3EKJA

Calcium-free gcamp2 (calcium binding deficient mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
301
Chain Sequence
b'LENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGGITTKQLGTVMRSLGQNPTEAELQDMINEVGGTIDFPQFLTMMARKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 78
structure length 301
sequence length 318
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekjA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekjA01
1JC0A 2WNDA 3CD1A 2JTTA 2JT3A 2D8NA 5EHUA 2OJKA 1IQ5A 4JFGA 3PN7C 4W74A 2K2FA 1NCXA 3IP2A 2MLEC 2EMOA 5HLOA 3GB3A 2ARLA 2ZO7A 2JXCA 1DJYA 1H4BA 2M97A 1SR6B 2BKIB 1YZWA 2QLGB 5EXCI 5DTLA 4OJ0A 2A48A 4LW5A 4RYSA 1WY9A 3ST3A 1M31A 3LVAA 1B9AA 2K7OA 3GEXA 2K0JA 1TRFA 2COLB 2K61A 4AOMA 1KK8B 4M2PA 3SG2A 4IK3A 4PCWA 1B4CA 2OTBA 1F8HA 4EMQA 1SY9A 2HRSA 1FI5A 4W6OA 1J1DA 4TNCA 4ICBA 2AMIA 1OMDA 3TMRA 4YI9A 2AWMA 4W7AA 1V1FA 3KF9A 5DKRA 1MF8B 5EBJA 4KEXA 2LLSA 2G2BA 2V4EA 2GGMA 5AXIA 2FCEA 3DQJA 2KGRA 1SBJA 3TMTA 2LV7A 1KQVA 4ZINA 4MSPA 1Y0VH 2Z6ZA 4DKMA 3TDIA 1QTXA 3MSEB 3AI5A 3CFHA 4W6MA 2Q57A 3CR5X 3C1VA 1CFPA 2VADA 2M7NA 5KU1A 3RLZA 1CLBA 2KAXA 2G2SB 1CTRA 2JC2A 3TS5B 1CFFA 3W1CA 3CFFA 1AHRA 4U2VA 3U0LA 1XA9A 2CTNA 2AWLA 2QPTA 1K95A 3EVVA 1F4OA 1QIVA 2WCBA 3H4SE 3OB1B 1SCMC 2KI6D 3SVBA 5AQBB 1YX8A 2QLIA 3VICA 3D0YB 3DVEA 1TNXA 3LA1A 3EK4A 4PALA 5FVFA 1QASA 2Y1NA 1QATA 3EVUA 5EJUA 3K1KA 2PSRA 4MRXA 4M2OA 1CMGA 1RM9A 4PE1A 4D1EA 5HKYA 3TZ1A 3SSPA 1BODA 2A47A 5DKNA 4H47A 5EB7A 2VVJA 1W7TA 5HGEA 2YDZA 1K96A 2H61C 1AUIB 2GV5A 1QYFA 2LC5A 2HQKA 3PJ5A 1JWDA 1PVBA 4W6NA 2O5GA 3WNXB 2JT8A 2K8MB 3DQNA 2ZRTA 5J2OA 3DQIA 1YHGA 4EULA 2K7CA 3BUXB 2H5RA 4W6SA 1YHHA 1XK4C 1KCYA 2JWWA 3SV5A 3SSHA 1QIWA 1CFCA 1B7TY 3DD4A 3CLNA 1UHIA 3SIAA 1SR6C 3CGAA 4ORCB 2IB6A 4N3DA 4KAGA 3E3RA 3DQ7A 2AHAA 4PE4A 4RTCA 1K9KA 1YVLA 4EDOA 4LJCA 1XA5A 2ZMWA 2B3PA 4ZF5A 1EXRA 3DQFA 2O60A 4QJ3B 2MBXA 5HW9A 1F09A 2JPTA 2Y4QA 3I5HB 1SPYA 4FQOA 1KQMC 4MEWA 2DUHA 4BDUA 3LS3A 2WSOA 5FHVA 4W6BA 1KK8C 1OE9B 3LF3A 2KAVA 5HBDA 1VRKA 1WDCC 3V3DA 3F45A 1RMPA 2Z6YA 1TCOB 1NUBA 4WQ3A 4W7EA 1QXTA 2KGBC 1Z1QA 3NXAA 2VRGA 2L2EA 3JVTB 3SVUA 1RFJA 3SIBA 4KW9A 3DVMA 1DGVA 2AUCA 5KSZA 2H6VA 1NCYA 4UTSA 2TN4A 4A4BA 1F55A 3IR8A 1HUYA 4P1QA 3DQ1A 3DQ3A 1ZGPA 4OR9B 3PALA 3BYAA 4HQCA 4NDBA 3SVOA 1ALVA 4W6FA 3BOWA 3CWGA 2Z6XA 5D69A 3JTDC 3DQKA 3DQ5A 3ZWHA 1YUUA 3TUYB 1EMEA 3TS5C 4W6JA 3M22A 4B30A 3DVJA 4KA9A 4MVFA 1D1OA 2MLFC 4W6DA 4OQWA 4W6PA 3CTNA 3DQAA 2G9BA 4I5KA 4KF5C 4IK4A 1TCFA 4YRUA 1YRTB 1J55A 4ZCUA 1QVIZ 5GQQC 1B8RA 3O4YA 2JULA 4OGSA 5CSFA 4J89A 1PALA 2KHNA 2KI4C 3KCSA 4OV2A 2K2AA 1XVJA 4DXPA 2Z1OA 4JWQA 2WISA 5H87A 1C7WA 1S6IA 4YI8A 2LLTA 1Q4AA 3NT9A 2ZMUA 1TNWA 1KK7Y 3SRYA 1QX7A 2WHSA 3U0MA 3ZUJA 1K9UA 4W7XA 2PRUA 3ADFA 4GGFC 4HE4A 1YURA 4HREE 2AWJA 4W6IA 2LMVA 1CKKA 1J7QA 3CR4X 3ZUFA 3RWAA 5EXBA 2QACA 5DPIA 4LQTA 2VZXA 4W7FA 2BBMA 1OXDA 1RROA 3AAKA 4IZNA 5CSNA 1TN4A 1IRJA 1EG4A 1YFPA 5DTYA 3BUMB 5AANA 1HCJA 2HGDA 1RWYA 2KOTA 2V53A 1EMAA 4R6BA 5CSJA 4AQJA 4Q7UA 4KW4A 2IOVA 2G3DB 4W6UA 2Q6PA 3AI4A 3OSRA 5JOLA 5LK4A 1EMBA 4H48A 3FS7A 4MZLA 2BE6A 3AKOA 4OHSA 2MAZA 5HYDA 1ZGOA 2A53B 2BCBA 2BCXA 3E5WA 1XO5A 2A4JA 4Q7TA 1B47A 3NSOA 2NZ0A 1KYRA 1RJVA 2LVJA 4E68A 1G8IA 2R2IA 3SSVA 4HSZA 3IF7A 3OP0A 1LA0A 2NCPA 1BR4B 2G16B 1Q4EA 3H1RA 1KSOA 2HFCA 1TOPA 2M8UA 1CMFA 1TIZA 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 3I5IB 1MYWA 1OSAA 4ANJA 3M0WA 2POXA 1YX7A 1EG3A 1K8UA 3FWCA 3DQCA 3AKBA 1NX1A 2YE0A 1EL4A 1Y1AA 2FCDA 2HF5A 4QJ4B 4BY4A 2AWKA 2V4EB 2H61A 3JVTC 1QLSA 4CFQA 1Z1PA 1M39A 3I5GC 1UHHA 3LL8B 2E30A 3BX9A 1DJZA 1A75A 2NCOA 2P4MA 4C0LA 4MRYA 4KW8A 1OMRA 1K2HA 4Q04A 1DTLA 1UUSA 4W6HA 4HVFA 5AERA 1XK4A 3EVRA 3WLCA 3TUYC 4IK5A 2DD7A 1YR5A 1RK9A 2JQ6A 2DDCA 1QYOA 1MOVA 1WRZA 4IL1A 2HQWA 2VVHA 1LA3A 1OMVA 3RWTA 3SG3A 2GW4B 1HQVA 2WSNA 4LJDC 4J8AA 4DXNA 1M63B 1PK0D 4J88A 1RMMA 2QU1A 3E5TA 4YGAA 2JT0A 2GGZA 1IH0A 2L5XB 1BJFA 4ZCVA 2L0PA 2BCAA 1Q4DA 5F6TA 1U5IA 1SL8A 1R6PA 4L1IA 3WXAA 4WQ2A 1CM4A 2HCGA 1NSHA 2DUIA 1QJTA 1FF1A 1KFUS 1NX0A 2WURA 1K93D 1QX2A 2EC6B 3WLDA 3A8SA 1NWDA 2EMNA 1YJFA 1NYAA 2MJWB 2G3OA 1XFYO 3DVKA 2JU0A 3ST0A 3SSLA 4NDDA 4W6AA 1C4FA 2M1KB 3DQLA 1CDLA 1UHNA 3KEVA 2OTGB 3DPZA 1BU3A 4DXOA 2A46A 1S36A 2G5ZB 1EJ3A 2A56B 2BBNA 2OGRA 1NPQA 3GK1A 4PPKA 2ZFDA 1YVHA 3O2PA 2YE1A 2ZN8A 1WRKA 3EKJA 1G4YR 3DQOA 1CDPA 2FOTA 3MGFA 4GF6B 2ZNEA 2ISDA 3VRNA 4PFEA 2KNEA 2RH7A 4PE7A 1S26D 2L4IA 5H89A 2M29A 1OZSA 2G6YA 2EHBA 4GUKA 1F54A 1B9CA 4KF5A 2PVBA 4OVNF 4I5NB 3LK0A 1ZGQA 1F70A 1XYDA 2KAYA 5DTXA 1MOUA 1MWNA 5HZUA 1ZMZA 4JEOA 1R2UA 4W6LA 2WHTA 2JXLA 1QYQA 3SS0A 3SG5A 5HZOA 1PULA 2H2KA 5DQMA 1GFLA 3BUNB 2BL0B 3NSLA 3GK4X 4PHKA 4GGFA 4ZF3A 4TZGA 2Q91A 2EGDA 5B8IB 4Z4MA 4AS8A 2O29A 3ZTFA 2DD9A 3U0NA 4W76A 3A4UB 5DRFA 4KF4A 3A8RA 3E5VA 4C0JA 2Y1MA 2H9WA 3ED8A 1L2OB 3NSKA 2F8PA 4P5OE 2FZUA 4GNKB 1CFDA 4Q9WA 3SVNA 1EMLA 2LNKA 4GFTA 5BTTB 4AQIA 1DF0A 1XAEA 3LVCA 2KQ6A 1J7OA 1RMOA 4USLA 4GOBA 1XSSA 2L98A 2JOJA 1MXLC 3CBEA 2L50A 2O24A 5D7FA 1ZUXA 3BOWB 1BLQA 3DF0A 1IG5A 1QLKA 1XFXO 2H5QA 3SVDA 4TZAA 3EK8A 4W6TA 5I2OA 1JFKA 1S5GZ 4ETOA 3OGOA 3UG0A 2DUFA 3BUOB 1SKTA 2M7LA 3CFAA 1NCZA 1WRLA 1FI6A 2EMDA 1E8AA 1XFVO 1KP5A 2M9GA 1LVCD 4UPGA 2YFPA 1SL7A 1S5GY 3I5FB 2E6WA 3ZNIA 3TDZA 3VRQA 1OXFA 2WC8A 3OB2B 4NWSA 5DRGA 1OOJA 4MLWA 3DQMA 4JRBA 2B3QA 2JTZA 2CCMA 2F3ZA 1H6RA 3KCTA 3DQHA 5HZSA 3GK2A 3CGLA 3SSYA 1SYMA 4W6CA 4Z4KA 1BR1B 3SVCA 4XOVA 1KWOB 3CB9A 4W6RA 3BXKA 2IB5A 1G7KA 5IBWA 1QV1A 3SVRA 3LLEA 2A54B 1GL4A 2Y0GA 4AR7A 2EC6C 4KGFA 4ZFSA 2GX2A 2KYFA 2ZNDA 2CNPA 1C7VA 5T3IA 4R6DA 1CNPA 1A4PA 1QVIY 4F0ZB 4GAOA 1RECA 3D10A 1M45A 2KI6C 1XQMA 3EKHA 4YBHB 1S1EA 2LVKA 2WORA 2FJUB 1A03A 1V1GA 1L7ZA 2LP3A 2C9IA 2JADA 1OXEA 5I8NA 4FTGA 3ZULA 2LVVA 5DU0A 4DUQA 1KFXL 1N65A 4XOWA 2F3YA 1WLMA 4U8DA 1SCMB 3VHTA 3S05A 1X02A 1NP8A 4PE0A 4LJDA 5FYXA 2B1UA 2HQZA 4LJBA 4XJKB 2ICRA 2I18A 5KTYA 2QLEA 2M0RA 3DQ8A 4DXIA 4W6KA 2M1UA 4P76A 1S6CA 1SK6D 1ZOTB 2LUCA 1PVAA 4BY5A 3ICBA 4JQ0D 5LTRA 4PPLA 5EXUA 1Y6WA 3U0KA 4PHJA 4L9MA 1B8LA 2JNFA 1W7SA 5DY6A 1OQPA 2BL0C 2OKYA 4XVPA 4GBAA 4PHMA 2C9JA 1S6JA 2PALA 4GGNA 2KBIA 1L2OC 1KSMA 1GJYA 1YTZC 2JNXA 1IGVA 4JGEA 1BMOA 2OTEA 4KGEA 3BXCA 5BQLA 3CS1A 3I5HC 3EVPA 1CLMA 2LLUA 3AAJA 4ORNA 1DJWA 2Q4UA 2LANA 1AJ4A 3O78A 1A29A 3DQEA 1LXFC 1NIWA 1XFUO 4DXMA 1AP4A 2DUEA 1UURA 2OPOA 2BECA 1NX2A 4DRWA 2L51A 3VK1A 1DJGA 1JF2A 1XFZO 2KSPA 1ALWA 5CPVA 1TNPA 4ZB1A 4L13A 2MHHA 1QX5B 3SG7A 3VROA 3WHTB 3SG4A 3KHEA 1A2XA 2KYCA 1IJ5A 2QT2A 2HJOA 1K9PA 1RTP1 2I94A 3NF0A 3SSKA 3NEZA 1OZOA 1GQMA 3I5FC 1G33A 3DQDA 1S6ZA 1Y1XA 2K7BA 4ZBLA 2LMTA 1KQMB 4OY4A 4CPVA 4YGEB 1U5IB 1AVSA 4OKHA 2LUXA 1WDCB 3NSIA 1N0YA 1UWOA 3G9AA 4EN1A 2DOQA 3PIBA 2I7AA 1EMMA 2KQYA 2QLGA 1KWOC 4ORBB 1JBYA 2FL1A 2ZRSA 3U8CA 2G6XA 3PJBA 4W72A 5I2QA 1SL9A 2H5OA 1TTXA 3H1OA 4JPZB 4DKNA 1SCVA 5HLVA 3IQQA 1JUOA 1DGUA 2H8QA 1F4QA 1UHKA 1BOCA 5DPJA 1SMGA 1DJXA 2KFHA 5BPJA 1J7RA 4JC2A 3KO0A 1YJ2A 1J7PA 3JTDB 1KFXS 4H3MA 4YGDB 3SSTA 2AAOA 1DJHA 2JRFA 2LHIA 1JC2A 2G6EA 2BTJA 3LF4B 4YGCB 4MBEA 3PFVA 2ZO6A 1EMCA 2K7DA 4MZKA 1EMFA 4GPLB 4B5YA 4W7CA 2F2OA 5CSIA 4P2YB 3LVDA 2H5PA 4W73A 3UFZA 5H88A 2VVIA 2I2RE 1ZACA 5LTPA 4N5XA 5JJGA 4Q9XA 4PPJA 2LVIA 5DPHA 2KBMA 2MRDA 2QZ0A 2KI4B 2QLHA 2ZKMX 2A52B 3TDUA 1DJIA 2CT9A 2AH8A 2M49B 3RM1A 4W69A 4QJ5B 4W77A 4C0KA 3GJ1A 1UISA 3PJ7A 2BE4A 3LSAA 1M46A 5AEQA 3P8UA 4DIRA 2OS8B 2MA2A 3DQ9A 5DPGA 3IQOA 1IQ3A 1CB1A 1N2DA 3NEDA 5HKZA 1JC1A 2PXSA 2WHUA 2WCEA 2WCFA 2DDDA 3HX4A 3DQ2A 5PALA 1EMKA 4IK8A 4ZF4A 1Y1UA 2KDHA 3D0YA 3WHUB 2KFGA 4PHNA 1MR8A 1DF0B 3QRXA 1JSAA 2JZIA 2GW3A 2Y5IA 1AJ5A 4HRGA 3GOFA 1IKUA 3I5IC 1CV7A 1HT9A 1W7IB 3DF0B 4Q7RA 1B7TZ 2FWQA 2L4HA 4NQGA 1H4UA 1DT7B 1QY3A 3SJSA 3HCMA 2LAPA 2F2PA 5TNCA 4N1FA 4I5LB 4MN0A 4HQ9A 2V4EC 1Q4CA 5G08A 2NLNA 4I5JA 4JF9A 1QXPA 2SASA 3KPXA 3DQUA 3CD9A 1K94A 3PLFB 4ZIOA 2WIQA 1Q4BA 4KPIA 2ZN9A 1YRUB 2CBLA 3PN7B 1EMGA 1S3PA 2LM5A 4RYWA 1TNQA 3O6BA 2PXWA 4HRHA 4B30B 1GGXA 1GGWA 1JBAA 1IJ6A 3I19A 1FW4A 2LE9B 3P28A 3VRPA 3OSQA 5DKQA 1QV0A 1EH2A 5DQBA 2GX0A 3EK7A 1YUSA 5KTGA 3LK1A 5LTQA 3OHMB 1F0BA 4H3LA 3OX5A 5J3XA 1WLZA 4CIDA 3PSRA 1H8BA 1ZFSA 2F33A 5EB6A 3NT3A 5K89A 3I5GB 2HQ8A 5BTTA 5AFPA 2WOSA 4M2QA 3BXAA 1JF0A 2NXQA 3O77A 1Q80A 5ER4X 4DCKA 1SW8A 4PDZA 1MUXA 2HETA 3SVEA 1NX3A 4DS7A 4R1EA 1W7UA 4W7DA 4NDCA 2PMYA 1C07A 1BT6A 3BXBA 2M3WA 1YHIA 2KFFA 5FVIA 3K21A 1YUTA 5ER5A 1AK8A 2P6BB 5HZTA 5DTZA 4IK1A 4XGYA 4W6GA 1F71A 3VHTB 3OX6A 1JFJA 3DQ6A 4DXQA 1CDMA 1BF5A 3LCPC 4IK9A 1XMZA 2OTGC 1KYSA 2A50B 1PRWA 1KK7Z 4ORAB 3DQ4A 3CZTX 2HPSA 3ST4A 3PATA 1UHJA 4MZJA 1UP5A 3BQ3A 3FWBA 2RGIA 1ZUZA 4XL5A 1B1GA 1RRXA 3BUWB 3U8PA 1KYPA 1LINA 1SRAA 2HGYA 1QS7A 2OS8C 2HPWA 2VAEA 1BFPA 4L12A 4I2YA 2LHLA 4W75A 2LMUA 3CR2A 4LQUA 1Q73A 4N1GA 3WCKA 2BKHB 1LKJA 3DPXA 1MHOA 3U8AA 5HKWA 1KFUL 2IE2A 4A4CA 1CM1A 1PSBA 2DUGA 4XYNA 1IWQA 2SCPA 1MXEA 3GJ2A 4H3NA 3SG6A 1FPWA 4EDSA 1W7JB 1B8CA 2LCPA 2CXJA 1ODBA 4WRIA 2OKWA 3AKAA 1SNLA 5F9GA 1BG1A 1CDNA 1JBZA 2PASA 4GESB 3GL4A 4CLNA 3DPWA 3M24A 4YGBB 1FBVA 3W1DA 4CFRA 1GGZA 1XFWO 1CLLA 1MQ1A 4W7RA 1J1EA 3PM8A 3VRRA 5BT0A 2QRFA 1PSRA 5FVGA 5I2LA 3FIAA 3SVSA 2O2BA 1DMOA 1A75B 4HQ8A 1K90D 3ST2A 4XJKA
chains in the Genus database with same CATH superfamily
1JC0A 2WNDA 3CD1A 2JTTA 2JT3A 2D8NA 5EHUA 2OJKA 1IQ5A 3R1VA 4JFGA 3PN7C 4W74A 2K2FA 1NCXA 3IP2A 2MLEC 2EMOA 5HLOA 3GB3A 2ARLA 2ZO7A 2JXCA 1DJYA 1W9ZA 1H4BA 2M97A 1SR6B 2BKIB 1YZWA 2QLGB 5FI2A 5EXCI 5DTLA 4OJ0A 2A48A 4LW5A 4RYSA 3SS5A 1WY9A 3ST3A 1M31A 3LVAA 1B9AA 2K7OA 3GEXA 5HL1A 2K0JA 1TRFA 2COLB 2K61A 4AOMA 1KK8B 4M2PA 3SG2A 4IK3A 4PCWA 3EG5B 1B4CA 2OTBA 1F8HA 4EMQA 1SY9A 2HRSA 1FI5A 4W6OA 1J1DA 4TNCA 4ICBA 2AMIA 1OMDA 2FJYA 3TMRA 4YI9A 2AWMA 4W7AA 1V1FA 3KF9A 5DKRA 1MF8B 5EBJA 4KEXA 2LLSA 3OGNA 2G2BA 2V4EA 2GGMA 5AXIA 2FCEA 3DQJA 2KGRA 1SBJA 1OW4A 3TMTA 2LV7A 1KQVA 4ZINA 4MSPA 1Y0VH 2Z6ZA 4DKMA 3TDIA 1QTXA 3MSEB 3AI5A 3CFHA 4W6MA 2Q57A 3CR5X 3C1VA 1CFPA 2VADA 2M7NA 5KU1A 3RLZA 1CLBA 2KAXA 2G2SB 1CTRA 2JC2A 3TS5B 1CFFA 3W1CA 3CFFA 1AHRA 4U2VA 3U0LA 1XA9A 2WCLA 2CTNA 3B88A 2AWLA 2QPTA 1K95A 3EVVA 1F4OA 4INXA 1QIVA 2WCBA 3CZ2A 3IVTA 3H4SE 3OB1B 1SCMC 2KI6D 3SVBA 5AQBB 1YX8A 2QLIA 3VICA 3D0YB 3DVEA 1TNXA 4KYNA 3PJIA 3LA1A 2WCKA 3EK4A 4PALA 5FVFA 1QASA 2Y1NA 1QATA 3EVUA 5EJUA 3K1KA 2PSRA 4MRXA 4M2OA 1CMGA 1RM9A 3S0GA 4PE1A 2JPOA 4D1EA 5HKYA 3TZ1A 3SSPA 1BODA 2A47A 5DKNA 4H47A 5EB7A 2VVJA 1W7TA 5HGEA 2YDZA 1K96A 2H61C 1AUIB 2GV5A 1QYFA 2LC5A 2HQKA 3PJ5A 1JWDA 1PVBA 4W6NA 2O5GA 3WNXB 2JT8A 2K8MB 3DQNA 2ZRTA 5J2OA 3DQIA 1YHGA 4EULA 3D76A 2K7CA 3BUXB 2H5RA 4W6SA 1YHHA 1XK4C 1KCYA 2JWWA 3SV5A 3SSHA 1QIWA 1CFCA 1B7TY 3DD4A 3CLNA 1UHIA 3SIAA 1SR6C 3CGAA 3DXLA 4ORCB 1DQEA 1DEKA 1OOIX 2IB6A 4N3DA 4KAGA 3E3RA 3DQ7A 2AHAA 4PE4A 4RTCA 1K9KA 1YVLA 4EDOA 3UO9A 4LJCA 1XA5A 2ZMWA 2B3PA 4ZF5A 1EXRA 3DQFA 2O60A 4QJ3B 2MBXA 5HW9A 1F09A 2JPTA 2Y4QA 3I5HB 1SPYA 4FQOA 1KQMC 4MEWA 2DUHA 4BDUA 3LS3A 2WSOA 5FHVA 4W6BA 1KK8C 1OE9B 3LF3A 2KAVA 5HBDA 1VRKA 1WDCC 5I94A 3V3DA 3F45A 3D78A 1RMPA 2Z6YA 1TCOB 1NUBA 3QMEA 4WQ3A 4W7EA 1QXTA 2KGBC 1Z1QA 3NXAA 2VRGA 3FE6A 2L2EA 3JVTB 3SVUA 1RFJA 3S0BA 3SIBA 4KW9A 3DVMA 1DGVA 2AUCA 5KSZA 2H6VA 1NCYA 4UTSA 2TN4A 4A4BA 1F55A 3IR8A 1HUYA 3B87A 4P1QA 3DQ1A 3DQ3A 1ZGPA 1SSEB 4OR9B 3PALA 1C3ZA 3BYAA 4HQCA 4NDBA 3SVOA 1ALVA 4W6FA 3BOWA 3CWGA 2Z6XA 5D69A 3JTDC 3DQKA 3DQ5A 3ZWHA 1YUUA 3TUYB 1EMEA 3TS5C 4W6JA 3M22A 4B30A 3DVJA 4KA9A 4MVFA 1D1OA 2MLFC 4W6DA 4OQWA 4W6PA 3CTNA 3DQAA 2G9BA 4I5KA 4IJ7A 4KF5C 4IK4A 1TCFA 4YRUA 1YRTB 2QEBA 1J55A 4ZCUA 1QVIZ 5GQQC 1B8RA 3O4YA 2JULA 4OGSA 5CSFA 4J89A 1PALA 2KHNA 2KI4C 3KCSA 4OV2A 2K2AA 1XVJA 4DXPA 2Z1OA 4JWQA 2WISA 5H87A 1C7WA 1S6IA 4YI8A 2LLTA 1Q4AA 3NT9A 2ZMUA 1TNWA 1KK7Y 3SRYA 1QX7A 2WHSA 3U0MA 3ZUJA 1K9UA 4W7XA 2PRUA 3FE8A 3K1EA 3ADFA 4GGFC 4F7FA 3D75A 4HE4A 1YURA 4HREE 2AWJA 4W6IA 2LMVA 1CKKA 1J7QA 2K60A 3CR4X 3RWAA 3ZUFA 5EXBA 2QACA 5DPIA 4LQTA 2VZXA 4W7FA 2BBMA 1OXDA 1RROA 3AAKA 4IZNA 5CSNA 1TN4A 1IRJA 1EG4A 1YFPA 5DTYA 3NHIA 3BUMB 5AANA 1HCJA 2HGDA 1RWYA 2KOTA 2V53A 1EMAA 4R6BA 5CSJA 4AQJA 4Q7UA 4INWA 4KW4A 2IOVA 2G3DB 4W6UA 2Q6PA 3AI4A 3OSRA 5JOLA 5LK4A 1EMBA 4H48A 2YGUA 3FS7A 4MZLA 2BE6A 3AKOA 4OHSA 2MAZA 5HYDA 1ZGOA 2A53B 2BCXA 2BCBA 3E5WA 1XO5A 2A4JA 4Q7TA 1B47A 3NSOA 2NZ0A 1KYRA 1RJVA 2LVJA 4E68A 1G8IA 2R2IA 3SSVA 4HSZA 3IF7A 3OP0A 1LA0A 2NCPA 1BR4B 2G16B 1Q4EA 3H1RA 1KSOA 2HFCA 1TOPA 2M8UA 1CMFA 1TIZA 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 3I5IB 1MYWA 1OSAA 4ANJA 3M0WA 2POXA 3L47A 1YX7A 1EG3A 1K8UA 3FWCA 3DQCA 3AKBA 1NX1A 2BNXA 2YE0A 1EL4A 1Y1AA 2FCDA 2HF5A 4QJ4B 2GTEA 4BY4A 2AWKA 2V4EB 2H61A 3JVTC 3S0FA 1QLSA 4CFQA 1Z1PA 1M39A 2QEHA 3I5GC 1UHHA 3LL8B 2E30A 3BX9A 1DJZA 1A75A 2NCOA 2P4MA 4OZDA 4C0LA 4MRYA 4KW8A 1OMRA 1K2HA 4Q04A 1DTLA 1UUSA 4W6HA 4HVFA 5AERA 1XK4A 3EVRA 3WLCA 3TUYC 4IK5A 3NHTA 2DD7A 1YR5A 1RK9A 2JQ6A 2DDCA 1QYOA 1MOVA 1WRZA 4IL1A 1DC1A 2HQWA 2VVHA 1LA3A 1OMVA 3RWTA 3SG3A 2GW4B 1HQVA 2WSNA 4LJDC 4J8AA 3CZ0A 4DXNA 1M63B 1PK0D 4J88A 1RMMA 3Q8IA 2QU1A 1QWVA 3SS4A 2KPHA 3E5TA 4YGAA 2JT0A 2GGZA 1IH0A 2L5XB 1BJFA 4ZCVA 2L0PA 2BCAA 1Q4DA 5F6TA 1U5IA 1SL8A 1R6PA 4L1IA 3WXAA 4WQ2A 1CM4A 2HCGA 1NSHA 2DUIA 1QJTA 1FF1A 1KFUS 1NX0A 2WURA 1K93D 1QX2A 2EC6B 3WLDA 3A8SA 1NWDA 2EMNA 1YJFA 1NYAA 2MJWB 2G3OA 1XFYO 3DVKA 2JU0A 3ST0A 3SSLA 4NDDA 4W6AA 1C4FA 3R1OA 2M1KB 3DQLA 1CDLA 1UHNA 3KEVA 3CDNA 2OTGB 3DPZA 1BU3A 4DXOA 2A46A 1S36A 2G5ZB 2L5YA 1TWOA 3B7AA 1EJ3A 2A56B 2BBNA 2OGRA 1NPQA 3GK1A 4PPKA 2ZFDA 1YVHA 3O2PA 2YE1A 2ZN8A 1WRKA 3EKJA 1G4YR 3DQOA 1CDPA 1OOFA 2FOTA 3MGFA 4GF6B 2ZNEA 2ISDA 3VRNA 4PFEA 3RZSA 2KNEA 2RH7A 4PE7A 1S26D 3BFBA 3PM2A 2L4IA 5H89A 2M29A 1OZSA 2G6YA 2EHBA 4GUKA 1F54A 1B9CA 4KF5A 2PVBA 4OVNF 3FE9A 4I5NB 3LK0A 1ZGQA 1F70A 1XYDA 2KAYA 5DTXA 1MOUA 1MWNA 5HZUA 1ZMZA 4JEOA 3D74A 1R2UA 4W6LA 2WHTA 2JXLA 3O4XA 1QYQA 3SS0A 3SG5A 2H8VA 5HZOA 1PULA 2H2KA 5DQMA 1GFLA 3BUNB 2BL0B 3NSLA 3GK4X 4PHKA 4GGFA 4ZF3A 4TZGA 2Q91A 2EGDA 5B8IB 3R1PA 4Z4MA 4AS8A 2O29A 3ZTFA 2WC6A 2PYQA 2DD9A 3U0NA 4W76A 3A4UB 5DRFA 4KF4A 3A8RA 3E5VA 4C0JA 2Y1MA 2H9WA 3ED8A 1L2OB 3NSKA 3NGVA 2F8PA 4P5OE 2FZUA 4GNKB 1CFDA 4Q9WA 3SVNA 3BJHA 1EMLA 2LNKA 4GFTA 5BTTB 4AQIA 1DF0A 1XAEA 3LVCA 2KQ6A 1J7OA 1RMOA 4USLA 4GOBA 1XSSA 2L98A 2JOJA 1MXLC 2P70A 3CBEA 2L50A 2O24A 5D7FA 1ZUXA 2ERBA 3BOWB 1BLQA 3DF0A 1IG5A 1QLKA 1XFXO 2H5QA 3SVDA 4TZAA 3EK8A 4W6TA 5I2OA 1JFKA 1S5GZ 4ETOA 3OGOA 3UG0A 2DUFA 1OOHA 3BUOB 1SKTA 2M7LA 3CFAA 1NCZA 1WRLA 1FI6A 2EMDA 1E8AA 1XFVO 1KP5A 2M9GA 1LVCD 4UPGA 2YFPA 1SL7A 1S5GY 3I5FB 2E6WA 3ZNIA 1LS8A 3TDZA 3VRQA 1OXFA 2WC8A 3OB2B 3BFAA 3DYEA 4NWSA 5DRGA 1OOJA 4MLWA 3DQMA 4JRBA 2KLEA 2B3QA 2JTZA 2CCMA 2F3ZA 1H6RA 3KCTA 2WCMA 3DQHA 5HZSA 3GK2A 3CGLA 3SSYA 1SYMA 4W6CA 4Z4KA 1BR1B 3L4AA 3SVCA 4XOVA 1KWOB 3S0AA 3CB9A 4W6RA 3BXKA 2IB5A 1G7KA 5IBWA 1QV1A 3SVRA 3LLEA 2A54B 1GL4A 2Y0GA 4AR7A 2EC6C 4KGFA 4ZFSA 3DY9A 2GX2A 2KYFA 2ZNDA 2CNPA 1C7VA 2WCHA 5T3IA 4R6DA 1CNPA 1A4PA 1QVIY 4F0ZB 4GAOA 1RECA 3D10A 1M45A 2KI6C 1XQMA 3EKHA 4YBHB 1S1EA 2LVKA 2WORA 2FJUB 1A03A 1V1GA 1L7ZA 2LP3A 3B86A 2C9IA 2QEOA 2JADA 1OXEA 5I8NA 4FTGA 3ZULA 2LVVA 5DU0A 3BFHA 4DUQA 1KFXL 1N65A 4XOWA 2F3YA 1WLMA 4U8DA 1SCMB 3VHTA 3S05A 1X02A 1NP8A 4PE0A 4LJDA 5FYXA 1Z4HA 2B1UA 2HQZA 4LJBA 3B6XA 4XJKB 2ICRA 2I18A 5KTYA 2QLEA 2M0RA 3DQ8A 4JKTA 4DXIA 4W6KA 3N7HA 2M1UA 4P76A 1S6CA 1SK6D 1ZOTB 2LUCA 1PVAA 4BY5A 3ICBA 4JQ0D 3OBVA 4PPLA 5LTRA 5EXUA 1Y6WA 3U0KA 4PHJA 4L9MA 1B8LA 2JNFA 1W7SA 5DY6A 1OQPA 2BL0C 2OKYA 4XVPA 4GBAA 4PHMA 2C9JA 1S6JA 2PALA 4GGNA 1IIOA 2KBIA 1L2OC 1KSMA 1GJYA 1YTZC 2JNXA 1IGVA 4JGEA 1BMOA 2OTEA 4KGEA 3BXCA 5BQLA 3L4LA 3CZ1A 3CS1A 3I5HC 3EVPA 1CLMA 2LLUA 3R72A 3AAJA 4ORNA 1DJWA 2Q4UA 2LANA 1DELA 1AJ4A 3O78A 1A29A 3DQEA 1LXFC 1NIWA 1XFUO 4DXMA 1AP4A 2DUEA 1UURA 2OPOA 2BECA 1NX2A 2QEVA 4DRWA 2L51A 3VK1A 1DJGA 1JF2A 1XFZO 2KSPA 1ALWA 5CPVA 1TNPA 4ZB1A 4L13A 2MHHA 1QX5B 3SG7A 3VROA 3WHTB 3SG4A 5FI7A 3KHEA 1A2XA 2KYCA 3UNWA 1IJ5A 2QT2A 2HJOA 1K9PA 1RTP1 2I94A 3NF0A 3SSKA 3NEZA 1OZOA 1GQMA 3I5FC 1G33A 3DQDA 1S6ZA 1Y1XA 2K7BA 4ZBLA 2LMTA 1KQMB 2KLDA 4OY4A 4CPVA 4YGEB 1U5IB 1AVSA 4OKHA 2LUXA 1WDCB 3NSIA 1N0YA 1UWOA 3G9AA 4EN1A 2DOQA 3PIBA 2I7AA 1EMMA 2KQYA 2QLGA 1KWOC 4ORBB 2WC5A 1JBYA 2FL1A 1T14A 2ZRSA 3U8CA 2G6XA 3PJBA 4W72A 5I2QA 1SL9A 2H5OA 1TTXA 3H1OA 4JPZB 2BAPA 4DKNA 1SCVA 5HLVA 3IQQA 1JUOA 1DGUA 2H8QA 1F4QA 1UHKA 1BOCA 1GM0A 5DPJA 1SMGA 1DJXA 2KFHA 2QDIA 5BPJA 1J7RA 3V2LA 4JC2A 3KO0A 1YJ2A 1J7PA 3JTDB 1KFXS 4H3MA 1Z2CB 4YGDB 3SSTA 2AAOA 1DJHA 2JRFA 2LHIA 1JC2A 2G6EA 2BTJA 3LF4B 4YGCB 4MBEA 3PFVA 2ZO6A 1EMCA 2K7DA 4MZKA 1EMFA 4GPLB 4B5YA 4W7CA 2F2OA 5CSIA 4P2YB 3LVDA 2H5PA 4W73A 3UFZA 5H88A 2VVIA 2I2RE 1ZACA 5LTPA 3CYZA 4N5XA 5JJGA 4Q9XA 2P71A 4PPJA 2LVIA 3CABA 5DPHA 2KBMA 2MRDA 2QZ0A 4FQTA 2KI4B 3DZTA 2QLHA 2ZKMX 2A52B 3TDUA 1DJIA 2CT9A 2AH8A 1OOGA 2M49B 4JD9A 3RM1A 4W69A 4QJ5B 4W77A 4C0KA 3GJ1A 1UISA 3PJ7A 2BE4A 3LSAA 1M46A 5AEQA 3S0DA 3P8UA 4DIRA 2OS8B 2MA2A 3DQ9A 4PT1A 5DPGA 3IQOA 1IQ3A 1CB1A 1N2DA 3NEDA 5HKZA 1JC1A 2PXSA 2WHUA 2WCEA 2WCFA 2DDDA 3HX4A 3DQ2A 5PALA 1EMKA 4IK8A 4ZF4A 1Y1UA 2KDHA 3D0YA 3WHUB 3D73A 2KFGA 4PHNA 1MR8A 1DF0B 3QRXA 1JSAA 2JZIA 2GW3A 2Y5IA 1AJ5A 4HRGA 3GOFA 1IKUA 3I5IC 1CV7A 1HT9A 1W7IB 3DF0B 4Q7RA 1B7TZ 2FWQA 3S0EA 2L4HA 4NQGA 1H4UA 1DT7B 1QY3A 3SJSA 3HCMA 2LAPA 2F2PA 5TNCA 4N1FA 4I5LB 4MN0A 4HQ9A 2V4EC 1Q4CA 3SS3A 5G08A 5EL2A 2NLNA 1C3YA 4I5JA 4JF9A 1QXPA 2SASA 3KPXA 3DQUA 3CD9A 1K94A 3PLFB 4ZIOA 2WIQA 1Q4BA 4KPIA 2ZN9A 1YRUB 1XFRA 2CBLA 3PN7B 1EMGA 1S3PA 2LM5A 4RYWA 1TNQA 3O6BA 2PXWA 4HRHA 5FI6A 4B30B 1GGXA 1GGWA 1JBAA 1IJ6A 3I19A 1FW4A 2LE9B 3P28A 3VRPA 3OSQA 5DKQA 1ORGA 1QV0A 2L2CA 1EH2A 5DQBA 2GX0A 3EK7A 1YUSA 5KTGA 3LK1A 5LTQA 3OHMB 1F0BA 4H3LA 3OX5A 5J3XA 1WLZA 4CIDA 3PSRA 1H8BA 1ZFSA 3D77A 2F33A 5EB6A 3NT3A 5K89A 3I5GB 2HQ8A 5BTTA 5AFPA 2WOSA 4M2QA 3BXAA 1JF0A 2NXQA 3O77A 1Q80A 5ER4X 4DCKA 1SW8A 4PDZA 1MUXA 2HETA 3SVEA 1NX3A 4DS7A 4R1EA 1W7UA 4W7DA 4NDCA 2PMYA 1C07A 1BT6A 3BXBA 2M3WA 1YHIA 2KFFA 5FVIA 3K21A 1YUTA 5ER5A 1AK8A 2P6BB 5HZTA 5DTZA 4IK1A 4XGYA 4W6GA 1F71A 3VHTB 3OX6A 2WCJA 1JFJA 3DQ6A 4DXQA 1CDMA 1BF5A 3LCPC 4IK9A 1XMZA 2OTGC 1KYSA 2A50B 1PRWA 1KK7Z 4ORAB 3DQ4A 3CZTX 2HPSA 3ST4A 3PATA 1UHJA 4MZJA 1UP5A 3BQ3A 3FWBA 2RGIA 1ZUZA 4XL5A 1B1GA 1RRXA 3BUWB 3U8PA 1P28A 1KYPA 1LINA 1SRAA 2HGYA 1QS7A 2OS8C 2HPWA 2VAEA 1BFPA 4L12A 4I2YA 3VB1A 2LHLA 4W75A 2LMUA 3CR2A 4LQUA 1Q73A 4N1GA 3WCKA 2BKHB 1LKJA 5DICA 3DPXA 1MHOA 3U8AA 1TUJA 1KFUL 5D3OA 5HKWA 2IE2A 4A4CA 1CM1A 1PSBA 2DUGA 4XYNA 1IWQA 1TUZA 2SCPA 1MXEA 3GJ2A 4H3NA 3SG6A 1FPWA 4EDSA 1W7JB 1B8CA 2LCPA 2CXJA 1ODBA 4WRIA 2OKWA 3AKAA 1SNLA 5F9GA 1BG1A 1CDNA 1JBZA 2PASA 4GESB 3GL4A 4CLNA 3DPWA 3M24A 4YGBB 1FBVA 3W1DA 4CFRA 1GGZA 1XFWO 1CLLA 1MQ1A 4W7RA 1J1EA 3PM8A 3VRRA 5BT0A 2QRFA 1PSRA 5FVGA 5I2LA 3FIAA 3SVSA 2O2BA 2PQLA 1DMOA 1A75B 4HQ8A 1K90D 3ST2A 4XJKA
chains in the Genus database with same CATH topology
1JC0A 2WNDA 3CD1A 2JTTA 2JT3A 2D8NA 5EHUA 2OJKA 1IQ5A 4JFGA 3PN7C 4W74A 2K2FA 1NCXA 3IP2A 2MLEC 2EMOA 5HLOA 3GB3A 2ARLA 2ZO7A 2JXCA 1DJYA 1H4BA 2M97A 1SR6B 2BKIB 1YZWA 2QLGB 5EXCI 5DTLA 4OJ0A 2A48A 4LW5A 4RYSA 1WY9A 3ST3A 1M31A 3LVAA 1B9AA 2K7OA 3GEXA 2K0JA 1TRFA 2COLB 2K61A 4AOMA 1KK8B 4M2PA 3SG2A 4IK3A 4PCWA 1B4CA 2OTBA 1F8HA 4EMQA 1SY9A 2HRSA 1FI5A 4W6OA 1J1DA 4TNCA 4ICBA 2AMIA 1OMDA 3TMRA 4YI9A 2AWMA 4W7AA 1V1FA 3KF9A 5DKRA 1MF8B 5EBJA 4KEXA 2LLSA 2G2BA 2V4EA 2GGMA 5AXIA 2FCEA 3DQJA 2KGRA 1SBJA 3TMTA 2LV7A 1KQVA 4ZINA 4MSPA 1Y0VH 2Z6ZA 4DKMA 3TDIA 1QTXA 3MSEB 3AI5A 3CFHA 4W6MA 2Q57A 3CR5X 3C1VA 1CFPA 2VADA 2M7NA 5KU1A 3RLZA 1CLBA 2KAXA 2G2SB 1CTRA 2JC2A 3TS5B 1CFFA 3W1CA 3CFFA 1AHRA 4U2VA 3U0LA 1XA9A 2CTNA 2AWLA 2QPTA 1K95A 3EVVA 1F4OA 1QIVA 2WCBA 3H4SE 3OB1B 1SCMC 2KI6D 3SVBA 5AQBB 1YX8A 2QLIA 3VICA 3D0YB 3DVEA 1TNXA 3LA1A 3EK4A 4PALA 5FVFA 1QASA 2Y1NA 1QATA 3EVUA 5EJUA 3K1KA 2PSRA 4MRXA 4M2OA 1CMGA 1RM9A 4PE1A 4D1EA 5HKYA 3TZ1A 3SSPA 1BODA 2A47A 5DKNA 4H47A 5EB7A 2VVJA 1W7TA 5HGEA 2YDZA 1K96A 2H61C 1AUIB 2GV5A 1QYFA 2LC5A 2HQKA 3PJ5A 1JWDA 1PVBA 4W6NA 2O5GA 3WNXB 2JT8A 2K8MB 3DQNA 2ZRTA 5J2OA 3DQIA 1YHGA 4EULA 2K7CA 3BUXB 2H5RA 4W6SA 1YHHA 1XK4C 1KCYA 2JWWA 3SV5A 3SSHA 1QIWA 1CFCA 1B7TY 3DD4A 3CLNA 1UHIA 3SIAA 1SR6C 3CGAA 4ORCB 2IB6A 4N3DA 4KAGA 3E3RA 3DQ7A 2AHAA 4PE4A 4RTCA 1K9KA 1YVLA 4EDOA 4LJCA 1XA5A 2ZMWA 2B3PA 4ZF5A 1EXRA 3DQFA 2O60A 4QJ3B 2MBXA 5HW9A 1F09A 2JPTA 2Y4QA 3I5HB 1SPYA 4FQOA 1KQMC 4MEWA 2DUHA 4BDUA 3LS3A 2WSOA 5FHVA 4W6BA 1KK8C 1OE9B 3LF3A 2KAVA 5HBDA 1VRKA 1WDCC 3V3DA 3F45A 1RMPA 2Z6YA 1TCOB 1NUBA 4WQ3A 4W7EA 1QXTA 2KGBC 1Z1QA 3NXAA 2VRGA 2L2EA 3JVTB 3SVUA 1RFJA 3SIBA 4KW9A 3DVMA 1DGVA 2AUCA 5KSZA 2H6VA 1NCYA 4UTSA 2TN4A 4A4BA 1F55A 3IR8A 1HUYA 4P1QA 3DQ1A 3DQ3A 1ZGPA 4OR9B 3PALA 3BYAA 4HQCA 4NDBA 3SVOA 1ALVA 4W6FA 3BOWA 3CWGA 2Z6XA 5D69A 3JTDC 3DQKA 3DQ5A 3ZWHA 1YUUA 3TUYB 1EMEA 3TS5C 4W6JA 3M22A 4B30A 3DVJA 4KA9A 4MVFA 1D1OA 2MLFC 4W6DA 4OQWA 4W6PA 3CTNA 3DQAA 2G9BA 4I5KA 4KF5C 4IK4A 1TCFA 4YRUA 1YRTB 1J55A 4ZCUA 1QVIZ 5GQQC 1B8RA 3O4YA 2JULA 4OGSA 5CSFA 4J89A 1PALA 2KHNA 2KI4C 3KCSA 4OV2A 2K2AA 1XVJA 4DXPA 2Z1OA 4JWQA 2WISA 5H87A 1C7WA 1S6IA 4YI8A 2LLTA 1Q4AA 3NT9A 2ZMUA 1TNWA 1KK7Y 3SRYA 1QX7A 2WHSA 3U0MA 3ZUJA 1K9UA 4W7XA 2PRUA 3ADFA 4GGFC 4HE4A 1YURA 4HREE 2AWJA 4W6IA 2LMVA 1CKKA 1J7QA 3CR4X 3ZUFA 3RWAA 5EXBA 2QACA 5DPIA 4LQTA 2VZXA 4W7FA 2BBMA 1OXDA 1RROA 3AAKA 4IZNA 5CSNA 1TN4A 1IRJA 1EG4A 1YFPA 5DTYA 3BUMB 5AANA 1HCJA 2HGDA 1RWYA 2KOTA 2V53A 1EMAA 4R6BA 5CSJA 4AQJA 4Q7UA 4KW4A 2IOVA 2G3DB 4W6UA 2Q6PA 3AI4A 3OSRA 5JOLA 5LK4A 1EMBA 4H48A 3FS7A 4MZLA 2BE6A 3AKOA 4OHSA 2MAZA 5HYDA 1ZGOA 2A53B 2BCBA 2BCXA 3E5WA 1XO5A 2A4JA 4Q7TA 1B47A 3NSOA 2NZ0A 1KYRA 1RJVA 2LVJA 4E68A 1G8IA 2R2IA 3SSVA 4HSZA 3IF7A 3OP0A 1LA0A 2NCPA 1BR4B 2G16B 1Q4EA 3H1RA 1KSOA 2HFCA 1TOPA 2M8UA 1CMFA 1TIZA 2IS9A 3VGOA 4OCIA 1DVIA 2LP2A 3I5IB 1MYWA 1OSAA 4ANJA 3M0WA 2POXA 1YX7A 1EG3A 1K8UA 3FWCA 3DQCA 3AKBA 1NX1A 2YE0A 1EL4A 1Y1AA 2FCDA 2HF5A 4QJ4B 4BY4A 2AWKA 2V4EB 2H61A 3JVTC 1QLSA 4CFQA 1Z1PA 1M39A 3I5GC 1UHHA 3LL8B 2E30A 3BX9A 1DJZA 1A75A 2NCOA 2P4MA 4C0LA 4MRYA 4KW8A 1OMRA 1K2HA 4Q04A 1DTLA 1UUSA 4W6HA 4HVFA 5AERA 1XK4A 3EVRA 3WLCA 3TUYC 4IK5A 2DD7A 1YR5A 1RK9A 2JQ6A 2DDCA 1QYOA 1MOVA 1WRZA 4IL1A 2HQWA 2VVHA 1LA3A 1OMVA 3RWTA 3SG3A 2GW4B 1HQVA 2WSNA 4LJDC 4J8AA 4DXNA 1M63B 1PK0D 4J88A 1RMMA 2QU1A 3E5TA 4YGAA 2JT0A 2GGZA 1IH0A 2L5XB 1BJFA 4ZCVA 2L0PA 2BCAA 1Q4DA 5F6TA 1U5IA 1SL8A 1R6PA 4L1IA 3WXAA 4WQ2A 1CM4A 2HCGA 1NSHA 2DUIA 1QJTA 1FF1A 1KFUS 1NX0A 2WURA 1K93D 1QX2A 2EC6B 3WLDA 3A8SA 1NWDA 2EMNA 1YJFA 1NYAA 2MJWB 2G3OA 1XFYO 3DVKA 2JU0A 3ST0A 3SSLA 4NDDA 4W6AA 1C4FA 2M1KB 3DQLA 1CDLA 1UHNA 3KEVA 2OTGB 3DPZA 1BU3A 4DXOA 2A46A 1S36A 2G5ZB 1EJ3A 2A56B 2BBNA 2OGRA 1NPQA 3GK1A 4PPKA 2ZFDA 1YVHA 3O2PA 2YE1A 2ZN8A 1WRKA 3EKJA 1G4YR 3DQOA 1CDPA 2FOTA 3MGFA 4GF6B 2ZNEA 2ISDA 3VRNA 4PFEA 2KNEA 2RH7A 4PE7A 1S26D 2L4IA 5H89A 2M29A 1OZSA 2G6YA 2EHBA 4GUKA 1F54A 1B9CA 4KF5A 2PVBA 4OVNF 4I5NB 3LK0A 1ZGQA 1F70A 1XYDA 2KAYA 5DTXA 1MOUA 1MWNA 5HZUA 1ZMZA 4JEOA 1R2UA 4W6LA 2WHTA 2JXLA 1QYQA 3SS0A 3SG5A 5HZOA 1PULA 2H2KA 5DQMA 1GFLA 3BUNB 2BL0B 3NSLA 3GK4X 4PHKA 4GGFA 4ZF3A 4TZGA 2Q91A 2EGDA 5B8IB 4Z4MA 4AS8A 2O29A 3ZTFA 2DD9A 3U0NA 4W76A 3A4UB 5DRFA 4KF4A 3A8RA 3E5VA 4C0JA 2Y1MA 2H9WA 3ED8A 1L2OB 3NSKA 2F8PA 4P5OE 2FZUA 4GNKB 1CFDA 4Q9WA 3SVNA 1EMLA 2LNKA 4GFTA 5BTTB 4AQIA 1DF0A 1XAEA 3LVCA 2KQ6A 1J7OA 1RMOA 4USLA 4GOBA 1XSSA 2L98A 2JOJA 1MXLC 3CBEA 2L50A 2O24A 5D7FA 1ZUXA 3BOWB 1BLQA 3DF0A 1IG5A 1QLKA 1XFXO 2H5QA 3SVDA 4TZAA 3EK8A 4W6TA 5I2OA 1JFKA 1S5GZ 4ETOA 3OGOA 3UG0A 2DUFA 3BUOB 1SKTA 2M7LA 3CFAA 1NCZA 1WRLA 1FI6A 2EMDA 1E8AA 1XFVO 1KP5A 2M9GA 1LVCD 4UPGA 2YFPA 1SL7A 1S5GY 3I5FB 2E6WA 3ZNIA 3TDZA 3VRQA 1OXFA 2WC8A 3OB2B 4NWSA 5DRGA 1OOJA 4MLWA 3DQMA 4JRBA 2B3QA 2JTZA 2CCMA 2F3ZA 1H6RA 3KCTA 3DQHA 5HZSA 3GK2A 3CGLA 3SSYA 1SYMA 4W6CA 4Z4KA 1BR1B 3SVCA 4XOVA 1KWOB 3CB9A 4W6RA 3BXKA 2IB5A 1G7KA 5IBWA 1QV1A 3SVRA 3LLEA 2A54B 1GL4A 2Y0GA 4AR7A 2EC6C 4KGFA 4ZFSA 2GX2A 2KYFA 2ZNDA 2CNPA 1C7VA 5T3IA 4R6DA 1CNPA 1A4PA 1QVIY 4F0ZB 4GAOA 1RECA 3D10A 1M45A 2KI6C 1XQMA 3EKHA 4YBHB 1S1EA 2LVKA 2WORA 2FJUB 1A03A 1V1GA 1L7ZA 2LP3A 2C9IA 2JADA 1OXEA 5I8NA 4FTGA 3ZULA 2LVVA 5DU0A 4DUQA 1KFXL 1N65A 4XOWA 2F3YA 1WLMA 4U8DA 1SCMB 3VHTA 3S05A 1X02A 1NP8A 4PE0A 4LJDA 5FYXA 2B1UA 2HQZA 4LJBA 4XJKB 2ICRA 2I18A 5KTYA 2QLEA 2M0RA 3DQ8A 4DXIA 4W6KA 2M1UA 4P76A 1S6CA 1SK6D 1ZOTB 2LUCA 1PVAA 4BY5A 3ICBA 4JQ0D 5LTRA 4PPLA 5EXUA 1Y6WA 3U0KA 4PHJA 4L9MA 1B8LA 2JNFA 1W7SA 5DY6A 1OQPA 2BL0C 2OKYA 4XVPA 4GBAA 4PHMA 2C9JA 1S6JA 2PALA 4GGNA 2KBIA 1L2OC 1KSMA 1GJYA 1YTZC 2JNXA 1IGVA 4JGEA 1BMOA 2OTEA 4KGEA 3BXCA 5BQLA 3CS1A 3I5HC 3EVPA 1CLMA 2LLUA 3AAJA 4ORNA 1DJWA 2Q4UA 2LANA 1AJ4A 3O78A 1A29A 3DQEA 1LXFC 1NIWA 1XFUO 4DXMA 1AP4A 2DUEA 1UURA 2OPOA 2BECA 1NX2A 4DRWA 2L51A 3VK1A 1DJGA 1JF2A 1XFZO 2KSPA 1ALWA 5CPVA 1TNPA 4ZB1A 4L13A 2MHHA 1QX5B 3SG7A 3VROA 3WHTB 3SG4A 3KHEA 1A2XA 2KYCA 1IJ5A 2QT2A 2HJOA 1K9PA 1RTP1 2I94A 3NF0A 3SSKA 3NEZA 1OZOA 1GQMA 3I5FC 1G33A 3DQDA 1S6ZA 1Y1XA 2K7BA 4ZBLA 2LMTA 1KQMB 4OY4A 4CPVA 4YGEB 1U5IB 1AVSA 4OKHA 2LUXA 1WDCB 3NSIA 1N0YA 1UWOA 3G9AA 4EN1A 2DOQA 3PIBA 2I7AA 1EMMA 2KQYA 2QLGA 1KWOC 4ORBB 1JBYA 2FL1A 2ZRSA 3U8CA 2G6XA 3PJBA 4W72A 5I2QA 1SL9A 2H5OA 1TTXA 3H1OA 4JPZB 4DKNA 1SCVA 5HLVA 3IQQA 1JUOA 1DGUA 2H8QA 1F4QA 1UHKA 1BOCA 5DPJA 1SMGA 1DJXA 2KFHA 5BPJA 1J7RA 4JC2A 3KO0A 1YJ2A 1J7PA 3JTDB 1KFXS 4H3MA 4YGDB 3SSTA 2AAOA 1DJHA 2JRFA 2LHIA 1JC2A 2G6EA 2BTJA 3LF4B 4YGCB 4MBEA 3PFVA 2ZO6A 1EMCA 2K7DA 4MZKA 1EMFA 4GPLB 4B5YA 4W7CA 2F2OA 5CSIA 4P2YB 3LVDA 2H5PA 4W73A 3UFZA 5H88A 2VVIA 2I2RE 1ZACA 5LTPA 4N5XA 5JJGA 4Q9XA 4PPJA 2LVIA 5DPHA 2KBMA 2MRDA 2QZ0A 2KI4B 2QLHA 2ZKMX 2A52B 3TDUA 1DJIA 2CT9A 2AH8A 2M49B 3RM1A 4W69A 4QJ5B 4W77A 4C0KA 3GJ1A 1UISA 3PJ7A 2BE4A 3LSAA 1M46A 5AEQA 3P8UA 4DIRA 2OS8B 2MA2A 3DQ9A 5DPGA 3IQOA 1IQ3A 1CB1A 1N2DA 3NEDA 5HKZA 1JC1A 2PXSA 2WHUA 2WCEA 2WCFA 2DDDA 3HX4A 3DQ2A 5PALA 1EMKA 4IK8A 4ZF4A 1Y1UA 2KDHA 3D0YA 3WHUB 2KFGA 4PHNA 1MR8A 1DF0B 3QRXA 1JSAA 2JZIA 2GW3A 2Y5IA 1AJ5A 4HRGA 3GOFA 1IKUA 3I5IC 1CV7A 1HT9A 1W7IB 3DF0B 4Q7RA 1B7TZ 2FWQA 2L4HA 4NQGA 1H4UA 1DT7B 1QY3A 3SJSA 3HCMA 2LAPA 2F2PA 5TNCA 4N1FA 4I5LB 4MN0A 4HQ9A 2V4EC 1Q4CA 5G08A 2NLNA 4I5JA 4JF9A 1QXPA 2SASA 3KPXA 3DQUA 3CD9A 1K94A 3PLFB 4ZIOA 2WIQA 1Q4BA 4KPIA 2ZN9A 1YRUB 2CBLA 3PN7B 1EMGA 1S3PA 2LM5A 4RYWA 1TNQA 3O6BA 2PXWA 4HRHA 4B30B 1GGXA 1GGWA 1JBAA 1IJ6A 3I19A 1FW4A 2LE9B 3P28A 3VRPA 3OSQA 5DKQA 1QV0A 1EH2A 5DQBA 2GX0A 3EK7A 1YUSA 5KTGA 3LK1A 5LTQA 3OHMB 1F0BA 4H3LA 3OX5A 5J3XA 1WLZA 4CIDA 3PSRA 1H8BA 1ZFSA 2F33A 5EB6A 3NT3A 5K89A 3I5GB 2HQ8A 5BTTA 5AFPA 2WOSA 4M2QA 3BXAA 1JF0A 2NXQA 3O77A 1Q80A 5ER4X 4DCKA 1SW8A 4PDZA 1MUXA 2HETA 3SVEA 1NX3A 4DS7A 4R1EA 1W7UA 4W7DA 4NDCA 2PMYA 1C07A 1BT6A 3BXBA 2M3WA 1YHIA 2KFFA 5FVIA 3K21A 1YUTA 5ER5A 1AK8A 2P6BB 5HZTA 5DTZA 4IK1A 4XGYA 4W6GA 1F71A 3VHTB 3OX6A 1JFJA 3DQ6A 4DXQA 1CDMA 1BF5A 3LCPC 4IK9A 1XMZA 2OTGC 1KYSA 2A50B 1PRWA 1KK7Z 4ORAB 3DQ4A 3CZTX 2HPSA 3ST4A 3PATA 1UHJA 4MZJA 1UP5A 3BQ3A 3FWBA 2RGIA 1ZUZA 4XL5A 1B1GA 1RRXA 3BUWB 3U8PA 1KYPA 1LINA 1SRAA 2HGYA 1QS7A 2OS8C 2HPWA 2VAEA 1BFPA 4L12A 4I2YA 2LHLA 4W75A 2LMUA 3CR2A 4LQUA 1Q73A 4N1GA 3WCKA 2BKHB 1LKJA 3DPXA 1MHOA 3U8AA 5HKWA 1KFUL 2IE2A 4A4CA 1CM1A 1PSBA 2DUGA 4XYNA 1IWQA 2SCPA 1MXEA 3GJ2A 4H3NA 3SG6A 1FPWA 4EDSA 1W7JB 1B8CA 2LCPA 2CXJA 1ODBA 4WRIA 2OKWA 3AKAA 1SNLA 5F9GA 1BG1A 1CDNA 1JBZA 2PASA 4GESB 3GL4A 4CLNA 3DPWA 3M24A 4YGBB 1FBVA 3W1DA 4CFRA 1GGZA 1XFWO 1CLLA 1MQ1A 4W7RA 1J1EA 3PM8A 3VRRA 5BT0A 2QRFA 1PSRA 5FVGA 5I2LA 3FIAA 3SVSA 2O2BA 1DMOA 1A75B 4HQ8A 1K90D 3ST2A 4XJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JC0 A;  2WND A;  3CD1 A;  2JTT A;  2JT3 A;  2D8N A;  5EHU A;  2OJK A;  1IQ5 A;  4JFG A;  3PN7 C;  4W74 A;  2K2F A;  1NCX A;  3IP2 A;  2MLE C;  2EMO A;  5HLO A;  3GB3 A;  2ARL A;  2ZO7 A;  2JXC A;  1DJY A;  1H4B A;  2M97 A;  1SR6 B;  2BKI B;  1YZW A;  2QLG B;  5EXC I;  5DTL A;  4OJ0 A;  2A48 A;  4LW5 A;  4RYS A;  1WY9 A;  3ST3 A;  1M31 A;  3LVA A;  1B9A A;  2K7O A;  3GEX A;  2K0J A;  1TRF A;  2COL B;  2K61 A;  4AOM A;  1KK8 B;  4M2P A;  3SG2 A;  4IK3 A;  4PCW A;  1B4C A;  2OTB A;  1F8H A;  4EMQ A;  1SY9 A;  2HRS A;  1FI5 A;  4W6O A;  1J1D A;  4TNC A;  4ICB A;  2AMI A;  1OMD A;  3TMR A;  4YI9 A;  2AWM A;  4W7A A;  1V1F A;  3KF9 A;  5DKR A;  1MF8 B;  5EBJ A;  4KEX A;  2LLS A;  2G2B A;  2V4E A;  2GGM A;  5AXI A;  2FCE A;  3DQJ A;  2KGR A;  1SBJ A;  3TMT A;  2LV7 A;  1KQV A;  4ZIN A;  4MSP A;  1Y0V H;  2Z6Z A;  4DKM A;  3TDI A;  1QTX A;  3MSE B;  3AI5 A;  3CFH A;  4W6M A;  2Q57 A;  3CR5 X;  3C1V A;  1CFP A;  2VAD A;  2M7N A;  5KU1 A;  3RLZ A;  1CLB A;  2KAX A;  2G2S B;  1CTR A;  2JC2 A;  3TS5 B;  1CFF A;  3W1C A;  3CFF A;  1AHR A;  4U2V A;  3U0L A;  1XA9 A;  2CTN A;  2AWL A;  2QPT A;  1K95 A;  3EVV A;  1F4O A;  1QIV A;  2WCB A;  3H4S E;  3OB1 B;  1SCM C;  2KI6 D;  3SVB A;  5AQB B;  1YX8 A;  2QLI A;  3VIC A;  3D0Y B;  3DVE A;  1TNX A;  3LA1 A;  3EK4 A;  4PAL A;  5FVF A;  1QAS A;  2Y1N A;  1QAT A;  3EVU A;  5EJU A;  3K1K A;  2PSR A;  4MRX A;  4M2O A;  1CMG A;  1RM9 A;  4PE1 A;  4D1E A;  5HKY A;  3TZ1 A;  3SSP A;  1BOD A;  2A47 A;  5DKN A;  4H47 A;  5EB7 A;  2VVJ A;  1W7T A;  5HGE A;  2YDZ A;  1K96 A;  2H61 C;  1AUI B;  2GV5 A;  1QYF A;  2LC5 A;  2HQK A;  3PJ5 A;  1JWD A;  1PVB A;  4W6N A;  2O5G A;  3WNX B;  2JT8 A;  2K8M B;  3DQN A;  2ZRT A;  5J2O A;  3DQI A;  1YHG A;  4EUL A;  2K7C A;  3BUX B;  2H5R A;  4W6S A;  1YHH A;  1XK4 C;  1KCY A;  2JWW A;  3SV5 A;  3SSH A;  1QIW A;  1CFC A;  1B7T Y;  3DD4 A;  3CLN A;  1UHI A;  3SIA A;  1SR6 C;  3CGA A;  4ORC B;  2IB6 A;  4N3D A;  4KAG A;  3E3R A;  3DQ7 A;  2AHA A;  4PE4 A;  4RTC A;  1K9K A;  1YVL A;  4EDO A;  4LJC A;  1XA5 A;  2ZMW A;  2B3P A;  4ZF5 A;  1EXR A;  3DQF A;  2O60 A;  4QJ3 B;  2MBX A;  5HW9 A;  1F09 A;  2JPT A;  2Y4Q A;  3I5H B;  1SPY A;  4FQO A;  1KQM C;  4MEW A;  2DUH A;  4BDU A;  3LS3 A;  2WSO A;  5FHV A;  4W6B A;  1KK8 C;  1OE9 B;  3LF3 A;  2KAV A;  5HBD A;  1VRK A;  1WDC C;  3V3D A;  3F45 A;  1RMP A;  2Z6Y A;  1TCO B;  1NUB A;  4WQ3 A;  4W7E A;  1QXT A;  2KGB C;  1Z1Q A;  3NXA A;  2VRG A;  2L2E A;  3JVT B;  3SVU A;  1RFJ A;  3SIB A;  4KW9 A;  3DVM A;  1DGV A;  2AUC A;  5KSZ A;  2H6V A;  1NCY A;  4UTS A;  2TN4 A;  4A4B A;  1F55 A;  3IR8 A;  1HUY A;  4P1Q A;  3DQ1 A;  3DQ3 A;  1ZGP A;  4OR9 B;  3PAL A;  3BYA A;  4HQC A;  4NDB A;  3SVO A;  1ALV A;  4W6F A;  3BOW A;  3CWG A;  2Z6X A;  5D69 A;  3JTD C;  3DQK A;  3DQ5 A;  3ZWH A;  1YUU A;  3TUY B;  1EME A;  3TS5 C;  4W6J A;  3M22 A;  4B30 A;  3DVJ A;  4KA9 A;  4MVF A;  1D1O A;  2MLF C;  4W6D A;  4OQW A;  4W6P A;  3CTN A;  3DQA A;  2G9B A;  4I5K A;  4KF5 C;  4IK4 A;  1TCF A;  4YRU A;  1YRT B;  1J55 A;  4ZCU A;  1QVI Z;  5GQQ C;  1B8R A;  3O4Y A;  2JUL A;  4OGS A;  5CSF A;  4J89 A;  1PAL A;  2KHN A;  2KI4 C;  3KCS A;  4OV2 A;  2K2A A;  1XVJ A;  4DXP A;  2Z1O A;  4JWQ A;  2WIS A;  5H87 A;  1C7W A;  1S6I A;  4YI8 A;  2LLT A;  1Q4A A;  3NT9 A;  2ZMU A;  1TNW A;  1KK7 Y;  3SRY A;  1QX7 A;  2WHS A;  3U0M A;  3ZUJ A;  1K9U A;  4W7X A;  2PRU A;  3ADF A;  4GGF C;  4HE4 A;  1YUR A;  4HRE E;  2AWJ A;  4W6I A;  2LMV A;  1CKK A;  1J7Q A;  3CR4 X;  3ZUF A;  3RWA A;  5EXB A;  2QAC A;  5DPI A;  4LQT A;  2VZX A;  4W7F A;  2BBM A;  1OXD A;  1RRO A;  3AAK A;  4IZN A;  5CSN A;  1TN4 A;  1IRJ A;  1EG4 A;  1YFP A;  5DTY A;  3BUM B;  5AAN A;  1HCJ A;  2HGD A;  1RWY A;  2KOT A;  2V53 A;  1EMA A;  4R6B A;  5CSJ A;  4AQJ A;  4Q7U A;  4KW4 A;  2IOV A;  2G3D B;  4W6U A;  2Q6P A;  3AI4 A;  3OSR A;  5JOL A;  5LK4 A;  1EMB A;  4H48 A;  3FS7 A;  4MZL A;  2BE6 A;  3AKO A;  4OHS A;  2MAZ A;  5HYD A;  1ZGO A;  2A53 B;  2BCB A;  2BCX A;  3E5W A;  1XO5 A;  2A4J A;  4Q7T A;  1B47 A;  3NSO A;  2NZ0 A;  1KYR A;  1RJV A;  2LVJ A;  4E68 A;  1G8I A;  2R2I A;  3SSV A;  4HSZ A;  3IF7 A;  3OP0 A;  1LA0 A;  2NCP A;  1BR4 B;  2G16 B;  1Q4E A;  3H1R A;  1KSO A;  2HFC A;  1TOP A;  2M8U A;  1CMF A;  1TIZ A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  3I5I B;  1MYW A;  1OSA A;  4ANJ A;  3M0W A;  2POX A;  1YX7 A;  1EG3 A;  1K8U A;  3FWC A;  3DQC A;  3AKB A;  1NX1 A;  2YE0 A;  1EL4 A;  1Y1A A;  2FCD A;  2HF5 A;  4QJ4 B;  4BY4 A;  2AWK A;  2V4E B;  2H61 A;  3JVT C;  1QLS A;  4CFQ A;  1Z1P A;  1M39 A;  3I5G C;  1UHH A;  3LL8 B;  2E30 A;  3BX9 A;  1DJZ A;  1A75 A;  2NCO A;  2P4M A;  4C0L A;  4MRY A;  4KW8 A;  1OMR A;  1K2H A;  4Q04 A;  1DTL A;  1UUS A;  4W6H A;  4HVF A;  5AER A;  1XK4 A;  3EVR A;  3WLC A;  3TUY C;  4IK5 A;  2DD7 A;  1YR5 A;  1RK9 A;  2JQ6 A;  2DDC A;  1QYO A;  1MOV A;  1WRZ A;  4IL1 A;  2HQW A;  2VVH A;  1LA3 A;  1OMV A;  3RWT A;  3SG3 A;  2GW4 B;  1HQV A;  2WSN A;  4LJD C;  4J8A A;  4DXN A;  1M63 B;  1PK0 D;  4J88 A;  1RMM A;  2QU1 A;  3E5T A;  4YGA A;  2JT0 A;  2GGZ A;  1IH0 A;  2L5X B;  1BJF A;  4ZCV A;  2L0P A;  2BCA A;  1Q4D A;  5F6T A;  1U5I A;  1SL8 A;  1R6P A;  4L1I A;  3WXA A;  4WQ2 A;  1CM4 A;  2HCG A;  1NSH A;  2DUI A;  1QJT A;  1FF1 A;  1KFU S;  1NX0 A;  2WUR A;  1K93 D;  1QX2 A;  2EC6 B;  3WLD A;  3A8S A;  1NWD A;  2EMN A;  1YJF A;  1NYA A;  2MJW B;  2G3O A;  1XFY O;  3DVK A;  2JU0 A;  3ST0 A;  3SSL A;  4NDD A;  4W6A A;  1C4F A;  2M1K B;  3DQL A;  1CDL A;  1UHN A;  3KEV A;  2OTG B;  3DPZ A;  1BU3 A;  4DXO A;  2A46 A;  1S36 A;  2G5Z B;  1EJ3 A;  2A56 B;  2BBN A;  2OGR A;  1NPQ A;  3GK1 A;  4PPK A;  2ZFD A;  1YVH A;  3O2P A;  2YE1 A;  2ZN8 A;  1WRK A;  3EKJ A;  1G4Y R;  3DQO A;  1CDP A;  2FOT A;  3MGF A;  4GF6 B;  2ZNE A;  2ISD A;  3VRN A;  4PFE A;  2KNE A;  2RH7 A;  4PE7 A;  1S26 D;  2L4I A;  5H89 A;  2M29 A;  1OZS A;  2G6Y A;  2EHB A;  4GUK A;  1F54 A;  1B9C A;  4KF5 A;  2PVB A;  4OVN F;  4I5N B;  3LK0 A;  1ZGQ A;  1F70 A;  1XYD A;  2KAY A;  5DTX A;  1MOU A;  1MWN A;  5HZU A;  1ZMZ A;  4JEO A;  1R2U A;  4W6L A;  2WHT A;  2JXL A;  1QYQ A;  3SS0 A;  3SG5 A;  5HZO A;  1PUL A;  2H2K A;  5DQM A;  1GFL A;  3BUN B;  2BL0 B;  3NSL A;  3GK4 X;  4PHK A;  4GGF A;  4ZF3 A;  4TZG A;  2Q91 A;  2EGD A;  5B8I B;  4Z4M A;  4AS8 A;  2O29 A;  3ZTF A;  2DD9 A;  3U0N A;  4W76 A;  3A4U B;  5DRF A;  4KF4 A;  3A8R A;  3E5V A;  4C0J A;  2Y1M A;  2H9W A;  3ED8 A;  1L2O B;  3NSK A;  2F8P A;  4P5O E;  2FZU A;  4GNK B;  1CFD A;  4Q9W A;  3SVN A;  1EML A;  2LNK A;  4GFT A;  5BTT B;  4AQI A;  1DF0 A;  1XAE A;  3LVC A;  2KQ6 A;  1J7O A;  1RMO A;  4USL A;  4GOB A;  1XSS A;  2L98 A;  2JOJ A;  1MXL C;  3CBE A;  2L50 A;  2O24 A;  5D7F A;  1ZUX A;  3BOW B;  1BLQ A;  3DF0 A;  1IG5 A;  1QLK A;  1XFX O;  2H5Q A;  3SVD A;  4TZA A;  3EK8 A;  4W6T A;  5I2O A;  1JFK A;  1S5G Z;  4ETO A;  3OGO A;  3UG0 A;  2DUF A;  3BUO B;  1SKT A;  2M7L A;  3CFA A;  1NCZ A;  1WRL A;  1FI6 A;  2EMD A;  1E8A A;  1XFV O;  1KP5 A;  2M9G A;  1LVC D;  4UPG A;  2YFP A;  1SL7 A;  1S5G Y;  3I5F B;  2E6W A;  3ZNI A;  3TDZ A;  3VRQ A;  1OXF A;  2WC8 A;  3OB2 B;  4NWS A;  5DRG A;  1OOJ A;  4MLW A;  3DQM A;  4JRB A;  2B3Q A;  2JTZ A;  2CCM A;  2F3Z A;  1H6R A;  3KCT A;  3DQH A;  5HZS A;  3GK2 A;  3CGL A;  3SSY A;  1SYM A;  4W6C A;  4Z4K A;  1BR1 B;  3SVC A;  4XOV A;  1KWO B;  3CB9 A;  4W6R A;  3BXK A;  2IB5 A;  1G7K A;  5IBW A;  1QV1 A;  3SVR A;  3LLE A;  2A54 B;  1GL4 A;  2Y0G A;  4AR7 A;  2EC6 C;  4KGF A;  4ZFS A;  2GX2 A;  2KYF A;  2ZND A;  2CNP A;  1C7V A;  5T3I A;  4R6D A;  1CNP A;  1A4P A;  1QVI Y;  4F0Z B;  4GAO A;  1REC A;  3D10 A;  1M45 A;  2KI6 C;  1XQM A;  3EKH A;  4YBH B;  1S1E A;  2LVK A;  2WOR A;  2FJU B;  1A03 A;  1V1G A;  1L7Z A;  2LP3 A;  2C9I A;  2JAD A;  1OXE A;  5I8N A;  4FTG A;  3ZUL A;  2LVV A;  5DU0 A;  4DUQ A;  1KFX L;  1N65 A;  4XOW A;  2F3Y A;  1WLM A;  4U8D A;  1SCM B;  3VHT A;  3S05 A;  1X02 A;  1NP8 A;  4PE0 A;  4LJD A;  5FYX A;  2B1U A;  2HQZ A;  4LJB A;  4XJK B;  2ICR A;  2I18 A;  5KTY A;  2QLE A;  2M0R A;  3DQ8 A;  4DXI A;  4W6K A;  2M1U A;  4P76 A;  1S6C A;  1SK6 D;  1ZOT B;  2LUC A;  1PVA A;  4BY5 A;  3ICB A;  4JQ0 D;  5LTR A;  4PPL A;  5EXU A;  1Y6W A;  3U0K A;  4PHJ A;  4L9M A;  1B8L A;  2JNF A;  1W7S A;  5DY6 A;  1OQP A;  2BL0 C;  2OKY A;  4XVP A;  4GBA A;  4PHM A;  2C9J A;  1S6J A;  2PAL A;  4GGN A;  2KBI A;  1L2O C;  1KSM A;  1GJY A;  1YTZ C;  2JNX A;  1IGV A;  4JGE A;  1BMO A;  2OTE A;  4KGE A;  3BXC A;  5BQL A;  3CS1 A;  3I5H C;  3EVP A;  1CLM A;  2LLU A;  3AAJ A;  4ORN A;  1DJW A;  2Q4U A;  2LAN A;  1AJ4 A;  3O78 A;  1A29 A;  3DQE A;  1LXF C;  1NIW A;  1XFU O;  4DXM A;  1AP4 A;  2DUE A;  1UUR A;  2OPO A;  2BEC A;  1NX2 A;  4DRW A;  2L51 A;  3VK1 A;  1DJG A;  1JF2 A;  1XFZ O;  2KSP A;  1ALW A;  5CPV A;  1TNP A;  4ZB1 A;  4L13 A;  2MHH A;  1QX5 B;  3SG7 A;  3VRO A;  3WHT B;  3SG4 A;  3KHE A;  1A2X A;  2KYC A;  1IJ5 A;  2QT2 A;  2HJO A;  1K9P A;  1RTP 1;  2I94 A;  3NF0 A;  3SSK A;  3NEZ A;  1OZO A;  1GQM A;  3I5F C;  1G33 A;  3DQD A;  1S6Z A;  1Y1X A;  2K7B A;  4ZBL A;  2LMT A;  1KQM B;  4OY4 A;  4CPV A;  4YGE B;  1U5I B;  1AVS A;  4OKH A;  2LUX A;  1WDC B;  3NSI A;  1N0Y A;  1UWO A;  3G9A A;  4EN1 A;  2DOQ A;  3PIB A;  2I7A A;  1EMM A;  2KQY A;  2QLG A;  1KWO C;  4ORB B;  1JBY A;  2FL1 A;  2ZRS A;  3U8C A;  2G6X A;  3PJB A;  4W72 A;  5I2Q A;  1SL9 A;  2H5O A;  1TTX A;  3H1O A;  4JPZ B;  4DKN A;  1SCV A;  5HLV A;  3IQQ A;  1JUO A;  1DGU A;  2H8Q A;  1F4Q A;  1UHK A;  1BOC A;  5DPJ A;  1SMG A;  1DJX A;  2KFH A;  5BPJ A;  1J7R A;  4JC2 A;  3KO0 A;  1YJ2 A;  1J7P A;  3JTD B;  1KFX S;  4H3M A;  4YGD B;  3SST A;  2AAO A;  1DJH A;  2JRF A;  2LHI A;  1JC2 A;  2G6E A;  2BTJ A;  3LF4 B;  4YGC B;  4MBE A;  3PFV A;  2ZO6 A;  1EMC A;  2K7D A;  4MZK A;  1EMF A;  4GPL B;  4B5Y A;  4W7C A;  2F2O A;  5CSI A;  4P2Y B;  3LVD A;  2H5P A;  4W73 A;  3UFZ A;  5H88 A;  2VVI A;  2I2R E;  1ZAC A;  5LTP A;  4N5X A;  5JJG A;  4Q9X A;  4PPJ A;  2LVI A;  5DPH A;  2KBM A;  2MRD A;  2QZ0 A;  2KI4 B;  2QLH A;  2ZKM X;  2A52 B;  3TDU A;  1DJI A;  2CT9 A;  2AH8 A;  2M49 B;  3RM1 A;  4W69 A;  4QJ5 B;  4W77 A;  4C0K A;  3GJ1 A;  1UIS A;  3PJ7 A;  2BE4 A;  3LSA A;  1M46 A;  5AEQ A;  3P8U A;  4DIR A;  2OS8 B;  2MA2 A;  3DQ9 A;  5DPG A;  3IQO A;  1IQ3 A;  1CB1 A;  1N2D A;  3NED A;  5HKZ A;  1JC1 A;  2PXS A;  2WHU A;  2WCE A;  2WCF A;  2DDD A;  3HX4 A;  3DQ2 A;  5PAL A;  1EMK A;  4IK8 A;  4ZF4 A;  1Y1U A;  2KDH A;  3D0Y A;  3WHU B;  2KFG A;  4PHN A;  1MR8 A;  1DF0 B;  3QRX A;  1JSA A;  2JZI A;  2GW3 A;  2Y5I A;  1AJ5 A;  4HRG A;  3GOF A;  1IKU A;  3I5I C;  1CV7 A;  1HT9 A;  1W7I B;  3DF0 B;  4Q7R A;  1B7T Z;  2FWQ A;  2L4H A;  4NQG A;  1H4U A;  1DT7 B;  1QY3 A;  3SJS A;  3HCM A;  2LAP A;  2F2P A;  5TNC A;  4N1F A;  4I5L B;  4MN0 A;  4HQ9 A;  2V4E C;  1Q4C A;  5G08 A;  2NLN A;  4I5J A;  4JF9 A;  1QXP A;  2SAS A;  3KPX A;  3DQU A;  3CD9 A;  1K94 A;  3PLF B;  4ZIO A;  2WIQ A;  1Q4B A;  4KPI A;  2ZN9 A;  1YRU B;  2CBL A;  3PN7 B;  1EMG A;  1S3P A;  2LM5 A;  4RYW A;  1TNQ A;  3O6B A;  2PXW A;  4HRH A;  4B30 B;  1GGX A;  1GGW A;  1JBA A;  1IJ6 A;  3I19 A;  1FW4 A;  2LE9 B;  3P28 A;  3VRP A;  3OSQ A;  5DKQ A;  1QV0 A;  1EH2 A;  5DQB A;  2GX0 A;  3EK7 A;  1YUS A;  5KTG A;  3LK1 A;  5LTQ A;  3OHM B;  1F0B A;  4H3L A;  3OX5 A;  5J3X A;  1WLZ A;  4CID A;  3PSR A;  1H8B A;  1ZFS A;  2F33 A;  5EB6 A;  3NT3 A;  5K89 A;  3I5G B;  2HQ8 A;  5BTT A;  5AFP A;  2WOS A;  4M2Q A;  3BXA A;  1JF0 A;  2NXQ A;  3O77 A;  1Q80 A;  5ER4 X;  4DCK A;  1SW8 A;  4PDZ A;  1MUX A;  2HET A;  3SVE A;  1NX3 A;  4DS7 A;  4R1E A;  1W7U A;  4W7D A;  4NDC A;  2PMY A;  1C07 A;  1BT6 A;  3BXB A;  2M3W A;  1YHI A;  2KFF A;  5FVI A;  3K21 A;  1YUT A;  5ER5 A;  1AK8 A;  2P6B B;  5HZT A;  5DTZ A;  4IK1 A;  4XGY A;  4W6G A;  1F71 A;  3VHT B;  3OX6 A;  1JFJ A;  3DQ6 A;  4DXQ A;  1CDM A;  1BF5 A;  3LCP C;  4IK9 A;  1XMZ A;  2OTG C;  1KYS A;  2A50 B;  1PRW A;  1KK7 Z;  4ORA B;  3DQ4 A;  3CZT X;  2HPS A;  3ST4 A;  3PAT A;  1UHJ A;  4MZJ A;  1UP5 A;  3BQ3 A;  3FWB A;  2RGI A;  1ZUZ A;  4XL5 A;  1B1G A;  1RRX A;  3BUW B;  3U8P A;  1KYP A;  1LIN A;  1SRA A;  2HGY A;  1QS7 A;  2OS8 C;  2HPW A;  2VAE A;  1BFP A;  4L12 A;  4I2Y A;  2LHL A;  4W75 A;  2LMU A;  3CR2 A;  4LQU A;  1Q73 A;  4N1G A;  3WCK A;  2BKH B;  1LKJ A;  3DPX A;  1MHO A;  3U8A A;  5HKW A;  1KFU L;  2IE2 A;  4A4C A;  1CM1 A;  1PSB A;  2DUG A;  4XYN A;  1IWQ A;  2SCP A;  1MXE A;  3GJ2 A;  4H3N A;  3SG6 A;  1FPW A;  4EDS A;  1W7J B;  1B8C A;  2LCP A;  2CXJ A;  1ODB A;  4WRI A;  2OKW A;  3AKA A;  1SNL A;  5F9G A;  1BG1 A;  1CDN A;  1JBZ A;  2PAS A;  4GES B;  3GL4 A;  4CLN A;  3DPW A;  3M24 A;  4YGB B;  1FBV A;  3W1D A;  4CFR A;  1GGZ A;  1XFW O;  1CLL A;  1MQ1 A;  4W7R A;  1J1E A;  3PM8 A;  3VRR A;  5BT0 A;  2QRF A;  1PSR A;  5FVG A;  5I2L A;  3FIA A;  3SVS A;  2O2B A;  1DMO A;  1A75 B;  4HQ8 A;  1K90 D;  3ST2 A;  4XJK A; 
#chains in the Genus database with same CATH topology
 1JC0 A;  2WND A;  3CD1 A;  2JTT A;  2JT3 A;  2D8N A;  5EHU A;  2OJK A;  1IQ5 A;  3R1V A;  4JFG A;  3PN7 C;  4W74 A;  2K2F A;  1NCX A;  3IP2 A;  2MLE C;  2EMO A;  5HLO A;  3GB3 A;  2ARL A;  2ZO7 A;  2JXC A;  1DJY A;  1W9Z A;  1H4B A;  2M97 A;  1SR6 B;  2BKI B;  1YZW A;  2QLG B;  5FI2 A;  5EXC I;  5DTL A;  4OJ0 A;  2A48 A;  4LW5 A;  4RYS A;  3SS5 A;  1WY9 A;  3ST3 A;  1M31 A;  3LVA A;  1B9A A;  2K7O A;  3GEX A;  5HL1 A;  2K0J A;  1TRF A;  2COL B;  2K61 A;  4AOM A;  1KK8 B;  4M2P A;  3SG2 A;  4IK3 A;  4PCW A;  3EG5 B;  1B4C A;  2OTB A;  1F8H A;  4EMQ A;  1SY9 A;  2HRS A;  1FI5 A;  4W6O A;  1J1D A;  4TNC A;  4ICB A;  2AMI A;  1OMD A;  2FJY A;  3TMR A;  4YI9 A;  2AWM A;  4W7A A;  1V1F A;  3KF9 A;  5DKR A;  1MF8 B;  5EBJ A;  4KEX A;  2LLS A;  3OGN A;  2G2B A;  2V4E A;  2GGM A;  5AXI A;  2FCE A;  3DQJ A;  2KGR A;  1SBJ A;  1OW4 A;  3TMT A;  2LV7 A;  1KQV A;  4ZIN A;  4MSP A;  1Y0V H;  2Z6Z A;  4DKM A;  3TDI A;  1QTX A;  3MSE B;  3AI5 A;  3CFH A;  4W6M A;  2Q57 A;  3CR5 X;  3C1V A;  1CFP A;  2VAD A;  2M7N A;  5KU1 A;  3RLZ A;  1CLB A;  2KAX A;  2G2S B;  1CTR A;  2JC2 A;  3TS5 B;  1CFF A;  3W1C A;  3CFF A;  1AHR A;  4U2V A;  3U0L A;  1XA9 A;  2WCL A;  2CTN A;  3B88 A;  2AWL A;  2QPT A;  1K95 A;  3EVV A;  1F4O A;  4INX A;  1QIV A;  2WCB A;  3CZ2 A;  3IVT A;  3H4S E;  3OB1 B;  1SCM C;  2KI6 D;  3SVB A;  5AQB B;  1YX8 A;  2QLI A;  3VIC A;  3D0Y B;  3DVE A;  1TNX A;  4KYN A;  3PJI A;  3LA1 A;  2WCK A;  3EK4 A;  4PAL A;  5FVF A;  1QAS A;  2Y1N A;  1QAT A;  3EVU A;  5EJU A;  3K1K A;  2PSR A;  4MRX A;  4M2O A;  1CMG A;  1RM9 A;  3S0G A;  4PE1 A;  2JPO A;  4D1E A;  5HKY A;  3TZ1 A;  3SSP A;  1BOD A;  2A47 A;  5DKN A;  4H47 A;  5EB7 A;  2VVJ A;  1W7T A;  5HGE A;  2YDZ A;  1K96 A;  2H61 C;  1AUI B;  2GV5 A;  1QYF A;  2LC5 A;  2HQK A;  3PJ5 A;  1JWD A;  1PVB A;  4W6N A;  2O5G A;  3WNX B;  2JT8 A;  2K8M B;  3DQN A;  2ZRT A;  5J2O A;  3DQI A;  1YHG A;  4EUL A;  3D76 A;  2K7C A;  3BUX B;  2H5R A;  4W6S A;  1YHH A;  1XK4 C;  1KCY A;  2JWW A;  3SV5 A;  3SSH A;  1QIW A;  1CFC A;  1B7T Y;  3DD4 A;  3CLN A;  1UHI A;  3SIA A;  1SR6 C;  3CGA A;  3DXL A;  4ORC B;  1DQE A;  1DEK A;  1OOI X;  2IB6 A;  4N3D A;  4KAG A;  3E3R A;  3DQ7 A;  2AHA A;  4PE4 A;  4RTC A;  1K9K A;  1YVL A;  4EDO A;  3UO9 A;  4LJC A;  1XA5 A;  2ZMW A;  2B3P A;  4ZF5 A;  1EXR A;  3DQF A;  2O60 A;  4QJ3 B;  2MBX A;  5HW9 A;  1F09 A;  2JPT A;  2Y4Q A;  3I5H B;  1SPY A;  4FQO A;  1KQM C;  4MEW A;  2DUH A;  4BDU A;  3LS3 A;  2WSO A;  5FHV A;  4W6B A;  1KK8 C;  1OE9 B;  3LF3 A;  2KAV A;  5HBD A;  1VRK A;  1WDC C;  5I94 A;  3V3D A;  3F45 A;  3D78 A;  1RMP A;  2Z6Y A;  1TCO B;  1NUB A;  3QME A;  4WQ3 A;  4W7E A;  1QXT A;  2KGB C;  1Z1Q A;  3NXA A;  2VRG A;  3FE6 A;  2L2E A;  3JVT B;  3SVU A;  1RFJ A;  3S0B A;  3SIB A;  4KW9 A;  3DVM A;  1DGV A;  2AUC A;  5KSZ A;  2H6V A;  1NCY A;  4UTS A;  2TN4 A;  4A4B A;  1F55 A;  3IR8 A;  1HUY A;  3B87 A;  4P1Q A;  3DQ1 A;  3DQ3 A;  1ZGP A;  1SSE B;  4OR9 B;  3PAL A;  1C3Z A;  3BYA A;  4HQC A;  4NDB A;  3SVO A;  1ALV A;  4W6F A;  3BOW A;  3CWG A;  2Z6X A;  5D69 A;  3JTD C;  3DQK A;  3DQ5 A;  3ZWH A;  1YUU A;  3TUY B;  1EME A;  3TS5 C;  4W6J A;  3M22 A;  4B30 A;  3DVJ A;  4KA9 A;  4MVF A;  1D1O A;  2MLF C;  4W6D A;  4OQW A;  4W6P A;  3CTN A;  3DQA A;  2G9B A;  4I5K A;  4IJ7 A;  4KF5 C;  4IK4 A;  1TCF A;  4YRU A;  1YRT B;  2QEB A;  1J55 A;  4ZCU A;  1QVI Z;  5GQQ C;  1B8R A;  3O4Y A;  2JUL A;  4OGS A;  5CSF A;  4J89 A;  1PAL A;  2KHN A;  2KI4 C;  3KCS A;  4OV2 A;  2K2A A;  1XVJ A;  4DXP A;  2Z1O A;  4JWQ A;  2WIS A;  5H87 A;  1C7W A;  1S6I A;  4YI8 A;  2LLT A;  1Q4A A;  3NT9 A;  2ZMU A;  1TNW A;  1KK7 Y;  3SRY A;  1QX7 A;  2WHS A;  3U0M A;  3ZUJ A;  1K9U A;  4W7X A;  2PRU A;  3FE8 A;  3K1E A;  3ADF A;  4GGF C;  4F7F A;  3D75 A;  4HE4 A;  1YUR A;  4HRE E;  2AWJ A;  4W6I A;  2LMV A;  1CKK A;  1J7Q A;  2K60 A;  3CR4 X;  3RWA A;  3ZUF A;  5EXB A;  2QAC A;  5DPI A;  4LQT A;  2VZX A;  4W7F A;  2BBM A;  1OXD A;  1RRO A;  3AAK A;  4IZN A;  5CSN A;  1TN4 A;  1IRJ A;  1EG4 A;  1YFP A;  5DTY A;  3NHI A;  3BUM B;  5AAN A;  1HCJ A;  2HGD A;  1RWY A;  2KOT A;  2V53 A;  1EMA A;  4R6B A;  5CSJ A;  4AQJ A;  4Q7U A;  4INW A;  4KW4 A;  2IOV A;  2G3D B;  4W6U A;  2Q6P A;  3AI4 A;  3OSR A;  5JOL A;  5LK4 A;  1EMB A;  4H48 A;  2YGU A;  3FS7 A;  4MZL A;  2BE6 A;  3AKO A;  4OHS A;  2MAZ A;  5HYD A;  1ZGO A;  2A53 B;  2BCX A;  2BCB A;  3E5W A;  1XO5 A;  2A4J A;  4Q7T A;  1B47 A;  3NSO A;  2NZ0 A;  1KYR A;  1RJV A;  2LVJ A;  4E68 A;  1G8I A;  2R2I A;  3SSV A;  4HSZ A;  3IF7 A;  3OP0 A;  1LA0 A;  2NCP A;  1BR4 B;  2G16 B;  1Q4E A;  3H1R A;  1KSO A;  2HFC A;  1TOP A;  2M8U A;  1CMF A;  1TIZ A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  3I5I B;  1MYW A;  1OSA A;  4ANJ A;  3M0W A;  2POX A;  3L47 A;  1YX7 A;  1EG3 A;  1K8U A;  3FWC A;  3DQC A;  3AKB A;  1NX1 A;  2BNX A;  2YE0 A;  1EL4 A;  1Y1A A;  2FCD A;  2HF5 A;  4QJ4 B;  2GTE A;  4BY4 A;  2AWK A;  2V4E B;  2H61 A;  3JVT C;  3S0F A;  1QLS A;  4CFQ A;  1Z1P A;  1M39 A;  2QEH A;  3I5G C;  1UHH A;  3LL8 B;  2E30 A;  3BX9 A;  1DJZ A;  1A75 A;  2NCO A;  2P4M A;  4OZD A;  4C0L A;  4MRY A;  4KW8 A;  1OMR A;  1K2H A;  4Q04 A;  1DTL A;  1UUS A;  4W6H A;  4HVF A;  5AER A;  1XK4 A;  3EVR A;  3WLC A;  3TUY C;  4IK5 A;  3NHT A;  2DD7 A;  1YR5 A;  1RK9 A;  2JQ6 A;  2DDC A;  1QYO A;  1MOV A;  1WRZ A;  4IL1 A;  1DC1 A;  2HQW A;  2VVH A;  1LA3 A;  1OMV A;  3RWT A;  3SG3 A;  2GW4 B;  1HQV A;  2WSN A;  4LJD C;  4J8A A;  3CZ0 A;  4DXN A;  1M63 B;  1PK0 D;  4J88 A;  1RMM A;  3Q8I A;  2QU1 A;  1QWV A;  3SS4 A;  2KPH A;  3E5T A;  4YGA A;  2JT0 A;  2GGZ A;  1IH0 A;  2L5X B;  1BJF A;  4ZCV A;  2L0P A;  2BCA A;  1Q4D A;  5F6T A;  1U5I A;  1SL8 A;  1R6P A;  4L1I A;  3WXA A;  4WQ2 A;  1CM4 A;  2HCG A;  1NSH A;  2DUI A;  1QJT A;  1FF1 A;  1KFU S;  1NX0 A;  2WUR A;  1K93 D;  1QX2 A;  2EC6 B;  3WLD A;  3A8S A;  1NWD A;  2EMN A;  1YJF A;  1NYA A;  2MJW B;  2G3O A;  1XFY O;  3DVK A;  2JU0 A;  3ST0 A;  3SSL A;  4NDD A;  4W6A A;  1C4F A;  3R1O A;  2M1K B;  3DQL A;  1CDL A;  1UHN A;  3KEV A;  3CDN A;  2OTG B;  3DPZ A;  1BU3 A;  4DXO A;  2A46 A;  1S36 A;  2G5Z B;  2L5Y A;  1TWO A;  3B7A A;  1EJ3 A;  2A56 B;  2BBN A;  2OGR A;  1NPQ A;  3GK1 A;  4PPK A;  2ZFD A;  1YVH A;  3O2P A;  2YE1 A;  2ZN8 A;  1WRK A;  3EKJ A;  1G4Y R;  3DQO A;  1CDP A;  1OOF A;  2FOT A;  3MGF A;  4GF6 B;  2ZNE A;  2ISD A;  3VRN A;  4PFE A;  3RZS A;  2KNE A;  2RH7 A;  4PE7 A;  1S26 D;  3BFB A;  3PM2 A;  2L4I A;  5H89 A;  2M29 A;  1OZS A;  2G6Y A;  2EHB A;  4GUK A;  1F54 A;  1B9C A;  4KF5 A;  2PVB A;  4OVN F;  3FE9 A;  4I5N B;  3LK0 A;  1ZGQ A;  1F70 A;  1XYD A;  2KAY A;  5DTX A;  1MOU A;  1MWN A;  5HZU A;  1ZMZ A;  4JEO A;  3D74 A;  1R2U A;  4W6L A;  2WHT A;  2JXL A;  3O4X A;  1QYQ A;  3SS0 A;  3SG5 A;  2H8V A;  5HZO A;  1PUL A;  2H2K A;  5DQM A;  1GFL A;  3BUN B;  2BL0 B;  3NSL A;  3GK4 X;  4PHK A;  4GGF A;  4ZF3 A;  4TZG A;  2Q91 A;  2EGD A;  5B8I B;  3R1P A;  4Z4M A;  4AS8 A;  2O29 A;  3ZTF A;  2WC6 A;  2PYQ A;  2DD9 A;  3U0N A;  4W76 A;  3A4U B;  5DRF A;  4KF4 A;  3A8R A;  3E5V A;  4C0J A;  2Y1M A;  2H9W A;  3ED8 A;  1L2O B;  3NSK A;  3NGV A;  2F8P A;  4P5O E;  2FZU A;  4GNK B;  1CFD A;  4Q9W A;  3SVN A;  3BJH A;  1EML A;  2LNK A;  4GFT A;  5BTT B;  4AQI A;  1DF0 A;  1XAE A;  3LVC A;  2KQ6 A;  1J7O A;  1RMO A;  4USL A;  4GOB A;  1XSS A;  2L98 A;  2JOJ A;  1MXL C;  2P70 A;  3CBE A;  2L50 A;  2O24 A;  5D7F A;  1ZUX A;  2ERB A;  3BOW B;  1BLQ A;  3DF0 A;  1IG5 A;  1QLK A;  1XFX O;  2H5Q A;  3SVD A;  4TZA A;  3EK8 A;  4W6T A;  5I2O A;  1JFK A;  1S5G Z;  4ETO A;  3OGO A;  3UG0 A;  2DUF A;  1OOH A;  3BUO B;  1SKT A;  2M7L A;  3CFA A;  1NCZ A;  1WRL A;  1FI6 A;  2EMD A;  1E8A A;  1XFV O;  1KP5 A;  2M9G A;  1LVC D;  4UPG A;  2YFP A;  1SL7 A;  1S5G Y;  3I5F B;  2E6W A;  3ZNI A;  1LS8 A;  3TDZ A;  3VRQ A;  1OXF A;  2WC8 A;  3OB2 B;  3BFA A;  3DYE A;  4NWS A;  5DRG A;  1OOJ A;  4MLW A;  3DQM A;  4JRB A;  2KLE A;  2B3Q A;  2JTZ A;  2CCM A;  2F3Z A;  1H6R A;  3KCT A;  2WCM A;  3DQH A;  5HZS A;  3GK2 A;  3CGL A;  3SSY A;  1SYM A;  4W6C A;  4Z4K A;  1BR1 B;  3L4A A;  3SVC A;  4XOV A;  1KWO B;  3S0A A;  3CB9 A;  4W6R A;  3BXK A;  2IB5 A;  1G7K A;  5IBW A;  1QV1 A;  3SVR A;  3LLE A;  2A54 B;  1GL4 A;  2Y0G A;  4AR7 A;  2EC6 C;  4KGF A;  4ZFS A;  3DY9 A;  2GX2 A;  2KYF A;  2ZND A;  2CNP A;  1C7V A;  2WCH A;  5T3I A;  4R6D A;  1CNP A;  1A4P A;  1QVI Y;  4F0Z B;  4GAO A;  1REC A;  3D10 A;  1M45 A;  2KI6 C;  1XQM A;  3EKH A;  4YBH B;  1S1E A;  2LVK A;  2WOR A;  2FJU B;  1A03 A;  1V1G A;  1L7Z A;  2LP3 A;  3B86 A;  2C9I A;  2QEO A;  2JAD A;  1OXE A;  5I8N A;  4FTG A;  3ZUL A;  2LVV A;  5DU0 A;  3BFH A;  4DUQ A;  1KFX L;  1N65 A;  4XOW A;  2F3Y A;  1WLM A;  4U8D A;  1SCM B;  3VHT A;  3S05 A;  1X02 A;  1NP8 A;  4PE0 A;  4LJD A;  5FYX A;  1Z4H A;  2B1U A;  2HQZ A;  4LJB A;  3B6X A;  4XJK B;  2ICR A;  2I18 A;  5KTY A;  2QLE A;  2M0R A;  3DQ8 A;  4JKT A;  4DXI A;  4W6K A;  3N7H A;  2M1U A;  4P76 A;  1S6C A;  1SK6 D;  1ZOT B;  2LUC A;  1PVA A;  4BY5 A;  3ICB A;  4JQ0 D;  3OBV A;  4PPL A;  5LTR A;  5EXU A;  1Y6W A;  3U0K A;  4PHJ A;  4L9M A;  1B8L A;  2JNF A;  1W7S A;  5DY6 A;  1OQP A;  2BL0 C;  2OKY A;  4XVP A;  4GBA A;  4PHM A;  2C9J A;  1S6J A;  2PAL A;  4GGN A;  1IIO A;  2KBI A;  1L2O C;  1KSM A;  1GJY A;  1YTZ C;  2JNX A;  1IGV A;  4JGE A;  1BMO A;  2OTE A;  4KGE A;  3BXC A;  5BQL A;  3L4L A;  3CZ1 A;  3CS1 A;  3I5H C;  3EVP A;  1CLM A;  2LLU A;  3R72 A;  3AAJ A;  4ORN A;  1DJW A;  2Q4U A;  2LAN A;  1DEL A;  1AJ4 A;  3O78 A;  1A29 A;  3DQE A;  1LXF C;  1NIW A;  1XFU O;  4DXM A;  1AP4 A;  2DUE A;  1UUR A;  2OPO A;  2BEC A;  1NX2 A;  2QEV A;  4DRW A;  2L51 A;  3VK1 A;  1DJG A;  1JF2 A;  1XFZ O;  2KSP A;  1ALW A;  5CPV A;  1TNP A;  4ZB1 A;  4L13 A;  2MHH A;  1QX5 B;  3SG7 A;  3VRO A;  3WHT B;  3SG4 A;  5FI7 A;  3KHE A;  1A2X A;  2KYC A;  3UNW A;  1IJ5 A;  2QT2 A;  2HJO A;  1K9P A;  1RTP 1;  2I94 A;  3NF0 A;  3SSK A;  3NEZ A;  1OZO A;  1GQM A;  3I5F C;  1G33 A;  3DQD A;  1S6Z A;  1Y1X A;  2K7B A;  4ZBL A;  2LMT A;  1KQM B;  2KLD A;  4OY4 A;  4CPV A;  4YGE B;  1U5I B;  1AVS A;  4OKH A;  2LUX A;  1WDC B;  3NSI A;  1N0Y A;  1UWO A;  3G9A A;  4EN1 A;  2DOQ A;  3PIB A;  2I7A A;  1EMM A;  2KQY A;  2QLG A;  1KWO C;  4ORB B;  2WC5 A;  1JBY A;  2FL1 A;  1T14 A;  2ZRS A;  3U8C A;  2G6X A;  3PJB A;  4W72 A;  5I2Q A;  1SL9 A;  2H5O A;  1TTX A;  3H1O A;  4JPZ B;  2BAP A;  4DKN A;  1SCV A;  5HLV A;  3IQQ A;  1JUO A;  1DGU A;  2H8Q A;  1F4Q A;  1UHK A;  1BOC A;  1GM0 A;  5DPJ A;  1SMG A;  1DJX A;  2KFH A;  2QDI A;  5BPJ A;  1J7R A;  3V2L A;  4JC2 A;  3KO0 A;  1YJ2 A;  1J7P A;  3JTD B;  1KFX S;  4H3M A;  1Z2C B;  4YGD B;  3SST A;  2AAO A;  1DJH A;  2JRF A;  2LHI A;  1JC2 A;  2G6E A;  2BTJ A;  3LF4 B;  4YGC B;  4MBE A;  3PFV A;  2ZO6 A;  1EMC A;  2K7D A;  4MZK A;  1EMF A;  4GPL B;  4B5Y A;  4W7C A;  2F2O A;  5CSI A;  4P2Y B;  3LVD A;  2H5P A;  4W73 A;  3UFZ A;  5H88 A;  2VVI A;  2I2R E;  1ZAC A;  5LTP A;  3CYZ A;  4N5X A;  5JJG A;  4Q9X A;  2P71 A;  4PPJ A;  2LVI A;  3CAB A;  5DPH A;  2KBM A;  2MRD A;  2QZ0 A;  4FQT A;  2KI4 B;  3DZT A;  2QLH A;  2ZKM X;  2A52 B;  3TDU A;  1DJI A;  2CT9 A;  2AH8 A;  1OOG A;  2M49 B;  4JD9 A;  3RM1 A;  4W69 A;  4QJ5 B;  4W77 A;  4C0K A;  3GJ1 A;  1UIS A;  3PJ7 A;  2BE4 A;  3LSA A;  1M46 A;  5AEQ A;  3S0D A;  3P8U A;  4DIR A;  2OS8 B;  2MA2 A;  3DQ9 A;  4PT1 A;  5DPG A;  3IQO A;  1IQ3 A;  1CB1 A;  1N2D A;  3NED A;  5HKZ A;  1JC1 A;  2PXS A;  2WHU A;  2WCE A;  2WCF A;  2DDD A;  3HX4 A;  3DQ2 A;  5PAL A;  1EMK A;  4IK8 A;  4ZF4 A;  1Y1U A;  2KDH A;  3D0Y A;  3WHU B;  3D73 A;  2KFG A;  4PHN A;  1MR8 A;  1DF0 B;  3QRX A;  1JSA A;  2JZI A;  2GW3 A;  2Y5I A;  1AJ5 A;  4HRG A;  3GOF A;  1IKU A;  3I5I C;  1CV7 A;  1HT9 A;  1W7I B;  3DF0 B;  4Q7R A;  1B7T Z;  2FWQ A;  3S0E A;  2L4H A;  4NQG A;  1H4U A;  1DT7 B;  1QY3 A;  3SJS A;  3HCM A;  2LAP A;  2F2P A;  5TNC A;  4N1F A;  4I5L B;  4MN0 A;  4HQ9 A;  2V4E C;  1Q4C A;  3SS3 A;  5G08 A;  5EL2 A;  2NLN A;  1C3Y A;  4I5J A;  4JF9 A;  1QXP A;  2SAS A;  3KPX A;  3DQU A;  3CD9 A;  1K94 A;  3PLF B;  4ZIO A;  2WIQ A;  1Q4B A;  4KPI A;  2ZN9 A;  1YRU B;  1XFR A;  2CBL A;  3PN7 B;  1EMG A;  1S3P A;  2LM5 A;  4RYW A;  1TNQ A;  3O6B A;  2PXW A;  4HRH A;  5FI6 A;  4B30 B;  1GGX A;  1GGW A;  1JBA A;  1IJ6 A;  3I19 A;  1FW4 A;  2LE9 B;  3P28 A;  3VRP A;  3OSQ A;  5DKQ A;  1ORG A;  1QV0 A;  2L2C A;  1EH2 A;  5DQB A;  2GX0 A;  3EK7 A;  1YUS A;  5KTG A;  3LK1 A;  5LTQ A;  3OHM B;  1F0B A;  4H3L A;  3OX5 A;  5J3X A;  1WLZ A;  4CID A;  3PSR A;  1H8B A;  1ZFS A;  3D77 A;  2F33 A;  5EB6 A;  3NT3 A;  5K89 A;  3I5G B;  2HQ8 A;  5BTT A;  5AFP A;  2WOS A;  4M2Q A;  3BXA A;  1JF0 A;  2NXQ A;  3O77 A;  1Q80 A;  5ER4 X;  4DCK A;  1SW8 A;  4PDZ A;  1MUX A;  2HET A;  3SVE A;  1NX3 A;  4DS7 A;  4R1E A;  1W7U A;  4W7D A;  4NDC A;  2PMY A;  1C07 A;  1BT6 A;  3BXB A;  2M3W A;  1YHI A;  2KFF A;  5FVI A;  3K21 A;  1YUT A;  5ER5 A;  1AK8 A;  2P6B B;  5HZT A;  5DTZ A;  4IK1 A;  4XGY A;  4W6G A;  1F71 A;  3VHT B;  3OX6 A;  2WCJ A;  1JFJ A;  3DQ6 A;  4DXQ A;  1CDM A;  1BF5 A;  3LCP C;  4IK9 A;  1XMZ A;  2OTG C;  1KYS A;  2A50 B;  1PRW A;  1KK7 Z;  4ORA B;  3DQ4 A;  3CZT X;  2HPS A;  3ST4 A;  3PAT A;  1UHJ A;  4MZJ A;  1UP5 A;  3BQ3 A;  3FWB A;  2RGI A;  1ZUZ A;  4XL5 A;  1B1G A;  1RRX A;  3BUW B;  3U8P A;  1P28 A;  1KYP A;  1LIN A;  1SRA A;  2HGY A;  1QS7 A;  2OS8 C;  2HPW A;  2VAE A;  1BFP A;  4L12 A;  4I2Y A;  3VB1 A;  2LHL A;  4W75 A;  2LMU A;  3CR2 A;  4LQU A;  1Q73 A;  4N1G A;  3WCK A;  2BKH B;  1LKJ A;  5DIC A;  3DPX A;  1MHO A;  3U8A A;  1TUJ A;  1KFU L;  5D3O A;  5HKW A;  2IE2 A;  4A4C A;  1CM1 A;  1PSB A;  2DUG A;  4XYN A;  1IWQ A;  1TUZ A;  2SCP A;  1MXE A;  3GJ2 A;  4H3N A;  3SG6 A;  1FPW A;  4EDS A;  1W7J B;  1B8C A;  2LCP A;  2CXJ A;  1ODB A;  4WRI A;  2OKW A;  3AKA A;  1SNL A;  5F9G A;  1BG1 A;  1CDN A;  1JBZ A;  2PAS A;  4GES B;  3GL4 A;  4CLN A;  3DPW A;  3M24 A;  4YGB B;  1FBV A;  3W1D A;  4CFR A;  1GGZ A;  1XFW O;  1CLL A;  1MQ1 A;  4W7R A;  1J1E A;  3PM8 A;  3VRR A;  5BT0 A;  2QRF A;  1PSR A;  5FVG A;  5I2L A;  3FIA A;  3SVS A;  2O2B A;  2PQL A;  1DMO A;  1A75 B;  4HQ8 A;  1K90 D;  3ST2 A;  4XJK A; 
#chains in the Genus database with same CATH homology
 1JC0 A;  2WND A;  3CD1 A;  2JTT A;  2JT3 A;  2D8N A;  5EHU A;  2OJK A;  1IQ5 A;  4JFG A;  3PN7 C;  4W74 A;  2K2F A;  1NCX A;  3IP2 A;  2MLE C;  2EMO A;  5HLO A;  3GB3 A;  2ARL A;  2ZO7 A;  2JXC A;  1DJY A;  1H4B A;  2M97 A;  1SR6 B;  2BKI B;  1YZW A;  2QLG B;  5EXC I;  5DTL A;  4OJ0 A;  2A48 A;  4LW5 A;  4RYS A;  1WY9 A;  3ST3 A;  1M31 A;  3LVA A;  1B9A A;  2K7O A;  3GEX A;  2K0J A;  1TRF A;  2COL B;  2K61 A;  4AOM A;  1KK8 B;  4M2P A;  3SG2 A;  4IK3 A;  4PCW A;  1B4C A;  2OTB A;  1F8H A;  4EMQ A;  1SY9 A;  2HRS A;  1FI5 A;  4W6O A;  1J1D A;  4TNC A;  4ICB A;  2AMI A;  1OMD A;  3TMR A;  4YI9 A;  2AWM A;  4W7A A;  1V1F A;  3KF9 A;  5DKR A;  1MF8 B;  5EBJ A;  4KEX A;  2LLS A;  2G2B A;  2V4E A;  2GGM A;  5AXI A;  2FCE A;  3DQJ A;  2KGR A;  1SBJ A;  3TMT A;  2LV7 A;  1KQV A;  4ZIN A;  4MSP A;  1Y0V H;  2Z6Z A;  4DKM A;  3TDI A;  1QTX A;  3MSE B;  3AI5 A;  3CFH A;  4W6M A;  2Q57 A;  3CR5 X;  3C1V A;  1CFP A;  2VAD A;  2M7N A;  5KU1 A;  3RLZ A;  1CLB A;  2KAX A;  2G2S B;  1CTR A;  2JC2 A;  3TS5 B;  1CFF A;  3W1C A;  3CFF A;  1AHR A;  4U2V A;  3U0L A;  1XA9 A;  2CTN A;  2AWL A;  2QPT A;  1K95 A;  3EVV A;  1F4O A;  1QIV A;  2WCB A;  3H4S E;  3OB1 B;  1SCM C;  2KI6 D;  3SVB A;  5AQB B;  1YX8 A;  2QLI A;  3VIC A;  3D0Y B;  3DVE A;  1TNX A;  3LA1 A;  3EK4 A;  4PAL A;  5FVF A;  1QAS A;  2Y1N A;  1QAT A;  3EVU A;  5EJU A;  3K1K A;  2PSR A;  4MRX A;  4M2O A;  1CMG A;  1RM9 A;  4PE1 A;  4D1E A;  5HKY A;  3TZ1 A;  3SSP A;  1BOD A;  2A47 A;  5DKN A;  4H47 A;  5EB7 A;  2VVJ A;  1W7T A;  5HGE A;  2YDZ A;  1K96 A;  2H61 C;  1AUI B;  2GV5 A;  1QYF A;  2LC5 A;  2HQK A;  3PJ5 A;  1JWD A;  1PVB A;  4W6N A;  2O5G A;  3WNX B;  2JT8 A;  2K8M B;  3DQN A;  2ZRT A;  5J2O A;  3DQI A;  1YHG A;  4EUL A;  2K7C A;  3BUX B;  2H5R A;  4W6S A;  1YHH A;  1XK4 C;  1KCY A;  2JWW A;  3SV5 A;  3SSH A;  1QIW A;  1CFC A;  1B7T Y;  3DD4 A;  3CLN A;  1UHI A;  3SIA A;  1SR6 C;  3CGA A;  4ORC B;  2IB6 A;  4N3D A;  4KAG A;  3E3R A;  3DQ7 A;  2AHA A;  4PE4 A;  4RTC A;  1K9K A;  1YVL A;  4EDO A;  4LJC A;  1XA5 A;  2ZMW A;  2B3P A;  4ZF5 A;  1EXR A;  3DQF A;  2O60 A;  4QJ3 B;  2MBX A;  5HW9 A;  1F09 A;  2JPT A;  2Y4Q A;  3I5H B;  1SPY A;  4FQO A;  1KQM C;  4MEW A;  2DUH A;  4BDU A;  3LS3 A;  2WSO A;  5FHV A;  4W6B A;  1KK8 C;  1OE9 B;  3LF3 A;  2KAV A;  5HBD A;  1VRK A;  1WDC C;  3V3D A;  3F45 A;  1RMP A;  2Z6Y A;  1TCO B;  1NUB A;  4WQ3 A;  4W7E A;  1QXT A;  2KGB C;  1Z1Q A;  3NXA A;  2VRG A;  2L2E A;  3JVT B;  3SVU A;  1RFJ A;  3SIB A;  4KW9 A;  3DVM A;  1DGV A;  2AUC A;  5KSZ A;  2H6V A;  1NCY A;  4UTS A;  2TN4 A;  4A4B A;  1F55 A;  3IR8 A;  1HUY A;  4P1Q A;  3DQ1 A;  3DQ3 A;  1ZGP A;  4OR9 B;  3PAL A;  3BYA A;  4HQC A;  4NDB A;  3SVO A;  1ALV A;  4W6F A;  3BOW A;  3CWG A;  2Z6X A;  5D69 A;  3JTD C;  3DQK A;  3DQ5 A;  3ZWH A;  1YUU A;  3TUY B;  1EME A;  3TS5 C;  4W6J A;  3M22 A;  4B30 A;  3DVJ A;  4KA9 A;  4MVF A;  1D1O A;  2MLF C;  4W6D A;  4OQW A;  4W6P A;  3CTN A;  3DQA A;  2G9B A;  4I5K A;  4KF5 C;  4IK4 A;  1TCF A;  4YRU A;  1YRT B;  1J55 A;  4ZCU A;  1QVI Z;  5GQQ C;  1B8R A;  3O4Y A;  2JUL A;  4OGS A;  5CSF A;  4J89 A;  1PAL A;  2KHN A;  2KI4 C;  3KCS A;  4OV2 A;  2K2A A;  1XVJ A;  4DXP A;  2Z1O A;  4JWQ A;  2WIS A;  5H87 A;  1C7W A;  1S6I A;  4YI8 A;  2LLT A;  1Q4A A;  3NT9 A;  2ZMU A;  1TNW A;  1KK7 Y;  3SRY A;  1QX7 A;  2WHS A;  3U0M A;  3ZUJ A;  1K9U A;  4W7X A;  2PRU A;  3ADF A;  4GGF C;  4HE4 A;  1YUR A;  4HRE E;  2AWJ A;  4W6I A;  2LMV A;  1CKK A;  1J7Q A;  3CR4 X;  3ZUF A;  3RWA A;  5EXB A;  2QAC A;  5DPI A;  4LQT A;  2VZX A;  4W7F A;  2BBM A;  1OXD A;  1RRO A;  3AAK A;  4IZN A;  5CSN A;  1TN4 A;  1IRJ A;  1EG4 A;  1YFP A;  5DTY A;  3BUM B;  5AAN A;  1HCJ A;  2HGD A;  1RWY A;  2KOT A;  2V53 A;  1EMA A;  4R6B A;  5CSJ A;  4AQJ A;  4Q7U A;  4KW4 A;  2IOV A;  2G3D B;  4W6U A;  2Q6P A;  3AI4 A;  3OSR A;  5JOL A;  5LK4 A;  1EMB A;  4H48 A;  3FS7 A;  4MZL A;  2BE6 A;  3AKO A;  4OHS A;  2MAZ A;  5HYD A;  1ZGO A;  2A53 B;  2BCB A;  2BCX A;  3E5W A;  1XO5 A;  2A4J A;  4Q7T A;  1B47 A;  3NSO A;  2NZ0 A;  1KYR A;  1RJV A;  2LVJ A;  4E68 A;  1G8I A;  2R2I A;  3SSV A;  4HSZ A;  3IF7 A;  3OP0 A;  1LA0 A;  2NCP A;  1BR4 B;  2G16 B;  1Q4E A;  3H1R A;  1KSO A;  2HFC A;  1TOP A;  2M8U A;  1CMF A;  1TIZ A;  2IS9 A;  3VGO A;  4OCI A;  1DVI A;  2LP2 A;  3I5I B;  1MYW A;  1OSA A;  4ANJ A;  3M0W A;  2POX A;  1YX7 A;  1EG3 A;  1K8U A;  3FWC A;  3DQC A;  3AKB A;  1NX1 A;  2YE0 A;  1EL4 A;  1Y1A A;  2FCD A;  2HF5 A;  4QJ4 B;  4BY4 A;  2AWK A;  2V4E B;  2H61 A;  3JVT C;  1QLS A;  4CFQ A;  1Z1P A;  1M39 A;  3I5G C;  1UHH A;  3LL8 B;  2E30 A;  3BX9 A;  1DJZ A;  1A75 A;  2NCO A;  2P4M A;  4C0L A;  4MRY A;  4KW8 A;  1OMR A;  1K2H A;  4Q04 A;  1DTL A;  1UUS A;  4W6H A;  4HVF A;  5AER A;  1XK4 A;  3EVR A;  3WLC A;  3TUY C;  4IK5 A;  2DD7 A;  1YR5 A;  1RK9 A;  2JQ6 A;  2DDC A;  1QYO A;  1MOV A;  1WRZ A;  4IL1 A;  2HQW A;  2VVH A;  1LA3 A;  1OMV A;  3RWT A;  3SG3 A;  2GW4 B;  1HQV A;  2WSN A;  4LJD C;  4J8A A;  4DXN A;  1M63 B;  1PK0 D;  4J88 A;  1RMM A;  2QU1 A;  3E5T A;  4YGA A;  2JT0 A;  2GGZ A;  1IH0 A;  2L5X B;  1BJF A;  4ZCV A;  2L0P A;  2BCA A;  1Q4D A;  5F6T A;  1U5I A;  1SL8 A;  1R6P A;  4L1I A;  3WXA A;  4WQ2 A;  1CM4 A;  2HCG A;  1NSH A;  2DUI A;  1QJT A;  1FF1 A;  1KFU S;  1NX0 A;  2WUR A;  1K93 D;  1QX2 A;  2EC6 B;  3WLD A;  3A8S A;  1NWD A;  2EMN A;  1YJF A;  1NYA A;  2MJW B;  2G3O A;  1XFY O;  3DVK A;  2JU0 A;  3ST0 A;  3SSL A;  4NDD A;  4W6A A;  1C4F A;  2M1K B;  3DQL A;  1CDL A;  1UHN A;  3KEV A;  2OTG B;  3DPZ A;  1BU3 A;  4DXO A;  2A46 A;  1S36 A;  2G5Z B;  1EJ3 A;  2A56 B;  2BBN A;  2OGR A;  1NPQ A;  3GK1 A;  4PPK A;  2ZFD A;  1YVH A;  3O2P A;  2YE1 A;  2ZN8 A;  1WRK A;  3EKJ A;  1G4Y R;  3DQO A;  1CDP A;  2FOT A;  3MGF A;  4GF6 B;  2ZNE A;  2ISD A;  3VRN A;  4PFE A;  2KNE A;  2RH7 A;  4PE7 A;  1S26 D;  2L4I A;  5H89 A;  2M29 A;  1OZS A;  2G6Y A;  2EHB A;  4GUK A;  1F54 A;  1B9C A;  4KF5 A;  2PVB A;  4OVN F;  4I5N B;  3LK0 A;  1ZGQ A;  1F70 A;  1XYD A;  2KAY A;  5DTX A;  1MOU A;  1MWN A;  5HZU A;  1ZMZ A;  4JEO A;  1R2U A;  4W6L A;  2WHT A;  2JXL A;  1QYQ A;  3SS0 A;  3SG5 A;  5HZO A;  1PUL A;  2H2K A;  5DQM A;  1GFL A;  3BUN B;  2BL0 B;  3NSL A;  3GK4 X;  4PHK A;  4GGF A;  4ZF3 A;  4TZG A;  2Q91 A;  2EGD A;  5B8I B;  4Z4M A;  4AS8 A;  2O29 A;  3ZTF A;  2DD9 A;  3U0N A;  4W76 A;  3A4U B;  5DRF A;  4KF4 A;  3A8R A;  3E5V A;  4C0J A;  2Y1M A;  2H9W A;  3ED8 A;  1L2O B;  3NSK A;  2F8P A;  4P5O E;  2FZU A;  4GNK B;  1CFD A;  4Q9W A;  3SVN A;  1EML A;  2LNK A;  4GFT A;  5BTT B;  4AQI A;  1DF0 A;  1XAE A;  3LVC A;  2KQ6 A;  1J7O A;  1RMO A;  4USL A;  4GOB A;  1XSS A;  2L98 A;  2JOJ A;  1MXL C;  3CBE A;  2L50 A;  2O24 A;  5D7F A;  1ZUX A;  3BOW B;  1BLQ A;  3DF0 A;  1IG5 A;  1QLK A;  1XFX O;  2H5Q A;  3SVD A;  4TZA A;  3EK8 A;  4W6T A;  5I2O A;  1JFK A;  1S5G Z;  4ETO A;  3OGO A;  3UG0 A;  2DUF A;  3BUO B;  1SKT A;  2M7L A;  3CFA A;  1NCZ A;  1WRL A;  1FI6 A;  2EMD A;  1E8A A;  1XFV O;  1KP5 A;  2M9G A;  1LVC D;  4UPG A;  2YFP A;  1SL7 A;  1S5G Y;  3I5F B;  2E6W A;  3ZNI A;  3TDZ A;  3VRQ A;  1OXF A;  2WC8 A;  3OB2 B;  4NWS A;  5DRG A;  1OOJ A;  4MLW A;  3DQM A;  4JRB A;  2B3Q A;  2JTZ A;  2CCM A;  2F3Z A;  1H6R A;  3KCT A;  3DQH A;  5HZS A;  3GK2 A;  3CGL A;  3SSY A;  1SYM A;  4W6C A;  4Z4K A;  1BR1 B;  3SVC A;  4XOV A;  1KWO B;  3CB9 A;  4W6R A;  3BXK A;  2IB5 A;  1G7K A;  5IBW A;  1QV1 A;  3SVR A;  3LLE A;  2A54 B;  1GL4 A;  2Y0G A;  4AR7 A;  2EC6 C;  4KGF A;  4ZFS A;  2GX2 A;  2KYF A;  2ZND A;  2CNP A;  1C7V A;  5T3I A;  4R6D A;  1CNP A;  1A4P A;  1QVI Y;  4F0Z B;  4GAO A;  1REC A;  3D10 A;  1M45 A;  2KI6 C;  1XQM A;  3EKH A;  4YBH B;  1S1E A;  2LVK A;  2WOR A;  2FJU B;  1A03 A;  1V1G A;  1L7Z A;  2LP3 A;  2C9I A;  2JAD A;  1OXE A;  5I8N A;  4FTG A;  3ZUL A;  2LVV A;  5DU0 A;  4DUQ A;  1KFX L;  1N65 A;  4XOW A;  2F3Y A;  1WLM A;  4U8D A;  1SCM B;  3VHT A;  3S05 A;  1X02 A;  1NP8 A;  4PE0 A;  4LJD A;  5FYX A;  2B1U A;  2HQZ A;  4LJB A;  4XJK B;  2ICR A;  2I18 A;  5KTY A;  2QLE A;  2M0R A;  3DQ8 A;  4DXI A;  4W6K A;  2M1U A;  4P76 A;  1S6C A;  1SK6 D;  1ZOT B;  2LUC A;  1PVA A;  4BY5 A;  3ICB A;  4JQ0 D;  5LTR A;  4PPL A;  5EXU A;  1Y6W A;  3U0K A;  4PHJ A;  4L9M A;  1B8L A;  2JNF A;  1W7S A;  5DY6 A;  1OQP A;  2BL0 C;  2OKY A;  4XVP A;  4GBA A;  4PHM A;  2C9J A;  1S6J A;  2PAL A;  4GGN A;  2KBI A;  1L2O C;  1KSM A;  1GJY A;  1YTZ C;  2JNX A;  1IGV A;  4JGE A;  1BMO A;  2OTE A;  4KGE A;  3BXC A;  5BQL A;  3CS1 A;  3I5H C;  3EVP A;  1CLM A;  2LLU A;  3AAJ A;  4ORN A;  1DJW A;  2Q4U A;  2LAN A;  1AJ4 A;  3O78 A;  1A29 A;  3DQE A;  1LXF C;  1NIW A;  1XFU O;  4DXM A;  1AP4 A;  2DUE A;  1UUR A;  2OPO A;  2BEC A;  1NX2 A;  4DRW A;  2L51 A;  3VK1 A;  1DJG A;  1JF2 A;  1XFZ O;  2KSP A;  1ALW A;  5CPV A;  1TNP A;  4ZB1 A;  4L13 A;  2MHH A;  1QX5 B;  3SG7 A;  3VRO A;  3WHT B;  3SG4 A;  3KHE A;  1A2X A;  2KYC A;  1IJ5 A;  2QT2 A;  2HJO A;  1K9P A;  1RTP 1;  2I94 A;  3NF0 A;  3SSK A;  3NEZ A;  1OZO A;  1GQM A;  3I5F C;  1G33 A;  3DQD A;  1S6Z A;  1Y1X A;  2K7B A;  4ZBL A;  2LMT A;  1KQM B;  4OY4 A;  4CPV A;  4YGE B;  1U5I B;  1AVS A;  4OKH A;  2LUX A;  1WDC B;  3NSI A;  1N0Y A;  1UWO A;  3G9A A;  4EN1 A;  2DOQ A;  3PIB A;  2I7A A;  1EMM A;  2KQY A;  2QLG A;  1KWO C;  4ORB B;  1JBY A;  2FL1 A;  2ZRS A;  3U8C A;  2G6X A;  3PJB A;  4W72 A;  5I2Q A;  1SL9 A;  2H5O A;  1TTX A;  3H1O A;  4JPZ B;  4DKN A;  1SCV A;  5HLV A;  3IQQ A;  1JUO A;  1DGU A;  2H8Q A;  1F4Q A;  1UHK A;  1BOC A;  5DPJ A;  1SMG A;  1DJX A;  2KFH A;  5BPJ A;  1J7R A;  4JC2 A;  3KO0 A;  1YJ2 A;  1J7P A;  3JTD B;  1KFX S;  4H3M A;  4YGD B;  3SST A;  2AAO A;  1DJH A;  2JRF A;  2LHI A;  1JC2 A;  2G6E A;  2BTJ A;  3LF4 B;  4YGC B;  4MBE A;  3PFV A;  2ZO6 A;  1EMC A;  2K7D A;  4MZK A;  1EMF A;  4GPL B;  4B5Y A;  4W7C A;  2F2O A;  5CSI A;  4P2Y B;  3LVD A;  2H5P A;  4W73 A;  3UFZ A;  5H88 A;  2VVI A;  2I2R E;  1ZAC A;  5LTP A;  4N5X A;  5JJG A;  4Q9X A;  4PPJ A;  2LVI A;  5DPH A;  2KBM A;  2MRD A;  2QZ0 A;  2KI4 B;  2QLH A;  2ZKM X;  2A52 B;  3TDU A;  1DJI A;  2CT9 A;  2AH8 A;  2M49 B;  3RM1 A;  4W69 A;  4QJ5 B;  4W77 A;  4C0K A;  3GJ1 A;  1UIS A;  3PJ7 A;  2BE4 A;  3LSA A;  1M46 A;  5AEQ A;  3P8U A;  4DIR A;  2OS8 B;  2MA2 A;  3DQ9 A;  5DPG A;  3IQO A;  1IQ3 A;  1CB1 A;  1N2D A;  3NED A;  5HKZ A;  1JC1 A;  2PXS A;  2WHU A;  2WCE A;  2WCF A;  2DDD A;  3HX4 A;  3DQ2 A;  5PAL A;  1EMK A;  4IK8 A;  4ZF4 A;  1Y1U A;  2KDH A;  3D0Y A;  3WHU B;  2KFG A;  4PHN A;  1MR8 A;  1DF0 B;  3QRX A;  1JSA A;  2JZI A;  2GW3 A;  2Y5I A;  1AJ5 A;  4HRG A;  3GOF A;  1IKU A;  3I5I C;  1CV7 A;  1HT9 A;  1W7I B;  3DF0 B;  4Q7R A;  1B7T Z;  2FWQ A;  2L4H A;  4NQG A;  1H4U A;  1DT7 B;  1QY3 A;  3SJS A;  3HCM A;  2LAP A;  2F2P A;  5TNC A;  4N1F A;  4I5L B;  4MN0 A;  4HQ9 A;  2V4E C;  1Q4C A;  5G08 A;  2NLN A;  4I5J A;  4JF9 A;  1QXP A;  2SAS A;  3KPX A;  3DQU A;  3CD9 A;  1K94 A;  3PLF B;  4ZIO A;  2WIQ A;  1Q4B A;  4KPI A;  2ZN9 A;  1YRU B;  2CBL A;  3PN7 B;  1EMG A;  1S3P A;  2LM5 A;  4RYW A;  1TNQ A;  3O6B A;  2PXW A;  4HRH A;  4B30 B;  1GGX A;  1GGW A;  1JBA A;  1IJ6 A;  3I19 A;  1FW4 A;  2LE9 B;  3P28 A;  3VRP A;  3OSQ A;  5DKQ A;  1QV0 A;  1EH2 A;  5DQB A;  2GX0 A;  3EK7 A;  1YUS A;  5KTG A;  3LK1 A;  5LTQ A;  3OHM B;  1F0B A;  4H3L A;  3OX5 A;  5J3X A;  1WLZ A;  4CID A;  3PSR A;  1H8B A;  1ZFS A;  2F33 A;  5EB6 A;  3NT3 A;  5K89 A;  3I5G B;  2HQ8 A;  5BTT A;  5AFP A;  2WOS A;  4M2Q A;  3BXA A;  1JF0 A;  2NXQ A;  3O77 A;  1Q80 A;  5ER4 X;  4DCK A;  1SW8 A;  4PDZ A;  1MUX A;  2HET A;  3SVE A;  1NX3 A;  4DS7 A;  4R1E A;  1W7U A;  4W7D A;  4NDC A;  2PMY A;  1C07 A;  1BT6 A;  3BXB A;  2M3W A;  1YHI A;  2KFF A;  5FVI A;  3K21 A;  1YUT A;  5ER5 A;  1AK8 A;  2P6B B;  5HZT A;  5DTZ A;  4IK1 A;  4XGY A;  4W6G A;  1F71 A;  3VHT B;  3OX6 A;  1JFJ A;  3DQ6 A;  4DXQ A;  1CDM A;  1BF5 A;  3LCP C;  4IK9 A;  1XMZ A;  2OTG C;  1KYS A;  2A50 B;  1PRW A;  1KK7 Z;  4ORA B;  3DQ4 A;  3CZT X;  2HPS A;  3ST4 A;  3PAT A;  1UHJ A;  4MZJ A;  1UP5 A;  3BQ3 A;  3FWB A;  2RGI A;  1ZUZ A;  4XL5 A;  1B1G A;  1RRX A;  3BUW B;  3U8P A;  1KYP A;  1LIN A;  1SRA A;  2HGY A;  1QS7 A;  2OS8 C;  2HPW A;  2VAE A;  1BFP A;  4L12 A;  4I2Y A;  2LHL A;  4W75 A;  2LMU A;  3CR2 A;  4LQU A;  1Q73 A;  4N1G A;  3WCK A;  2BKH B;  1LKJ A;  3DPX A;  1MHO A;  3U8A A;  5HKW A;  1KFU L;  2IE2 A;  4A4C A;  1CM1 A;  1PSB A;  2DUG A;  4XYN A;  1IWQ A;  2SCP A;  1MXE A;  3GJ2 A;  4H3N A;  3SG6 A;  1FPW A;  4EDS A;  1W7J B;  1B8C A;  2LCP A;  2CXJ A;  1ODB A;  4WRI A;  2OKW A;  3AKA A;  1SNL A;  5F9G A;  1BG1 A;  1CDN A;  1JBZ A;  2PAS A;  4GES B;  3GL4 A;  4CLN A;  3DPW A;  3M24 A;  4YGB B;  1FBV A;  3W1D A;  4CFR A;  1GGZ A;  1XFW O;  1CLL A;  1MQ1 A;  4W7R A;  1J1E A;  3PM8 A;  3VRR A;  5BT0 A;  2QRF A;  1PSR A;  5FVG A;  5I2L A;  3FIA A;  3SVS A;  2O2B A;  1DMO A;  1A75 B;  4HQ8 A;  1K90 D;  3ST2 A;  4XJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...