;  2V4E C;  2DUI A;  4W73 A;  1REC A;  4W74 A;  2HPW A;  3AI5 A;  2PRU A;  3O2P A;  3LVA A;  1OXE A;  3DQU A;  1DF0 B;  1SRA A;  3SG6 A;  1K9U A;  3SVN A;  2Y1N A;  3PJ7 A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3ZWH A;  5I2O A;  1SMG A;  4C0L A;  4OVN F;  4PCW A;  4GAO A;  4EN1 A;  1TRF A;  3I5F C;  4QJ4 B;  2JQ6 A;  2Z6X A;  1TCO B;  3EK7 A;  1B7T Z;  2AWJ A;  3AKA A;  3IP2 A;  3LK0 A;  4LJB A;  1KWO B;  2KAV A;  4W6R A;  1QX7 A;  3PIB A;  4RYS A;  4XOW A;  3DQK A;  1SR6 C;  2AHA A;  4JFG A;  1G7K A;  2OS8 B;  3DD4 A;  1QYQ A;  1QY3 A;  1J7O A;  4L12 A;  1R2U A;  4DRW A;  5F6T A;  4PPK A;  2V4E B;  3GEX A;  3M24 A;  5EXB A;  3DF0 B;  1OMD A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  4D1E A;  1QXP A;  2PAL A;  5LTR A;  3I5F B;  1JBZ A;  4Q7U A;  1OZO A;  3FWB A;  3OX5 A;  1XFV O;  1YJ2 A;  1IRJ A;  1DJH A;  2M29 A;  2I7A A;  4U2V A;  1C7V A;  1SR6 B;  3PN7 B;  3OSR A;  4DXM A;  2Q6P A;  2Z6Z A;  1K8U A;  1J1E A;  1QV0 A;  4CFQ A;  1B4C A;  1FI6 A;  1TNX A;  1SL7 A;  5GQQ C;  3CLN A;  2ZO7 A;  3GK1 A;  1JC2 A;  5DPI A;  1SW8 A;  3DQ2 A;  1E8A A;  3AAK A;  2A52 B;  1EG4 A;  1S6Z A;  1F4O A;  4AOM A;  1K95 A;  1ZGO A;  2Y0G A;  5DQB A;  4GNK B;  1CDM A;  1TOP A;  4Z4M A;  2M0R A;  4UPG A;  2KFF A;  2H6V A;  4AR7 A;  3LL8 B;  3MSE B;  1Q4A A;  1MXL C;  4MVF A;  4GFT A;  2NCP A;  4W7D A;  5DKR A;  3O4Y A;  4W6B A;  4C0K A;  1H4B A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  1QYO A;  1K2H A;  2NLN A;  4OCI A;  1PSB A;  3WLC A;  2B3P A;  4DXP A;  1DGU A;  1YR5 A;  5LK4 A;  4HSZ A;  1DVI A;  1OMR A;  4QJ5 B;  2ZRS A;  1RJV A;  4JRB A;  4W7X A;  2MJW B;  1RMO A;  4W6P A;  4WRI A;  4Z4K A;  1NX3 A;  1YVL A;  2JXC A;  4TNC A;  3DQF A;  2WCE A;  2LLS A;  4JQ0 D;  4LQU A;  3O78 A;  2BBN A;  2KFH A;  2H61 A;  2EMD A;  5CSI A;  5B8I B;  1YZW A;  1NIW A;  2L50 A;  3OP0 A;  2KQ6 A;  2JRF A;  2LNK A;  2LM5 A;  4NWS A;  1QIV A;  5DTL A;  2WIQ A;  1BT6 A;  2DUF A;  4MZL A;  1EL4 A;  1KQV A;  2LV7 A;  1YX8 A;  3CWG A;  3VRQ A;  3AKB A;  3NSK A;  4W75 A;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  4USL A;  4M2Q A;  4PDZ A;  1KFX L;  3GB3 A;  3GJ2 A;  2WHT A;  4ORA B;  2PVB A;  1H8B A;  1QLS A;  1XFW O;  1QV1 A;  4DXN A;  2BE4 A;  5AEQ A;  1JF2 A;  4W6G A;  2PAS A;  5T3I A;  3KPX A;  1M63 B;  4KW9 A;  4W7F A;  4N1G A;  5AAN A;  4OKH A;  2K2A A;  5I2L A;  2G3D B;  1SPY A;  4H47 A;  3LCP C;  2KQY A;  3BUW B;  5PAL A;  3DQ9 A;  2LP3 A;  2Z6Y A;  1QYF A;  4IK8 A;  5DPH A;  1GFL A;  3HCM A;  1MXE A;  4YGE B;  4J8A A;  4MRY A;  2Z1O A;  1S5G Z;  3OB1 B;  5EB7 A;  3NT9 A;  4FQO A;  2E30 A;  4ZFS A;  2HQ8 A;  1S6J A;  4GOB A;  2EMO A;  4ANJ A;  3SSY A;  1PSR A;  1YUU A;  1KP5 A;  1KFU L;  1N0Y A;  2GX0 A;  4XGY A;  3ST4 A;  2QLI A;  1B9C A;  4XJK A;  4GGF A;  3CBE A;  4TZG A;  3W1C A;  1SNL A;  2ZNE A;  1GGX A;  3DQ5 A;  1MYW A;  3H1O A;  3BX9 A;  4W7R A;  2BCB A;  3A8R A;  3BXA A;  4GF6 B;  1QVI Y;  3SSL A;  1YHG A;  3M0W A;  3I5G C;  2LP2 A;  1RMP A;  2HGY A;  2F8P A;  2KAY A;  1FF1 A;  1S36 A;  3SG7 A;  2MLE C;  3SG5 A;  3FIA A;  5H88 A;  3CGL A;  3G9A A;  2NCO A;  2ZO6 A;  1KQM C;  1B1G A;  4KPI A;  3TUY C;  1V1G A;  1ZAC A;  1HT9 A;  1M45 A;  2LVJ A;  3DQL A;  1EJ3 A;  2RH7 A;  1WY9 A;  2PXW A;  2QLH A;  2H61 C;  1WLM A;  2QZ0 A;  2WHS A;  4ORB B;  1C07 A;  3ST3 A;  2OKW A;  3I5G B;  1UHK A;  2RGI A;  4P1Q A;  3BOW B;  1NX1 A;  3OB2 B;  2KNE A;  2M9G A;  1B8C A;  3BUX B;  1DJY A;  1WDC C;  2KHN A;  1XA5 A;  2K8M B;  1ZMZ A;  1FPW A;  3EK4 A;  4W72 A;  5K89 A;  4KW8 A;  2OPO A;  3WHT B;  1EH2 A;  4ZB1 A;  1KQM B;  4XYN A;  3TUY B;  1Q4C A;  3CFF A;  2HET A;  1Q4B A;  2COL B;  3ZUL A;  2FJU B;  4W6O A;  4Q7T A;  5DTY A;  1Q73 A;  1UUS A;  3S05 A;  3F45 A;  2P6B B;  1SCM C;  2WIS A;  2LVV A;  1PK0 D;  2GV5 A;  4IK5 A;  2B1U A;  1CFP A;  5KU1 A;  4EMQ A;  2P4M A;  5FHV A;  4OV2 A;  2G16 B;  1A2X A;  5BPJ A;  1WDC B;  4KAG A;  1LA0 A;  5DPJ A;  2FWQ A;  2LHL A;  2M1U A;  3OGO A;  4Q7R A;  2B3Q A;  2ZN9 A;  3SJS A;  4CPV A;  1W7U A;  2AWL A;  2MA2 A;  2H2K A;  3SIA A;  2L5X B;  4HQ8 A;  4LQT A;  4BDU A;  3O77 A;  3EKJ A;  4KGE A;  3OSQ A;  4JGE A;  2K7B A;  4WQ3 A;  4DS7 A;  3SSK A;  3VRR A;  5DY6 A;  2VVI A;  3CZT X;  3TMR A;  2WHU A;  1CFF A;  2GX2 A;  2OTG C;  3FS7 A;  2DDD A;  3CR4 X;  2JTT A;  1YUT A;  4H3L A;  2GW4 B;  1XK4 A;  4GGF C;  1XFY O;  2HFC A;  1XAE A;  3CTN A;  1TNP A;  4R6D A;  1DJI A;  1IG5 A;  1ZOT B;  1ODB A;  4PPJ A;  2E6W A;  3DQA A;  3DPW A;  3IR8 A;  3D0Y A;  4KF5 A;  2G2B A;  3BYA A;  1BG1 A;  3EVR A;  3U8P A;  1FBV A;  4ZF3 A;  1GJY A;  4OY4 A;  2K61 A;  3GOF A;  1OSA A;  1AUI B;  4AQJ A;  3EVP A;  1YJF A;  1EMA A;  2TN4 A;  2OTG B;  2H9W A;  4EDO A;  1KK8 C;  4PE7 A;  3CR5 X;  3DVM A;  3WLD A;  4J88 A;  5HGE A;  1J7R A;  2Q4U A;  4PPL A;  4W76 A;  3A4U B;  3VRP A;  5I8N A;  2ZMU A;  1RWY A;  1C7W A;  3LA1 A;  5EXC I;  1EME A;  2AUC A;  3BXB A;  3CS1 A;  2DUH A;  1JUO A;  1SL8 A;  3SS0 A;  4L1I A;  1NWD A;  3WHU B;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  3MGF A;  4HQC A;  4PHN A;  1Z1Q A;  4HE4 A;  4DXI A;  3CD1 A;  2K7O A;  4XL5 A;  1F09 A;  4ZIO A;  4DCK A;  2BL0 C;  4E68 A;  2LAN A;  5BT0 A;  1EMB A;  1KK8 B;  2KGR A;  1YHH A;  4YI8 A;  3KCS A;  2L98 A;  2G3O A;  3C1V A;  3SVC A;  1S5G Y;  4IK3 A;  5BTT B;  2A4J A;  4H48 A;  2QRF A;  3VHT B;  3ICB A;  2GW3 A;  3I5I C;  1F0B A;  4MRX A;  2AWK A;  4EDS A;  3VIC A;  1JC0 A;  4DUQ A;  4L13 A;  1H6R A;  3DPZ A;  3D10 A;  1FI5 A;  2BL0 B;  2JOJ A;  2FCD A;  3U8A A;  1LIN A;  1SBJ A;  1AHR A;  4IK9 A;  4R1E A;  1MQ1 A;  1S26 D;  2GGZ A;  5ER4 X;  3DQ6 A;  1YUR A;  4W6C A;  5FVG A;  2KYF A;  2K7D A;  1LVC D;  4XVP A;  1CKK A;  1Q4D A;  5HLO A;  1XYD A;  1QAT A;  3I5I B;  1IGV A;  1Y0V H;  4AS8 A;  1GGW A;  3ED8 A;  1JSA A;  1XK4 C;  2KBM A;  4GBA A;  2I18 A;  5DTZ A;  4DKM A;  3SV5 A;  1J55 A;  4I5J A;  4JF9 A;  3NXA A;  2JWW A;  5H87 A;  5HZU A;  1QS7 A;  5CSJ A;  1PVB A;  4FTG A;  1CDL A;  3ZUJ A;  2JAD A;  4W6U A;  1W7I B;  1CDP A;  3GK2 A;  1F70 A;  2HJO A;  4KF5 C;  5HW9 A;  1SL9 A;  2PXS A;  2G6E A;  1OZS A;  1S6I A;  2HPS A;  2KGB C;  2VVJ A;  3SIB A;  2LLU A;  3LK1 A;  1EML A;  2IB5 A;  1TCF A;  1UHH A;  2MBX A;  3SVE A;  3RM1 A;  1CNP A;  1ZGQ A;  2G6X A;  4N3D A;  4W6A A;  4W6J A;  2BE6 A;  1YFP A;  2WUR A;  1QLK A;  4W6T A;  2KAX A;  2QLG A;  1K9K A;  4W77 A;  1B8R A;  2MHH A;  3KEV A;  1J7Q A;  2YFP A;  1RK9 A;  4KF4 A;  4W6H A;  3BXC A;  1JC1 A;  2DD9 A;  4W69 A;  2Y1M A;  1WLZ A;  3TDI A;  4LJD A;  3VK1 A;  1NP8 A;  1YRT B;  4PFE A;  2KFG A;  2F3Z A;  1KK7 Z;  1XSS A;  2EGD A;  3NED A;  3DQD A;  3LVC A;  4ORC B;  3E5T A;  4ICB A;  2I2R E;  2YDZ A;  1IKU A;  1PRW A;  2WCF A;  1RMM A;  3IF7 A;  1UUR A;  2AWM A;  3BUN B;  2H5R A;  1QXT A;  1RTP 1;  1XFU O;  3NEZ A;  2I94 A;  2ZFD A;  2DD7 A;  1IJ6 A;  5DU0 A;  5EXU A;  2A46 A;  2L4H A;  4YRU A;  1LXF C;  3AAJ A;  1M39 A;  5AER A;  1EMC A;  1LA3 A;  2H8Q A;  3DQM A;  2IOV A;  1UWO A;  4P76 A;  1G4Y R;  3DVE A;  2DUE A;  1YHI A;  3EVU A;  2JZI A;  4LJC A;  2L4I A;  2M7L A;  1IQ5 A;  2QT2 A;  2L51 A;  3CFH A;  3TS5 C;  1IH0 A;  4CLN A;  1NPQ A;  4IK4 A;  3SSH A;  4Q04 A;  2H5O A;  4W6K A;  2JT0 A;  1JWD A;  2CNP A;  1CLB A;  2AH8 A;  5LTP A;  1H4U A;  1HQV A;  1F4Q A;  3U0N A;  4AQI A;  3SG4 A;  5HZO A;  2VAD A;  2HQW A;  2A47 A;  2LMV A;  1RRX A;  2OTE A;  5HZS A;  3U0L A;  1ZUZ A;  3WCK A;  2JT3 A;  4OGS A;  2F3Y A;  3UFZ A;  1QAS A;  1N65 A;  1X02 A;  3DQ3 A;  3TS5 B;  1J1D A;  3U0K A;  2WOS A;  2V4E A;  3AI4 A;  1EG3 A;  3DVJ A;  4HRE E;  3DQ4 A;  3DQH A;  3SST A;  4NQG A;  2LVI A;  3DF0 A;  1D1O A;  3PLF B;  2O29 A;  2VZX A;  2KDH A;  4TZA A;  2OJK A;  4PHM A;  3EKH A;  4W6M A;  2KYC A;  3HX4 A;  4PE0 A;  4HVF A;  5EJU A;  5LTQ A;  2FCE A;  3ZNI A;  1JBA A;  4YGC B;  2ZMW A;  3LF4 B;  1YTZ C;  1U5I B;  4MN0 A;  4PE4 A;  4QJ3 B;  3DQO A;  1UHN A;  1MHO A;  4P5O E;  3M22 A;  3E3R A;  2LVK A;  1F54 A;  1WRK A; 
#chains in the Genus database with same CATH topology
 3DPX A;  2KI4 C;  2P70 A;  3NSI A;  2QEV A;  2JU0 A;  3GK4 X;  1M31 A;  4PE1 A;  1NX2 A;  1XFR A;  2OTB A;  2HRS A;  3BUM B;  4IL1 A;  4F7F A;  5DKN A;  4W6D A;  2LLT A;  4YGD B;  1UHJ A;  2O2B A;  3CD9 A;  4M2P A;  3CB9 A;  1OXD A;  5DRG A;  2FJY A;  1UHI A;  5ER5 A;  2JUL A;  2QPT A;  1BFP A;  4GES B;  1TNQ A;  3DQ1 A;  4KW4 A;  1CFD A;  4GPL B;  2QLG B;  2HQK A;  3SVS A;  1F71 A;  3JTD C;  3SSP A;  1K9P A;  3DZT A;  5AFP A;  2V53 A;  4W6S A;  1F8H A;  1V1F A;  3SVB A;  5CPV A;  3DQE A;  2ZKM X;  3SG2 A;  1IQ3 A;  5BQL A;  1PAL A;  4UTS A;  1OQP A;  3K1E A;  1W7T A;  2G6Y A;  4DIR A;  3KHE A;  1SCM B;  3I5H C;  1EMM A;  2C9I A;  4BY4 A;  3WNX B;  4IK1 A;  2YGU A;  3SG3 A;  3TDU A;  2JC2 A;  2CCM A;  1CLM A;  5HKW A;  2VRG A;  4MLW A;  5JOL A;  1W7S A;  2VAE A;  4RYW A;  4LW5 A;  4OQW A;  1S1E A;  4MZJ A;  4ZCU A;  1DEK A;  3JTD B;  3LS3 A;  2M8U A;  5EB6 A;  2G5Z B;  4YBH B;  1QWV A;  3ZTF A;  1KSM A;  1DJG A;  2QEO A;  1KWO C;  3DVK A;  2LMU A;  5I94 A;  4I5L B;  1QX5 B;  1A75 A;  1FW4 A;  5HZT A;  3I5H B;  2OKY A;  5CSF A;  1CM4 A;  3KF9 A;  2HCG A;  1XMZ A;  1ALW A;  1HCJ A;  1SCV A;  4XJK B;  2L2E A;  1XVJ A;  1DJZ A;  3TMT A;  2A48 A;  4JPZ B;  1TTX A;  2FOT A;  2OGR A;  1KK7 Y;  2BTJ A;  3LF3 A;  4F0Z B;  4C0J A;  1BLQ A;  3U0M A;  1JFK A;  3S0B A;  2YE1 A;  2FZU A;  3KO0 A;  1NX0 A;  3PN7 C;  3H1R A;  2Y5I A;  2HGD A;  2M97 A;  4NDC A;  3R1O A;  2EMN A;  3PM8 A;  2A50 B;  2BKI B;  3DQ7 A;  1F55 A;  4Q9X A;  3TZ1 A;  2PQL A;  1A4P A;  3SS3 A;  4CFR A;  5J2O A;  2A53 B;  2ICR A;  2F33 A;  2H5Q A;  5FVI A;  1BR1 B;  3R1V A;  4EUL A;  4W6F A;  1OE9 B;  3RWA A;  5AXI A;  1GL4 A;  1VRK A;  4OJ0 A;  4PHK A;  1RFJ A;  5AQB B;  3CR2 A;  5I2Q A;  5JJG A;  3CAB A;  1YUS A;  4ZIN A;  1AVS A;  3UG0 A;  1JBY A;  3K21 A;  1K94 A;  2K2F A;  2LE9 B;  2QU1 A;  5IBW A;  3FE9 A;  2EC6 C;  1NSH A;  3B7A A;  2JXL A;  3SVR A;  2NZ0 A;  1AJ4 A;  2JTZ A;  2JNF A;  4H3M A;  4JC2 A;  1AJ5 A;  1YRU B;  4HRG A;  3L4L A;  3CZ2 A;  1QJT A;  3SRY A;  2HF5 A;  1EXR A;  1AK8 A;  1CLL A;  4A4C A;  3PAL A;  4M2O A;  2CBL A;  1K90 D;  3BQ3 A;  1EMF A;  4RTC A;  2WCJ A;  1OOF A;  1NCX A;  2M49 B;  3PJ5 A;  1ZUX A;  3IQO A;  5FYX A;  2MLF C;  2A56 B;  2BCX A;  4H3N A;  2O24 A;  1Q4E A;  1JF0 A;  1QTX A;  4B30 A;  4B5Y A;  1UIS A;  1OOH A;  3BOW A;  5DPG A;  1HUY A;  2EC6 B;  3SVD A;  1XQM A;  4BY5 A;  2CXJ A;  4ETO A;  3OX6 A;  3IVT A;  3DQ8 A;  5KTG A;  1B8L A;  2FL1 A;  4W7C A;  1S6C A;  2MAZ A;  3TDZ A;  5D7F A;  3ST2 A;  5CSN A;  1BOC A;  2KPH A;  1Z1P A;  1XFX O;  2BBM A;  1WRL A;  4PAL A;  2HQZ A;  2POX A;  3EVV A;  1Y1U A;  5HLV A;  2KI6 D;  2KOT A;  5HBD A;  4L9M A;  4HQ9 A;  3Q8I A;  4N5X A;  1BU3 A;  2IB6 A;  3A8S A;  1P28 A;  2CT9 A;  3K1K A;  1JFJ A;  1BR4 B;  3BXK A;  2BCA A;  4KA9 A;  1L2O C;  3D74 A;  3O4X A;  4W6N A;  4I5N B;  1MUX A;  5HKZ A;  1BJF A;  2KSP A;  1S3P A;  1OXF A;  4ZF5 A;  2WOR A;  3D0Y B;  3UO9 A;  1AP4 A;  1QIW A;  3E5V A;  2H8V A;  2LC5 A;  1YVH A;  4DXQ A;  1Y6W A;  2VVH A;  3GL4 A;  2G2S B;  3I19 A;  2Q91 A;  3FWC A;  1NUB A;  3R1P A;  2DOQ A;  2A54 B;  4YGA A;  2K60 A;  3NSL A;  3CGA A;  5HKY A;  4DKN A;  2R2I A;  4KEX A;  1N2D A;  4N1F A;  1SKT A;  5EBJ A;  1L2O B;  1IWQ A;  2LUX A;  1ALV A;  2ZND A;  3EG5 B;  2D8N A;  2ZN8 A;  2WCB A;  2PSR A;  1GGZ A;  2GGM A;  4I2Y A;  1A29 A;  3VRO A;  1RM9 A;  1BF5 A;  2SCP A;  4GUK A;  4YI9 A;  3D77 A;  1DT7 B;  3V3D A;  2SAS A;  3BFA A;  2L0P A;  4MEW A;  1DJW A;  4A4B A;  2IE2 A;  1Y1X A;  3NF0 A;  2K7C A;  4CID A;  5DRF A;  2LHI A;  4Q9W A;  4YGB B;  1CM1 A;  3VRN A;  3O6B A;  1DF0 A;  1WRZ A;  2NXQ A;  5D69 A;  3DQN A;  3LLE A;  5F9G A;  3ZUF A;  2QAC A;  2ERB A;  3PSR A;  1MOV A;  2H5P A;  2AMI A;  1PVA A;  3SVU A;  1G33 A;  1EMK A;  1CFC A;  1RRO A;  1XO5 A;  1SY9 A;  3JVT C;  3ST0 A;  2WSN A;  3SVO A;  2M3W A;  4GGN A;  2O5G A;  1NCY A;  4ZBL A;  1OMV A;  4R6B A;  5DQM A;  3P28 A;  3NT3 A;  3DQC A;  2C9J A;  1TIZ A;  4ORN A;  3VGO A;  1MR8 A;  3KCT A;  1UP5 A;  1KYP A;  1B7T Y;  1NCZ A;  4MSP A;  5H89 A;  3CFA A;  1A03 A;  4ZCV A;  1OOJ A;  4WQ2 A;  5EHU A;  1DTL A;  4I5K A;  5KTY A;  1MF8 B;  1Q80 A;  3E5W A;  1KCY A;  2Q57 A;  4JWQ A;  1DMO A;  4W6L A;  4NDB A;  2K0J A;  2WSO A;  5BTT A;  1CTR A;  3BUO B;  3PFV A;  2IS9 A;  1J7P A;  1B9A A;  2AAO A;  3DQI A;  1DGV A;  1KFX S;  1KYR A;  3JVT B;  4MZK A;  1CB1 A;  3VHT A;  1TNW A;  2Y4Q A;  2KI6 C;  4OHS A;  4B30 B;  2JT8 A;  2JNX A;  2QLE A;  1CMF A;  4JEO A;  2L5Y A;  1QX2 A;  2WCK A;  1TUZ A;  4IJ7 A;  1Y1A A;  4LJD C;  3SSV A;  1CV7 A;  2MRD A;  2G9B A;  1C4F A;  1YX7 A;  3EK8 A;  3V2L A;  1K93 D;  2DDC A;  4MBE A;  5J3X A;  4NDD A;  2M7N A;  3AKO A;  1GQM A;  4DXO A;  2O60 A;  2EHB A;  2ARL A;  2JPT A;  1DEL A;  1NYA A;  4FQT A;  2L2C A;  2CTN A;  4J89 A;  3UNW A;  4OR9 B;  4U8D A;  4IZN A;  2KI4 B;  2LUC A;  2F2P A;  1KFU S;  1TN4 A;  2YE0 A;  3U8C A;  4HRH A;  1CDN A;  4W7A A;  1B47 A;  5KSZ A;  5DKQ A;  2LCP A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  2BEC A;  3PM2 A;  1XFZ O;  2ZRT A;  5TNC A;  4JD9 A;  3ADF A;  3DQJ A;  1G8I A;  4ZF4 A;  4XOV A;  3WXA A;  3W1D A;  1MWN A;  3CYZ A;  3H4S E;  2DUG A;  1SYM A;  3RLZ A;  3NHT A;  1ZGP A;  2WCL A;  4W6I A;  3LSA A;  3RWT A;  2BKH B;  3IQQ A;  1ZFS A;  3FE6 A;  3PJI A;  3P8U A;  1XA9 A;  1KSO A;  1R6P A;  4PT1 A;  4KYN A;  1MOU A;  4W7E A;  4KGF A;  2PMY A;  2OS8 C;  3LVD A;  2WC8 A;  2ISD A;  3D76 A;  3PJB A;  1KYS A;  2WC6 A;  3GJ1 A;  1EMG A;  2WND A;  3PAT A;  4P2Y B;  5FVF A;  1QVI Z;  5DTX A;  2V4E C;  2DUI A;  4W73 A;  1REC A;  4W74 A;  2HPW A;  3SS5 A;  3AI5 A;  2PRU A;  3O2P A;  3LVA A;  1OXE A;  3DQU A;  1DF0 B;  1SRA A;  3SG6 A;  1K9U A;  3SVN A;  2Y1N A;  3PJ7 A;  3B6X A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3ZWH A;  5I2O A;  1SMG A;  4C0L A;  4OVN F;  4PCW A;  4GAO A;  4EN1 A;  1TRF A;  3I5F C;  3BJH A;  4QJ4 B;  2JQ6 A;  2Z6X A;  3EK7 A;  1TCO B;  1B7T Z;  2AWJ A;  3AKA A;  3IP2 A;  3LK0 A;  5FI2 A;  4LJB A;  1KWO B;  2KAV A;  4W6R A;  1QX7 A;  3PIB A;  3QME A;  4RYS A;  1ORG A;  4XOW A;  4INW A;  2QDI A;  3DQK A;  1SR6 C;  2AHA A;  4JFG A;  1G7K A;  2OS8 B;  3DD4 A;  1QYQ A;  1QY3 A;  1J7O A;  4L12 A;  1R2U A;  3CDN A;  4DRW A;  5F6T A;  4PPK A;  2V4E B;  3S0A A;  3GEX A;  3M24 A;  5EXB A;  3DF0 B;  1OMD A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  4D1E A;  1QXP A;  2PAL A;  5LTR A;  3I5F B;  1JBZ A;  3D75 A;  4Q7U A;  1OZO A;  3FWB A;  3OX5 A;  1XFV O;  1YJ2 A;  1IRJ A;  1DJH A;  3NHI A;  2M29 A;  2I7A A;  4U2V A;  1C7V A;  1SR6 B;  3PN7 B;  3OSR A;  4DXM A;  2Q6P A;  2Z6Z A;  1K8U A;  1J1E A;  1QV0 A;  4CFQ A;  1B4C A;  1FI6 A;  1TNX A;  1SL7 A;  5GQQ C;  3CLN A;  2ZO7 A;  3GK1 A;  1JC2 A;  5DPI A;  2KLE A;  1SW8 A;  3DQ2 A;  2QEH A;  1E8A A;  3AAK A;  2A52 B;  1EG4 A;  1S6Z A;  5EL2 A;  4AOM A;  1F4O A;  1K95 A;  1ZGO A;  2Y0G A;  5DQB A;  4GNK B;  1CDM A;  2WCM A;  1TOP A;  3DYE A;  4Z4M A;  2M0R A;  4UPG A;  2KFF A;  3S0G A;  2H6V A;  4AR7 A;  3LL8 B;  3MSE B;  1Q4A A;  1MXL C;  4MVF A;  4GFT A;  2NCP A;  4W7D A;  5DKR A;  3O4Y A;  4W6B A;  4C0K A;  1H4B A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  3FE8 A;  1QYO A;  1K2H A;  2NLN A;  4OCI A;  3S0D A;  1PSB A;  3WLC A;  2B3P A;  4DXP A;  1DGU A;  1YR5 A;  5LK4 A;  4HSZ A;  1DVI A;  1OMR A;  4QJ5 B;  2ZRS A;  1RJV A;  4JRB A;  4W7X A;  2MJW B;  1RMO A;  4W6P A;  4WRI A;  4Z4K A;  1NX3 A;  1YVL A;  2JXC A;  4TNC A;  3DQF A;  2WCE A;  2LLS A;  4JQ0 D;  4LQU A;  3O78 A;  2BBN A;  2KFH A;  2H61 A;  2EMD A;  5CSI A;  5B8I B;  1YZW A;  1NIW A;  2L50 A;  3OP0 A;  2KQ6 A;  2JRF A;  2LNK A;  2LM5 A;  4NWS A;  1QIV A;  5DTL A;  2WIQ A;  1BT6 A;  2DUF A;  4MZL A;  1EL4 A;  1KQV A;  2LV7 A;  1YX8 A;  3CWG A;  3VRQ A;  3AKB A;  3NSK A;  4W75 A;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  4USL A;  4M2Q A;  4PDZ A;  1KFX L;  3GB3 A;  3GJ2 A;  5HL1 A;  2WHT A;  4ORA B;  2PVB A;  2BAP A;  1H8B A;  1QLS A;  1XFW O;  1QV1 A;  4DXN A;  2BE4 A;  5AEQ A;  1JF2 A;  4W6G A;  2PAS A;  5T3I A;  3KPX A;  1M63 B;  4KW9 A;  4W7F A;  4N1G A;  5AAN A;  4OKH A;  2K2A A;  5I2L A;  2G3D B;  1SPY A;  4H47 A;  3LCP C;  2KQY A;  3BUW B;  5PAL A;  3DQ9 A;  2LP3 A;  2Z6Y A;  1QYF A;  4IK8 A;  5DPH A;  1GFL A;  3HCM A;  1TWO A;  1MXE A;  4YGE B;  4J8A A;  4MRY A;  2Z1O A;  1S5G Z;  3OB1 B;  5EB7 A;  3NT9 A;  4FQO A;  2E30 A;  4ZFS A;  2HQ8 A;  1S6J A;  4GOB A;  2EMO A;  4ANJ A;  3SSY A;  1PSR A;  1YUU A;  1KP5 A;  1KFU L;  1N0Y A;  2GX0 A;  4OZD A;  4XGY A;  3ST4 A;  2QLI A;  1B9C A;  3NGV A;  4XJK A;  4GGF A;  3CBE A;  4TZG A;  3W1C A;  1SNL A;  2ZNE A;  1GGX A;  3DQ5 A;  1MYW A;  3H1O A;  3BX9 A;  4W7R A;  2BCB A;  3A8R A;  3BXA A;  4GF6 B;  1QVI Y;  3D73 A;  3SSL A;  3OGN A;  1YHG A;  3M0W A;  3I5G C;  2LP2 A;  1RMP A;  2HGY A;  2F8P A;  2KAY A;  1FF1 A;  1S36 A;  3SG7 A;  2MLE C;  3SG5 A;  3FIA A;  5H88 A;  3CGL A;  3G9A A;  2NCO A;  2P71 A;  2ZO6 A;  1KQM C;  1B1G A;  4KPI A;  3TUY C;  1V1G A;  1ZAC A;  1HT9 A;  1M45 A;  2LVJ A;  3DQL A;  1EJ3 A;  1LS8 A;  2RH7 A;  1WY9 A;  2PXW A;  2QLH A;  2H61 C;  1WLM A;  2QZ0 A;  2WHS A;  4ORB B;  1C07 A;  3ST3 A;  2OKW A;  3I5G B;  1UHK A;  2RGI A;  4P1Q A;  3BOW B;  1NX1 A;  3OB2 B;  2KNE A;  2M9G A;  1B8C A;  3BUX B;  1DJY A;  1WDC C;  2KHN A;  1XA5 A;  2K8M B;  1ZMZ A;  1FPW A;  1DQE A;  3EK4 A;  4W72 A;  5K89 A;  4KW8 A;  2OPO A;  3WHT B;  1EH2 A;  4ZB1 A;  3L4A A;  1KQM B;  4XYN A;  3TUY B;  1Q4C A;  3CFF A;  2HET A;  1Q4B A;  2COL B;  3ZUL A;  2KLD A;  3DXL A;  2FJU B;  1C3Z A;  4W6O A;  4Q7T A;  5DTY A;  1Z2C B;  1Q73 A;  1UUS A;  3S05 A;  3F45 A;  2P6B B;  1SCM C;  2WIS A;  2LVV A;  1PK0 D;  2GV5 A;  4IK5 A;  2B1U A;  1CFP A;  5KU1 A;  4EMQ A;  2P4M A;  5FHV A;  2GTE A;  4OV2 A;  2G16 B;  1A2X A;  5BPJ A;  1WDC B;  4KAG A;  1LA0 A;  3B86 A;  5DPJ A;  2FWQ A;  2LHL A;  2M1U A;  3OGO A;  4Q7R A;  2B3Q A;  2ZN9 A;  3SJS A;  4CPV A;  1W7U A;  2AWL A;  2MA2 A;  2H2K A;  3SIA A;  2L5X B;  4HQ8 A;  1TUJ A;  4LQT A;  3L47 A;  4BDU A;  3O77 A;  3EKJ A;  4KGE A;  3OSQ A;  4JGE A;  2K7B A;  4WQ3 A;  4DS7 A;  3SSK A;  3VRR A;  5DY6 A;  2VVI A;  3CZT X;  3TMR A;  2WHU A;  1CFF A;  2GX2 A;  2OTG C;  3FS7 A;  2DDD A;  3CR4 X;  2JTT A;  1YUT A;  4H3L A;  2GW4 B;  1XK4 A;  4GGF C;  1XFY O;  2HFC A;  2QEB A;  1XAE A;  3CTN A;  1TNP A;  4INX A;  3SS4 A;  4R6D A;  1DJI A;  1IG5 A;  1ZOT B;  1ODB A;  4PPJ A;  2E6W A;  3DQA A;  3DPW A;  3IR8 A;  3D0Y A;  4KF5 A;  2G2B A;  3BYA A;  1BG1 A;  3D78 A;  3EVR A;  5FI7 A;  3U8P A;  1FBV A;  3CZ1 A;  4ZF3 A;  1GJY A;  4OY4 A;  2K61 A;  3GOF A;  1OSA A;  1AUI B;  4AQJ A;  3EVP A;  1YJF A;  1EMA A;  2TN4 A;  2OTG B;  2H9W A;  4EDO A;  1KK8 C;  4PE7 A;  3CR5 X;  3DVM A;  3WLD A;  4J88 A;  5HGE A;  1J7R A;  2Q4U A;  4PPL A;  4W76 A;  3A4U B;  3VRP A;  5I8N A;  2ZMU A;  3DY9 A;  1RWY A;  1C7W A;  3LA1 A;  2WCH A;  5EXC I;  1EME A;  2AUC A;  3BXB A;  3CS1 A;  2DUH A;  1JUO A;  1SL8 A;  3SS0 A;  4L1I A;  1NWD A;  3WHU B;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  3MGF A;  4HQC A;  4PHN A;  1Z1Q A;  4HE4 A;  4DXI A;  3CD1 A;  2K7O A;  4XL5 A;  1F09 A;  4ZIO A;  4DCK A;  2BL0 C;  4E68 A;  2LAN A;  1DC1 A;  5BT0 A;  1EMB A;  1KK8 B;  2KGR A;  1YHH A;  2JPO A;  4YI8 A;  3KCS A;  2L98 A;  2G3O A;  3C1V A;  3SVC A;  1S5G Y;  4IK3 A;  5BTT B;  2A4J A;  4H48 A;  2QRF A;  3BFH A;  3VHT B;  3ICB A;  2GW3 A;  3I5I C;  1F0B A;  4MRX A;  2AWK A;  4EDS A;  5FI6 A;  3VIC A;  1JC0 A;  4DUQ A;  4L13 A;  1OOG A;  1H6R A;  1OOI X;  3DPZ A;  3D10 A;  1FI5 A;  2BL0 B;  2JOJ A;  2FCD A;  3U8A A;  1LIN A;  1SBJ A;  1AHR A;  4IK9 A;  4R1E A;  1MQ1 A;  1S26 D;  2GGZ A;  5ER4 X;  3DQ6 A;  1YUR A;  4W6C A;  5FVG A;  2KYF A;  1OW4 A;  2K7D A;  1LVC D;  4XVP A;  1CKK A;  1Q4D A;  3S0E A;  5HLO A;  1XYD A;  1QAT A;  3I5I B;  1IGV A;  1Y0V H;  4AS8 A;  1GGW A;  3ED8 A;  1JSA A;  3B88 A;  1XK4 C;  2KBM A;  4GBA A;  2I18 A;  5DTZ A;  4DKM A;  3SV5 A;  1T14 A;  1J55 A;  4I5J A;  4JF9 A;  3NXA A;  2JWW A;  3B87 A;  5H87 A;  5HZU A;  1QS7 A;  5CSJ A;  1PVB A;  4FTG A;  1CDL A;  3ZUJ A;  2JAD A;  4W6U A;  1W7I B;  1CDP A;  3GK2 A;  1F70 A;  2HJO A;  4KF5 C;  5HW9 A;  1SL9 A;  2PXS A;  2G6E A;  1OZS A;  1S6I A;  2HPS A;  2KGB C;  2VVJ A;  3SIB A;  2LLU A;  3LK1 A;  1EML A;  2IB5 A;  1TCF A;  1UHH A;  2MBX A;  3SVE A;  3RM1 A;  1CNP A;  1ZGQ A;  2G6X A;  4N3D A;  4W6A A;  4W6J A;  2WC5 A;  2BE6 A;  1YFP A;  2WUR A;  1QLK A;  1GM0 A;  3R72 A;  4W6T A;  2BNX A;  2KAX A;  2QLG A;  1K9K A;  4W77 A;  1B8R A;  2MHH A;  3KEV A;  1J7Q A;  2YFP A;  1RK9 A;  1C3Y A;  4KF4 A;  4W6H A;  3BXC A;  1JC1 A;  2DD9 A;  4W69 A;  2Y1M A;  1WLZ A;  3TDI A;  4LJD A;  4JKT A;  3VK1 A;  1W9Z A;  1NP8 A;  1SSE B;  1YRT B;  4PFE A;  2KFG A;  2F3Z A;  1KK7 Z;  3RZS A;  1XSS A;  2EGD A;  3NED A;  3DQD A;  3LVC A;  4ORC B;  3E5T A;  4ICB A;  2I2R E;  2YDZ A;  1IKU A;  1PRW A;  2WCF A;  1RMM A;  3IF7 A;  1UUR A;  2AWM A;  3BUN B;  5D3O A;  2H5R A;  1QXT A;  1RTP 1;  1XFU O;  3NEZ A;  2I94 A;  2ZFD A;  2DD7 A;  1IJ6 A;  5DU0 A;  5EXU A;  2A46 A;  2L4H A;  4YRU A;  3OBV A;  1LXF C;  3AAJ A;  1M39 A;  5AER A;  1EMC A;  1LA3 A;  2H8Q A;  3DQM A;  2IOV A;  1UWO A;  4P76 A;  1G4Y R;  3DVE A;  2DUE A;  1YHI A;  3EVU A;  2JZI A;  4LJC A;  2L4I A;  2M7L A;  1IQ5 A;  2QT2 A;  2L51 A;  3CFH A;  3TS5 C;  1IH0 A;  4CLN A;  1NPQ A;  2PYQ A;  4IK4 A;  3SSH A;  4Q04 A;  2H5O A;  4W6K A;  2JT0 A;  1JWD A;  2CNP A;  1CLB A;  2AH8 A;  5LTP A;  1H4U A;  1HQV A;  1F4Q A;  3U0N A;  4AQI A;  3SG4 A;  5HZO A;  2VAD A;  2HQW A;  2A47 A;  3CZ0 A;  2LMV A;  1RRX A;  2OTE A;  5HZS A;  1IIO A;  3U0L A;  1ZUZ A;  3N7H A;  3WCK A;  2JT3 A;  5DIC A;  4OGS A;  2F3Y A;  3UFZ A;  1QAS A;  1Z4H A;  1N65 A;  1X02 A;  3DQ3 A;  3TS5 B;  1J1D A;  3U0K A;  2WOS A;  2V4E A;  3S0F A;  3BFB A;  3AI4 A;  1EG3 A;  3DVJ A;  4HRE E;  3DQ4 A;  3DQH A;  3SST A;  4NQG A;  2LVI A;  3DF0 A;  1D1O A;  3PLF B;  2O29 A;  2VZX A;  2KDH A;  4TZA A;  2OJK A;  4PHM A;  3EKH A;  4W6M A;  2KYC A;  3HX4 A;  4PE0 A;  4HVF A;  5EJU A;  5LTQ A;  2FCE A;  3ZNI A;  1JBA A;  4YGC B;  2ZMW A;  3LF4 B;  1YTZ C;  1U5I B;  4MN0 A;  4PE4 A;  4QJ3 B;  3DQO A;  1UHN A;  1MHO A;  4P5O E;  3VB1 A;  3M22 A;  3E3R A;  2LVK A;  1F54 A;  1WRK A; 
#chains in the Genus database with same CATH homology
 3DPX A;  2KI4 C;  3NSI A;  2JU0 A;  3GK4 X;  1M31 A;  4PE1 A;  1NX2 A;  2OTB A;  2HRS A;  3BUM B;  4IL1 A;  5DKN A;  4W6D A;  2LLT A;  4YGD B;  1UHJ A;  2O2B A;  3CD9 A;  4M2P A;  3CB9 A;  1OXD A;  5DRG A;  1UHI A;  5ER5 A;  2JUL A;  2QPT A;  1BFP A;  4GES B;  1TNQ A;  3DQ1 A;  4KW4 A;  1CFD A;  4GPL B;  2QLG B;  2HQK A;  3SVS A;  1F71 A;  3JTD C;  3SSP A;  1K9P A;  5AFP A;  2V53 A;  4W6S A;  1F8H A;  1V1F A;  3SVB A;  5CPV A;  3DQE A;  2ZKM X;  3SG2 A;  1IQ3 A;  5BQL A;  1PAL A;  4UTS A;  1OQP A;  1W7T A;  2G6Y A;  4DIR A;  3KHE A;  1SCM B;  3I5H C;  1EMM A;  2C9I A;  4BY4 A;  3WNX B;  4IK1 A;  3SG3 A;  3TDU A;  2JC2 A;  2CCM A;  1CLM A;  5HKW A;  2VRG A;  4MLW A;  5JOL A;  1W7S A;  2VAE A;  4RYW A;  4LW5 A;  4OQW A;  1S1E A;  4MZJ A;  4ZCU A;  3JTD B;  3LS3 A;  2M8U A;  5EB6 A;  2G5Z B;  4YBH B;  3ZTF A;  1KSM A;  1DJG A;  1KWO C;  3DVK A;  2LMU A;  4I5L B;  1QX5 B;  1A75 A;  1FW4 A;  5HZT A;  3I5H B;  2OKY A;  5CSF A;  1CM4 A;  3KF9 A;  2HCG A;  1ALW A;  1HCJ A;  1XMZ A;  1SCV A;  4XJK B;  2L2E A;  1XVJ A;  1DJZ A;  3TMT A;  2A48 A;  4JPZ B;  1TTX A;  2FOT A;  2OGR A;  1KK7 Y;  2BTJ A;  3LF3 A;  4F0Z B;  4C0J A;  1BLQ A;  3U0M A;  1JFK A;  2YE1 A;  2FZU A;  3KO0 A;  1NX0 A;  3PN7 C;  3H1R A;  2Y5I A;  2HGD A;  2M97 A;  4NDC A;  2EMN A;  3PM8 A;  2A50 B;  2BKI B;  3DQ7 A;  1F55 A;  4Q9X A;  3TZ1 A;  1A4P A;  4CFR A;  5J2O A;  2A53 B;  2ICR A;  2F33 A;  2H5Q A;  5FVI A;  1BR1 B;  4EUL A;  4W6F A;  1OE9 B;  3RWA A;  5AXI A;  1GL4 A;  1VRK A;  4OJ0 A;  4PHK A;  1RFJ A;  5AQB B;  3CR2 A;  5I2Q A;  5JJG A;  1YUS A;  4ZIN A;  1AVS A;  3UG0 A;  1JBY A;  3K21 A;  1K94 A;  2K2F A;  2LE9 B;  2QU1 A;  5IBW A;  2EC6 C;  1NSH A;  2JXL A;  3SVR A;  2NZ0 A;  1AJ4 A;  2JTZ A;  2JNF A;  4H3M A;  4JC2 A;  1AJ5 A;  1YRU B;  4HRG A;  1QJT A;  3SRY A;  2HF5 A;  1EXR A;  1AK8 A;  1CLL A;  4A4C A;  3PAL A;  4M2O A;  2CBL A;  1K90 D;  3BQ3 A;  1EMF A;  4RTC A;  1NCX A;  2M49 B;  3PJ5 A;  1ZUX A;  3IQO A;  5FYX A;  2MLF C;  2A56 B;  2BCX A;  4H3N A;  2O24 A;  1Q4E A;  1JF0 A;  1QTX A;  4B30 A;  4B5Y A;  1UIS A;  3BOW A;  5DPG A;  1HUY A;  2EC6 B;  3SVD A;  1XQM A;  4BY5 A;  2CXJ A;  4ETO A;  3OX6 A;  3DQ8 A;  5KTG A;  1B8L A;  2FL1 A;  4W7C A;  1S6C A;  2MAZ A;  3TDZ A;  5D7F A;  3ST2 A;  5CSN A;  1BOC A;  1Z1P A;  1XFX O;  2BBM A;  1WRL A;  4PAL A;  2HQZ A;  2POX A;  3EVV A;  1Y1U A;  5HLV A;  2KI6 D;  2KOT A;  5HBD A;  4L9M A;  4HQ9 A;  4N5X A;  1BU3 A;  2IB6 A;  3A8S A;  2CT9 A;  3K1K A;  1JFJ A;  1BR4 B;  3BXK A;  2BCA A;  4KA9 A;  1L2O C;  4W6N A;  4I5N B;  1MUX A;  5HKZ A;  1BJF A;  2KSP A;  1S3P A;  1OXF A;  4ZF5 A;  2WOR A;  3D0Y B;  1AP4 A;  1QIW A;  3E5V A;  2LC5 A;  1YVH A;  4DXQ A;  1Y6W A;  2VVH A;  3GL4 A;  2G2S B;  3I19 A;  2Q91 A;  3FWC A;  1NUB A;  2DOQ A;  2A54 B;  4YGA A;  3NSL A;  3CGA A;  5HKY A;  4DKN A;  2R2I A;  4KEX A;  1N2D A;  4N1F A;  1SKT A;  5EBJ A;  1L2O B;  1IWQ A;  2LUX A;  1ALV A;  2ZND A;  2D8N A;  2ZN8 A;  2WCB A;  2PSR A;  1GGZ A;  2GGM A;  4I2Y A;  1A29 A;  3VRO A;  1RM9 A;  1BF5 A;  2SCP A;  4GUK A;  4YI9 A;  1DT7 B;  3V3D A;  2SAS A;  2L0P A;  4MEW A;  1DJW A;  4A4B A;  2IE2 A;  1Y1X A;  3NF0 A;  2K7C A;  4CID A;  5DRF A;  2LHI A;  4Q9W A;  4YGB B;  1CM1 A;  3VRN A;  3O6B A;  1DF0 A;  1WRZ A;  2NXQ A;  5D69 A;  3DQN A;  3LLE A;  5F9G A;  3ZUF A;  2QAC A;  3PSR A;  1MOV A;  2H5P A;  2AMI A;  1PVA A;  3SVU A;  1G33 A;  1EMK A;  1CFC A;  1RRO A;  1XO5 A;  1SY9 A;  3JVT C;  3ST0 A;  2WSN A;  3SVO A;  2M3W A;  4GGN A;  2O5G A;  1NCY A;  4ZBL A;  1OMV A;  4R6B A;  5DQM A;  3P28 A;  3NT3 A;  3DQC A;  2C9J A;  1TIZ A;  4ORN A;  3VGO A;  1MR8 A;  3KCT A;  1UP5 A;  1KYP A;  1B7T Y;  1NCZ A;  4MSP A;  5H89 A;  3CFA A;  1A03 A;  4ZCV A;  1OOJ A;  4WQ2 A;  5EHU A;  1DTL A;  4I5K A;  5KTY A;  1MF8 B;  1Q80 A;  3E5W A;  1KCY A;  2Q57 A;  4JWQ A;  1DMO A;  4W6L A;  4NDB A;  2K0J A;  2WSO A;  5BTT A;  1CTR A;  3BUO B;  3PFV A;  2IS9 A;  1J7P A;  1B9A A;  2AAO A;  3DQI A;  1DGV A;  1KFX S;  1KYR A;  3JVT B;  4MZK A;  1CB1 A;  3VHT A;  1TNW A;  2Y4Q A;  2KI6 C;  4OHS A;  4B30 B;  2JT8 A;  2JNX A;  2QLE A;  1CMF A;  4JEO A;  1QX2 A;  1Y1A A;  4LJD C;  3SSV A;  1CV7 A;  2MRD A;  2G9B A;  1C4F A;  1YX7 A;  3EK8 A;  1K93 D;  2DDC A;  4MBE A;  5J3X A;  4NDD A;  2M7N A;  3AKO A;  1GQM A;  4DXO A;  2O60 A;  2EHB A;  2ARL A;  2JPT A;  1NYA A;  2CTN A;  4J89 A;  4OR9 B;  4U8D A;  4IZN A;  2KI4 B;  2LUC A;  2F2P A;  1KFU S;  1TN4 A;  2YE0 A;  3U8C A;  4HRH A;  1CDN A;  4W7A A;  1B47 A;  5KSZ A;  5DKQ A;  2LCP A;  1K96 A;  1CMG A;  1L7Z A;  2M1K B;  5G08 A;  2BEC A;  1XFZ O;  2ZRT A;  5TNC A;  3ADF A;  3DQJ A;  1G8I A;  4ZF4 A;  4XOV A;  3WXA A;  3W1D A;  1MWN A;  3H4S E;  2DUG A;  1SYM A;  3RLZ A;  1ZGP A;  4W6I A;  3LSA A;  3RWT A;  2BKH B;  3IQQ A;  1ZFS A;  3P8U A;  1XA9 A;  1KSO A;  1R6P A;  1MOU A;  4W7E A;  4KGF A;  2PMY A;  2OS8 C;  3LVD A;  2WC8 A;  2ISD A;  3PJB A;  1KYS A;  3GJ1 A;  1EMG A;  2WND A;  3PAT A;  4P2Y B;  5FVF A;  1QVI Z;  5DTX A;  2V4E C;  2DUI A;  4W73 A;  1REC A;  4W74 A;  2HPW A;  3AI5 A;  2PRU A;  3O2P A;  3LVA A;  1OXE A;  3DQU A;  1DF0 B;  1SRA A;  3SG6 A;  1K9U A;  3SVN A;  2Y1N A;  3PJ7 A;  1LKJ A;  3OHM B;  1SK6 D;  4PHJ A;  3ZWH A;  5I2O A;  1SMG A;  4C0L A;  4OVN F;  4PCW A;  4GAO A;  4EN1 A;  1TRF A;  3I5F C;  4QJ4 B;  2JQ6 A;  2Z6X A;  1TCO B;  3EK7 A;  1B7T Z;  2AWJ A;  3AKA A;  3IP2 A;  3LK0 A;  4LJB A;  1KWO B;  2KAV A;  4W6R A;  1QX7 A;  3PIB A;  4RYS A;  4XOW A;  3DQK A;  1SR6 C;  2AHA A;  4JFG A;  1G7K A;  2OS8 B;  3DD4 A;  1QYQ A;  1QY3 A;  1J7O A;  4L12 A;  1R2U A;  4DRW A;  5F6T A;  4PPK A;  2V4E B;  3GEX A;  3M24 A;  5EXB A;  3DF0 B;  1OMD A;  3QRX A;  1M46 A;  3NSO A;  2F2O A;  4D1E A;  1QXP A;  2PAL A;  5LTR A;  3I5F B;  1JBZ A;  4Q7U A;  1OZO A;  3FWB A;  3OX5 A;  1XFV O;  1YJ2 A;  1IRJ A;  1DJH A;  2M29 A;  2I7A A;  4U2V A;  1C7V A;  1SR6 B;  3PN7 B;  3OSR A;  4DXM A;  2Q6P A;  2Z6Z A;  1K8U A;  1J1E A;  1QV0 A;  4CFQ A;  1B4C A;  1FI6 A;  1TNX A;  1SL7 A;  5GQQ C;  3CLN A;  2ZO7 A;  3GK1 A;  1JC2 A;  5DPI A;  1SW8 A;  3DQ2 A;  1E8A A;  3AAK A;  2A52 B;  1EG4 A;  1S6Z A;  1F4O A;  4AOM A;  1K95 A;  1ZGO A;  2Y0G A;  5DQB A;  4GNK B;  1CDM A;  1TOP A;  4Z4M A;  2M0R A;  4UPG A;  2KFF A;  2H6V A;  4AR7 A;  3LL8 B;  3MSE B;  1Q4A A;  1MXL C;  4MVF A;  4GFT A;  2NCP A;  4W7D A;  5DKR A;  3O4Y A;  4W6B A;  4C0K A;  1H4B A;  1BMO A;  2LAP A;  1U5I A;  2KBI A;  1QYO A;  1K2H A;  2NLN A;  4OCI A;  1PSB A;  3WLC A;  2B3P A;  4DXP A;  1DGU A;  1YR5 A;  5LK4 A;  4HSZ A;  1DVI A;  1OMR A;  4QJ5 B;  2ZRS A;  1RJV A;  4JRB A;  4W7X A;  2MJW B;  1RMO A;  4W6P A;  4WRI A;  4Z4K A;  1NX3 A;  1YVL A;  2JXC A;  4TNC A;  3DQF A;  2WCE A;  2LLS A;  4JQ0 D;  4LQU A;  3O78 A;  2BBN A;  2KFH A;  2H61 A;  2EMD A;  5CSI A;  5B8I B;  1YZW A;  1NIW A;  2L50 A;  3OP0 A;  2KQ6 A;  2JRF A;  2LNK A;  2LM5 A;  4NWS A;  1QIV A;  5DTL A;  2WIQ A;  1BT6 A;  2DUF A;  4MZL A;  1EL4 A;  1KQV A;  2LV7 A;  1YX8 A;  3CWG A;  3VRQ A;  3AKB A;  3NSK A;  4W75 A;  5HYD A;  1PUL A;  1DJX A;  1A75 B;  4USL A;  4M2Q A;  4PDZ A;  1KFX L;  3GB3 A;  3GJ2 A;  2WHT A;  4ORA B;  2PVB A;  1H8B A;  1QLS A;  1XFW O;  1QV1 A;  4DXN A;  2BE4 A;  5AEQ A;  1JF2 A;  4W6G A;  2PAS A;  5T3I A;  3KPX A;  1M63 B;  4KW9 A;  4W7F A;  4N1G A;  5AAN A;  4OKH A;  2K2A A;  5I2L A;  2G3D B;  1SPY A;  4H47 A;  3LCP C;  2KQY A;  3BUW B;  5PAL A;  3DQ9 A;  2LP3 A;  2Z6Y A;  1QYF A;  4IK8 A;  5DPH A;  1GFL A;  3HCM A;  1MXE A;  4YGE B;  4J8A A;  4MRY A;  2Z1O A;  1S5G Z;  3OB1 B;  5EB7 A;  3NT9 A;  4FQO A;  2E30 A;  4ZFS A;  2HQ8 A;  1S6J A;  4GOB A;  2EMO A;  4ANJ A;  3SSY A;  1PSR A;  1YUU A;  1KP5 A;  1KFU L;  1N0Y A;  2GX0 A;  4XGY A;  3ST4 A;  2QLI A;  1B9C A;  4XJK A;  4GGF A;  3CBE A;  4TZG A;  3W1C A;  1SNL A;  2ZNE A;  1GGX A;  3DQ5 A;  1MYW A;  3H1O A;  3BX9 A;  4W7R A;  2BCB A;  3A8R A;  3BXA A;  4GF6 B;  1QVI Y;  3SSL A;  1YHG A;  3M0W A;  3I5G C;  2LP2 A;  1RMP A;  2HGY A;  2F8P A;  2KAY A;  1FF1 A;  1S36 A;  3SG7 A;  2MLE C;  3SG5 A;  3FIA A;  5H88 A;  3CGL A;  3G9A A;  2NCO A;  2ZO6 A;  1KQM C;  1B1G A;  4KPI A;  3TUY C;  1V1G A;  1ZAC A;  1HT9 A;  1M45 A;  2LVJ A;  3DQL A;  1EJ3 A;  2RH7 A;  1WY9 A;  2PXW A;  2QLH A;  2H61 C;  1WLM A;  2QZ0 A;  2WHS A;  4ORB B;  1C07 A;  3ST3 A;  2OKW A;  3I5G B;  1UHK A;  2RGI A;  4P1Q A;  3BOW B;  1NX1 A;  3OB2 B;  2KNE A;  2M9G A;  1B8C A;  3BUX B;  1DJY A;  1WDC C;  2KHN A;  1XA5 A;  2K8M B;  1ZMZ A;  1FPW A;  3EK4 A;  4W72 A;  5K89 A;  4KW8 A;  2OPO A;  3WHT B;  1EH2 A;  4ZB1 A;  1KQM B;  4XYN A;  3TUY B;  1Q4C A;  3CFF A;  2HET A;  1Q4B A;  2COL B;  3ZUL A;  2FJU B;  4W6O A;  4Q7T A;  5DTY A;  1Q73 A;  1UUS A;  3S05 A;  3F45 A;  2P6B B;  1SCM C;  2WIS A;  2LVV A;  1PK0 D;  2GV5 A;  4IK5 A;  2B1U A;  1CFP A;  5KU1 A;  4EMQ A;  2P4M A;  5FHV A;  4OV2 A;  2G16 B;  1A2X A;  5BPJ A;  1WDC B;  4KAG A;  1LA0 A;  5DPJ A;  2FWQ A;  2LHL A;  2M1U A;  3OGO A;  4Q7R A;  2B3Q A;  2ZN9 A;  3SJS A;  4CPV A;  1W7U A;  2AWL A;  2MA2 A;  2H2K A;  3SIA A;  2L5X B;  4HQ8 A;  4LQT A;  4BDU A;  3O77 A;  3EKJ A;  4KGE A;  3OSQ A;  4JGE A;  2K7B A;  4WQ3 A;  4DS7 A;  3SSK A;  3VRR A;  5DY6 A;  2VVI A;  3CZT X;  3TMR A;  2WHU A;  1CFF A;  2GX2 A;  2OTG C;  3FS7 A;  2DDD A;  3CR4 X;  2JTT A;  1YUT A;  4H3L A;  2GW4 B;  1XK4 A;  4GGF C;  1XFY O;  2HFC A;  1XAE A;  3CTN A;  1TNP A;  4R6D A;  1DJI A;  1IG5 A;  1ZOT B;  1ODB A;  4PPJ A;  2E6W A;  3DQA A;  3DPW A;  3IR8 A;  3D0Y A;  4KF5 A;  2G2B A;  3BYA A;  1BG1 A;  3EVR A;  3U8P A;  1FBV A;  4ZF3 A;  1GJY A;  4OY4 A;  2K61 A;  3GOF A;  1OSA A;  1AUI B;  4AQJ A;  3EVP A;  1YJF A;  1EMA A;  2TN4 A;  2OTG B;  2H9W A;  4EDO A;  1KK8 C;  4PE7 A;  3CR5 X;  3DVM A;  3WLD A;  4J88 A;  5HGE A;  1J7R A;  2Q4U A;  4PPL A;  4W76 A;  3A4U B;  3VRP A;  5I8N A;  2ZMU A;  1RWY A;  1C7W A;  3LA1 A;  5EXC I;  1EME A;  2AUC A;  3BXB A;  3CS1 A;  2DUH A;  1JUO A;  1SL8 A;  3SS0 A;  4L1I A;  1NWD A;  3WHU B;  1IJ5 A;  1W7J B;  2LMT A;  1BOD A;  3MGF A;  4HQC A;  4PHN A;  1Z1Q A;  4HE4 A;  4DXI A;  3CD1 A;  2K7O A;  4XL5 A;  1F09 A;  4ZIO A;  4DCK A;  2BL0 C;  4E68 A;  2LAN A;  5BT0 A;  1EMB A;  1KK8 B;  2KGR A;  1YHH A;  4YI8 A;  3KCS A;  2L98 A;  2G3O A;  3C1V A;  3SVC A;  1S5G Y;  4IK3 A;  5BTT B;  2A4J A;  4H48 A;  2QRF A;  3VHT B;  3ICB A;  2GW3 A;  3I5I C;  1F0B A;  4MRX A;  2AWK A;  4EDS A;  3VIC A;  1JC0 A;  4DUQ A;  4L13 A;  1H6R A;  3DPZ A;  3D10 A;  1FI5 A;  2BL0 B;  2JOJ A;  2FCD A;  3U8A A;  1LIN A;  1SBJ A;  1AHR A;  4IK9 A;  4R1E A;  1MQ1 A;  1S26 D;  2GGZ A;  5ER4 X;  3DQ6 A;  1YUR A;  4W6C A;  5FVG A;  2KYF A;  2K7D A;  1LVC D;  4XVP A;  1CKK A;  1Q4D A;  5HLO A;  1XYD A;  1QAT A;  3I5I B;  1IGV A;  1Y0V H;  4AS8 A;  1GGW A;  3ED8 A;  1JSA A;  1XK4 C;  2KBM A;  4GBA A;  2I18 A;  5DTZ A;  4DKM A;  3SV5 A;  1J55 A;  4I5J A;  4JF9 A;  3NXA A;  2JWW A;  5H87 A;  5HZU A;  1QS7 A;  5CSJ A;  1PVB A;  4FTG A;  1CDL A;  3ZUJ A;  2JAD A;  4W6U A;  1W7I B;  1CDP A;  3GK2 A;  1F70 A;  2HJO A;  4KF5 C;  5HW9 A;  1SL9 A;  2PXS A;  2G6E A;  1OZS A;  1S6I A;  2HPS A;  2KGB C;  2VVJ A;  3SIB A;  2LLU A;  3LK1 A;  1EML A;  2IB5 A;  1TCF A;  1UHH A;  2MBX A;  3SVE A;  3RM1 A;  1CNP A;  1ZGQ A;  2G6X A;  4N3D A;  4W6A A;  4W6J A;  2BE6 A;  1YFP A;  2WUR A;  1QLK A;  4W6T A;  2KAX A;  2QLG A;  1K9K A;  4W77 A;  1B8R A;  2MHH A;  3KEV A;  1J7Q A;  2YFP A;  1RK9 A;  4KF4 A;  4W6H A;  3BXC A;  1JC1 A;  2DD9 A;  4W69 A;  2Y1M A;  1WLZ A;  3TDI A;  4LJD A;  3VK1 A;  1NP8 A;  1YRT B;  4PFE A;  2KFG A;  2F3Z A;  1KK7 Z;  1XSS A;  2EGD A;  3NED A;  3DQD A;  3LVC A;  4ORC B;  3E5T A;  4ICB A;  2I2R E;  2YDZ A;  1IKU A;  1PRW A;  2WCF A;  1RMM A;  3IF7 A;  1UUR A;  2AWM A;  3BUN B;  2H5R A;  1QXT A;  1RTP 1;  1XFU O;  3NEZ A;  2I94 A;  2ZFD A;  2DD7 A;  1IJ6 A;  5DU0 A;  5EXU A;  2A46 A;  2L4H A;  4YRU A;  1LXF C;  3AAJ A;  1M39 A;  5AER A;  1EMC A;  1LA3 A;  2H8Q A;  3DQM A;  2IOV A;  1UWO A;  4P76 A;  1G4Y R;  3DVE A;  2DUE A;  1YHI A;  3EVU A;  2JZI A;  4LJC A;  2L4I A;  2M7L A;  1IQ5 A;  2QT2 A;  2L51 A;  3CFH A;  3TS5 C;  1IH0 A;  4CLN A;  1NPQ A;  4IK4 A;  3SSH A;  4Q04 A;  2H5O A;  4W6K A;  2JT0 A;  1JWD A;  2CNP A;  1CLB A;  2AH8 A;  5LTP A;  1H4U A;  1HQV A;  1F4Q A;  3U0N A;  4AQI A;  3SG4 A;  5HZO A;  2VAD A;  2HQW A;  2A47 A;  2LMV A;  1RRX A;  2OTE A;  5HZS A;  3U0L A;  1ZUZ A;  3WCK A;  2JT3 A;  4OGS A;  2F3Y A;  3UFZ A;  1QAS A;  1N65 A;  1X02 A;  3DQ3 A;  3TS5 B;  1J1D A;  3U0K A;  2WOS A;  2V4E A;  3AI4 A;  1EG3 A;  3DVJ A;  4HRE E;  3DQ4 A;  3DQH A;  3SST A;  4NQG A;  2LVI A;  3DF0 A;  1D1O A;  3PLF B;  2O29 A;  2VZX A;  2KDH A;  4TZA A;  2OJK A;  4PHM A;  3EKH A;  4W6M A;  2KYC A;  3HX4 A;  4PE0 A;  4HVF A;  5EJU A;  5LTQ A;  2FCE A;  3ZNI A;  1JBA A;  4YGC B;  2ZMW A;  3LF4 B;  1YTZ C;  1U5I B;  4MN0 A;  4PE4 A;  4QJ3 B;  3DQO A;  1UHN A;  1MHO A;  4P5O E;  3M22 A;  3E3R A;  2LVK A;  1F54 A;  1WRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...