3EKJA

Calcium-free gcamp2 (calcium binding deficient mutant)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
318
structure length
301
Chain Sequence
LENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGGITTKQLGTVMRSLGQNPTEAELQDMINEVGGTIDFPQFLTMMARKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 78
structure length 301
sequence length 318
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekjA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekjA01
3NEDA 4AS8A 1J7PA 2OTEA 2FOTA 3U8CA 3SSKA 1K9UA 4AR7A 3AKBA 1Y6WA 4C0KA 1J55A 1JBAA 1RMMA 2A53B 4W7DA 1J1DA 4MN0A 3I5HC 1RM9A 5CPVA 3I5FB 1CMFA 3M24A 2JZIA 2M0RA 1TCOB 4C0JA 5HW9A 2GGMA 1S1EA 4TNCA 1TNQA 1F71A 3M0WA 2KGBC 1S6ZA 1K93D 3ST3A 3VHTA 3D10A 4CPVA 2DD9A 4ANJA 1E8AA 2COLB 4W7FA 2GW3A 1YRUB 1CDNA 2SASA 1CFCA 1JFKA 3JVTC 2GV5A 3NXAA 1YZWA 4YGCB 3TMTA 2OS8B 3EVPA 1Q4CA 5LTPA 4PE4A 1AJ5A 3OHMB 5HLOA 3NSOA 2M9GA 3O6BA 2M1KB 1CFPA 1SRAA 3U0KA 1NX1A 3DQ5A 1A75B 1Y1XA 2PXSA 2OTGC 1S6JA 2HGDA 2L0PA 1NIWA 3VROA 3DQAA 4AQIA 3KF9A 2JT8A 1AK8A 1NP8A 3PJBA 1MF8B 1B8CA 4U2VA 1WLMA 2ZRTA 1H8BA 1PVBA 4EULA 5BPJA 2QLGA 4P76A 1OSAA 1XK4C 1K8UA 3CZTX 1EG3A 3CFFA 2KQ6A 5BTTB 2PMYA 1YVHA 1JBYA 4ZFSA 3SVEA 1EMBA 5I2LA 3QRXA 3DPZA 5JOLA 2K7OA 4KF4A 4TZAA 2BECA 1AUIB 5FYXA 3WCKA 1AVSA 4DS7A 4XOVA 2QU1A 3CTNA 1EXRA 3UG0A 3VRNA 2ZO6A 1YVLA 1EMKA 5HZOA 2WHTA 3SRYA 3GB3A 4PE7A 1RRXA 5FHVA 2O24A 2HF5A 3SVUA 4ORCB 3E5TA 4R1EA 5D7FA 1UHJA 3AKAA 1N2DA 3I5IC 2LVVA 1J1EA 3BUWB 4RYSA 2PXWA 4W6AA 3BOWB 4W73A 2QZ0A 1YFPA 4DXIA 1BG1A 1CDPA 1RWYA 1MYWA 3LK1A 1YX8A 2OGRA 3DQCA 1OE9B 3E3RA 2HQ8A 2ZO7A 4YGAA 1JSAA 5HBDA 1W7SA 3TS5B 1PSRA 2L5XB 2H8QA 1QX2A 3SVRA 3DQUA 3RWTA 2OJKA 2ZNDA 1YHIA 1CB1A 3EVRA 1F55A 2AWKA 4DKNA 2ZRSA 1YHGA 2YE0A 1OXFA 2IB5A 1GGWA 1QS7A 5KSZA 1WY9A 3OX5A 1TRFA 3CFHA 1XVJA 2MRDA 2G16B 2NLNA 2G5ZB 2MJWB 1OXDA 5F6TA 3DPXA 4OR9B 1WDCC 1AJ4A 2Q57A 1CDMA 1SBJA 4XJKA 1UP5A 1KYPA 1Q4BA 2DDDA 3DQOA 4W6PA 1QLKA 3WLDA 2DDCA 3GJ2A 4OY4A 2DUGA 3U0NA 4YGDB 3I5FC 1CTRA 4HQ8A 1KSMA 4JF9A 3WNXB 4DRWA 2HQKA 2VZXA 5HKYA 4MSPA 3BUMB 2CCMA 3DQ3A 5EB6A 1F8HA 1QV0A 3D0YA 2L4HA 1BJFA 4N1FA 3HX4A 5FVIA 2L50A 3U0LA 4RYWA 2WURA 4GF6B 1KSOA 2GX0A 1CLBA 2V53A 3SV5A 4L9MA 2F8PA 1EMMA 4H47A 2EMDA 1XO5A 1DT7B 2G3OA 2KOTA 2VRGA 4P5OE 1MXLC 1RFJA 1J7OA 2OKWA 1DMOA 4KGEA 4W6UA 1FF1A 1IKUA 1EMLA 1W7IB 2PRUA 5DU0A 3CB9A 3H1RA 2LP3A 1XSSA 2A47A 2M8UA 1QXPA 4NDBA 4D1EA 3LLEA 4W7EA 2GW4B 1RROA 4WQ2A 4IK8A 3SG2A 4P2YB 4ZINA 5HZTA 3PLFB 2A54B 2VVJA 4GUKA 4KA9A 1ZUZA 2JT0A 1QIVA 1YR5A 1NYAA 2KFFA 4DUQA 3DQ1A 4WQ3A 2KI4B 2PALA 4IK3A 2JTZA 4IK1A 3K1KA 2KDHA 4J8AA 2KSPA 1A03A 4N1GA 4W6TA 5DPGA 1J7RA 2H5PA 2LNKA 2DUFA 3O77A 3AAJA 2LVIA 5AQBB 4W6LA 2LMUA 3MSEB 1NX0A 4YGBB 3PFVA 1KYRA 4W72A 2WC8A 4GAOA 1TOPA 4PHMA 2Z6ZA 3DQEA 5TNCA 1BFPA 1K9PA 4J88A 3FS7A 2FJUB 4MEWA 2DOQA 3RLZA 4CIDA 3DQNA 4JGEA 2KBMA 2KFHA 2G6YA 1DF0B 3CGLA 2JADA 5EB7A 5PALA 2QLEA 2L51A 1KFXL 1QATA 1PVAA 1KYSA 2KFGA 4I5JA 4XGYA 4MZKA 2LE9B 2M97A 2ZFDA 5EXCI 2IB6A 2KNEA 3DQ7A 1W7JB 1YURA 2M3WA 3GEXA 4IK4A 3V3DA 3BXAA 2G2BA 4GBAA 4W6HA 4MRYA 4HSZA 2KYFA 4A4CA 3TS5C 4HQCA 4DXMA 2A4JA 4W7CA 3GK4X 1GJYA 1UURA 1CM1A 5F9GA 2Y4QA 2QACA 4FTGA 1XMZA 2NZ0A 3H4SE 3OSRA 1YX7A 1VRKA 3DVEA 5AEQA 4N5XA 2KBIA 1PK0D 1KK7Z 1NUBA 2FZUA 2G6EA 3KCTA 3JTDB 5FVFA 1G33A 5AXIA 3SG5A 1B9CA 4ZBLA 1CLLA 4W6MA 1CFDA 4DXQA 2MA2A 2EC6B 4I5LB 1RJVA 1B47A 5HZSA 4W6BA 1OMVA 2IOVA 1LXFC 4YI8A 1YRTB 1IH0A 4DKMA 2G3DB 3E5WA 4ZCVA 1YUUA 1JUOA 2HJOA 2MHHA 1CKKA 1ZOTB 1L7ZA 4HE4A 2A52B 2JNXA 1NWDA 3FWBA 3BXKA 1F54A 1ZUXA 3DD4A 4A4BA 5I2OA 1SCMC 2V4EC 2H5OA 1KQMB 1G4YR 5AANA 2M49B 3WLCA 2CXJA 3O78A 3ICBA 1NX2A 1QASA 2H2KA 3I5GB 5HZUA 3DQIA 2JXCA 2EGDA 1NCXA 4LQTA 1KWOB 1IJ6A 2AAOA 3VRPA 1LVCD 3TDUA 4IL1A 1HQVA 4GPLB 1Q4DA 2LHIA 1B7TZ 3PJ7A 4TZGA 3SSYA 4F0ZB 1G7KA 3DF0A 1Y1AA 4I5NB 5I8NA 1FBVA 3OB1B 4OJ0A 2R2IA 2M7LA 3D0YB 1K9KA 4GOBA 3GL4A 2KAYA 5H88A 1ALVA 1QJTA 2P4MA 5DPJA 2ZNEA 1NCYA 2DUIA 4OKHA 1JC2A 3DQHA 1Y1UA 1R6PA 1M63B 1AP4A 3SVSA 4W7AA 1GGZA 1GL4A 2MLEC 2C9IA 2HFCA 1K94A 3SG3A 2A48A 1YUSA 4MZJA 4GFTA 1DGVA 2AMIA 1IGVA 4RTCA 4JWQA 3SS0A 2BCAA 1RMPA 2LVJA 1ZGOA 4GGFC 1CNPA 5DTYA 1XK4A 4PCWA 4P1QA 3CR5X 3DQLA 5HGEA 3SVDA 2SCPA 1MXEA 1YJ2A 2MAZA 3BUNB 3DQJA 4BY4A 2GGZA 2YE1A 1EMAA 4JQ0D 3TUYB 3O4YA 2O5GA 1RTP1 3TDZA 1GQMA 4MRXA 3OSQA 4Z4MA 2O60A 3ST4A 5H87A 2LUCA 2Y1NA 4HRGA 2BBMA 2VVIA 4R6BA 5LTQA 1JC1A 2ZMUA 1Q73A 2K2AA 1MQ1A 4W6CA 3EK8A 2A56B 2WSNA 2HGYA 1KCYA 2JXLA 5HYDA 2A50B 1MR8A 2BCXA 2Z1OA 1M46A 2EMOA 4XYNA 1XFUO 3PATA 4YI9A 1KK8B 3EVVA 1L2OB 1DJWA 4DXPA 4KW8A 4JRBA 4Q7RA 3JTDC 3SG4A 3TDIA 1NSHA 1JC0A 5LTRA 1QV1A 5CSIA 2B1UA 4QJ3B 4ORNA 3SJSA 3NSLA 4PE0A 2KGRA 4OV2A 3W1CA 3CLNA 4W76A 4W77A 1XFZO 3IF7A 1C4FA 1SR6B 3GK2A 2YDZA 1B8LA 2K7CA 2OTBA 2FWQA 4CFQA 1Q4AA 3LVDA 3LVCA 1B9AA 1SL7A 5B8IB 1S6CA 2PASA 1PULA 1SW8A 2OKYA 2OPOA 4W6SA 2K7DA 2JU0A 2HQZA 3DPWA 1KK7Y 5EJUA 2H61C 3ZULA 1BR4B 3DVJA 2KAXA 4Q04A 1WRKA 1BOCA 3A8SA 4Q9XA 2FCEA 3PALA 3I5GC 1F09A 1BMOA 1KWOC 1OMDA 1W7UA 1UHKA 3DQ9A 2G2SB 1QYFA 1BT6A 3LS3A 1SCVA 2IS9A 2VAEA 4KW4A 2MBXA 2QRFA 2QLIA 1CLMA 3NSKA 3VRRA 3GJ1A 2WSOA 4AQJA 2E30A 3AAKA 4DIRA 4M2QA 1XA5A 3ZUJA 3I5HB 3EVUA 2OS8C 5HKZA 1C7VA 3SSPA 2KI6C 4IK5A 1M39A 4PHKA 4W6GA 2M1UA 3SG7A 1F70A 3DQ8A 5DQBA 1ZGQA 1A75A 3EKHA 3VHTB 1A29A 2JQ6A 4ZIOA 1OOJA 5DKRA 1BF5A 5DPHA 5HKWA 2TN4A 4L13A 1TTXA 3E5VA 2H6VA 3KO0A 3LF3A 1DTLA 1B7TY 2JC2A 4KW9A 2H5RA 4C0LA 5EXUA 1UHIA 1DJYA 5BT0A 2BTJA 5BTTA 3HCMA 3P8UA 1KFUS 5LK4A 1XAEA 3BUOB 1YHHA 2O2BA 2RH7A 3TUYC 3KEVA 2MLFC 1UHHA 4Z4KA 4GGNA 3SSHA 1JFJA 4ZF4A 2ARLA 1DJGA 1B4CA 1HT9A 5DKNA 1S36A 2HPWA 2JRFA 5J2OA 1DGUA 1JF2A 3ZWHA 3DQMA 2EMNA 4W69A 2LCPA 1BU3A 2QLGB 1TIZA 4NWSA 1B1GA 2G6XA 1EMGA 2BCBA 4YRUA 2KYCA 4IK9A 2CNPA 4OHSA 2AHAA 1RK9A 2LC5A 4I5KA 4MVFA 3VK1A 1C07A 2ZMWA 2FCDA 2Y5IA 2QT2A 1ALWA 1UUSA 3DQDA 2H5QA 2LM5A 2LAPA 1G8IA 4OCIA 3U8PA 4H3MA 4DXNA 1KK8C 4JC2A 2K8MB 1L2OC 3PN7B 1SY9A 1TN4A 4M2OA 1Y0VH 5DQMA 4B30A 3AI4A 1TCFA 2LMVA 4OQWA 4LJCA 3VRQA 2Y0GA 3NT3A 4JEOA 1F4OA 1XYDA 4PDZA 3I5IB 5DTLA 1NPQA 2ZKMX 4LJDC 1QX5B 1EH2A 5AFPA 1V1GA 1SR6C 2F33A 1CDLA 3TZ1A 2LVKA 3CD9A 1K90D 3C1VA 3DQ4A 3KHEA 2KQYA 1QX7A 2L4IA 2LHLA 1NCZA 5HLVA 4LJBA 5DRFA 4KF5C 4GNKB 3EK7A 4KEXA 5DTZA 4QJ5B 1CV7A 3CD1A 1QXTA 1MOVA 2Q6PA 1WLZA 4PHNA 4EN1A 2KI6D 1GFLA 1BLQA 3PM8A 4AOMA 3O2PA 1MHOA 1S6IA 1Q4EA 1EMEA 3OGOA 1EMCA 4W7RA 1XQMA 2V4EA 3U8AA 4FQOA 1IJ5A 1WDCB 4M2PA 3WHTB 4XJKB 3H1OA 4L12A 1EL4A 2F3ZA 1H4UA 4MZLA 3LVAA 2HPSA 2LLTA 1B8RA 2K0JA 2NCPA 5EXBA 2I94A 4QJ4B 4Q9WA 2K2FA 3UFZA 4HQ9A 2WHSA 2F3YA 3FWCA 2PSRA 3BUXB 1S5GZ 1M45A 2CTNA 4DCKA 1CFFA 2JULA 1K96A 3A4UB 1XFVO 1J7QA 1LA3A 1A2XA 2DUHA 3W1DA 1OXEA 2JPTA 1TNPA 5ER4X 1U5IA 2Q91A 4NQGA 2M29A 3RWAA 2I7AA 1XFWO 4NDCA 1QTXA 3GOFA 2WHUA 1QVIZ 4CLNA 3DQKA 3EKJA 2VVHA 2KI4C 1MUXA 1IG5A 3OP0A 3ADFA 3SVOA 4ORAB 4EMQA 1LINA 1SYMA 4H3LA 1RMOA 2PVBA 4BDUA 1FPWA 1SPYA 2LP2A 4GGFA 1MWNA 3LSAA 3SSLA 4UPGA 4W6IA 5H89A 2Y1MA 1Z1QA 2F2PA 1ODBA 2ZN9A 2BL0B 3BYAA 2HETA 2JTTA 2A46A 1N0YA 1YUTA 1ZFSA 1DF0A 4W6RA 2D8NA 5CSFA 4YBHB 2HCGA 2Q4UA 5CSJA 4W7XA 3OX6A 1YTZC 2WNDA 1QYQA 3DQ2A 1YJFA 4ZB1A 3MGFA 3NT9A 3NF0A 2NCOA 3AI5A 4ETOA 4LQUA 3PN7C 2H9WA 4N3DA 1BODA 3LK0A 4ZF3A 1KP5A 2E6WA 1OMRA 1EMFA 1QY3A 4ICBA 3FIAA 3CGAA 3NEZA 3ST0A 5DPIA 4W6NA 4MBEA 2ICRA 3AKOA 2JWWA 3K21A 3BXCA 2G9BA 3SVBA 3SVCA 2BE4A 1SK6D 4KPIA 1F0BA 2EC6C 1HCJA 2WCEA 1JF0A 1LKJA 4PE1A 1IQ3A 2L98A 3PSRA 3IR8A 4ORBB 4B30B 3SG6A 5DY6A 1S3PA 2HQWA 2AUCA 2QPTA 2CBLA 2BBNA 1R2UA 1N65A 4KAGA 1DJXA 4HVFA 2HRSA 1FW4A 1GGXA 4B5YA 3ED8A 2H61A 5EBJA 2C9JA 1CM4A 2AWLA 1KQMC 1RECA 3IQQA 3DQFA 2BE6A 3LF4B 2WCFA 4YGEB 2KHNA 3LCPC 1JBZA 3DQ6A 3OB2B 2WISA 4W6KA 3KCSA 2ZN8A 2P6BB 5I2QA 1DJHA 5FVGA 2POXA 2LLSA 1K95A 2M7NA 3KPXA 1EG4A 1X02A 4PPLA 2DUEA 1CMGA 3SVNA 3PIBA 2B3PA 4ZF5A 2WCBA 2LMTA 4E68A 4XOWA 1XFYO 3RM1A 2Z6YA 1SCMB 2V4EB 2B3QA 3A8RA 3DVKA 1A4PA 3IP2A 1IRJA 1K2HA 3VGOA 2GX2A 2CT9A 2FL1A 3ZTFA 5KTGA 4CFRA 4LW5A 4PPJA 4BY5A 4L1IA 1S26D 2BKIB 1SL8A 2LANA 5CSNA 1XFXO 1H6RA 3DF0B 5GQQC 4OVNF 1Q80A 3JVTB 1S5GY 4MLWA 2JOJA 3WHUB 1KFXS 1OZSA 4U8DA 1V1FA 1U5IB 3BX9A 1ZGPA 1LA0A 4OGSA 2DD7A 1IWQA 1SL9A 3VICA 2VADA 2QLHA 2NXQA 2OTGB 1OZOA 2BL0C 1SMGA 3NSIA 4NDDA 1UWOA 1QVIY 2L2EA 2F2OA 2BKHB 5KTYA 2WIQA 4EDOA 3SIAA 5DKQA 2LV7A 2WORA 4W75A 2JT3A 3EK4A 3BXBA 5IBWA 1UISA 3CS1A 3CR2A 1WRLA 4W6OA 4XL5A 4PALA 4W6JA 4ZCUA 2WOSA 1C7WA 4HREE 2JNFA 1W7TA 4DXOA 1OQPA 2Z6XA 1M31A 1IQ5A 1FI6A 4KGFA 3CFAA 2I2RE 4J89A 5D69A 1JWDA 2K7BA 3BOWA 3LL8B 4H3NA 4W6FA 4WRIA 1FI5A 5DTXA 2I18A 2KAVA 1DVIA 3SSVA 4IZNA 4Q7UA 3IQOA 1AHRA 5EHUA 4Q7TA 5K89A 1Z1PA 5DRGA 3S05A 1ZMZA 2EHBA 4USLA 2RGIA 1XA9A 1PSBA 1KQVA 2AWMA 5J3XA 5JJGA 3I19A 5ER5A 1KFUL 1SNLA 1NX3A 3CBEA 1F4QA 1ZACA 3SIBA 5KU1A 4HRHA 1WRZA 3GK1A 4PHJA 1H4BA 5BQLA 1DJZA 2AWJA 4LJDA 1QIWA 1MOUA 1UHNA 3M22A 1HUYA 3DVMA 2O29A 3PJ5A 1QYOA 3WXAA 3ZNIA 4JPZB 4W74A 4W6DA 1QLSA 1D1OA 2IE2A 3ST2A 4KF5A 3U0MA 3CR4X 4UTSA 4I2YA 1DJIA 2LLUA 3CWGA 3SSTA 4XVPA 4H48A 5T3IA 1PRWA 4GESB 4EDSA 2LUXA 3G9AA 2K61A 4JFGA 1PALA 3TMRA 3ZUFA 3BQ3A 2ISDA 2AH8A 3LA1A 2YFPA 1BR1B 1SKTA 5AERA 4PFEA 3F45A 1EJ3A 5G08A 3P28A 1TNWA 4R6DA 1TNXA 4PPKA
chains in the Genus database with same CATH superfamily
2YGUA 3NEDA 4AS8A 1J7PA 2OTEA 2FOTA 3U8CA 3SSKA 1K9UA 4AR7A 3AKBA 1Y6WA 4C0KA 1J55A 1JBAA 1RMMA 2A53B 4W7DA 1J1DA 3B87A 4MN0A 3I5HC 1RM9A 5CPVA 3I5FB 1CMFA 3M24A 2JZIA 2M0RA 1TCOB 4C0JA 5HW9A 2QEVA 2GGMA 1S1EA 4TNCA 1TNQA 1F71A 3M0WA 2KGBC 1S6ZA 1K93D 3ST3A 3VHTA 3D10A 4CPVA 2DD9A 4ANJA 1E8AA 2COLB 4W7FA 3L4AA 2GW3A 1YRUB 1CDNA 2PYQA 2SASA 1CFCA 1JFKA 3JVTC 2GV5A 3NXAA 1YZWA 1TWOA 4YGCB 3TMTA 2OS8B 3EVPA 1Q4CA 5LTPA 4PE4A 1AJ5A 3OHMB 5HLOA 3NSOA 2M9GA 3O6BA 2M1KB 1CFPA 1SRAA 3U0KA 1NX1A 3DQ5A 1A75B 1Y1XA 2PXSA 2OTGC 1S6JA 2HGDA 3NHIA 4PT1A 2L0PA 1NIWA 3VROA 3DQAA 4AQIA 3KF9A 2JT8A 1AK8A 1NP8A 3PJBA 1MF8B 1B8CA 1OOGA 4U2VA 1WLMA 3CZ2A 2ZRTA 1H8BA 1PVBA 4EULA 5BPJA 2QLGA 4P76A 1OSAA 1XK4C 1K8UA 3CZTX 1EG3A 3CFFA 2KQ6A 5BTTB 3N7HA 2PMYA 1YVHA 1JBYA 4ZFSA 3SVEA 1EMBA 5I2LA 3QRXA 3DPZA 2ERBA 5JOLA 2K7OA 4KF4A 4TZAA 2BECA 1AUIB 5FYXA 1T14A 3WCKA 1AVSA 3FE8A 3CABA 4DS7A 4XOVA 2QU1A 3CTNA 1EXRA 3UG0A 3VRNA 2ZO6A 1YVLA 1EMKA 5HZOA 2WHTA 3SRYA 3GB3A 4PE7A 1RRXA 5FHVA 2O24A 2HF5A 3SVUA 4ORCB 3E5TA 4R1EA 5D7FA 1UHJA 3AKAA 1N2DA 3I5IC 2LVVA 1J1EA 3BUWB 3S0EA 4RYSA 2PXWA 4W6AA 3BOWB 4W73A 2QZ0A 1YFPA 4DXIA 1BG1A 1CDPA 1RWYA 1MYWA 3LK1A 1YX8A 2OGRA 3DQCA 1OE9B 3E3RA 2HQ8A 3L4LA 2ZO7A 4YGAA 1JSAA 5HBDA 1W7SA 3TS5B 1PSRA 2L5XB 2H8QA 1QX2A 3SVRA 3DQUA 3RWTA 2OJKA 2ZNDA 1YHIA 1CB1A 3EVRA 1F55A 2AWKA 4DKNA 2ZRSA 1YHGA 2YE0A 1OXFA 2IB5A 1GGWA 1QS7A 1DQEA 5KSZA 1WY9A 3OX5A 2K60A 1TRFA 3CFHA 1XVJA 2MRDA 2G16B 2NLNA 3RZSA 2G5ZB 2MJWB 1OXDA 5F6TA 3DPXA 4OR9B 1WDCC 1AJ4A 2Q57A 1CDMA 1SBJA 4XJKA 1UP5A 3PM2A 1KYPA 5FI6A 1Q4BA 2DDDA 3DQOA 4W6PA 1QLKA 3WLDA 2DDCA 3GJ2A 4OY4A 2QEOA 2DUGA 3U0NA 4YGDB 3I5FC 1CTRA 4HQ8A 1KSMA 3D78A 1TUJA 4JF9A 3WNXB 4DRWA 2HQKA 2QEBA 2VZXA 5HKYA 1Z2CB 2BAPA 4MSPA 3BUMB 2CCMA 3DQ3A 5EB6A 1F8HA 2KLDA 1QV0A 3D0YA 2L4HA 1BJFA 4N1FA 3HX4A 5FVIA 2L50A 3U0LA 1GM0A 4RYWA 1DC1A 2WURA 4GF6B 1KSOA 2GX0A 1CLBA 2V53A 3SV5A 4L9MA 2F8PA 1EMMA 4H47A 2EMDA 1XO5A 1DT7B 2G3OA 2KOTA 2VRGA 4P5OE 1MXLC 1RFJA 1J7OA 2OKWA 1DMOA 4KGEA 4W6UA 1FF1A 1IKUA 1EMLA 1W7IB 2PRUA 5DU0A 3CB9A 3H1RA 1IIOA 2LP3A 1XSSA 2A47A 2M8UA 1QXPA 4NDBA 4D1EA 3LLEA 4W7EA 2GW4B 3FE9A 1RROA 4WQ2A 4IK8A 3SG2A 3PJIA 4P2YB 4PPKA 4ZINA 5HZTA 3SS4A 3PLFB 2A54B 2VVJA 4JKTA 4GUKA 4KA9A 1ZUZA 2JT0A 1QIVA 1YR5A 1NYAA 2KFFA 4DUQA 3DQ1A 4WQ3A 2KI4B 2PALA 4IK3A 2JTZA 4IK1A 3K1KA 2KDHA 4J8AA 2KSPA 1A03A 4N1GA 4W6TA 5DPGA 1J7RA 2H5PA 2LNKA 2DUFA 3O77A 3AAJA 2LVIA 5AQBB 4W6LA 2LMUA 3MSEB 1NX0A 4YGBB 3PFVA 1KYRA 4W72A 2WC8A 4GAOA 1TOPA 4PHMA 3DYEA 2Z6ZA 3DQEA 5TNCA 1BFPA 1K9PA 4J88A 3FS7A 2FJUB 4MEWA 2DOQA 3RLZA 4CIDA 3DQNA 4JGEA 3IVTA 2KBMA 5HL1A 2KFHA 2G6YA 1DF0B 3CGLA 2JADA 5EB7A 5PALA 2QLEA 2L51A 1KFXL 1QATA 1PVAA 1KYSA 2KFGA 4I5JA 4XGYA 4MZKA 2LE9B 2M97A 2ZFDA 5EXCI 3D74A 2IB6A 2KNEA 3DQ7A 1W7JB 1YURA 2M3WA 3GEXA 4IK4A 3V3DA 3BXAA 2P70A 2G2BA 4GBAA 4W6HA 3OBVA 4MRYA 4HSZA 2KYFA 2GTEA 4A4CA 3SS5A 3D76A 3TS5C 4HQCA 4DXMA 2A4JA 4W7CA 3GK4X 1GJYA 1UURA 1CM1A 5F9GA 2Y4QA 2QACA 4FTGA 1XMZA 2NZ0A 3H4SE 3OSRA 1YX7A 1VRKA 3DVEA 5AEQA 4N5XA 2KBIA 1PK0D 3CYZA 2KLEA 1KK7Z 1NUBA 2FZUA 2G6EA 3KCTA 3JTDB 5FVFA 1G33A 5AXIA 3SG5A 1B9CA 4ZBLA 1CLLA 4W6MA 1CFDA 4DXQA 2MA2A 2EC6B 4I5LB 1RJVA 1B47A 5HZSA 4W6BA 1OMVA 2IOVA 1LXFC 4YI8A 1YRTB 1IH0A 4DKMA 2G3DB 3E5WA 4ZCVA 1YUUA 1JUOA 2HJOA 2MHHA 1CKKA 1ZOTB 1L7ZA 4HE4A 2A52B 2JNXA 1NWDA 3FWBA 3BXKA 1F54A 1ZUXA 3DD4A 4A4BA 5I2OA 1SCMC 2V4EC 2H5OA 1KQMB 1G4YR 1ORGA 5AANA 2M49B 3WLCA 2CXJA 3O78A 3ICBA 1NX2A 3BFBA 3B88A 1QASA 2H2KA 3I5GB 5HZUA 3DQIA 2JXCA 2EGDA 1NCXA 4LQTA 1KWOB 1IJ6A 2AAOA 3VRPA 1LVCD 3TDUA 4IL1A 1HQVA 4GPLB 1Q4DA 2LHIA 1B7TZ 3PJ7A 4TZGA 3SSYA 4F0ZB 1G7KA 3DF0A 5EL2A 1Y1AA 4I5NB 5I8NA 1FBVA 3OB1B 4OJ0A 2R2IA 2M7LA 3D0YB 1K9KA 4GOBA 3GL4A 2KAYA 5H88A 1ALVA 1QJTA 2P4MA 5DPJA 2ZNEA 1NCYA 2DUIA 4OKHA 1JC2A 3DQHA 1Y1UA 4INWA 1R6PA 1M63B 1OW4A 1AP4A 3SVSA 4W7AA 1GGZA 1GL4A 2MLEC 3UNWA 2C9IA 2HFCA 1K94A 3SG3A 2A48A 1YUSA 3S0BA 4MZJA 4GFTA 1DGVA 2AMIA 1IGVA 4RTCA 4JWQA 3SS0A 2BCAA 3UO9A 2FJYA 2H8VA 1RMPA 2LVJA 1ZGOA 4GGFC 1CNPA 5DTYA 1XK4A 4PCWA 1P28A 4P1QA 3CR5X 3DQLA 5HGEA 3SVDA 2SCPA 1MXEA 1YJ2A 2MAZA 3BUNB 2L5YA 3DQJA 4BY4A 2GGZA 2YE1A 1EMAA 4JQ0D 3TUYB 3O4YA 2O5GA 1RTP1 3TDZA 1GQMA 4MRXA 1TUZA 3OSQA 4Z4MA 2O60A 3ST4A 5H87A 2LUCA 2Y1NA 4HRGA 2BBMA 2VVIA 4R6BA 3R1PA 5LTQA 1JC1A 2ZMUA 1Q73A 2K2AA 1MQ1A 3D77A 4W6CA 3EK8A 2A56B 2WSNA 2HGYA 1KCYA 2JXLA 5HYDA 3BFHA 2A50B 2WCHA 3FE6A 1MR8A 2BCXA 2Z1OA 1M46A 2EMOA 1C3YA 4XYNA 1XFUO 3PATA 4YI9A 1KK8B 2WCKA 3EVVA 1L2OB 1DJWA 4DXPA 4KW8A 4JRBA 4Q7RA 3JTDC 3SG4A 3TDIA 1NSHA 1JC0A 5LTRA 1QV1A 5CSIA 2B1UA 4QJ3B 3S0FA 4ORNA 3SJSA 5FI2A 3NSLA 4PE0A 2KGRA 4OV2A 4INXA 3W1CA 3CLNA 4W76A 3QMEA 4W77A 1XFZO 3IF7A 1Z4HA 1C4FA 1SR6B 3GK2A 2YDZA 1B8LA 2K7CA 2OTBA 2FWQA 4CFQA 1Q4AA 3LVDA 3LVCA 1B9AA 1SL7A 5B8IB 1S6CA 2PASA 1PULA 1SW8A 2OKYA 2OPOA 2QEHA 2K7DA 4W6SA 2JU0A 2HQZA 3DPWA 1KK7Y 2L2CA 5EJUA 2H61C 3ZULA 3V2LA 1BR4B 3K1EA 3DVJA 2KAXA 4Q04A 1WRKA 1BOCA 3A8SA 4Q9XA 2FCEA 3PALA 3I5GC 1F09A 1BMOA 1KWOC 1OMDA 1W7UA 1UHKA 3DQ9A 3CDNA 2G2SB 1QYFA 1BT6A 3LS3A 1SCVA 2IS9A 2VAEA 4FQTA 4KW4A 2MBXA 2QRFA 2QLIA 1CLMA 3NSKA 3VRRA 3GJ1A 2WSOA 4AQJA 2E30A 3AAKA 4DIRA 4M2QA 1XA5A 3ZUJA 3I5HB 3EVUA 2OS8C 5HKZA 3CZ1A 1C7VA 3SSPA 2KI6C 4IK5A 1M39A 4PHKA 4W6GA 2M1UA 3SG7A 1F70A 3DQ8A 5DQBA 1ZGQA 1A75A 3EKHA 3VHTB 1A29A 2JQ6A 4ZIOA 1OOJA 5DKRA 1BF5A 5DPHA 5HKWA 2TN4A 4L13A 3R1VA 1TTXA 3E5VA 2H6VA 3KO0A 3LF3A 1DTLA 1B7TY 2JC2A 4KW9A 2H5RA 4C0LA 5EXUA 1UHIA 1DJYA 5BT0A 2BTJA 5BTTA 3HCMA 3P8UA 1KFUS 5LK4A 1XAEA 3BUOB 4IJ7A 1YHHA 2O2BA 2RH7A 3TUYC 3KEVA 2MLFC 1UHHA 4Z4KA 4GGNA 3SSHA 1JFJA 4ZF4A 2ARLA 1DJGA 1B4CA 1HT9A 5DKNA 1S36A 2HPWA 2JRFA 5J2OA 1DGUA 1JF2A 3ZWHA 3DQMA 2EMNA 4W69A 2LCPA 1BU3A 2QLGB 1TIZA 4NWSA 1B1GA 2G6XA 2WC5A 1EMGA 2BCBA 4YRUA 2KYCA 4IK9A 2CNPA 2KPHA 2AHAA 4OHSA 1RK9A 2LC5A 4I5KA 4MVFA 3VK1A 1C07A 2ZMWA 2FCDA 2Y5IA 2QT2A 1ALWA 1UUSA 2JPOA 3DQDA 2H5QA 2LM5A 2LAPA 1G8IA 4OCIA 3U8PA 4H3MA 4DXNA 1KK8C 4JC2A 2K8MB 1L2OC 3PN7B 1SY9A 1TN4A 4M2OA 1Y0VH 5DQMA 4B30A 3AI4A 1TCFA 2LMVA 4OQWA 4LJCA 3VRQA 2Y0GA 3S0DA 3NT3A 4JEOA 1F4OA 1XYDA 4PDZA 3I5IB 5DTLA 1NPQA 2WCMA 2ZKMX 1OOIX 1QX5B 1EH2A 4LJDC 5AFPA 1V1GA 1SR6C 2F33A 1CDLA 3TZ1A 2LVKA 3CD9A 4KYNA 1K90D 3C1VA 3DQ4A 3KHEA 2KQYA 1QX7A 2L4IA 2LHLA 1NCZA 5HLVA 4LJBA 5DRFA 4KF5C 4GNKB 3EK7A 4KEXA 5DTZA 4QJ5B 1CV7A 3CD1A 1QXTA 1MOVA 2Q6PA 1WLZA 4PHNA 4EN1A 2KI6D 1GFLA 1BLQA 3PM8A 4AOMA 3O2PA 1MHOA 1S6IA 1Q4EA 1EMEA 3OGOA 1EMCA 3DXLA 4W7RA 1XQMA 2V4EA 3U8AA 4FQOA 1IJ5A 1WDCB 4M2PA 3WHTB 1SSEB 4XJKB 3H1OA 4L12A 1EL4A 2F3ZA 1H4UA 4MZLA 3LVAA 2HPSA 2LLTA 1B8RA 2K0JA 2NCPA 5EXBA 2I94A 4QJ4B 4Q9WA 2K2FA 3UFZA 4HQ9A 2WHSA 3FWCA 2PSRA 3BUXB 1S5GZ 1M45A 2CTNA 4DCKA 1CFFA 2JULA 1K96A 3A4UB 1XFVO 1J7QA 1LA3A 1A2XA 2DUHA 3W1DA 2WCLA 1C3ZA 1OXEA 2JPTA 1TNPA 5ER4X 1U5IA 2Q91A 4NQGA 2M29A 4JD9A 3RWAA 2I7AA 1XFWO 4NDCA 1QTXA 3B6XA 3GOFA 2WHUA 1QVIZ 4CLNA 3DQKA 3R1OA 3EKJA 2VVHA 2KI4C 1MUXA 1IG5A 3OP0A 3ADFA 3SVOA 2PQLA 4ORAB 2WC6A 4EMQA 1LINA 1SYMA 4H3LA 1RMOA 3NHTA 2PVBA 4BDUA 1FPWA 1SPYA 2LP2A 4GGFA 1MWNA 3LSAA 3SSLA 4UPGA 4W6IA 5H89A 2Y1MA 1Z1QA 2F2PA 1ODBA 2ZN9A 2BL0B 3BYAA 2HETA 2JTTA 2A46A 1N0YA 1YUTA 1ZFSA 1DF0A 4W6RA 2D8NA 5CSFA 4YBHB 2HCGA 2Q4UA 5CSJA 4W7XA 3OX6A 1YTZC 2WNDA 2P71A 1QYQA 4OZDA 3DQ2A 1YJFA 4ZB1A 3MGFA 3NT9A 3NF0A 2NCOA 3AI5A 4ETOA 4LQUA 3PN7C 2H9WA 4N3DA 1BODA 3LK0A 4ZF3A 3D73A 1KP5A 2E6WA 1OMRA 1EMFA 1QY3A 4ICBA 3FIAA 1OOHA 3CGAA 3NEZA 3ST0A 5DPIA 3EG5B 4W6NA 4MBEA 2ICRA 3AKOA 2JWWA 3K21A 3BXCA 2G9BA 3SVBA 3SVCA 2BE4A 1SK6D 5D3OA 4KPIA 1F0BA 2EC6C 1OOFA 1HCJA 2WCEA 1JF0A 1LKJA 4PE1A 1IQ3A 2L98A 3PSRA 3IR8A 2WCJA 4ORBB 4B30B 3SG6A 5DY6A 1S3PA 2HQWA 2AUCA 2QPTA 2CBLA 2BBNA 1R2UA 1N65A 4KAGA 1DJXA 4HVFA 2HRSA 1FW4A 1GGXA 4B5YA 3ED8A 2H61A 5EBJA 2C9JA 1CM4A 2AWLA 1KQMC 1RECA 3CZ0A 3IQQA 3DQFA 2BE6A 3LF4B 2WCFA 4YGEB 2KHNA 3LCPC 1JBZA 3DQ6A 3OB2B 2WISA 4W6KA 3KCSA 2ZN8A 2P6BB 5I2QA 1DJHA 5FVGA 2POXA 2LLSA 1K95A 2M7NA 3KPXA 1EG4A 3S0AA 1X02A 4PPLA 2DUEA 1CMGA 3SVNA 3PIBA 2BNXA 2B3PA 4ZF5A 5FI7A 2WCBA 2LMTA 3OGNA 4E68A 4XOWA 1XFYO 3RM1A 2Z6YA 1SCMB 3BFAA 2V4EB 2B3QA 3A8RA 3DVKA 1A4PA 3IP2A 1IRJA 1K2HA 3VGOA 2GX2A 2CT9A 2FL1A 3ZTFA 5KTGA 4CFRA 2QDIA 4F7FA 4LW5A 4PPJA 1DEKA 4BY5A 4L1IA 3D75A 1S26D 2BKIB 1SL8A 2LANA 3B86A 5CSNA 1XFXO 1H6RA 3DF0B 5GQQC 4OVNF 3S0GA 1Q80A 3JVTB 1S5GY 4MLWA 2JOJA 3WHUB 1KFXS 1OZSA 4U8DA 1V1FA 1U5IB 3BX9A 1ZGPA 1LA0A 1DELA 4OGSA 2DD7A 1IWQA 1SL9A 3VICA 2VADA 2QLHA 2NXQA 2OTGB 1OZOA 2BL0C 1SMGA 3NSIA 4NDDA 1UWOA 1QVIY 2L2EA 5I94A 2F2OA 2BKHB 5KTYA 2WIQA 3O4XA 4EDOA 1W9ZA 3SIAA 5DKQA 2LV7A 2WORA 4W75A 2JT3A 3EK4A 3BXBA 3DY9A 5IBWA 1UISA 3CS1A 3SS3A 3CR2A 1WRLA 4W6OA 4XL5A 4PALA 4W6JA 4ZCUA 2WOSA 1C7WA 4HREE 2JNFA 1W7TA 4DXOA 1OQPA 2Z6XA 1M31A 1IQ5A 1FI6A 4KGFA 3CFAA 2I2RE 4J89A 5D69A 3NGVA 1JWDA 2K7BA 3BOWA 3LL8B 3Q8IA 4H3NA 4W6FA 4WRIA 1FI5A 5DTXA 2I18A 2KAVA 1DVIA 3SSVA 4IZNA 4Q7UA 3IQOA 1AHRA 5EHUA 5K89A 1Z1PA 4Q7TA 5DRGA 3S05A 1ZMZA 2EHBA 3B7AA 4USLA 2RGIA 1XA9A 1PSBA 1KQVA 2AWMA 5J3XA 5JJGA 3I19A 5ER5A 1KFUL 1SNLA 1NX3A 3CBEA 1F4QA 1ZACA 3SIBA 5KU1A 4HRHA 1WRZA 3GK1A 4PHJA 1H4BA 5BQLA 1DJZA 2AWJA 4LJDA 3BJHA 1QIWA 5DICA 1MOUA 1UHNA 3M22A 3L47A 1HUYA 3DVMA 2O29A 3PJ5A 1QYOA 3WXAA 3ZNIA 4JPZB 4W74A 4W6DA 1QLSA 1D1OA 2IE2A 3R72A 3ST2A 4KF5A 3U0MA 3CR4X 4UTSA 1XFRA 1QWVA 3DZTA 4I2YA 1DJIA 2LLUA 3CWGA 3SSTA 4XVPA 4H48A 5T3IA 1PRWA 4GESB 4EDSA 2LUXA 3G9AA 2K61A 4JFGA 1PALA 3TMRA 3ZUFA 3BQ3A 2ISDA 3VB1A 2AH8A 1LS8A 3LA1A 2YFPA 1BR1B 1SKTA 5AERA 4PFEA 3F45A 1EJ3A 5G08A 3P28A 1TNWA 4R6DA 1TNXA 2F3YA
chains in the Genus database with same CATH topology
3NEDA 4AS8A 1J7PA 2OTEA 2FOTA 3U8CA 3SSKA 1K9UA 4AR7A 3AKBA 1Y6WA 4C0KA 1J55A 1JBAA 1RMMA 2A53B 4W7DA 1J1DA 4MN0A 3I5HC 1RM9A 5CPVA 3I5FB 1CMFA 3M24A 2JZIA 2M0RA 1TCOB 4C0JA 5HW9A 2GGMA 1S1EA 4TNCA 1TNQA 1F71A 3M0WA 2KGBC 1S6ZA 1K93D 3ST3A 3VHTA 3D10A 4CPVA 2DD9A 4ANJA 1E8AA 2COLB 4W7FA 2GW3A 1YRUB 1CDNA 2SASA 1CFCA 1JFKA 3JVTC 2GV5A 3NXAA 1YZWA 4YGCB 3TMTA 2OS8B 3EVPA 1Q4CA 5LTPA 4PE4A 1AJ5A 3OHMB 5HLOA 3NSOA 2M9GA 3O6BA 2M1KB 1CFPA 1SRAA 3U0KA 1NX1A 3DQ5A 1A75B 1Y1XA 2PXSA 2OTGC 1S6JA 2HGDA 2L0PA 1NIWA 3VROA 3DQAA 4AQIA 3KF9A 2JT8A 1AK8A 1NP8A 3PJBA 1MF8B 1B8CA 4U2VA 1WLMA 2ZRTA 1H8BA 1PVBA 4EULA 5BPJA 2QLGA 4P76A 1OSAA 1XK4C 1K8UA 3CZTX 1EG3A 3CFFA 2KQ6A 5BTTB 2PMYA 1YVHA 1JBYA 4ZFSA 3SVEA 1EMBA 5I2LA 3QRXA 3DPZA 5JOLA 2K7OA 4KF4A 4TZAA 2BECA 1AUIB 5FYXA 3WCKA 1AVSA 4DS7A 4XOVA 2QU1A 3CTNA 1EXRA 3UG0A 3VRNA 2ZO6A 1YVLA 1EMKA 5HZOA 2WHTA 3SRYA 3GB3A 4PE7A 1RRXA 5FHVA 2O24A 2HF5A 3SVUA 4ORCB 3E5TA 4R1EA 5D7FA 1UHJA 3AKAA 1N2DA 3I5IC 2LVVA 1J1EA 3BUWB 4RYSA 2PXWA 4W6AA 3BOWB 4W73A 2QZ0A 1YFPA 4DXIA 1BG1A 1CDPA 1RWYA 1MYWA 3LK1A 1YX8A 2OGRA 3DQCA 1OE9B 3E3RA 2HQ8A 2ZO7A 4YGAA 1JSAA 5HBDA 1W7SA 3TS5B 1PSRA 2L5XB 2H8QA 1QX2A 3SVRA 3DQUA 3RWTA 2OJKA 2ZNDA 1YHIA 1CB1A 3EVRA 1F55A 2AWKA 4DKNA 2ZRSA 1YHGA 2YE0A 1OXFA 2IB5A 1GGWA 1QS7A 5KSZA 1WY9A 3OX5A 1TRFA 3CFHA 1XVJA 2MRDA 2G16B 2NLNA 2G5ZB 2MJWB 1OXDA 5F6TA 3DPXA 4OR9B 1WDCC 1AJ4A 2Q57A 1CDMA 1SBJA 4XJKA 1UP5A 1KYPA 1Q4BA 2DDDA 3DQOA 4W6PA 1QLKA 3WLDA 2DDCA 3GJ2A 4OY4A 2DUGA 3U0NA 4YGDB 3I5FC 1CTRA 4HQ8A 1KSMA 4JF9A 3WNXB 4DRWA 2HQKA 2VZXA 5HKYA 4MSPA 3BUMB 2CCMA 3DQ3A 5EB6A 1F8HA 1QV0A 3D0YA 2L4HA 1BJFA 4N1FA 3HX4A 5FVIA 2L50A 3U0LA 4RYWA 2WURA 4GF6B 1KSOA 2GX0A 1CLBA 2V53A 3SV5A 4L9MA 2F8PA 1EMMA 4H47A 2EMDA 1XO5A 1DT7B 2G3OA 2KOTA 2VRGA 4P5OE 1MXLC 1RFJA 1J7OA 2OKWA 1DMOA 4KGEA 4W6UA 1FF1A 1IKUA 1EMLA 1W7IB 2PRUA 5DU0A 3CB9A 3H1RA 2LP3A 1XSSA 2A47A 2M8UA 1QXPA 4NDBA 4D1EA 3LLEA 4W7EA 2GW4B 1RROA 4WQ2A 4IK8A 3SG2A 4P2YB 4ZINA 5HZTA 3PLFB 2A54B 2VVJA 4GUKA 4KA9A 1ZUZA 2JT0A 1QIVA 1YR5A 1NYAA 2KFFA 4DUQA 3DQ1A 4WQ3A 2KI4B 2PALA 4IK3A 2JTZA 4IK1A 3K1KA 2KDHA 4J8AA 2KSPA 1A03A 4N1GA 4W6TA 5DPGA 1J7RA 2H5PA 2LNKA 2DUFA 3O77A 3AAJA 2LVIA 5AQBB 4W6LA 2LMUA 3MSEB 1NX0A 4YGBB 3PFVA 1KYRA 4W72A 2WC8A 4GAOA 1TOPA 4PHMA 2Z6ZA 3DQEA 5TNCA 1BFPA 1K9PA 4J88A 3FS7A 2FJUB 4MEWA 2DOQA 3RLZA 4CIDA 3DQNA 4JGEA 2KBMA 2KFHA 2G6YA 1DF0B 3CGLA 2JADA 5EB7A 5PALA 2QLEA 2L51A 1KFXL 1QATA 1PVAA 1KYSA 2KFGA 4I5JA 4XGYA 4MZKA 2LE9B 2M97A 2ZFDA 5EXCI 2IB6A 2KNEA 3DQ7A 1W7JB 1YURA 2M3WA 3GEXA 4IK4A 3V3DA 3BXAA 2G2BA 4GBAA 4W6HA 4MRYA 4HSZA 2KYFA 4A4CA 3TS5C 4HQCA 4DXMA 2A4JA 4W7CA 3GK4X 1GJYA 1UURA 1CM1A 5F9GA 2Y4QA 2QACA 4FTGA 1XMZA 2NZ0A 3H4SE 3OSRA 1YX7A 1VRKA 3DVEA 5AEQA 4N5XA 2KBIA 1PK0D 1KK7Z 1NUBA 2FZUA 2G6EA 3KCTA 3JTDB 5FVFA 1G33A 5AXIA 3SG5A 1B9CA 4ZBLA 1CLLA 4W6MA 1CFDA 4DXQA 2MA2A 2EC6B 4I5LB 1RJVA 1B47A 5HZSA 4W6BA 1OMVA 2IOVA 1LXFC 4YI8A 1YRTB 1IH0A 4DKMA 2G3DB 3E5WA 4ZCVA 1YUUA 1JUOA 2HJOA 2MHHA 1CKKA 1ZOTB 1L7ZA 4HE4A 2A52B 2JNXA 1NWDA 3FWBA 3BXKA 1F54A 1ZUXA 3DD4A 4A4BA 5I2OA 1SCMC 2V4EC 2H5OA 1KQMB 1G4YR 5AANA 2M49B 3WLCA 2CXJA 3O78A 3ICBA 1NX2A 1QASA 2H2KA 3I5GB 5HZUA 3DQIA 2JXCA 2EGDA 1NCXA 4LQTA 1KWOB 1IJ6A 2AAOA 3VRPA 1LVCD 3TDUA 4IL1A 1HQVA 4GPLB 1Q4DA 2LHIA 1B7TZ 3PJ7A 4TZGA 3SSYA 4F0ZB 1G7KA 3DF0A 1Y1AA 4I5NB 5I8NA 1FBVA 3OB1B 4OJ0A 2R2IA 2M7LA 3D0YB 1K9KA 4GOBA 3GL4A 2KAYA 5H88A 1ALVA 1QJTA 2P4MA 5DPJA 2ZNEA 1NCYA 2DUIA 4OKHA 1JC2A 3DQHA 1Y1UA 1R6PA 1M63B 1AP4A 3SVSA 4W7AA 1GGZA 1GL4A 2MLEC 2C9IA 2HFCA 1K94A 3SG3A 2A48A 1YUSA 4MZJA 4GFTA 1DGVA 2AMIA 1IGVA 4RTCA 4JWQA 3SS0A 2BCAA 1RMPA 2LVJA 1ZGOA 4GGFC 1CNPA 5DTYA 1XK4A 4PCWA 4P1QA 3CR5X 3DQLA 5HGEA 3SVDA 2SCPA 1MXEA 1YJ2A 2MAZA 3BUNB 3DQJA 4BY4A 2GGZA 2YE1A 1EMAA 4JQ0D 3TUYB 3O4YA 2O5GA 1RTP1 3TDZA 1GQMA 4MRXA 3OSQA 4Z4MA 2O60A 3ST4A 5H87A 2LUCA 2Y1NA 4HRGA 2BBMA 2VVIA 4R6BA 5LTQA 1JC1A 2ZMUA 1Q73A 2K2AA 1MQ1A 4W6CA 3EK8A 2A56B 2WSNA 2HGYA 1KCYA 2JXLA 5HYDA 2A50B 1MR8A 2BCXA 2Z1OA 1M46A 2EMOA 4XYNA 1XFUO 3PATA 4YI9A 1KK8B 3EVVA 1L2OB 1DJWA 4DXPA 4KW8A 4JRBA 4Q7RA 3JTDC 3SG4A 3TDIA 1NSHA 1JC0A 5LTRA 1QV1A 5CSIA 2B1UA 4QJ3B 4ORNA 3SJSA 3NSLA 4PE0A 2KGRA 4OV2A 3W1CA 3CLNA 4W76A 4W77A 1XFZO 3IF7A 1C4FA 1SR6B 3GK2A 2YDZA 1B8LA 2K7CA 2OTBA 2FWQA 4CFQA 1Q4AA 3LVDA 3LVCA 1B9AA 1SL7A 5B8IB 1S6CA 2PASA 1PULA 1SW8A 2OKYA 2OPOA 4W6SA 2K7DA 2JU0A 2HQZA 3DPWA 1KK7Y 5EJUA 2H61C 3ZULA 1BR4B 3DVJA 2KAXA 4Q04A 1WRKA 1BOCA 3A8SA 4Q9XA 2FCEA 3PALA 3I5GC 1F09A 1BMOA 1KWOC 1OMDA 1W7UA 1UHKA 3DQ9A 2G2SB 1QYFA 1BT6A 3LS3A 1SCVA 2IS9A 2VAEA 4KW4A 2MBXA 2QRFA 2QLIA 1CLMA 3NSKA 3VRRA 3GJ1A 2WSOA 4AQJA 2E30A 3AAKA 4DIRA 4M2QA 1XA5A 3ZUJA 3I5HB 3EVUA 2OS8C 5HKZA 1C7VA 3SSPA 2KI6C 4IK5A 1M39A 4PHKA 4W6GA 2M1UA 3SG7A 1F70A 3DQ8A 5DQBA 1ZGQA 1A75A 3EKHA 3VHTB 1A29A 2JQ6A 4ZIOA 1OOJA 5DKRA 1BF5A 5DPHA 5HKWA 2TN4A 4L13A 1TTXA 3E5VA 2H6VA 3KO0A 3LF3A 1DTLA 1B7TY 2JC2A 4KW9A 2H5RA 4C0LA 5EXUA 1UHIA 1DJYA 5BT0A 2BTJA 5BTTA 3HCMA 3P8UA 1KFUS 5LK4A 1XAEA 3BUOB 1YHHA 2O2BA 2RH7A 3TUYC 3KEVA 2MLFC 1UHHA 4Z4KA 4GGNA 3SSHA 1JFJA 4ZF4A 2ARLA 1DJGA 1B4CA 1HT9A 5DKNA 1S36A 2HPWA 2JRFA 5J2OA 1DGUA 1JF2A 3ZWHA 3DQMA 2EMNA 4W69A 2LCPA 1BU3A 2QLGB 1TIZA 4NWSA 1B1GA 2G6XA 1EMGA 2BCBA 4YRUA 2KYCA 4IK9A 2CNPA 4OHSA 2AHAA 1RK9A 2LC5A 4I5KA 4MVFA 3VK1A 1C07A 2ZMWA 2FCDA 2Y5IA 2QT2A 1ALWA 1UUSA 3DQDA 2H5QA 2LM5A 2LAPA 1G8IA 4OCIA 3U8PA 4H3MA 4DXNA 1KK8C 4JC2A 2K8MB 1L2OC 3PN7B 1SY9A 1TN4A 4M2OA 1Y0VH 5DQMA 4B30A 3AI4A 1TCFA 2LMVA 4OQWA 4LJCA 3VRQA 2Y0GA 3NT3A 4JEOA 1F4OA 1XYDA 4PDZA 3I5IB 5DTLA 1NPQA 2ZKMX 4LJDC 1QX5B 1EH2A 5AFPA 1V1GA 1SR6C 2F33A 1CDLA 3TZ1A 2LVKA 3CD9A 1K90D 3C1VA 3DQ4A 3KHEA 2KQYA 1QX7A 2L4IA 2LHLA 1NCZA 5HLVA 4LJBA 5DRFA 4KF5C 4GNKB 3EK7A 4KEXA 5DTZA 4QJ5B 1CV7A 3CD1A 1QXTA 1MOVA 2Q6PA 1WLZA 4PHNA 4EN1A 2KI6D 1GFLA 1BLQA 3PM8A 4AOMA 3O2PA 1MHOA 1S6IA 1Q4EA 1EMEA 3OGOA 1EMCA 4W7RA 1XQMA 2V4EA 3U8AA 4FQOA 1IJ5A 1WDCB 4M2PA 3WHTB 4XJKB 3H1OA 4L12A 1EL4A 2F3ZA 1H4UA 4MZLA 3LVAA 2HPSA 2LLTA 1B8RA 2K0JA 2NCPA 5EXBA 2I94A 4QJ4B 4Q9WA 2K2FA 3UFZA 4HQ9A 2WHSA 2F3YA 3FWCA 2PSRA 3BUXB 1S5GZ 1M45A 2CTNA 4DCKA 1CFFA 2JULA 1K96A 3A4UB 1XFVO 1J7QA 1LA3A 1A2XA 2DUHA 3W1DA 1OXEA 2JPTA 1TNPA 5ER4X 1U5IA 2Q91A 4NQGA 2M29A 3RWAA 2I7AA 1XFWO 4NDCA 1QTXA 3GOFA 2WHUA 1QVIZ 4CLNA 3DQKA 3EKJA 2VVHA 2KI4C 1MUXA 1IG5A 3OP0A 3ADFA 3SVOA 4ORAB 4EMQA 1LINA 1SYMA 4H3LA 1RMOA 2PVBA 4BDUA 1FPWA 1SPYA 2LP2A 4GGFA 1MWNA 3LSAA 3SSLA 4UPGA 4W6IA 5H89A 2Y1MA 1Z1QA 2F2PA 1ODBA 2ZN9A 2BL0B 3BYAA 2HETA 2JTTA 2A46A 1N0YA 1YUTA 1ZFSA 1DF0A 4W6RA 2D8NA 5CSFA 4YBHB 2HCGA 2Q4UA 5CSJA 4W7XA 3OX6A 1YTZC 2WNDA 1QYQA 3DQ2A 1YJFA 4ZB1A 3MGFA 3NT9A 3NF0A 2NCOA 3AI5A 4ETOA 4LQUA 3PN7C 2H9WA 4N3DA 1BODA 3LK0A 4ZF3A 1KP5A 2E6WA 1OMRA 1EMFA 1QY3A 4ICBA 3FIAA 3CGAA 3NEZA 3ST0A 5DPIA 4W6NA 4MBEA 2ICRA 3AKOA 2JWWA 3K21A 3BXCA 2G9BA 3SVBA 3SVCA 2BE4A 1SK6D 4KPIA 1F0BA 2EC6C 1HCJA 2WCEA 1JF0A 1LKJA 4PE1A 1IQ3A 2L98A 3PSRA 3IR8A 4ORBB 4B30B 3SG6A 5DY6A 1S3PA 2HQWA 2AUCA 2QPTA 2CBLA 2BBNA 1R2UA 1N65A 4KAGA 1DJXA 4HVFA 2HRSA 1FW4A 1GGXA 4B5YA 3ED8A 2H61A 5EBJA 2C9JA 1CM4A 2AWLA 1KQMC 1RECA 3IQQA 3DQFA 2BE6A 3LF4B 2WCFA 4YGEB 2KHNA 3LCPC 1JBZA 3DQ6A 3OB2B 2WISA 4W6KA 3KCSA 2ZN8A 2P6BB 5I2QA 1DJHA 5FVGA 2POXA 2LLSA 1K95A 2M7NA 3KPXA 1EG4A 1X02A 4PPLA 2DUEA 1CMGA 3SVNA 3PIBA 2B3PA 4ZF5A 2WCBA 2LMTA 4E68A 4XOWA 1XFYO 3RM1A 2Z6YA 1SCMB 2V4EB 2B3QA 3A8RA 3DVKA 1A4PA 3IP2A 1IRJA 1K2HA 3VGOA 2GX2A 2CT9A 2FL1A 3ZTFA 5KTGA 4CFRA 4LW5A 4PPJA 4BY5A 4L1IA 1S26D 2BKIB 1SL8A 2LANA 5CSNA 1XFXO 1H6RA 3DF0B 5GQQC 4OVNF 1Q80A 3JVTB 1S5GY 4MLWA 2JOJA 3WHUB 1KFXS 1OZSA 4U8DA 1V1FA 1U5IB 3BX9A 1ZGPA 1LA0A 4OGSA 2DD7A 1IWQA 1SL9A 3VICA 2VADA 2QLHA 2NXQA 2OTGB 1OZOA 2BL0C 1SMGA 3NSIA 4NDDA 1UWOA 1QVIY 2L2EA 2F2OA 2BKHB 5KTYA 2WIQA 4EDOA 3SIAA 5DKQA 2LV7A 2WORA 4W75A 2JT3A 3EK4A 3BXBA 5IBWA 1UISA 3CS1A 3CR2A 1WRLA 4W6OA 4XL5A 4PALA 4W6JA 4ZCUA 2WOSA 1C7WA 4HREE 2JNFA 1W7TA 4DXOA 1OQPA 2Z6XA 1M31A 1IQ5A 1FI6A 4KGFA 3CFAA 2I2RE 4J89A 5D69A 1JWDA 2K7BA 3BOWA 3LL8B 4H3NA 4W6FA 4WRIA 1FI5A 5DTXA 2I18A 2KAVA 1DVIA 3SSVA 4IZNA 4Q7UA 3IQOA 1AHRA 5EHUA 4Q7TA 5K89A 1Z1PA 5DRGA 3S05A 1ZMZA 2EHBA 4USLA 2RGIA 1XA9A 1PSBA 1KQVA 2AWMA 5J3XA 5JJGA 3I19A 5ER5A 1KFUL 1SNLA 1NX3A 3CBEA 1F4QA 1ZACA 3SIBA 5KU1A 4HRHA 1WRZA 3GK1A 4PHJA 1H4BA 5BQLA 1DJZA 2AWJA 4LJDA 1QIWA 1MOUA 1UHNA 3M22A 1HUYA 3DVMA 2O29A 3PJ5A 1QYOA 3WXAA 3ZNIA 4JPZB 4W74A 4W6DA 1QLSA 1D1OA 2IE2A 3ST2A 4KF5A 3U0MA 3CR4X 4UTSA 4I2YA 1DJIA 2LLUA 3CWGA 3SSTA 4XVPA 4H48A 5T3IA 1PRWA 4GESB 4EDSA 2LUXA 3G9AA 2K61A 4JFGA 1PALA 3TMRA 3ZUFA 3BQ3A 2ISDA 2AH8A 3LA1A 2YFPA 1BR1B 1SKTA 5AERA 4PFEA 3F45A 1EJ3A 5G08A 3P28A 1TNWA 4R6DA 1TNXA 4PPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NED A;  4AS8 A;  1J7P A;  2OTE A;  2FOT A;  3U8C A;  3SSK A;  1K9U A;  4AR7 A;  3AKB A;  1Y6W A;  4C0K A;  1J55 A;  1JBA A;  1RMM A;  2A53 B;  4W7D A;  1J1D A;  4MN0 A;  3I5H C;  1RM9 A;  5CPV A;  3I5F B;  1CMF A;  3M24 A;  2JZI A;  2M0R A;  1TCO B;  4C0J A;  5HW9 A;  2GGM A;  1S1E A;  4TNC A;  1TNQ A;  1F71 A;  3M0W A;  2KGB C;  1S6Z A;  1K93 D;  3ST3 A;  3VHT A;  3D10 A;  4CPV A;  2DD9 A;  4ANJ A;  1E8A A;  2COL B;  4W7F A;  2GW3 A;  1YRU B;  1CDN A;  2SAS A;  1CFC A;  1JFK A;  3JVT C;  2GV5 A;  3NXA A;  1YZW A;  4YGC B;  3TMT A;  2OS8 B;  3EVP A;  1Q4C A;  5LTP A;  4PE4 A;  1AJ5 A;  3OHM B;  5HLO A;  3NSO A;  2M9G A;  3O6B A;  2M1K B;  1CFP A;  1SRA A;  3U0K A;  1NX1 A;  3DQ5 A;  1A75 B;  1Y1X A;  2PXS A;  2OTG C;  1S6J A;  2HGD A;  2L0P A;  1NIW A;  3VRO A;  3DQA A;  4AQI A;  3KF9 A;  2JT8 A;  1AK8 A;  1NP8 A;  3PJB A;  1MF8 B;  1B8C A;  4U2V A;  1WLM A;  2ZRT A;  1H8B A;  1PVB A;  4EUL A;  5BPJ A;  2QLG A;  4P76 A;  1OSA A;  1XK4 C;  1K8U A;  3CZT X;  1EG3 A;  3CFF A;  2KQ6 A;  5BTT B;  2PMY A;  1YVH A;  1JBY A;  4ZFS A;  3SVE A;  1EMB A;  5I2L A;  3QRX A;  3DPZ A;  5JOL A;  2K7O A;  4KF4 A;  4TZA A;  2BEC A;  1AUI B;  5FYX A;  3WCK A;  1AVS A;  4DS7 A;  4XOV A;  2QU1 A;  3CTN A;  1EXR A;  3UG0 A;  3VRN A;  2ZO6 A;  1YVL A;  1EMK A;  5HZO A;  2WHT A;  3SRY A;  3GB3 A;  4PE7 A;  1RRX A;  5FHV A;  2O24 A;  2HF5 A;  3SVU A;  4ORC B;  3E5T A;  4R1E A;  5D7F A;  1UHJ A;  3AKA A;  1N2D A;  3I5I C;  2LVV A;  1J1E A;  3BUW B;  4RYS A;  2PXW A;  4W6A A;  3BOW B;  4W73 A;  2QZ0 A;  1YFP A;  4DXI A;  1BG1 A;  1CDP A;  1RWY A;  1MYW A;  3LK1 A;  1YX8 A;  2OGR A;  3DQC A;  1OE9 B;  3E3R A;  2HQ8 A;  2ZO7 A;  4YGA A;  1JSA A;  5HBD A;  1W7S A;  3TS5 B;  1PSR A;  2L5X B;  2H8Q A;  1QX2 A;  3SVR A;  3DQU A;  3RWT A;  2OJK A;  2ZND A;  1YHI A;  1CB1 A;  3EVR A;  1F55 A;  2AWK A;  4DKN A;  2ZRS A;  1YHG A;  2YE0 A;  1OXF A;  2IB5 A;  1GGW A;  1QS7 A;  5KSZ A;  1WY9 A;  3OX5 A;  1TRF A;  3CFH A;  1XVJ A;  2MRD A;  2G16 B;  2NLN A;  2G5Z B;  2MJW B;  1OXD A;  5F6T A;  3DPX A;  4OR9 B;  1WDC C;  1AJ4 A;  2Q57 A;  1CDM A;  1SBJ A;  4XJK A;  1UP5 A;  1KYP A;  1Q4B A;  2DDD A;  3DQO A;  4W6P A;  1QLK A;  3WLD A;  2DDC A;  3GJ2 A;  4OY4 A;  2DUG A;  3U0N A;  4YGD B;  3I5F C;  1CTR A;  4HQ8 A;  1KSM A;  4JF9 A;  3WNX B;  4DRW A;  2HQK A;  2VZX A;  5HKY A;  4MSP A;  3BUM B;  2CCM A;  3DQ3 A;  5EB6 A;  1F8H A;  1QV0 A;  3D0Y A;  2L4H A;  1BJF A;  4N1F A;  3HX4 A;  5FVI A;  2L50 A;  3U0L A;  4RYW A;  2WUR A;  4GF6 B;  1KSO A;  2GX0 A;  1CLB A;  2V53 A;  3SV5 A;  4L9M A;  2F8P A;  1EMM A;  4H47 A;  2EMD A;  1XO5 A;  1DT7 B;  2G3O A;  2KOT A;  2VRG A;  4P5O E;  1MXL C;  1RFJ A;  1J7O A;  2OKW A;  1DMO A;  4KGE A;  4W6U A;  1FF1 A;  1IKU A;  1EML A;  1W7I B;  2PRU A;  5DU0 A;  3CB9 A;  3H1R A;  2LP3 A;  1XSS A;  2A47 A;  2M8U A;  1QXP A;  4NDB A;  4D1E A;  3LLE A;  4W7E A;  2GW4 B;  1RRO A;  4WQ2 A;  4IK8 A;  3SG2 A;  4P2Y B;  4ZIN A;  5HZT A;  3PLF B;  2A54 B;  2VVJ A;  4GUK A;  4KA9 A;  1ZUZ A;  2JT0 A;  1QIV A;  1YR5 A;  1NYA A;  2KFF A;  4DUQ A;  3DQ1 A;  4WQ3 A;  2KI4 B;  2PAL A;  4IK3 A;  2JTZ A;  4IK1 A;  3K1K A;  2KDH A;  4J8A A;  2KSP A;  1A03 A;  4N1G A;  4W6T A;  5DPG A;  1J7R A;  2H5P A;  2LNK A;  2DUF A;  3O77 A;  3AAJ A;  2LVI A;  5AQB B;  4W6L A;  2LMU A;  3MSE B;  1NX0 A;  4YGB B;  3PFV A;  1KYR A;  4W72 A;  2WC8 A;  4GAO A;  1TOP A;  4PHM A;  2Z6Z A;  3DQE A;  5TNC A;  1BFP A;  1K9P A;  4J88 A;  3FS7 A;  2FJU B;  4MEW A;  2DOQ A;  3RLZ A;  4CID A;  3DQN A;  4JGE A;  2KBM A;  2KFH A;  2G6Y A;  1DF0 B;  3CGL A;  2JAD A;  5EB7 A;  5PAL A;  2QLE A;  2L51 A;  1KFX L;  1QAT A;  1PVA A;  1KYS A;  2KFG A;  4I5J A;  4XGY A;  4MZK A;  2LE9 B;  2M97 A;  2ZFD A;  5EXC I;  2IB6 A;  2KNE A;  3DQ7 A;  1W7J B;  1YUR A;  2M3W A;  3GEX A;  4IK4 A;  3V3D A;  3BXA A;  2G2B A;  4GBA A;  4W6H A;  4MRY A;  4HSZ A;  2KYF A;  4A4C A;  3TS5 C;  4HQC A;  4DXM A;  2A4J A;  4W7C A;  3GK4 X;  1GJY A;  1UUR A;  1CM1 A;  5F9G A;  2Y4Q A;  2QAC A;  4FTG A;  1XMZ A;  2NZ0 A;  3H4S E;  3OSR A;  1YX7 A;  1VRK A;  3DVE A;  5AEQ A;  4N5X A;  2KBI A;  1PK0 D;  1KK7 Z;  1NUB A;  2FZU A;  2G6E A;  3KCT A;  3JTD B;  5FVF A;  1G33 A;  5AXI A;  3SG5 A;  1B9C A;  4ZBL A;  1CLL A;  4W6M A;  1CFD A;  4DXQ A;  2MA2 A;  2EC6 B;  4I5L B;  1RJV A;  1B47 A;  5HZS A;  4W6B A;  1OMV A;  2IOV A;  1LXF C;  4YI8 A;  1YRT B;  1IH0 A;  4DKM A;  2G3D B;  3E5W A;  4ZCV A;  1YUU A;  1JUO A;  2HJO A;  2MHH A;  1CKK A;  1ZOT B;  1L7Z A;  4HE4 A;  2A52 B;  2JNX A;  1NWD A;  3FWB A;  3BXK A;  1F54 A;  1ZUX A;  3DD4 A;  4A4B A;  5I2O A;  1SCM C;  2V4E C;  2H5O A;  1KQM B;  1G4Y R;  5AAN A;  2M49 B;  3WLC A;  2CXJ A;  3O78 A;  3ICB A;  1NX2 A;  1QAS A;  2H2K A;  3I5G B;  5HZU A;  3DQI A;  2JXC A;  2EGD A;  1NCX A;  4LQT A;  1KWO B;  1IJ6 A;  2AAO A;  3VRP A;  1LVC D;  3TDU A;  4IL1 A;  1HQV A;  4GPL B;  1Q4D A;  2LHI A;  1B7T Z;  3PJ7 A;  4TZG A;  3SSY A;  4F0Z B;  1G7K A;  3DF0 A;  1Y1A A;  4I5N B;  5I8N A;  1FBV A;  3OB1 B;  4OJ0 A;  2R2I A;  2M7L A;  3D0Y B;  1K9K A;  4GOB A;  3GL4 A;  2KAY A;  5H88 A;  1ALV A;  1QJT A;  2P4M A;  5DPJ A;  2ZNE A;  1NCY A;  2DUI A;  4OKH A;  1JC2 A;  3DQH A;  1Y1U A;  1R6P A;  1M63 B;  1AP4 A;  3SVS A;  4W7A A;  1GGZ A;  1GL4 A;  2MLE C;  2C9I A;  2HFC A;  1K94 A;  3SG3 A;  2A48 A;  1YUS A;  4MZJ A;  4GFT A;  1DGV A;  2AMI A;  1IGV A;  4RTC A;  4JWQ A;  3SS0 A;  2BCA A;  1RMP A;  2LVJ A;  1ZGO A;  4GGF C;  1CNP A;  5DTY A;  1XK4 A;  4PCW A;  4P1Q A;  3CR5 X;  3DQL A;  5HGE A;  3SVD A;  2SCP A;  1MXE A;  1YJ2 A;  2MAZ A;  3BUN B;  3DQJ A;  4BY4 A;  2GGZ A;  2YE1 A;  1EMA A;  4JQ0 D;  3TUY B;  3O4Y A;  2O5G A;  1RTP 1;  3TDZ A;  1GQM A;  4MRX A;  3OSQ A;  4Z4M A;  2O60 A;  3ST4 A;  5H87 A;  2LUC A;  2Y1N A;  4HRG A;  2BBM A;  2VVI A;  4R6B A;  5LTQ A;  1JC1 A;  2ZMU A;  1Q73 A;  2K2A A;  1MQ1 A;  4W6C A;  3EK8 A;  2A56 B;  2WSN A;  2HGY A;  1KCY A;  2JXL A;  5HYD A;  2A50 B;  1MR8 A;  2BCX A;  2Z1O A;  1M46 A;  2EMO A;  4XYN A;  1XFU O;  3PAT A;  4YI9 A;  1KK8 B;  3EVV A;  1L2O B;  1DJW A;  4DXP A;  4KW8 A;  4JRB A;  4Q7R A;  3JTD C;  3SG4 A;  3TDI A;  1NSH A;  1JC0 A;  5LTR A;  1QV1 A;  5CSI A;  2B1U A;  4QJ3 B;  4ORN A;  3SJS A;  3NSL A;  4PE0 A;  2KGR A;  4OV2 A;  3W1C A;  3CLN A;  4W76 A;  4W77 A;  1XFZ O;  3IF7 A;  1C4F A;  1SR6 B;  3GK2 A;  2YDZ A;  1B8L A;  2K7C A;  2OTB A;  2FWQ A;  4CFQ A;  1Q4A A;  3LVD A;  3LVC A;  1B9A A;  1SL7 A;  5B8I B;  1S6C A;  2PAS A;  1PUL A;  1SW8 A;  2OKY A;  2OPO A;  4W6S A;  2K7D A;  2JU0 A;  2HQZ A;  3DPW A;  1KK7 Y;  5EJU A;  2H61 C;  3ZUL A;  1BR4 B;  3DVJ A;  2KAX A;  4Q04 A;  1WRK A;  1BOC A;  3A8S A;  4Q9X A;  2FCE A;  3PAL A;  3I5G C;  1F09 A;  1BMO A;  1KWO C;  1OMD A;  1W7U A;  1UHK A;  3DQ9 A;  2G2S B;  1QYF A;  1BT6 A;  3LS3 A;  1SCV A;  2IS9 A;  2VAE A;  4KW4 A;  2MBX A;  2QRF A;  2QLI A;  1CLM A;  3NSK A;  3VRR A;  3GJ1 A;  2WSO A;  4AQJ A;  2E30 A;  3AAK A;  4DIR A;  4M2Q A;  1XA5 A;  3ZUJ A;  3I5H B;  3EVU A;  2OS8 C;  5HKZ A;  1C7V A;  3SSP A;  2KI6 C;  4IK5 A;  1M39 A;  4PHK A;  4W6G A;  2M1U A;  3SG7 A;  1F70 A;  3DQ8 A;  5DQB A;  1ZGQ A;  1A75 A;  3EKH A;  3VHT B;  1A29 A;  2JQ6 A;  4ZIO A;  1OOJ A;  5DKR A;  1BF5 A;  5DPH A;  5HKW A;  2TN4 A;  4L13 A;  1TTX A;  3E5V A;  2H6V A;  3KO0 A;  3LF3 A;  1DTL A;  1B7T Y;  2JC2 A;  4KW9 A;  2H5R A;  4C0L A;  5EXU A;  1UHI A;  1DJY A;  5BT0 A;  2BTJ A;  5BTT A;  3HCM A;  3P8U A;  1KFU S;  5LK4 A;  1XAE A;  3BUO B;  1YHH A;  2O2B A;  2RH7 A;  3TUY C;  3KEV A;  2MLF C;  1UHH A;  4Z4K A;  4GGN A;  3SSH A;  1JFJ A;  4ZF4 A;  2ARL A;  1DJG A;  1B4C A;  1HT9 A;  5DKN A;  1S36 A;  2HPW A;  2JRF A;  5J2O A;  1DGU A;  1JF2 A;  3ZWH A;  3DQM A;  2EMN A;  4W69 A;  2LCP A;  1BU3 A;  2QLG B;  1TIZ A;  4NWS A;  1B1G A;  2G6X A;  1EMG A;  2BCB A;  4YRU A;  2KYC A;  4IK9 A;  2CNP A;  4OHS A;  2AHA A;  1RK9 A;  2LC5 A;  4I5K A;  4MVF A;  3VK1 A;  1C07 A;  2ZMW A;  2FCD A;  2Y5I A;  2QT2 A;  1ALW A;  1UUS A;  3DQD A;  2H5Q A;  2LM5 A;  2LAP A;  1G8I A;  4OCI A;  3U8P A;  4H3M A;  4DXN A;  1KK8 C;  4JC2 A;  2K8M B;  1L2O C;  3PN7 B;  1SY9 A;  1TN4 A;  4M2O A;  1Y0V H;  5DQM A;  4B30 A;  3AI4 A;  1TCF A;  2LMV A;  4OQW A;  4LJC A;  3VRQ A;  2Y0G A;  3NT3 A;  4JEO A;  1F4O A;  1XYD A;  4PDZ A;  3I5I B;  5DTL A;  1NPQ A;  2ZKM X;  4LJD C;  1QX5 B;  1EH2 A;  5AFP A;  1V1G A;  1SR6 C;  2F33 A;  1CDL A;  3TZ1 A;  2LVK A;  3CD9 A;  1K90 D;  3C1V A;  3DQ4 A;  3KHE A;  2KQY A;  1QX7 A;  2L4I A;  2LHL A;  1NCZ A;  5HLV A;  4LJB A;  5DRF A;  4KF5 C;  4GNK B;  3EK7 A;  4KEX A;  5DTZ A;  4QJ5 B;  1CV7 A;  3CD1 A;  1QXT A;  1MOV A;  2Q6P A;  1WLZ A;  4PHN A;  4EN1 A;  2KI6 D;  1GFL A;  1BLQ A;  3PM8 A;  4AOM A;  3O2P A;  1MHO A;  1S6I A;  1Q4E A;  1EME A;  3OGO A;  1EMC A;  4W7R A;  1XQM A;  2V4E A;  3U8A A;  4FQO A;  1IJ5 A;  1WDC B;  4M2P A;  3WHT B;  4XJK B;  3H1O A;  4L12 A;  1EL4 A;  2F3Z A;  1H4U A;  4MZL A;  3LVA A;  2HPS A;  2LLT A;  1B8R A;  2K0J A;  2NCP A;  5EXB A;  2I94 A;  4QJ4 B;  4Q9W A;  2K2F A;  3UFZ A;  4HQ9 A;  2WHS A;  2F3Y A;  3FWC A;  2PSR A;  3BUX B;  1S5G Z;  1M45 A;  2CTN A;  4DCK A;  1CFF A;  2JUL A;  1K96 A;  3A4U B;  1XFV O;  1J7Q A;  1LA3 A;  1A2X A;  2DUH A;  3W1D A;  1OXE A;  2JPT A;  1TNP A;  5ER4 X;  1U5I A;  2Q91 A;  4NQG A;  2M29 A;  3RWA A;  2I7A A;  1XFW O;  4NDC A;  1QTX A;  3GOF A;  2WHU A;  1QVI Z;  4CLN A;  3DQK A;  3EKJ A;  2VVH A;  2KI4 C;  1MUX A;  1IG5 A;  3OP0 A;  3ADF A;  3SVO A;  4ORA B;  4EMQ A;  1LIN A;  1SYM A;  4H3L A;  1RMO A;  2PVB A;  4BDU A;  1FPW A;  1SPY A;  2LP2 A;  4GGF A;  1MWN A;  3LSA A;  3SSL A;  4UPG A;  4W6I A;  5H89 A;  2Y1M A;  1Z1Q A;  2F2P A;  1ODB A;  2ZN9 A;  2BL0 B;  3BYA A;  2HET A;  2JTT A;  2A46 A;  1N0Y A;  1YUT A;  1ZFS A;  1DF0 A;  4W6R A;  2D8N A;  5CSF A;  4YBH B;  2HCG A;  2Q4U A;  5CSJ A;  4W7X A;  3OX6 A;  1YTZ C;  2WND A;  1QYQ A;  3DQ2 A;  1YJF A;  4ZB1 A;  3MGF A;  3NT9 A;  3NF0 A;  2NCO A;  3AI5 A;  4ETO A;  4LQU A;  3PN7 C;  2H9W A;  4N3D A;  1BOD A;  3LK0 A;  4ZF3 A;  1KP5 A;  2E6W A;  1OMR A;  1EMF A;  1QY3 A;  4ICB A;  3FIA A;  3CGA A;  3NEZ A;  3ST0 A;  5DPI A;  4W6N A;  4MBE A;  2ICR A;  3AKO A;  2JWW A;  3K21 A;  3BXC A;  2G9B A;  3SVB A;  3SVC A;  2BE4 A;  1SK6 D;  4KPI A;  1F0B A;  2EC6 C;  1HCJ A;  2WCE A;  1JF0 A;  1LKJ A;  4PE1 A;  1IQ3 A;  2L98 A;  3PSR A;  3IR8 A;  4ORB B;  4B30 B;  3SG6 A;  5DY6 A;  1S3P A;  2HQW A;  2AUC A;  2QPT A;  2CBL A;  2BBN A;  1R2U A;  1N65 A;  4KAG A;  1DJX A;  4HVF A;  2HRS A;  1FW4 A;  1GGX A;  4B5Y A;  3ED8 A;  2H61 A;  5EBJ A;  2C9J A;  1CM4 A;  2AWL A;  1KQM C;  1REC A;  3IQQ A;  3DQF A;  2BE6 A;  3LF4 B;  2WCF A;  4YGE B;  2KHN A;  3LCP C;  1JBZ A;  3DQ6 A;  3OB2 B;  2WIS A;  4W6K A;  3KCS A;  2ZN8 A;  2P6B B;  5I2Q A;  1DJH A;  5FVG A;  2POX A;  2LLS A;  1K95 A;  2M7N A;  3KPX A;  1EG4 A;  1X02 A;  4PPL A;  2DUE A;  1CMG A;  3SVN A;  3PIB A;  2B3P A;  4ZF5 A;  2WCB A;  2LMT A;  4E68 A;  4XOW A;  1XFY O;  3RM1 A;  2Z6Y A;  1SCM B;  2V4E B;  2B3Q A;  3A8R A;  3DVK A;  1A4P A;  3IP2 A;  1IRJ A;  1K2H A;  3VGO A;  2GX2 A;  2CT9 A;  2FL1 A;  3ZTF A;  5KTG A;  4CFR A;  4LW5 A;  4PPJ A;  4BY5 A;  4L1I A;  1S26 D;  2BKI B;  1SL8 A;  2LAN A;  5CSN A;  1XFX O;  1H6R A;  3DF0 B;  5GQQ C;  4OVN F;  1Q80 A;  3JVT B;  1S5G Y;  4MLW A;  2JOJ A;  3WHU B;  1KFX S;  1OZS A;  4U8D A;  1V1F A;  1U5I B;  3BX9 A;  1ZGP A;  1LA0 A;  4OGS A;  2DD7 A;  1IWQ A;  1SL9 A;  3VIC A;  2VAD A;  2QLH A;  2NXQ A;  2OTG B;  1OZO A;  2BL0 C;  1SMG A;  3NSI A;  4NDD A;  1UWO A;  1QVI Y;  2L2E A;  2F2O A;  2BKH B;  5KTY A;  2WIQ A;  4EDO A;  3SIA A;  5DKQ A;  2LV7 A;  2WOR A;  4W75 A;  2JT3 A;  3EK4 A;  3BXB A;  5IBW A;  1UIS A;  3CS1 A;  3CR2 A;  1WRL A;  4W6O A;  4XL5 A;  4PAL A;  4W6J A;  4ZCU A;  2WOS A;  1C7W A;  4HRE E;  2JNF A;  1W7T A;  4DXO A;  1OQP A;  2Z6X A;  1M31 A;  1IQ5 A;  1FI6 A;  4KGF A;  3CFA A;  2I2R E;  4J89 A;  5D69 A;  1JWD A;  2K7B A;  3BOW A;  3LL8 B;  4H3N A;  4W6F A;  4WRI A;  1FI5 A;  5DTX A;  2I18 A;  2KAV A;  1DVI A;  3SSV A;  4IZN A;  4Q7U A;  3IQO A;  1AHR A;  5EHU A;  4Q7T A;  5K89 A;  1Z1P A;  5DRG A;  3S05 A;  1ZMZ A;  2EHB A;  4USL A;  2RGI A;  1XA9 A;  1PSB A;  1KQV A;  2AWM A;  5J3X A;  5JJG A;  3I19 A;  5ER5 A;  1KFU L;  1SNL A;  1NX3 A;  3CBE A;  1F4Q A;  1ZAC A;  3SIB A;  5KU1 A;  4HRH A;  1WRZ A;  3GK1 A;  4PHJ A;  1H4B A;  5BQL A;  1DJZ A;  2AWJ A;  4LJD A;  1QIW A;  1MOU A;  1UHN A;  3M22 A;  1HUY A;  3DVM A;  2O29 A;  3PJ5 A;  1QYO A;  3WXA A;  3ZNI A;  4JPZ B;  4W74 A;  4W6D A;  1QLS A;  1D1O A;  2IE2 A;  3ST2 A;  4KF5 A;  3U0M A;  3CR4 X;  4UTS A;  4I2Y A;  1DJI A;  2LLU A;  3CWG A;  3SST A;  4XVP A;  4H48 A;  5T3I A;  1PRW A;  4GES B;  4EDS A;  2LUX A;  3G9A A;  2K61 A;  4JFG A;  1PAL A;  3TMR A;  3ZUF A;  3BQ3 A;  2ISD A;  2AH8 A;  3LA1 A;  2YFP A;  1BR1 B;  1SKT A;  5AER A;  4PFE A;  3F45 A;  1EJ3 A;  5G08 A;  3P28 A;  1TNW A;  4R6D A;  1TNX A;  4PPK A; 
#chains in the Genus database with same CATH topology
 2YGU A;  3NED A;  4AS8 A;  1J7P A;  2OTE A;  2FOT A;  3U8C A;  3SSK A;  1K9U A;  4AR7 A;  3AKB A;  1Y6W A;  4C0K A;  1J55 A;  1JBA A;  1RMM A;  2A53 B;  4W7D A;  1J1D A;  3B87 A;  4MN0 A;  3I5H C;  1RM9 A;  5CPV A;  3I5F B;  1CMF A;  3M24 A;  2JZI A;  2M0R A;  1TCO B;  4C0J A;  5HW9 A;  2QEV A;  2GGM A;  1S1E A;  4TNC A;  1TNQ A;  1F71 A;  3M0W A;  2KGB C;  1S6Z A;  1K93 D;  3ST3 A;  3VHT A;  3D10 A;  4CPV A;  2DD9 A;  4ANJ A;  1E8A A;  2COL B;  4W7F A;  3L4A A;  2GW3 A;  1YRU B;  1CDN A;  2PYQ A;  2SAS A;  1CFC A;  1JFK A;  3JVT C;  2GV5 A;  3NXA A;  1YZW A;  1TWO A;  4YGC B;  3TMT A;  2OS8 B;  3EVP A;  1Q4C A;  5LTP A;  4PE4 A;  1AJ5 A;  3OHM B;  5HLO A;  3NSO A;  2M9G A;  3O6B A;  2M1K B;  1CFP A;  1SRA A;  3U0K A;  1NX1 A;  3DQ5 A;  1A75 B;  1Y1X A;  2PXS A;  2OTG C;  1S6J A;  2HGD A;  3NHI A;  4PT1 A;  2L0P A;  1NIW A;  3VRO A;  3DQA A;  4AQI A;  3KF9 A;  2JT8 A;  1AK8 A;  1NP8 A;  3PJB A;  1MF8 B;  1B8C A;  1OOG A;  4U2V A;  1WLM A;  3CZ2 A;  2ZRT A;  1H8B A;  1PVB A;  4EUL A;  5BPJ A;  2QLG A;  4P76 A;  1OSA A;  1XK4 C;  1K8U A;  3CZT X;  1EG3 A;  3CFF A;  2KQ6 A;  5BTT B;  3N7H A;  2PMY A;  1YVH A;  1JBY A;  4ZFS A;  3SVE A;  1EMB A;  5I2L A;  3QRX A;  3DPZ A;  2ERB A;  5JOL A;  2K7O A;  4KF4 A;  4TZA A;  2BEC A;  1AUI B;  5FYX A;  1T14 A;  3WCK A;  1AVS A;  3FE8 A;  3CAB A;  4DS7 A;  4XOV A;  2QU1 A;  3CTN A;  1EXR A;  3UG0 A;  3VRN A;  2ZO6 A;  1YVL A;  1EMK A;  5HZO A;  2WHT A;  3SRY A;  3GB3 A;  4PE7 A;  1RRX A;  5FHV A;  2O24 A;  2HF5 A;  3SVU A;  4ORC B;  3E5T A;  4R1E A;  5D7F A;  1UHJ A;  3AKA A;  1N2D A;  3I5I C;  2LVV A;  1J1E A;  3BUW B;  3S0E A;  4RYS A;  2PXW A;  4W6A A;  3BOW B;  4W73 A;  2QZ0 A;  1YFP A;  4DXI A;  1BG1 A;  1CDP A;  1RWY A;  1MYW A;  3LK1 A;  1YX8 A;  2OGR A;  3DQC A;  1OE9 B;  3E3R A;  2HQ8 A;  3L4L A;  2ZO7 A;  4YGA A;  1JSA A;  5HBD A;  1W7S A;  3TS5 B;  1PSR A;  2L5X B;  2H8Q A;  1QX2 A;  3SVR A;  3DQU A;  3RWT A;  2OJK A;  2ZND A;  1YHI A;  1CB1 A;  3EVR A;  1F55 A;  2AWK A;  4DKN A;  2ZRS A;  1YHG A;  2YE0 A;  1OXF A;  2IB5 A;  1GGW A;  1QS7 A;  1DQE A;  5KSZ A;  1WY9 A;  3OX5 A;  2K60 A;  1TRF A;  3CFH A;  1XVJ A;  2MRD A;  2G16 B;  2NLN A;  3RZS A;  2G5Z B;  2MJW B;  1OXD A;  5F6T A;  3DPX A;  4OR9 B;  1WDC C;  1AJ4 A;  2Q57 A;  1CDM A;  1SBJ A;  4XJK A;  1UP5 A;  3PM2 A;  1KYP A;  5FI6 A;  1Q4B A;  2DDD A;  3DQO A;  4W6P A;  1QLK A;  3WLD A;  2DDC A;  3GJ2 A;  4OY4 A;  2QEO A;  2DUG A;  3U0N A;  4YGD B;  3I5F C;  1CTR A;  4HQ8 A;  1KSM A;  3D78 A;  1TUJ A;  4JF9 A;  3WNX B;  4DRW A;  2HQK A;  2QEB A;  2VZX A;  5HKY A;  1Z2C B;  2BAP A;  4MSP A;  3BUM B;  2CCM A;  3DQ3 A;  5EB6 A;  1F8H A;  2KLD A;  1QV0 A;  3D0Y A;  2L4H A;  1BJF A;  4N1F A;  3HX4 A;  5FVI A;  2L50 A;  3U0L A;  1GM0 A;  4RYW A;  1DC1 A;  2WUR A;  4GF6 B;  1KSO A;  2GX0 A;  1CLB A;  2V53 A;  3SV5 A;  4L9M A;  2F8P A;  1EMM A;  4H47 A;  2EMD A;  1XO5 A;  1DT7 B;  2G3O A;  2KOT A;  2VRG A;  4P5O E;  1MXL C;  1RFJ A;  1J7O A;  2OKW A;  1DMO A;  4KGE A;  4W6U A;  1FF1 A;  1IKU A;  1EML A;  1W7I B;  2PRU A;  5DU0 A;  3CB9 A;  3H1R A;  1IIO A;  2LP3 A;  1XSS A;  2A47 A;  2M8U A;  1QXP A;  4NDB A;  4D1E A;  3LLE A;  4W7E A;  2GW4 B;  3FE9 A;  1RRO A;  4WQ2 A;  4IK8 A;  3SG2 A;  3PJI A;  4P2Y B;  4PPK A;  4ZIN A;  5HZT A;  3SS4 A;  3PLF B;  2A54 B;  2VVJ A;  4JKT A;  4GUK A;  4KA9 A;  1ZUZ A;  2JT0 A;  1QIV A;  1YR5 A;  1NYA A;  2KFF A;  4DUQ A;  3DQ1 A;  4WQ3 A;  2KI4 B;  2PAL A;  4IK3 A;  2JTZ A;  4IK1 A;  3K1K A;  2KDH A;  4J8A A;  2KSP A;  1A03 A;  4N1G A;  4W6T A;  5DPG A;  1J7R A;  2H5P A;  2LNK A;  2DUF A;  3O77 A;  3AAJ A;  2LVI A;  5AQB B;  4W6L A;  2LMU A;  3MSE B;  1NX0 A;  4YGB B;  3PFV A;  1KYR A;  4W72 A;  2WC8 A;  4GAO A;  1TOP A;  4PHM A;  3DYE A;  2Z6Z A;  3DQE A;  5TNC A;  1BFP A;  1K9P A;  4J88 A;  3FS7 A;  2FJU B;  4MEW A;  2DOQ A;  3RLZ A;  4CID A;  3DQN A;  4JGE A;  3IVT A;  2KBM A;  5HL1 A;  2KFH A;  2G6Y A;  1DF0 B;  3CGL A;  2JAD A;  5EB7 A;  5PAL A;  2QLE A;  2L51 A;  1KFX L;  1QAT A;  1PVA A;  1KYS A;  2KFG A;  4I5J A;  4XGY A;  4MZK A;  2LE9 B;  2M97 A;  2ZFD A;  5EXC I;  3D74 A;  2IB6 A;  2KNE A;  3DQ7 A;  1W7J B;  1YUR A;  2M3W A;  3GEX A;  4IK4 A;  3V3D A;  3BXA A;  2P70 A;  2G2B A;  4GBA A;  4W6H A;  3OBV A;  4MRY A;  4HSZ A;  2KYF A;  2GTE A;  4A4C A;  3SS5 A;  3D76 A;  3TS5 C;  4HQC A;  4DXM A;  2A4J A;  4W7C A;  3GK4 X;  1GJY A;  1UUR A;  1CM1 A;  5F9G A;  2Y4Q A;  2QAC A;  4FTG A;  1XMZ A;  2NZ0 A;  3H4S E;  3OSR A;  1YX7 A;  1VRK A;  3DVE A;  5AEQ A;  4N5X A;  2KBI A;  1PK0 D;  3CYZ A;  2KLE A;  1KK7 Z;  1NUB A;  2FZU A;  2G6E A;  3KCT A;  3JTD B;  5FVF A;  1G33 A;  5AXI A;  3SG5 A;  1B9C A;  4ZBL A;  1CLL A;  4W6M A;  1CFD A;  4DXQ A;  2MA2 A;  2EC6 B;  4I5L B;  1RJV A;  1B47 A;  5HZS A;  4W6B A;  1OMV A;  2IOV A;  1LXF C;  4YI8 A;  1YRT B;  1IH0 A;  4DKM A;  2G3D B;  3E5W A;  4ZCV A;  1YUU A;  1JUO A;  2HJO A;  2MHH A;  1CKK A;  1ZOT B;  1L7Z A;  4HE4 A;  2A52 B;  2JNX A;  1NWD A;  3FWB A;  3BXK A;  1F54 A;  1ZUX A;  3DD4 A;  4A4B A;  5I2O A;  1SCM C;  2V4E C;  2H5O A;  1KQM B;  1G4Y R;  1ORG A;  5AAN A;  2M49 B;  3WLC A;  2CXJ A;  3O78 A;  3ICB A;  1NX2 A;  3BFB A;  3B88 A;  1QAS A;  2H2K A;  3I5G B;  5HZU A;  3DQI A;  2JXC A;  2EGD A;  1NCX A;  4LQT A;  1KWO B;  1IJ6 A;  2AAO A;  3VRP A;  1LVC D;  3TDU A;  4IL1 A;  1HQV A;  4GPL B;  1Q4D A;  2LHI A;  1B7T Z;  3PJ7 A;  4TZG A;  3SSY A;  4F0Z B;  1G7K A;  3DF0 A;  5EL2 A;  1Y1A A;  4I5N B;  5I8N A;  1FBV A;  3OB1 B;  4OJ0 A;  2R2I A;  2M7L A;  3D0Y B;  1K9K A;  4GOB A;  3GL4 A;  2KAY A;  5H88 A;  1ALV A;  1QJT A;  2P4M A;  5DPJ A;  2ZNE A;  1NCY A;  2DUI A;  4OKH A;  1JC2 A;  3DQH A;  1Y1U A;  4INW A;  1R6P A;  1M63 B;  1OW4 A;  1AP4 A;  3SVS A;  4W7A A;  1GGZ A;  1GL4 A;  2MLE C;  3UNW A;  2C9I A;  2HFC A;  1K94 A;  3SG3 A;  2A48 A;  1YUS A;  3S0B A;  4MZJ A;  4GFT A;  1DGV A;  2AMI A;  1IGV A;  4RTC A;  4JWQ A;  3SS0 A;  2BCA A;  3UO9 A;  2FJY A;  2H8V A;  1RMP A;  2LVJ A;  1ZGO A;  4GGF C;  1CNP A;  5DTY A;  1XK4 A;  4PCW A;  1P28 A;  4P1Q A;  3CR5 X;  3DQL A;  5HGE A;  3SVD A;  2SCP A;  1MXE A;  1YJ2 A;  2MAZ A;  3BUN B;  2L5Y A;  3DQJ A;  4BY4 A;  2GGZ A;  2YE1 A;  1EMA A;  4JQ0 D;  3TUY B;  3O4Y A;  2O5G A;  1RTP 1;  3TDZ A;  1GQM A;  4MRX A;  1TUZ A;  3OSQ A;  4Z4M A;  2O60 A;  3ST4 A;  5H87 A;  2LUC A;  2Y1N A;  4HRG A;  2BBM A;  2VVI A;  4R6B A;  3R1P A;  5LTQ A;  1JC1 A;  2ZMU A;  1Q73 A;  2K2A A;  1MQ1 A;  3D77 A;  4W6C A;  3EK8 A;  2A56 B;  2WSN A;  2HGY A;  1KCY A;  2JXL A;  5HYD A;  3BFH A;  2A50 B;  2WCH A;  3FE6 A;  1MR8 A;  2BCX A;  2Z1O A;  1M46 A;  2EMO A;  1C3Y A;  4XYN A;  1XFU O;  3PAT A;  4YI9 A;  1KK8 B;  2WCK A;  3EVV A;  1L2O B;  1DJW A;  4DXP A;  4KW8 A;  4JRB A;  4Q7R A;  3JTD C;  3SG4 A;  3TDI A;  1NSH A;  1JC0 A;  5LTR A;  1QV1 A;  5CSI A;  2B1U A;  4QJ3 B;  3S0F A;  4ORN A;  3SJS A;  5FI2 A;  3NSL A;  4PE0 A;  2KGR A;  4OV2 A;  4INX A;  3W1C A;  3CLN A;  4W76 A;  3QME A;  4W77 A;  1XFZ O;  3IF7 A;  1Z4H A;  1C4F A;  1SR6 B;  3GK2 A;  2YDZ A;  1B8L A;  2K7C A;  2OTB A;  2FWQ A;  4CFQ A;  1Q4A A;  3LVD A;  3LVC A;  1B9A A;  1SL7 A;  5B8I B;  1S6C A;  2PAS A;  1PUL A;  1SW8 A;  2OKY A;  2OPO A;  2QEH A;  2K7D A;  4W6S A;  2JU0 A;  2HQZ A;  3DPW A;  1KK7 Y;  2L2C A;  5EJU A;  2H61 C;  3ZUL A;  3V2L A;  1BR4 B;  3K1E A;  3DVJ A;  2KAX A;  4Q04 A;  1WRK A;  1BOC A;  3A8S A;  4Q9X A;  2FCE A;  3PAL A;  3I5G C;  1F09 A;  1BMO A;  1KWO C;  1OMD A;  1W7U A;  1UHK A;  3DQ9 A;  3CDN A;  2G2S B;  1QYF A;  1BT6 A;  3LS3 A;  1SCV A;  2IS9 A;  2VAE A;  4FQT A;  4KW4 A;  2MBX A;  2QRF A;  2QLI A;  1CLM A;  3NSK A;  3VRR A;  3GJ1 A;  2WSO A;  4AQJ A;  2E30 A;  3AAK A;  4DIR A;  4M2Q A;  1XA5 A;  3ZUJ A;  3I5H B;  3EVU A;  2OS8 C;  5HKZ A;  3CZ1 A;  1C7V A;  3SSP A;  2KI6 C;  4IK5 A;  1M39 A;  4PHK A;  4W6G A;  2M1U A;  3SG7 A;  1F70 A;  3DQ8 A;  5DQB A;  1ZGQ A;  1A75 A;  3EKH A;  3VHT B;  1A29 A;  2JQ6 A;  4ZIO A;  1OOJ A;  5DKR A;  1BF5 A;  5DPH A;  5HKW A;  2TN4 A;  4L13 A;  3R1V A;  1TTX A;  3E5V A;  2H6V A;  3KO0 A;  3LF3 A;  1DTL A;  1B7T Y;  2JC2 A;  4KW9 A;  2H5R A;  4C0L A;  5EXU A;  1UHI A;  1DJY A;  5BT0 A;  2BTJ A;  5BTT A;  3HCM A;  3P8U A;  1KFU S;  5LK4 A;  1XAE A;  3BUO B;  4IJ7 A;  1YHH A;  2O2B A;  2RH7 A;  3TUY C;  3KEV A;  2MLF C;  1UHH A;  4Z4K A;  4GGN A;  3SSH A;  1JFJ A;  4ZF4 A;  2ARL A;  1DJG A;  1B4C A;  1HT9 A;  5DKN A;  1S36 A;  2HPW A;  2JRF A;  5J2O A;  1DGU A;  1JF2 A;  3ZWH A;  3DQM A;  2EMN A;  4W69 A;  2LCP A;  1BU3 A;  2QLG B;  1TIZ A;  4NWS A;  1B1G A;  2G6X A;  2WC5 A;  1EMG A;  2BCB A;  4YRU A;  2KYC A;  4IK9 A;  2CNP A;  2KPH A;  2AHA A;  4OHS A;  1RK9 A;  2LC5 A;  4I5K A;  4MVF A;  3VK1 A;  1C07 A;  2ZMW A;  2FCD A;  2Y5I A;  2QT2 A;  1ALW A;  1UUS A;  2JPO A;  3DQD A;  2H5Q A;  2LM5 A;  2LAP A;  1G8I A;  4OCI A;  3U8P A;  4H3M A;  4DXN A;  1KK8 C;  4JC2 A;  2K8M B;  1L2O C;  3PN7 B;  1SY9 A;  1TN4 A;  4M2O A;  1Y0V H;  5DQM A;  4B30 A;  3AI4 A;  1TCF A;  2LMV A;  4OQW A;  4LJC A;  3VRQ A;  2Y0G A;  3S0D A;  3NT3 A;  4JEO A;  1F4O A;  1XYD A;  4PDZ A;  3I5I B;  5DTL A;  1NPQ A;  2WCM A;  2ZKM X;  1OOI X;  1QX5 B;  1EH2 A;  4LJD C;  5AFP A;  1V1G A;  1SR6 C;  2F33 A;  1CDL A;  3TZ1 A;  2LVK A;  3CD9 A;  4KYN A;  1K90 D;  3C1V A;  3DQ4 A;  3KHE A;  2KQY A;  1QX7 A;  2L4I A;  2LHL A;  1NCZ A;  5HLV A;  4LJB A;  5DRF A;  4KF5 C;  4GNK B;  3EK7 A;  4KEX A;  5DTZ A;  4QJ5 B;  1CV7 A;  3CD1 A;  1QXT A;  1MOV A;  2Q6P A;  1WLZ A;  4PHN A;  4EN1 A;  2KI6 D;  1GFL A;  1BLQ A;  3PM8 A;  4AOM A;  3O2P A;  1MHO A;  1S6I A;  1Q4E A;  1EME A;  3OGO A;  1EMC A;  3DXL A;  4W7R A;  1XQM A;  2V4E A;  3U8A A;  4FQO A;  1IJ5 A;  1WDC B;  4M2P A;  3WHT B;  1SSE B;  4XJK B;  3H1O A;  4L12 A;  1EL4 A;  2F3Z A;  1H4U A;  4MZL A;  3LVA A;  2HPS A;  2LLT A;  1B8R A;  2K0J A;  2NCP A;  5EXB A;  2I94 A;  4QJ4 B;  4Q9W A;  2K2F A;  3UFZ A;  4HQ9 A;  2WHS A;  3FWC A;  2PSR A;  3BUX B;  1S5G Z;  1M45 A;  2CTN A;  4DCK A;  1CFF A;  2JUL A;  1K96 A;  3A4U B;  1XFV O;  1J7Q A;  1LA3 A;  1A2X A;  2DUH A;  3W1D A;  2WCL A;  1C3Z A;  1OXE A;  2JPT A;  1TNP A;  5ER4 X;  1U5I A;  2Q91 A;  4NQG A;  2M29 A;  4JD9 A;  3RWA A;  2I7A A;  1XFW O;  4NDC A;  1QTX A;  3B6X A;  3GOF A;  2WHU A;  1QVI Z;  4CLN A;  3DQK A;  3R1O A;  3EKJ A;  2VVH A;  2KI4 C;  1MUX A;  1IG5 A;  3OP0 A;  3ADF A;  3SVO A;  2PQL A;  4ORA B;  2WC6 A;  4EMQ A;  1LIN A;  1SYM A;  4H3L A;  1RMO A;  3NHT A;  2PVB A;  4BDU A;  1FPW A;  1SPY A;  2LP2 A;  4GGF A;  1MWN A;  3LSA A;  3SSL A;  4UPG A;  4W6I A;  5H89 A;  2Y1M A;  1Z1Q A;  2F2P A;  1ODB A;  2ZN9 A;  2BL0 B;  3BYA A;  2HET A;  2JTT A;  2A46 A;  1N0Y A;  1YUT A;  1ZFS A;  1DF0 A;  4W6R A;  2D8N A;  5CSF A;  4YBH B;  2HCG A;  2Q4U A;  5CSJ A;  4W7X A;  3OX6 A;  1YTZ C;  2WND A;  2P71 A;  1QYQ A;  4OZD A;  3DQ2 A;  1YJF A;  4ZB1 A;  3MGF A;  3NT9 A;  3NF0 A;  2NCO A;  3AI5 A;  4ETO A;  4LQU A;  3PN7 C;  2H9W A;  4N3D A;  1BOD A;  3LK0 A;  4ZF3 A;  3D73 A;  1KP5 A;  2E6W A;  1OMR A;  1EMF A;  1QY3 A;  4ICB A;  3FIA A;  1OOH A;  3CGA A;  3NEZ A;  3ST0 A;  5DPI A;  3EG5 B;  4W6N A;  4MBE A;  2ICR A;  3AKO A;  2JWW A;  3K21 A;  3BXC A;  2G9B A;  3SVB A;  3SVC A;  2BE4 A;  1SK6 D;  5D3O A;  4KPI A;  1F0B A;  2EC6 C;  1OOF A;  1HCJ A;  2WCE A;  1JF0 A;  1LKJ A;  4PE1 A;  1IQ3 A;  2L98 A;  3PSR A;  3IR8 A;  2WCJ A;  4ORB B;  4B30 B;  3SG6 A;  5DY6 A;  1S3P A;  2HQW A;  2AUC A;  2QPT A;  2CBL A;  2BBN A;  1R2U A;  1N65 A;  4KAG A;  1DJX A;  4HVF A;  2HRS A;  1FW4 A;  1GGX A;  4B5Y A;  3ED8 A;  2H61 A;  5EBJ A;  2C9J A;  1CM4 A;  2AWL A;  1KQM C;  1REC A;  3CZ0 A;  3IQQ A;  3DQF A;  2BE6 A;  3LF4 B;  2WCF A;  4YGE B;  2KHN A;  3LCP C;  1JBZ A;  3DQ6 A;  3OB2 B;  2WIS A;  4W6K A;  3KCS A;  2ZN8 A;  2P6B B;  5I2Q A;  1DJH A;  5FVG A;  2POX A;  2LLS A;  1K95 A;  2M7N A;  3KPX A;  1EG4 A;  3S0A A;  1X02 A;  4PPL A;  2DUE A;  1CMG A;  3SVN A;  3PIB A;  2BNX A;  2B3P A;  4ZF5 A;  5FI7 A;  2WCB A;  2LMT A;  3OGN A;  4E68 A;  4XOW A;  1XFY O;  3RM1 A;  2Z6Y A;  1SCM B;  3BFA A;  2V4E B;  2B3Q A;  3A8R A;  3DVK A;  1A4P A;  3IP2 A;  1IRJ A;  1K2H A;  3VGO A;  2GX2 A;  2CT9 A;  2FL1 A;  3ZTF A;  5KTG A;  4CFR A;  2QDI A;  4F7F A;  4LW5 A;  4PPJ A;  1DEK A;  4BY5 A;  4L1I A;  3D75 A;  1S26 D;  2BKI B;  1SL8 A;  2LAN A;  3B86 A;  5CSN A;  1XFX O;  1H6R A;  3DF0 B;  5GQQ C;  4OVN F;  3S0G A;  1Q80 A;  3JVT B;  1S5G Y;  4MLW A;  2JOJ A;  3WHU B;  1KFX S;  1OZS A;  4U8D A;  1V1F A;  1U5I B;  3BX9 A;  1ZGP A;  1LA0 A;  1DEL A;  4OGS A;  2DD7 A;  1IWQ A;  1SL9 A;  3VIC A;  2VAD A;  2QLH A;  2NXQ A;  2OTG B;  1OZO A;  2BL0 C;  1SMG A;  3NSI A;  4NDD A;  1UWO A;  1QVI Y;  2L2E A;  5I94 A;  2F2O A;  2BKH B;  5KTY A;  2WIQ A;  3O4X A;  4EDO A;  1W9Z A;  3SIA A;  5DKQ A;  2LV7 A;  2WOR A;  4W75 A;  2JT3 A;  3EK4 A;  3BXB A;  3DY9 A;  5IBW A;  1UIS A;  3CS1 A;  3SS3 A;  3CR2 A;  1WRL A;  4W6O A;  4XL5 A;  4PAL A;  4W6J A;  4ZCU A;  2WOS A;  1C7W A;  4HRE E;  2JNF A;  1W7T A;  4DXO A;  1OQP A;  2Z6X A;  1M31 A;  1IQ5 A;  1FI6 A;  4KGF A;  3CFA A;  2I2R E;  4J89 A;  5D69 A;  3NGV A;  1JWD A;  2K7B A;  3BOW A;  3LL8 B;  3Q8I A;  4H3N A;  4W6F A;  4WRI A;  1FI5 A;  5DTX A;  2I18 A;  2KAV A;  1DVI A;  3SSV A;  4IZN A;  4Q7U A;  3IQO A;  1AHR A;  5EHU A;  5K89 A;  1Z1P A;  4Q7T A;  5DRG A;  3S05 A;  1ZMZ A;  2EHB A;  3B7A A;  4USL A;  2RGI A;  1XA9 A;  1PSB A;  1KQV A;  2AWM A;  5J3X A;  5JJG A;  3I19 A;  5ER5 A;  1KFU L;  1SNL A;  1NX3 A;  3CBE A;  1F4Q A;  1ZAC A;  3SIB A;  5KU1 A;  4HRH A;  1WRZ A;  3GK1 A;  4PHJ A;  1H4B A;  5BQL A;  1DJZ A;  2AWJ A;  4LJD A;  3BJH A;  1QIW A;  5DIC A;  1MOU A;  1UHN A;  3M22 A;  3L47 A;  1HUY A;  3DVM A;  2O29 A;  3PJ5 A;  1QYO A;  3WXA A;  3ZNI A;  4JPZ B;  4W74 A;  4W6D A;  1QLS A;  1D1O A;  2IE2 A;  3R72 A;  3ST2 A;  4KF5 A;  3U0M A;  3CR4 X;  4UTS A;  1XFR A;  1QWV A;  3DZT A;  4I2Y A;  1DJI A;  2LLU A;  3CWG A;  3SST A;  4XVP A;  4H48 A;  5T3I A;  1PRW A;  4GES B;  4EDS A;  2LUX A;  3G9A A;  2K61 A;  4JFG A;  1PAL A;  3TMR A;  3ZUF A;  3BQ3 A;  2ISD A;  3VB1 A;  2AH8 A;  1LS8 A;  3LA1 A;  2YFP A;  1BR1 B;  1SKT A;  5AER A;  4PFE A;  3F45 A;  1EJ3 A;  5G08 A;  3P28 A;  1TNW A;  4R6D A;  1TNX A;  2F3Y A; 
#chains in the Genus database with same CATH homology
 3NED A;  4AS8 A;  1J7P A;  2OTE A;  2FOT A;  3U8C A;  3SSK A;  1K9U A;  4AR7 A;  3AKB A;  1Y6W A;  4C0K A;  1J55 A;  1JBA A;  1RMM A;  2A53 B;  4W7D A;  1J1D A;  4MN0 A;  3I5H C;  1RM9 A;  5CPV A;  3I5F B;  1CMF A;  3M24 A;  2JZI A;  2M0R A;  1TCO B;  4C0J A;  5HW9 A;  2GGM A;  1S1E A;  4TNC A;  1TNQ A;  1F71 A;  3M0W A;  2KGB C;  1S6Z A;  1K93 D;  3ST3 A;  3VHT A;  3D10 A;  4CPV A;  2DD9 A;  4ANJ A;  1E8A A;  2COL B;  4W7F A;  2GW3 A;  1YRU B;  1CDN A;  2SAS A;  1CFC A;  1JFK A;  3JVT C;  2GV5 A;  3NXA A;  1YZW A;  4YGC B;  3TMT A;  2OS8 B;  3EVP A;  1Q4C A;  5LTP A;  4PE4 A;  1AJ5 A;  3OHM B;  5HLO A;  3NSO A;  2M9G A;  3O6B A;  2M1K B;  1CFP A;  1SRA A;  3U0K A;  1NX1 A;  3DQ5 A;  1A75 B;  1Y1X A;  2PXS A;  2OTG C;  1S6J A;  2HGD A;  2L0P A;  1NIW A;  3VRO A;  3DQA A;  4AQI A;  3KF9 A;  2JT8 A;  1AK8 A;  1NP8 A;  3PJB A;  1MF8 B;  1B8C A;  4U2V A;  1WLM A;  2ZRT A;  1H8B A;  1PVB A;  4EUL A;  5BPJ A;  2QLG A;  4P76 A;  1OSA A;  1XK4 C;  1K8U A;  3CZT X;  1EG3 A;  3CFF A;  2KQ6 A;  5BTT B;  2PMY A;  1YVH A;  1JBY A;  4ZFS A;  3SVE A;  1EMB A;  5I2L A;  3QRX A;  3DPZ A;  5JOL A;  2K7O A;  4KF4 A;  4TZA A;  2BEC A;  1AUI B;  5FYX A;  3WCK A;  1AVS A;  4DS7 A;  4XOV A;  2QU1 A;  3CTN A;  1EXR A;  3UG0 A;  3VRN A;  2ZO6 A;  1YVL A;  1EMK A;  5HZO A;  2WHT A;  3SRY A;  3GB3 A;  4PE7 A;  1RRX A;  5FHV A;  2O24 A;  2HF5 A;  3SVU A;  4ORC B;  3E5T A;  4R1E A;  5D7F A;  1UHJ A;  3AKA A;  1N2D A;  3I5I C;  2LVV A;  1J1E A;  3BUW B;  4RYS A;  2PXW A;  4W6A A;  3BOW B;  4W73 A;  2QZ0 A;  1YFP A;  4DXI A;  1BG1 A;  1CDP A;  1RWY A;  1MYW A;  3LK1 A;  1YX8 A;  2OGR A;  3DQC A;  1OE9 B;  3E3R A;  2HQ8 A;  2ZO7 A;  4YGA A;  1JSA A;  5HBD A;  1W7S A;  3TS5 B;  1PSR A;  2L5X B;  2H8Q A;  1QX2 A;  3SVR A;  3DQU A;  3RWT A;  2OJK A;  2ZND A;  1YHI A;  1CB1 A;  3EVR A;  1F55 A;  2AWK A;  4DKN A;  2ZRS A;  1YHG A;  2YE0 A;  1OXF A;  2IB5 A;  1GGW A;  1QS7 A;  5KSZ A;  1WY9 A;  3OX5 A;  1TRF A;  3CFH A;  1XVJ A;  2MRD A;  2G16 B;  2NLN A;  2G5Z B;  2MJW B;  1OXD A;  5F6T A;  3DPX A;  4OR9 B;  1WDC C;  1AJ4 A;  2Q57 A;  1CDM A;  1SBJ A;  4XJK A;  1UP5 A;  1KYP A;  1Q4B A;  2DDD A;  3DQO A;  4W6P A;  1QLK A;  3WLD A;  2DDC A;  3GJ2 A;  4OY4 A;  2DUG A;  3U0N A;  4YGD B;  3I5F C;  1CTR A;  4HQ8 A;  1KSM A;  4JF9 A;  3WNX B;  4DRW A;  2HQK A;  2VZX A;  5HKY A;  4MSP A;  3BUM B;  2CCM A;  3DQ3 A;  5EB6 A;  1F8H A;  1QV0 A;  3D0Y A;  2L4H A;  1BJF A;  4N1F A;  3HX4 A;  5FVI A;  2L50 A;  3U0L A;  4RYW A;  2WUR A;  4GF6 B;  1KSO A;  2GX0 A;  1CLB A;  2V53 A;  3SV5 A;  4L9M A;  2F8P A;  1EMM A;  4H47 A;  2EMD A;  1XO5 A;  1DT7 B;  2G3O A;  2KOT A;  2VRG A;  4P5O E;  1MXL C;  1RFJ A;  1J7O A;  2OKW A;  1DMO A;  4KGE A;  4W6U A;  1FF1 A;  1IKU A;  1EML A;  1W7I B;  2PRU A;  5DU0 A;  3CB9 A;  3H1R A;  2LP3 A;  1XSS A;  2A47 A;  2M8U A;  1QXP A;  4NDB A;  4D1E A;  3LLE A;  4W7E A;  2GW4 B;  1RRO A;  4WQ2 A;  4IK8 A;  3SG2 A;  4P2Y B;  4ZIN A;  5HZT A;  3PLF B;  2A54 B;  2VVJ A;  4GUK A;  4KA9 A;  1ZUZ A;  2JT0 A;  1QIV A;  1YR5 A;  1NYA A;  2KFF A;  4DUQ A;  3DQ1 A;  4WQ3 A;  2KI4 B;  2PAL A;  4IK3 A;  2JTZ A;  4IK1 A;  3K1K A;  2KDH A;  4J8A A;  2KSP A;  1A03 A;  4N1G A;  4W6T A;  5DPG A;  1J7R A;  2H5P A;  2LNK A;  2DUF A;  3O77 A;  3AAJ A;  2LVI A;  5AQB B;  4W6L A;  2LMU A;  3MSE B;  1NX0 A;  4YGB B;  3PFV A;  1KYR A;  4W72 A;  2WC8 A;  4GAO A;  1TOP A;  4PHM A;  2Z6Z A;  3DQE A;  5TNC A;  1BFP A;  1K9P A;  4J88 A;  3FS7 A;  2FJU B;  4MEW A;  2DOQ A;  3RLZ A;  4CID A;  3DQN A;  4JGE A;  2KBM A;  2KFH A;  2G6Y A;  1DF0 B;  3CGL A;  2JAD A;  5EB7 A;  5PAL A;  2QLE A;  2L51 A;  1KFX L;  1QAT A;  1PVA A;  1KYS A;  2KFG A;  4I5J A;  4XGY A;  4MZK A;  2LE9 B;  2M97 A;  2ZFD A;  5EXC I;  2IB6 A;  2KNE A;  3DQ7 A;  1W7J B;  1YUR A;  2M3W A;  3GEX A;  4IK4 A;  3V3D A;  3BXA A;  2G2B A;  4GBA A;  4W6H A;  4MRY A;  4HSZ A;  2KYF A;  4A4C A;  3TS5 C;  4HQC A;  4DXM A;  2A4J A;  4W7C A;  3GK4 X;  1GJY A;  1UUR A;  1CM1 A;  5F9G A;  2Y4Q A;  2QAC A;  4FTG A;  1XMZ A;  2NZ0 A;  3H4S E;  3OSR A;  1YX7 A;  1VRK A;  3DVE A;  5AEQ A;  4N5X A;  2KBI A;  1PK0 D;  1KK7 Z;  1NUB A;  2FZU A;  2G6E A;  3KCT A;  3JTD B;  5FVF A;  1G33 A;  5AXI A;  3SG5 A;  1B9C A;  4ZBL A;  1CLL A;  4W6M A;  1CFD A;  4DXQ A;  2MA2 A;  2EC6 B;  4I5L B;  1RJV A;  1B47 A;  5HZS A;  4W6B A;  1OMV A;  2IOV A;  1LXF C;  4YI8 A;  1YRT B;  1IH0 A;  4DKM A;  2G3D B;  3E5W A;  4ZCV A;  1YUU A;  1JUO A;  2HJO A;  2MHH A;  1CKK A;  1ZOT B;  1L7Z A;  4HE4 A;  2A52 B;  2JNX A;  1NWD A;  3FWB A;  3BXK A;  1F54 A;  1ZUX A;  3DD4 A;  4A4B A;  5I2O A;  1SCM C;  2V4E C;  2H5O A;  1KQM B;  1G4Y R;  5AAN A;  2M49 B;  3WLC A;  2CXJ A;  3O78 A;  3ICB A;  1NX2 A;  1QAS A;  2H2K A;  3I5G B;  5HZU A;  3DQI A;  2JXC A;  2EGD A;  1NCX A;  4LQT A;  1KWO B;  1IJ6 A;  2AAO A;  3VRP A;  1LVC D;  3TDU A;  4IL1 A;  1HQV A;  4GPL B;  1Q4D A;  2LHI A;  1B7T Z;  3PJ7 A;  4TZG A;  3SSY A;  4F0Z B;  1G7K A;  3DF0 A;  1Y1A A;  4I5N B;  5I8N A;  1FBV A;  3OB1 B;  4OJ0 A;  2R2I A;  2M7L A;  3D0Y B;  1K9K A;  4GOB A;  3GL4 A;  2KAY A;  5H88 A;  1ALV A;  1QJT A;  2P4M A;  5DPJ A;  2ZNE A;  1NCY A;  2DUI A;  4OKH A;  1JC2 A;  3DQH A;  1Y1U A;  1R6P A;  1M63 B;  1AP4 A;  3SVS A;  4W7A A;  1GGZ A;  1GL4 A;  2MLE C;  2C9I A;  2HFC A;  1K94 A;  3SG3 A;  2A48 A;  1YUS A;  4MZJ A;  4GFT A;  1DGV A;  2AMI A;  1IGV A;  4RTC A;  4JWQ A;  3SS0 A;  2BCA A;  1RMP A;  2LVJ A;  1ZGO A;  4GGF C;  1CNP A;  5DTY A;  1XK4 A;  4PCW A;  4P1Q A;  3CR5 X;  3DQL A;  5HGE A;  3SVD A;  2SCP A;  1MXE A;  1YJ2 A;  2MAZ A;  3BUN B;  3DQJ A;  4BY4 A;  2GGZ A;  2YE1 A;  1EMA A;  4JQ0 D;  3TUY B;  3O4Y A;  2O5G A;  1RTP 1;  3TDZ A;  1GQM A;  4MRX A;  3OSQ A;  4Z4M A;  2O60 A;  3ST4 A;  5H87 A;  2LUC A;  2Y1N A;  4HRG A;  2BBM A;  2VVI A;  4R6B A;  5LTQ A;  1JC1 A;  2ZMU A;  1Q73 A;  2K2A A;  1MQ1 A;  4W6C A;  3EK8 A;  2A56 B;  2WSN A;  2HGY A;  1KCY A;  2JXL A;  5HYD A;  2A50 B;  1MR8 A;  2BCX A;  2Z1O A;  1M46 A;  2EMO A;  4XYN A;  1XFU O;  3PAT A;  4YI9 A;  1KK8 B;  3EVV A;  1L2O B;  1DJW A;  4DXP A;  4KW8 A;  4JRB A;  4Q7R A;  3JTD C;  3SG4 A;  3TDI A;  1NSH A;  1JC0 A;  5LTR A;  1QV1 A;  5CSI A;  2B1U A;  4QJ3 B;  4ORN A;  3SJS A;  3NSL A;  4PE0 A;  2KGR A;  4OV2 A;  3W1C A;  3CLN A;  4W76 A;  4W77 A;  1XFZ O;  3IF7 A;  1C4F A;  1SR6 B;  3GK2 A;  2YDZ A;  1B8L A;  2K7C A;  2OTB A;  2FWQ A;  4CFQ A;  1Q4A A;  3LVD A;  3LVC A;  1B9A A;  1SL7 A;  5B8I B;  1S6C A;  2PAS A;  1PUL A;  1SW8 A;  2OKY A;  2OPO A;  4W6S A;  2K7D A;  2JU0 A;  2HQZ A;  3DPW A;  1KK7 Y;  5EJU A;  2H61 C;  3ZUL A;  1BR4 B;  3DVJ A;  2KAX A;  4Q04 A;  1WRK A;  1BOC A;  3A8S A;  4Q9X A;  2FCE A;  3PAL A;  3I5G C;  1F09 A;  1BMO A;  1KWO C;  1OMD A;  1W7U A;  1UHK A;  3DQ9 A;  2G2S B;  1QYF A;  1BT6 A;  3LS3 A;  1SCV A;  2IS9 A;  2VAE A;  4KW4 A;  2MBX A;  2QRF A;  2QLI A;  1CLM A;  3NSK A;  3VRR A;  3GJ1 A;  2WSO A;  4AQJ A;  2E30 A;  3AAK A;  4DIR A;  4M2Q A;  1XA5 A;  3ZUJ A;  3I5H B;  3EVU A;  2OS8 C;  5HKZ A;  1C7V A;  3SSP A;  2KI6 C;  4IK5 A;  1M39 A;  4PHK A;  4W6G A;  2M1U A;  3SG7 A;  1F70 A;  3DQ8 A;  5DQB A;  1ZGQ A;  1A75 A;  3EKH A;  3VHT B;  1A29 A;  2JQ6 A;  4ZIO A;  1OOJ A;  5DKR A;  1BF5 A;  5DPH A;  5HKW A;  2TN4 A;  4L13 A;  1TTX A;  3E5V A;  2H6V A;  3KO0 A;  3LF3 A;  1DTL A;  1B7T Y;  2JC2 A;  4KW9 A;  2H5R A;  4C0L A;  5EXU A;  1UHI A;  1DJY A;  5BT0 A;  2BTJ A;  5BTT A;  3HCM A;  3P8U A;  1KFU S;  5LK4 A;  1XAE A;  3BUO B;  1YHH A;  2O2B A;  2RH7 A;  3TUY C;  3KEV A;  2MLF C;  1UHH A;  4Z4K A;  4GGN A;  3SSH A;  1JFJ A;  4ZF4 A;  2ARL A;  1DJG A;  1B4C A;  1HT9 A;  5DKN A;  1S36 A;  2HPW A;  2JRF A;  5J2O A;  1DGU A;  1JF2 A;  3ZWH A;  3DQM A;  2EMN A;  4W69 A;  2LCP A;  1BU3 A;  2QLG B;  1TIZ A;  4NWS A;  1B1G A;  2G6X A;  1EMG A;  2BCB A;  4YRU A;  2KYC A;  4IK9 A;  2CNP A;  4OHS A;  2AHA A;  1RK9 A;  2LC5 A;  4I5K A;  4MVF A;  3VK1 A;  1C07 A;  2ZMW A;  2FCD A;  2Y5I A;  2QT2 A;  1ALW A;  1UUS A;  3DQD A;  2H5Q A;  2LM5 A;  2LAP A;  1G8I A;  4OCI A;  3U8P A;  4H3M A;  4DXN A;  1KK8 C;  4JC2 A;  2K8M B;  1L2O C;  3PN7 B;  1SY9 A;  1TN4 A;  4M2O A;  1Y0V H;  5DQM A;  4B30 A;  3AI4 A;  1TCF A;  2LMV A;  4OQW A;  4LJC A;  3VRQ A;  2Y0G A;  3NT3 A;  4JEO A;  1F4O A;  1XYD A;  4PDZ A;  3I5I B;  5DTL A;  1NPQ A;  2ZKM X;  4LJD C;  1QX5 B;  1EH2 A;  5AFP A;  1V1G A;  1SR6 C;  2F33 A;  1CDL A;  3TZ1 A;  2LVK A;  3CD9 A;  1K90 D;  3C1V A;  3DQ4 A;  3KHE A;  2KQY A;  1QX7 A;  2L4I A;  2LHL A;  1NCZ A;  5HLV A;  4LJB A;  5DRF A;  4KF5 C;  4GNK B;  3EK7 A;  4KEX A;  5DTZ A;  4QJ5 B;  1CV7 A;  3CD1 A;  1QXT A;  1MOV A;  2Q6P A;  1WLZ A;  4PHN A;  4EN1 A;  2KI6 D;  1GFL A;  1BLQ A;  3PM8 A;  4AOM A;  3O2P A;  1MHO A;  1S6I A;  1Q4E A;  1EME A;  3OGO A;  1EMC A;  4W7R A;  1XQM A;  2V4E A;  3U8A A;  4FQO A;  1IJ5 A;  1WDC B;  4M2P A;  3WHT B;  4XJK B;  3H1O A;  4L12 A;  1EL4 A;  2F3Z A;  1H4U A;  4MZL A;  3LVA A;  2HPS A;  2LLT A;  1B8R A;  2K0J A;  2NCP A;  5EXB A;  2I94 A;  4QJ4 B;  4Q9W A;  2K2F A;  3UFZ A;  4HQ9 A;  2WHS A;  2F3Y A;  3FWC A;  2PSR A;  3BUX B;  1S5G Z;  1M45 A;  2CTN A;  4DCK A;  1CFF A;  2JUL A;  1K96 A;  3A4U B;  1XFV O;  1J7Q A;  1LA3 A;  1A2X A;  2DUH A;  3W1D A;  1OXE A;  2JPT A;  1TNP A;  5ER4 X;  1U5I A;  2Q91 A;  4NQG A;  2M29 A;  3RWA A;  2I7A A;  1XFW O;  4NDC A;  1QTX A;  3GOF A;  2WHU A;  1QVI Z;  4CLN A;  3DQK A;  3EKJ A;  2VVH A;  2KI4 C;  1MUX A;  1IG5 A;  3OP0 A;  3ADF A;  3SVO A;  4ORA B;  4EMQ A;  1LIN A;  1SYM A;  4H3L A;  1RMO A;  2PVB A;  4BDU A;  1FPW A;  1SPY A;  2LP2 A;  4GGF A;  1MWN A;  3LSA A;  3SSL A;  4UPG A;  4W6I A;  5H89 A;  2Y1M A;  1Z1Q A;  2F2P A;  1ODB A;  2ZN9 A;  2BL0 B;  3BYA A;  2HET A;  2JTT A;  2A46 A;  1N0Y A;  1YUT A;  1ZFS A;  1DF0 A;  4W6R A;  2D8N A;  5CSF A;  4YBH B;  2HCG A;  2Q4U A;  5CSJ A;  4W7X A;  3OX6 A;  1YTZ C;  2WND A;  1QYQ A;  3DQ2 A;  1YJF A;  4ZB1 A;  3MGF A;  3NT9 A;  3NF0 A;  2NCO A;  3AI5 A;  4ETO A;  4LQU A;  3PN7 C;  2H9W A;  4N3D A;  1BOD A;  3LK0 A;  4ZF3 A;  1KP5 A;  2E6W A;  1OMR A;  1EMF A;  1QY3 A;  4ICB A;  3FIA A;  3CGA A;  3NEZ A;  3ST0 A;  5DPI A;  4W6N A;  4MBE A;  2ICR A;  3AKO A;  2JWW A;  3K21 A;  3BXC A;  2G9B A;  3SVB A;  3SVC A;  2BE4 A;  1SK6 D;  4KPI A;  1F0B A;  2EC6 C;  1HCJ A;  2WCE A;  1JF0 A;  1LKJ A;  4PE1 A;  1IQ3 A;  2L98 A;  3PSR A;  3IR8 A;  4ORB B;  4B30 B;  3SG6 A;  5DY6 A;  1S3P A;  2HQW A;  2AUC A;  2QPT A;  2CBL A;  2BBN A;  1R2U A;  1N65 A;  4KAG A;  1DJX A;  4HVF A;  2HRS A;  1FW4 A;  1GGX A;  4B5Y A;  3ED8 A;  2H61 A;  5EBJ A;  2C9J A;  1CM4 A;  2AWL A;  1KQM C;  1REC A;  3IQQ A;  3DQF A;  2BE6 A;  3LF4 B;  2WCF A;  4YGE B;  2KHN A;  3LCP C;  1JBZ A;  3DQ6 A;  3OB2 B;  2WIS A;  4W6K A;  3KCS A;  2ZN8 A;  2P6B B;  5I2Q A;  1DJH A;  5FVG A;  2POX A;  2LLS A;  1K95 A;  2M7N A;  3KPX A;  1EG4 A;  1X02 A;  4PPL A;  2DUE A;  1CMG A;  3SVN A;  3PIB A;  2B3P A;  4ZF5 A;  2WCB A;  2LMT A;  4E68 A;  4XOW A;  1XFY O;  3RM1 A;  2Z6Y A;  1SCM B;  2V4E B;  2B3Q A;  3A8R A;  3DVK A;  1A4P A;  3IP2 A;  1IRJ A;  1K2H A;  3VGO A;  2GX2 A;  2CT9 A;  2FL1 A;  3ZTF A;  5KTG A;  4CFR A;  4LW5 A;  4PPJ A;  4BY5 A;  4L1I A;  1S26 D;  2BKI B;  1SL8 A;  2LAN A;  5CSN A;  1XFX O;  1H6R A;  3DF0 B;  5GQQ C;  4OVN F;  1Q80 A;  3JVT B;  1S5G Y;  4MLW A;  2JOJ A;  3WHU B;  1KFX S;  1OZS A;  4U8D A;  1V1F A;  1U5I B;  3BX9 A;  1ZGP A;  1LA0 A;  4OGS A;  2DD7 A;  1IWQ A;  1SL9 A;  3VIC A;  2VAD A;  2QLH A;  2NXQ A;  2OTG B;  1OZO A;  2BL0 C;  1SMG A;  3NSI A;  4NDD A;  1UWO A;  1QVI Y;  2L2E A;  2F2O A;  2BKH B;  5KTY A;  2WIQ A;  4EDO A;  3SIA A;  5DKQ A;  2LV7 A;  2WOR A;  4W75 A;  2JT3 A;  3EK4 A;  3BXB A;  5IBW A;  1UIS A;  3CS1 A;  3CR2 A;  1WRL A;  4W6O A;  4XL5 A;  4PAL A;  4W6J A;  4ZCU A;  2WOS A;  1C7W A;  4HRE E;  2JNF A;  1W7T A;  4DXO A;  1OQP A;  2Z6X A;  1M31 A;  1IQ5 A;  1FI6 A;  4KGF A;  3CFA A;  2I2R E;  4J89 A;  5D69 A;  1JWD A;  2K7B A;  3BOW A;  3LL8 B;  4H3N A;  4W6F A;  4WRI A;  1FI5 A;  5DTX A;  2I18 A;  2KAV A;  1DVI A;  3SSV A;  4IZN A;  4Q7U A;  3IQO A;  1AHR A;  5EHU A;  4Q7T A;  5K89 A;  1Z1P A;  5DRG A;  3S05 A;  1ZMZ A;  2EHB A;  4USL A;  2RGI A;  1XA9 A;  1PSB A;  1KQV A;  2AWM A;  5J3X A;  5JJG A;  3I19 A;  5ER5 A;  1KFU L;  1SNL A;  1NX3 A;  3CBE A;  1F4Q A;  1ZAC A;  3SIB A;  5KU1 A;  4HRH A;  1WRZ A;  3GK1 A;  4PHJ A;  1H4B A;  5BQL A;  1DJZ A;  2AWJ A;  4LJD A;  1QIW A;  1MOU A;  1UHN A;  3M22 A;  1HUY A;  3DVM A;  2O29 A;  3PJ5 A;  1QYO A;  3WXA A;  3ZNI A;  4JPZ B;  4W74 A;  4W6D A;  1QLS A;  1D1O A;  2IE2 A;  3ST2 A;  4KF5 A;  3U0M A;  3CR4 X;  4UTS A;  4I2Y A;  1DJI A;  2LLU A;  3CWG A;  3SST A;  4XVP A;  4H48 A;  5T3I A;  1PRW A;  4GES B;  4EDS A;  2LUX A;  3G9A A;  2K61 A;  4JFG A;  1PAL A;  3TMR A;  3ZUF A;  3BQ3 A;  2ISD A;  2AH8 A;  3LA1 A;  2YFP A;  1BR1 B;  1SKT A;  5AER A;  4PFE A;  3F45 A;  1EJ3 A;  5G08 A;  3P28 A;  1TNW A;  4R6D A;  1TNX A;  4PPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...