4R6DA

Modified mtfp* for enhanced metal binding: co-crystallization with cucl2
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
214
structure length
213
Chain Sequence
GVIKPDMKIKLKMEGNVNGYAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISLEEDSFIYEIYLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGYYRVDFKTIYRAKKAVKLPDYHFVDHRIECLNHDKDHNKVTVYESAVARN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like fluorescent chromoprotein cFP484
publication title Modified mTFP* for enhanced metal binding: co-crystallization with CuCl2
rcsb
source organism Clavularia sp.
molecule tags Fluorescent protein
total genus 60
structure length 213
sequence length 214
ec nomenclature
pdb deposition date 2014-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4r6dA00
4KA9A 5BQLA 2Z6ZA 3TMRA 2EMDA 5FVFA 5LTPA 1XMZA 3LA1A 2OTBA 3O78A 2WHTA 5EB7A 2H6VA 3LVAA 2H9WA 3EVVA 2HCGA 4W69A 2WISA 2B3PA 3BX9A 3SG6A 1JC0A 4JFGA 2Q57A 2B3QA 2WSNA 1KYSA 4W6UA 2DUIA 1W7TA 2A53B 3EK4A 1GFLA 1XSSA 2ZMWA 3SSLA 1EMBA 3ZUFA 1Q4EA 5BT0A 2A52B 3DPZA 3U8PA 3SG4A 3EKJA 3AI5A 2RH7A 1Q4DA 4DXIA 5BTTB 2VVJA 3AI4A 3DQDA 3VHTB 4XGYA 3VICA 4Q7UA 4IK5A 3NT3A 4DXNA 5DPHA 4B30B 3ADFA 4LJCA 4W6CA 3P28A 2AWMA 4LJBA 4RYSA 1XA9A 2AWKA 4ZIOA 2QLHA 3DQHA 4Q7TA 2P4MA 4IK3A 2HFCA 3AKOA 4L13A 4B5YA 5HZSA 2DDDA 2VADA 5HZUA 5KTGA 4EDSA 2H5PA 1F0BA 5J2OA 1JC1A 5DQBA 2AWLA 2AWJA 3SVBA 4KF5C 2A47A 4XOVA 1RMOA 3DQ8A 4W6KA 4W6NA 2DD9A 2H5QA 4ZINA 1KYPA 4U2VA 1Z1PA 1KP5A 3H1RA 2HGYA 5EB6A 4PPLA 5HW9A 3GEXA 2V4EC 2G2SB 1JBZA 3DQJA 1H4UA 3CB9A 4W6DA 3EK8A 4ZBLA 1YFPA 2IB5A 2EMNA 4DXOA 2IE2A 3SVEA 2WURA 1S6ZA 2QLEA 2QLGB 1YJFA 4KF5A 4HE4A 3OGOA 3SSHA 4ZFSA 1EMAA 4JF9A 3U8AA 5HZTA 1QY3A 4ZF5A 2G5ZB 4XVPA 4H48A 4Z4MA 3NEDA 4KGFA 4RTCA 2OTEA 4R6DA 5EXUA 3SG7A 2V4EA 3DPXA 3CGLA 2AHAA 4HQ8A 3A8SA 2VZXA 1XQMA 4W72A 3WLCA 3SG3A 3ST4A 3U0KA 2QLGA 3SVDA 3OSQA 4KGEA 3BXCA 2FZUA 4H3MA 2G6XA 2FWQA 4JC2A 4L12A 3SSPA 4LJDC 4PFEA 4RYWA 4KF4A 5F9GA 1F09A 4P1QA 2HPWA 2WHSA 4AS8A 3K1KA 4DXMA 4Z4KA 3SVNA 3S05A 3LVCA 3NF0A 3IR8A 1B9CA 5FVIA 3BXAA 4EN1A 3ED8A 4KAGA 4L1IA 4P76A 4XOWA 1OXDA 1EMGA 3LF4B 4I2YA 4OY4A 3EVUA 4DXPA 3RWAA 1QXTA 2VVIA 3SVOA 1G7KA 4N3DA 3IP2A 4LJDA 5LTRA 3ZTFA 1YHHA 3DQ4A 3WLDA 3UG0A 3U8CA 2ZO7A 3DQNA 5DTXA 2G6YA 4W7RA 3EKHA 3GB3A 3DQ3A 5DTZA 2POXA 1OXEA 4KW9A 3E5WA 2OKWA 4W7XA 4W75A 3SSKA 5DTLA 5H87A 2ZMUA 3W1CA 1EMMA 1MOUA 3G9AA 3ST3A 2IB6A 2HQZA 4EULA 2QRFA 4W7CA 1Q73A 4TZGA 1RMPA 1OXFA 4OJ0A 4R6BA 3SG2A 3DQ2A 1YHGA 3SVRA 1HCJA 4W6AA 3ST0A 3DQ6A 4OHSA 1C4FA 5BTTA 3EVPA 3SVUA 4OGSA 2G3DB 3W1DA 3VHTA 3EVRA 3LSAA 4UTSA 3DQ1A 3SG5A 2AH8A 2ZO6A 4B30A 1BFPA 2DUGA 4J88A 1EMCA 2HQKA 4IZNA 5EJUA 3RWTA 2H8QA 2HRSA 4OQWA 1YZWA 4W7AA 2BTJA 3U0LA 2O29A 2QLIA 3KCSA 2O2BA 5T3IA 3KCTA 3DQ5A 3P8UA 4W7DA 1EMEA 3I19A 4J89A 4BDUA 5DPJA 1EMFA 4AR7A 3E5VA 4IK1A 4LQUA 1QYOA 1EMLA 1RRXA 1Q4CA 3SVSA 4HQ9A 1MYWA 3DPWA 3SSVA 3NT9A 4KEXA 5DY6A 2QU1A 2OJKA 4W6OA 1ZGQA 1QYFA 2JADA 3DQAA 5HGEA 5LTQA 1GL4A 3ZUJA 4W74A 3SS0A 2OGRA 4JRBA 4ORNA 4EDOA 3DQLA 3DQKA 4Q7RA 4GESB 1W7SA 1KYRA 3EK7A 4W6BA 3DQUA 2WIQA 3M22A 2H5RA 1W7UA 4ZF3A 4W6FA 2HGDA 1ZGOA 1RM9A 4JGEA 1UISA 1Q4BA 2A48A 4IK8A 2VAEA 3DQFA 2DUHA 4W6IA 2Z6XA 4W6HA 5HZOA 3GL4A 4Q9WA 3V3DA 5H88A 4NWSA 4DXQA 4IK9A 5HBDA 1CV7A 3SSTA 4ZF4A 2A46A 3WCKA 3BXBA 2QT2A 2HJOA 5EXCI 5H89A 1JBYA 2GX2A 4J8AA 4W6RA 1GGXA 4W73A 2ARLA 4HQCA 2A56B 3CFAA 2ICRA 3PIBA 4W6SA 3DQ9A 4W7FA 1RMMA 2C9IA 1YJ2A 3DQOA 3GJ1A 3O77A 2PXSA 1H6RA 4W6LA 4GOBA 5DRFA 2PXWA 5FHVA 3DQ7A 3LVDA 4DKMA 3UFZA 2Z6YA 4IK4A 4W6MA 3CFHA 2YDZA 2DUEA 1HUYA 1ZGPA 3CFFA 5LK4A 2G3OA 1Q4AA 3OSRA 4H3LA 3SSYA 4LQTA 1XAEA 4GF6B 4KW4A 2VVHA 4H3NA 4W7EA 3SV5A 2A54B 4W6PA 2GW3A 3DQEA 3CBEA 2O24A 2Y0GA 3TMTA 3LF3A 2Q6PA 3LS3A 2G16B 2G6EA 3DQCA 3ST2A 2OKYA 5AQBB 2Z1OA 5DQMA 2V4EB 1MOVA 5DTYA 5DPIA 3GJ2A 2A50B 3U0MA 2C9JA 3PJ7A 4Q9XA 3CD1A 5EBJA 3DQMA 5DPGA 3SRYA 3U0NA 4H47A 3ZULA 2H5OA 4EMQA 4W6GA 5DU0A 3SVCA 2WSOA 4ZB1A 4TZAA 5EXBA 1Z1QA 1QYQA 4W76A 2IOVA 3CD9A 2YE0A 3H1OA 4XL5A 4W6JA 1ZUXA 4PPKA 2GW4B 3PJBA 2FL1A 4LW5A 4KPIA 2EMOA 3NEZA 1EMKA 4ANJA 4DKNA 3E5TA 2GX0A 3DQIA 3MGFA 5DRGA 3VK1A 4JEOA 2WHUA 3PJ5A 4PPJA 4W77A 3M24A 2DUFA 1YHIA 4W6TA 4HVFA 4KW8A 2YE1A 5EHUA 2QZ0A 5FVGA 2DD7A 2DDCA 2YFPA
chains in the Genus database with same CATH superfamily
4KA9A 5BQLA 2Z6ZA 3TMRA 2EMDA 5FVFA 5LTPA 1XMZA 3LA1A 2OTBA 3O78A 2WHTA 5EB7A 2H6VA 3LVAA 2H9WA 3EVVA 2HCGA 4W69A 2WISA 2B3PA 3BX9A 3SG6A 1JC0A 4JFGA 2Q57A 2B3QA 2WSNA 1KYSA 4W6UA 2DUIA 1W7TA 2A53B 3EK4A 1GFLA 1XSSA 2ZMWA 3SSLA 1EMBA 3ZUFA 1Q4EA 5BT0A 2A52B 3DPZA 3U8PA 3SG4A 3EKJA 3AI5A 2RH7A 1Q4DA 4DXIA 5BTTB 2VVJA 3AI4A 3DQDA 3VHTB 4XGYA 3VICA 4Q7UA 4IK5A 3NT3A 4DXNA 5DPHA 4B30B 3ADFA 4LJCA 4W6CA 3P28A 2AWMA 4LJBA 4RYSA 1XA9A 2AWKA 4ZIOA 2QLHA 3DQHA 4Q7TA 2P4MA 4IK3A 2HFCA 3AKOA 4L13A 4B5YA 5HZSA 2DDDA 2VADA 5HZUA 5KTGA 4EDSA 2H5PA 1F0BA 5J2OA 1JC1A 5DQBA 2AWLA 2AWJA 3SVBA 4KF5C 2A47A 4XOVA 1RMOA 3DQ8A 4W6KA 4W6NA 2DD9A 2H5QA 4ZINA 1KYPA 4U2VA 1Z1PA 1KP5A 3H1RA 2HGYA 5EB6A 4PPLA 5HW9A 3GEXA 2V4EC 2G2SB 1JBZA 3DQJA 1H4UA 3CB9A 4W6DA 3EK8A 4ZBLA 1YFPA 2IB5A 2EMNA 4DXOA 2IE2A 3SVEA 2WURA 1S6ZA 2QLEA 2QLGB 1YJFA 4KF5A 4HE4A 3OGOA 3SSHA 4ZFSA 1EMAA 4JF9A 3U8AA 5HZTA 1QY3A 4ZF5A 2G5ZB 4XVPA 4H48A 4Z4MA 3NEDA 4KGFA 4RTCA 2OTEA 4R6DA 5EXUA 3SG7A 2V4EA 3DPXA 3CGLA 2AHAA 4HQ8A 3A8SA 2VZXA 1XQMA 4W72A 3WLCA 3SG3A 3ST4A 3U0KA 2QLGA 3SVDA 3OSQA 4KGEA 3BXCA 2FZUA 4H3MA 2G6XA 2FWQA 4JC2A 4L12A 3SSPA 4LJDC 4PFEA 4RYWA 4KF4A 5F9GA 1F09A 4P1QA 2HPWA 2WHSA 4AS8A 3K1KA 4DXMA 4Z4KA 3SVNA 3S05A 3LVCA 3NF0A 3IR8A 1B9CA 5FVIA 3BXAA 4EN1A 3ED8A 4KAGA 4L1IA 4P76A 4XOWA 1OXDA 1EMGA 3LF4B 4I2YA 4OY4A 3EVUA 4DXPA 3RWAA 1QXTA 2VVIA 3SVOA 1G7KA 4N3DA 3IP2A 4LJDA 5LTRA 3ZTFA 1YHHA 3DQ4A 3WLDA 3UG0A 3U8CA 2ZO7A 3DQNA 5DTXA 2G6YA 4W7RA 3EKHA 3GB3A 3DQ3A 5DTZA 2POXA 1OXEA 4KW9A 3E5WA 2OKWA 4W7XA 4W75A 3SSKA 5DTLA 5H87A 2ZMUA 3W1CA 1EMMA 1MOUA 3G9AA 3ST3A 2IB6A 2HQZA 4EULA 2QRFA 4W7CA 1Q73A 4TZGA 1RMPA 1OXFA 4OJ0A 4R6BA 3SG2A 3DQ2A 1YHGA 3SVRA 1HCJA 4W6AA 3ST0A 3DQ6A 4OHSA 1C4FA 5BTTA 3EVPA 3SVUA 4OGSA 2G3DB 3W1DA 3VHTA 3EVRA 3LSAA 4UTSA 3DQ1A 3SG5A 2AH8A 2ZO6A 4B30A 1BFPA 2DUGA 4J88A 1EMCA 2HQKA 4IZNA 5EJUA 3RWTA 2H8QA 2HRSA 4OQWA 1YZWA 4W7AA 2BTJA 3U0LA 2O29A 2QLIA 3KCSA 2O2BA 5T3IA 3KCTA 3DQ5A 3P8UA 4W7DA 1EMEA 3I19A 4J89A 4BDUA 5DPJA 1EMFA 4AR7A 3E5VA 4IK1A 4LQUA 1QYOA 1EMLA 1RRXA 1Q4CA 3SVSA 4HQ9A 1MYWA 3DPWA 3SSVA 3NT9A 4KEXA 5DY6A 2QU1A 2OJKA 4W6OA 1ZGQA 1QYFA 2JADA 3DQAA 5HGEA 5LTQA 1GL4A 3ZUJA 4W74A 3SS0A 2OGRA 4JRBA 4ORNA 4EDOA 3DQLA 3DQKA 4Q7RA 4GESB 1W7SA 1KYRA 3EK7A 4W6BA 3DQUA 2WIQA 3M22A 2H5RA 1W7UA 4ZF3A 4W6FA 2HGDA 1ZGOA 1RM9A 4JGEA 1UISA 1Q4BA 2A48A 4IK8A 2VAEA 3DQFA 2DUHA 4W6IA 2Z6XA 4W6HA 5HZOA 3GL4A 4Q9WA 3V3DA 5H88A 4NWSA 4DXQA 4IK9A 5HBDA 1CV7A 3SSTA 4ZF4A 2A46A 3WCKA 3BXBA 2QT2A 2HJOA 5EXCI 5H89A 1JBYA 2GX2A 4J8AA 4W6RA 1GGXA 4W73A 2ARLA 4HQCA 2A56B 3CFAA 2ICRA 3PIBA 4W6SA 3DQ9A 4W7FA 1RMMA 2C9IA 1YJ2A 3DQOA 3GJ1A 3O77A 2PXSA 1H6RA 4W6LA 4GOBA 5DRFA 2PXWA 5FHVA 3DQ7A 3LVDA 4DKMA 3UFZA 2Z6YA 4IK4A 4W6MA 3CFHA 2YDZA 2DUEA 1HUYA 1ZGPA 3CFFA 5LK4A 2G3OA 1Q4AA 3OSRA 4H3LA 3SSYA 4LQTA 1XAEA 4GF6B 4KW4A 2VVHA 4H3NA 4W7EA 3SV5A 2A54B 4W6PA 2GW3A 3DQEA 3CBEA 2O24A 2Y0GA 3TMTA 3LF3A 2Q6PA 3LS3A 2G16B 2G6EA 3DQCA 3ST2A 2OKYA 5AQBB 2Z1OA 5DQMA 2V4EB 1MOVA 5DTYA 5DPIA 3GJ2A 2A50B 3U0MA 2C9JA 3PJ7A 4Q9XA 3CD1A 5EBJA 3DQMA 5DPGA 3SRYA 3U0NA 4H47A 3ZULA 2H5OA 4EMQA 4W6GA 5DU0A 3SVCA 2WSOA 4ZB1A 4TZAA 5EXBA 1Z1QA 1QYQA 4W76A 2IOVA 3CD9A 2YE0A 3H1OA 4XL5A 4W6JA 1ZUXA 4PPKA 2GW4B 3PJBA 2FL1A 4LW5A 4KPIA 2EMOA 3NEZA 1EMKA 4ANJA 4DKNA 3E5TA 2GX0A 3DQIA 3MGFA 5DRGA 3VK1A 4JEOA 2WHUA 3PJ5A 4PPJA 4W77A 3M24A 2DUFA 1YHIA 4W6TA 4HVFA 4KW8A 2YE1A 5EHUA 2QZ0A 5FVGA 2DD7A 2DDCA 2YFPA
chains in the Genus database with same CATH topology
4KA9A 5BQLA 2Z6ZA 3TMRA 2EMDA 5FVFA 5LTPA 1XMZA 3LA1A 2OTBA 3O78A 2WHTA 5EB7A 2H6VA 3LVAA 2H9WA 3EVVA 2HCGA 4W69A 2WISA 2B3PA 3BX9A 3SG6A 1JC0A 4JFGA 2Q57A 2B3QA 2WSNA 1KYSA 4W6UA 2DUIA 1W7TA 2A53B 3EK4A 1GFLA 1XSSA 2ZMWA 3SSLA 1EMBA 3ZUFA 1Q4EA 5BT0A 2A52B 3DPZA 3U8PA 3SG4A 3EKJA 3AI5A 2RH7A 1Q4DA 4DXIA 5BTTB 2VVJA 3AI4A 3DQDA 3VHTB 4XGYA 3VICA 4Q7UA 4IK5A 3NT3A 4DXNA 5DPHA 4B30B 3ADFA 4LJCA 4W6CA 3P28A 2AWMA 4LJBA 4RYSA 1XA9A 2AWKA 4ZIOA 2QLHA 3DQHA 4Q7TA 2P4MA 4IK3A 2HFCA 3AKOA 4L13A 4B5YA 5HZSA 2DDDA 2VADA 5HZUA 5KTGA 4EDSA 2H5PA 1F0BA 5J2OA 1JC1A 5DQBA 2AWLA 2AWJA 3SVBA 4KF5C 2A47A 4XOVA 1RMOA 3DQ8A 4W6KA 4W6NA 2DD9A 2H5QA 4ZINA 1KYPA 4U2VA 1Z1PA 1KP5A 3H1RA 2HGYA 5EB6A 4PPLA 5HW9A 3GEXA 2V4EC 2G2SB 1JBZA 3DQJA 1H4UA 3CB9A 4W6DA 3EK8A 4ZBLA 1YFPA 2IB5A 2EMNA 4DXOA 2IE2A 3SVEA 2WURA 1S6ZA 2QLEA 2QLGB 1YJFA 4KF5A 4HE4A 3OGOA 3SSHA 4ZFSA 1EMAA 4JF9A 3U8AA 5HZTA 1QY3A 4ZF5A 2G5ZB 4XVPA 4H48A 4Z4MA 3NEDA 4KGFA 4RTCA 2OTEA 4R6DA 5EXUA 3SG7A 2V4EA 3DPXA 3CGLA 2AHAA 4HQ8A 3A8SA 2VZXA 1XQMA 4W72A 3WLCA 3SG3A 3ST4A 3U0KA 2QLGA 3SVDA 3OSQA 4KGEA 3BXCA 2FZUA 4H3MA 2G6XA 2FWQA 4JC2A 4L12A 3SSPA 4LJDC 4PFEA 4RYWA 4KF4A 5F9GA 1F09A 4P1QA 2HPWA 2WHSA 4AS8A 3K1KA 4DXMA 4Z4KA 3SVNA 3S05A 3LVCA 3NF0A 3IR8A 1B9CA 5FVIA 3BXAA 4EN1A 3ED8A 4KAGA 4L1IA 4P76A 4XOWA 1OXDA 1EMGA 3LF4B 4I2YA 4OY4A 3EVUA 4DXPA 3RWAA 1QXTA 2VVIA 3SVOA 1G7KA 4N3DA 3IP2A 4LJDA 5LTRA 3ZTFA 1YHHA 3DQ4A 3WLDA 3UG0A 3U8CA 2ZO7A 3DQNA 5DTXA 2G6YA 4W7RA 3EKHA 3GB3A 3DQ3A 5DTZA 2POXA 1OXEA 4KW9A 3E5WA 2OKWA 4W7XA 4W75A 3SSKA 5DTLA 5H87A 2ZMUA 3W1CA 1EMMA 1MOUA 3G9AA 3ST3A 2IB6A 2HQZA 4EULA 2QRFA 4W7CA 1Q73A 4TZGA 1RMPA 1OXFA 4OJ0A 4R6BA 3SG2A 3DQ2A 1YHGA 3SVRA 1HCJA 4W6AA 3ST0A 3DQ6A 4OHSA 1C4FA 5BTTA 3EVPA 3SVUA 4OGSA 2G3DB 3W1DA 3VHTA 3EVRA 3LSAA 4UTSA 3DQ1A 3SG5A 2AH8A 2ZO6A 4B30A 1BFPA 2DUGA 4J88A 1EMCA 2HQKA 4IZNA 5EJUA 3RWTA 2H8QA 2HRSA 4OQWA 1YZWA 4W7AA 2BTJA 3U0LA 2O29A 2QLIA 3KCSA 2O2BA 5T3IA 3KCTA 3DQ5A 3P8UA 4W7DA 1EMEA 3I19A 4J89A 4BDUA 5DPJA 1EMFA 4AR7A 3E5VA 4IK1A 4LQUA 1QYOA 1EMLA 1RRXA 1Q4CA 3SVSA 4HQ9A 1MYWA 3DPWA 3SSVA 3NT9A 4KEXA 5DY6A 2QU1A 2OJKA 4W6OA 1ZGQA 1QYFA 2JADA 3DQAA 5HGEA 5LTQA 1GL4A 3ZUJA 4W74A 3SS0A 2OGRA 4JRBA 4ORNA 4EDOA 3DQLA 3DQKA 4Q7RA 4GESB 1W7SA 1KYRA 3EK7A 4W6BA 3DQUA 2WIQA 3M22A 2H5RA 1W7UA 4ZF3A 4W6FA 2HGDA 1ZGOA 1RM9A 4JGEA 1UISA 1Q4BA 2A48A 4IK8A 2VAEA 3DQFA 2DUHA 4W6IA 2Z6XA 4W6HA 5HZOA 3GL4A 4Q9WA 3V3DA 5H88A 4NWSA 4DXQA 4IK9A 5HBDA 1CV7A 3SSTA 4ZF4A 2A46A 3WCKA 3BXBA 2QT2A 2HJOA 5EXCI 5H89A 1JBYA 2GX2A 4J8AA 4W6RA 1GGXA 4W73A 2ARLA 4HQCA 2A56B 3CFAA 2ICRA 3PIBA 4W6SA 3DQ9A 4W7FA 1RMMA 2C9IA 1YJ2A 3DQOA 3GJ1A 3O77A 2PXSA 1H6RA 4W6LA 4GOBA 5DRFA 2PXWA 5FHVA 3DQ7A 3LVDA 4DKMA 3UFZA 2Z6YA 4IK4A 4W6MA 3CFHA 2YDZA 2DUEA 1HUYA 1ZGPA 3CFFA 5LK4A 2G3OA 1Q4AA 3OSRA 4H3LA 3SSYA 4LQTA 1XAEA 4GF6B 4KW4A 2VVHA 4H3NA 4W7EA 3SV5A 2A54B 4W6PA 2GW3A 3DQEA 3CBEA 2O24A 2Y0GA 3TMTA 3LF3A 2Q6PA 3LS3A 2G16B 2G6EA 3DQCA 3ST2A 2OKYA 5AQBB 2Z1OA 5DQMA 2V4EB 1MOVA 5DTYA 5DPIA 3GJ2A 2A50B 3U0MA 2C9JA 3PJ7A 4Q9XA 3CD1A 5EBJA 3DQMA 5DPGA 3SRYA 3U0NA 4H47A 3ZULA 2H5OA 4EMQA 4W6GA 5DU0A 3SVCA 2WSOA 4ZB1A 4TZAA 5EXBA 1Z1QA 1QYQA 4W76A 2IOVA 3CD9A 2YE0A 3H1OA 4XL5A 4W6JA 1ZUXA 4PPKA 2GW4B 3PJBA 2FL1A 4LW5A 4KPIA 2EMOA 3NEZA 1EMKA 4ANJA 4DKNA 3E5TA 2GX0A 3DQIA 3MGFA 5DRGA 3VK1A 4JEOA 2WHUA 3PJ5A 4PPJA 4W77A 3M24A 2DUFA 1YHIA 4W6TA 4HVFA 4KW8A 2YE1A 5EHUA 2QZ0A 5FVGA 2DD7A 2DDCA 2YFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KA9 A;  5BQL A;  2Z6Z A;  3TMR A;  2EMD A;  5FVF A;  5LTP A;  1XMZ A;  3LA1 A;  2OTB A;  3O78 A;  2WHT A;  5EB7 A;  2H6V A;  3LVA A;  2H9W A;  3EVV A;  2HCG A;  4W69 A;  2WIS A;  2B3P A;  3BX9 A;  3SG6 A;  1JC0 A;  4JFG A;  2Q57 A;  2B3Q A;  2WSN A;  1KYS A;  4W6U A;  2DUI A;  1W7T A;  2A53 B;  3EK4 A;  1GFL A;  1XSS A;  2ZMW A;  3SSL A;  1EMB A;  3ZUF A;  1Q4E A;  5BT0 A;  2A52 B;  3DPZ A;  3U8P A;  3SG4 A;  3EKJ A;  3AI5 A;  2RH7 A;  1Q4D A;  4DXI A;  5BTT B;  2VVJ A;  3AI4 A;  3DQD A;  3VHT B;  4XGY A;  3VIC A;  4Q7U A;  4IK5 A;  3NT3 A;  4DXN A;  5DPH A;  4B30 B;  3ADF A;  4LJC A;  4W6C A;  3P28 A;  2AWM A;  4LJB A;  4RYS A;  1XA9 A;  2AWK A;  4ZIO A;  2QLH A;  3DQH A;  4Q7T A;  2P4M A;  4IK3 A;  2HFC A;  3AKO A;  4L13 A;  4B5Y A;  5HZS A;  2DDD A;  2VAD A;  5HZU A;  5KTG A;  4EDS A;  2H5P A;  1F0B A;  5J2O A;  1JC1 A;  5DQB A;  2AWL A;  2AWJ A;  3SVB A;  4KF5 C;  2A47 A;  4XOV A;  1RMO A;  3DQ8 A;  4W6K A;  4W6N A;  2DD9 A;  2H5Q A;  4ZIN A;  1KYP A;  4U2V A;  1Z1P A;  1KP5 A;  3H1R A;  2HGY A;  5EB6 A;  4PPL A;  5HW9 A;  3GEX A;  2V4E C;  2G2S B;  1JBZ A;  3DQJ A;  1H4U A;  3CB9 A;  4W6D A;  3EK8 A;  4ZBL A;  1YFP A;  2IB5 A;  2EMN A;  4DXO A;  2IE2 A;  3SVE A;  2WUR A;  1S6Z A;  2QLE A;  2QLG B;  1YJF A;  4KF5 A;  4HE4 A;  3OGO A;  3SSH A;  4ZFS A;  1EMA A;  4JF9 A;  3U8A A;  5HZT A;  1QY3 A;  4ZF5 A;  2G5Z B;  4XVP A;  4H48 A;  4Z4M A;  3NED A;  4KGF A;  4RTC A;  2OTE A;  4R6D A;  5EXU A;  3SG7 A;  2V4E A;  3DPX A;  3CGL A;  2AHA A;  4HQ8 A;  3A8S A;  2VZX A;  1XQM A;  4W72 A;  3WLC A;  3SG3 A;  3ST4 A;  3U0K A;  2QLG A;  3SVD A;  3OSQ A;  4KGE A;  3BXC A;  2FZU A;  4H3M A;  2G6X A;  2FWQ A;  4JC2 A;  4L12 A;  3SSP A;  4LJD C;  4PFE A;  4RYW A;  4KF4 A;  5F9G A;  1F09 A;  4P1Q A;  2HPW A;  2WHS A;  4AS8 A;  3K1K A;  4DXM A;  4Z4K A;  3SVN A;  3S05 A;  3LVC A;  3NF0 A;  3IR8 A;  1B9C A;  5FVI A;  3BXA A;  4EN1 A;  3ED8 A;  4KAG A;  4L1I A;  4P76 A;  4XOW A;  1OXD A;  1EMG A;  3LF4 B;  4I2Y A;  4OY4 A;  3EVU A;  4DXP A;  3RWA A;  1QXT A;  2VVI A;  3SVO A;  1G7K A;  4N3D A;  3IP2 A;  4LJD A;  5LTR A;  3ZTF A;  1YHH A;  3DQ4 A;  3WLD A;  3UG0 A;  3U8C A;  2ZO7 A;  3DQN A;  5DTX A;  2G6Y A;  4W7R A;  3EKH A;  3GB3 A;  3DQ3 A;  5DTZ A;  2POX A;  1OXE A;  4KW9 A;  3E5W A;  2OKW A;  4W7X A;  4W75 A;  3SSK A;  5DTL A;  5H87 A;  2ZMU A;  3W1C A;  1EMM A;  1MOU A;  3G9A A;  3ST3 A;  2IB6 A;  2HQZ A;  4EUL A;  2QRF A;  4W7C A;  1Q73 A;  4TZG A;  1RMP A;  1OXF A;  4OJ0 A;  4R6B A;  3SG2 A;  3DQ2 A;  1YHG A;  3SVR A;  1HCJ A;  4W6A A;  3ST0 A;  3DQ6 A;  4OHS A;  1C4F A;  5BTT A;  3EVP A;  3SVU A;  4OGS A;  2G3D B;  3W1D A;  3VHT A;  3EVR A;  3LSA A;  4UTS A;  3DQ1 A;  3SG5 A;  2AH8 A;  2ZO6 A;  4B30 A;  1BFP A;  2DUG A;  4J88 A;  1EMC A;  2HQK A;  4IZN A;  5EJU A;  3RWT A;  2H8Q A;  2HRS A;  4OQW A;  1YZW A;  4W7A A;  2BTJ A;  3U0L A;  2O29 A;  2QLI A;  3KCS A;  2O2B A;  5T3I A;  3KCT A;  3DQ5 A;  3P8U A;  4W7D A;  1EME A;  3I19 A;  4J89 A;  4BDU A;  5DPJ A;  1EMF A;  4AR7 A;  3E5V A;  4IK1 A;  4LQU A;  1QYO A;  1EML A;  1RRX A;  1Q4C A;  3SVS A;  4HQ9 A;  1MYW A;  3DPW A;  3SSV A;  3NT9 A;  4KEX A;  5DY6 A;  2QU1 A;  2OJK A;  4W6O A;  1ZGQ A;  1QYF A;  2JAD A;  3DQA A;  5HGE A;  5LTQ A;  1GL4 A;  3ZUJ A;  4W74 A;  3SS0 A;  2OGR A;  4JRB A;  4ORN A;  4EDO A;  3DQL A;  3DQK A;  4Q7R A;  4GES B;  1W7S A;  1KYR A;  3EK7 A;  4W6B A;  3DQU A;  2WIQ A;  3M22 A;  2H5R A;  1W7U A;  4ZF3 A;  4W6F A;  2HGD A;  1ZGO A;  1RM9 A;  4JGE A;  1UIS A;  1Q4B A;  2A48 A;  4IK8 A;  2VAE A;  3DQF A;  2DUH A;  4W6I A;  2Z6X A;  4W6H A;  5HZO A;  3GL4 A;  4Q9W A;  3V3D A;  5H88 A;  4NWS A;  4DXQ A;  4IK9 A;  5HBD A;  1CV7 A;  3SST A;  4ZF4 A;  2A46 A;  3WCK A;  3BXB A;  2QT2 A;  2HJO A;  5EXC I;  5H89 A;  1JBY A;  2GX2 A;  4J8A A;  4W6R A;  1GGX A;  4W73 A;  2ARL A;  4HQC A;  2A56 B;  3CFA A;  2ICR A;  3PIB A;  4W6S A;  3DQ9 A;  4W7F A;  1RMM A;  2C9I A;  1YJ2 A;  3DQO A;  3GJ1 A;  3O77 A;  2PXS A;  1H6R A;  4W6L A;  4GOB A;  5DRF A;  2PXW A;  5FHV A;  3DQ7 A;  3LVD A;  4DKM A;  3UFZ A;  2Z6Y A;  4IK4 A;  4W6M A;  3CFH A;  2YDZ A;  2DUE A;  1HUY A;  1ZGP A;  3CFF A;  5LK4 A;  2G3O A;  1Q4A A;  3OSR A;  4H3L A;  3SSY A;  4LQT A;  1XAE A;  4GF6 B;  4KW4 A;  2VVH A;  4H3N A;  4W7E A;  3SV5 A;  2A54 B;  4W6P A;  2GW3 A;  3DQE A;  3CBE A;  2O24 A;  2Y0G A;  3TMT A;  3LF3 A;  2Q6P A;  3LS3 A;  2G16 B;  2G6E A;  3DQC A;  3ST2 A;  2OKY A;  5AQB B;  2Z1O A;  5DQM A;  2V4E B;  1MOV A;  5DTY A;  5DPI A;  3GJ2 A;  2A50 B;  3U0M A;  2C9J A;  3PJ7 A;  4Q9X A;  3CD1 A;  5EBJ A;  3DQM A;  5DPG A;  3SRY A;  3U0N A;  4H47 A;  3ZUL A;  2H5O A;  4EMQ A;  4W6G A;  5DU0 A;  3SVC A;  2WSO A;  4ZB1 A;  4TZA A;  5EXB A;  1Z1Q A;  1QYQ A;  4W76 A;  2IOV A;  3CD9 A;  2YE0 A;  3H1O A;  4XL5 A;  4W6J A;  1ZUX A;  4PPK A;  2GW4 B;  3PJB A;  2FL1 A;  4LW5 A;  4KPI A;  2EMO A;  3NEZ A;  1EMK A;  4ANJ A;  4DKN A;  3E5T A;  2GX0 A;  3DQI A;  3MGF A;  5DRG A;  3VK1 A;  4JEO A;  2WHU A;  3PJ5 A;  4PPJ A;  4W77 A;  3M24 A;  2DUF A;  1YHI A;  4W6T A;  4HVF A;  4KW8 A;  2YE1 A;  5EHU A;  2QZ0 A;  5FVG A;  2DD7 A;  2DDC A;  2YFP A; 
#chains in the Genus database with same CATH topology
 4KA9 A;  5BQL A;  2Z6Z A;  3TMR A;  2EMD A;  5FVF A;  5LTP A;  1XMZ A;  3LA1 A;  2OTB A;  3O78 A;  2WHT A;  5EB7 A;  2H6V A;  3LVA A;  2H9W A;  3EVV A;  2HCG A;  4W69 A;  2WIS A;  2B3P A;  3BX9 A;  3SG6 A;  1JC0 A;  4JFG A;  2Q57 A;  2B3Q A;  2WSN A;  1KYS A;  4W6U A;  2DUI A;  1W7T A;  2A53 B;  3EK4 A;  1GFL A;  1XSS A;  2ZMW A;  3SSL A;  1EMB A;  3ZUF A;  1Q4E A;  5BT0 A;  2A52 B;  3DPZ A;  3U8P A;  3SG4 A;  3EKJ A;  3AI5 A;  2RH7 A;  1Q4D A;  4DXI A;  5BTT B;  2VVJ A;  3AI4 A;  3DQD A;  3VHT B;  4XGY A;  3VIC A;  4Q7U A;  4IK5 A;  3NT3 A;  4DXN A;  5DPH A;  4B30 B;  3ADF A;  4LJC A;  4W6C A;  3P28 A;  2AWM A;  4LJB A;  4RYS A;  1XA9 A;  2AWK A;  4ZIO A;  2QLH A;  3DQH A;  4Q7T A;  2P4M A;  4IK3 A;  2HFC A;  3AKO A;  4L13 A;  4B5Y A;  5HZS A;  2DDD A;  2VAD A;  5HZU A;  5KTG A;  4EDS A;  2H5P A;  1F0B A;  5J2O A;  1JC1 A;  5DQB A;  2AWL A;  2AWJ A;  3SVB A;  4KF5 C;  2A47 A;  4XOV A;  1RMO A;  3DQ8 A;  4W6K A;  4W6N A;  2DD9 A;  2H5Q A;  4ZIN A;  1KYP A;  4U2V A;  1Z1P A;  1KP5 A;  3H1R A;  2HGY A;  5EB6 A;  4PPL A;  5HW9 A;  3GEX A;  2V4E C;  2G2S B;  1JBZ A;  3DQJ A;  1H4U A;  3CB9 A;  4W6D A;  3EK8 A;  4ZBL A;  1YFP A;  2IB5 A;  2EMN A;  4DXO A;  2IE2 A;  3SVE A;  2WUR A;  1S6Z A;  2QLE A;  2QLG B;  1YJF A;  4KF5 A;  4HE4 A;  3OGO A;  3SSH A;  4ZFS A;  1EMA A;  4JF9 A;  3U8A A;  5HZT A;  1QY3 A;  4ZF5 A;  2G5Z B;  4XVP A;  4H48 A;  4Z4M A;  3NED A;  4KGF A;  4RTC A;  2OTE A;  4R6D A;  5EXU A;  3SG7 A;  2V4E A;  3DPX A;  3CGL A;  2AHA A;  4HQ8 A;  3A8S A;  2VZX A;  1XQM A;  4W72 A;  3WLC A;  3SG3 A;  3ST4 A;  3U0K A;  2QLG A;  3SVD A;  3OSQ A;  4KGE A;  3BXC A;  2FZU A;  4H3M A;  2G6X A;  2FWQ A;  4JC2 A;  4L12 A;  3SSP A;  4LJD C;  4PFE A;  4RYW A;  4KF4 A;  5F9G A;  1F09 A;  4P1Q A;  2HPW A;  2WHS A;  4AS8 A;  3K1K A;  4DXM A;  4Z4K A;  3SVN A;  3S05 A;  3LVC A;  3NF0 A;  3IR8 A;  1B9C A;  5FVI A;  3BXA A;  4EN1 A;  3ED8 A;  4KAG A;  4L1I A;  4P76 A;  4XOW A;  1OXD A;  1EMG A;  3LF4 B;  4I2Y A;  4OY4 A;  3EVU A;  4DXP A;  3RWA A;  1QXT A;  2VVI A;  3SVO A;  1G7K A;  4N3D A;  3IP2 A;  4LJD A;  5LTR A;  3ZTF A;  1YHH A;  3DQ4 A;  3WLD A;  3UG0 A;  3U8C A;  2ZO7 A;  3DQN A;  5DTX A;  2G6Y A;  4W7R A;  3EKH A;  3GB3 A;  3DQ3 A;  5DTZ A;  2POX A;  1OXE A;  4KW9 A;  3E5W A;  2OKW A;  4W7X A;  4W75 A;  3SSK A;  5DTL A;  5H87 A;  2ZMU A;  3W1C A;  1EMM A;  1MOU A;  3G9A A;  3ST3 A;  2IB6 A;  2HQZ A;  4EUL A;  2QRF A;  4W7C A;  1Q73 A;  4TZG A;  1RMP A;  1OXF A;  4OJ0 A;  4R6B A;  3SG2 A;  3DQ2 A;  1YHG A;  3SVR A;  1HCJ A;  4W6A A;  3ST0 A;  3DQ6 A;  4OHS A;  1C4F A;  5BTT A;  3EVP A;  3SVU A;  4OGS A;  2G3D B;  3W1D A;  3VHT A;  3EVR A;  3LSA A;  4UTS A;  3DQ1 A;  3SG5 A;  2AH8 A;  2ZO6 A;  4B30 A;  1BFP A;  2DUG A;  4J88 A;  1EMC A;  2HQK A;  4IZN A;  5EJU A;  3RWT A;  2H8Q A;  2HRS A;  4OQW A;  1YZW A;  4W7A A;  2BTJ A;  3U0L A;  2O29 A;  2QLI A;  3KCS A;  2O2B A;  5T3I A;  3KCT A;  3DQ5 A;  3P8U A;  4W7D A;  1EME A;  3I19 A;  4J89 A;  4BDU A;  5DPJ A;  1EMF A;  4AR7 A;  3E5V A;  4IK1 A;  4LQU A;  1QYO A;  1EML A;  1RRX A;  1Q4C A;  3SVS A;  4HQ9 A;  1MYW A;  3DPW A;  3SSV A;  3NT9 A;  4KEX A;  5DY6 A;  2QU1 A;  2OJK A;  4W6O A;  1ZGQ A;  1QYF A;  2JAD A;  3DQA A;  5HGE A;  5LTQ A;  1GL4 A;  3ZUJ A;  4W74 A;  3SS0 A;  2OGR A;  4JRB A;  4ORN A;  4EDO A;  3DQL A;  3DQK A;  4Q7R A;  4GES B;  1W7S A;  1KYR A;  3EK7 A;  4W6B A;  3DQU A;  2WIQ A;  3M22 A;  2H5R A;  1W7U A;  4ZF3 A;  4W6F A;  2HGD A;  1ZGO A;  1RM9 A;  4JGE A;  1UIS A;  1Q4B A;  2A48 A;  4IK8 A;  2VAE A;  3DQF A;  2DUH A;  4W6I A;  2Z6X A;  4W6H A;  5HZO A;  3GL4 A;  4Q9W A;  3V3D A;  5H88 A;  4NWS A;  4DXQ A;  4IK9 A;  5HBD A;  1CV7 A;  3SST A;  4ZF4 A;  2A46 A;  3WCK A;  3BXB A;  2QT2 A;  2HJO A;  5EXC I;  5H89 A;  1JBY A;  2GX2 A;  4J8A A;  4W6R A;  1GGX A;  4W73 A;  2ARL A;  4HQC A;  2A56 B;  3CFA A;  2ICR A;  3PIB A;  4W6S A;  3DQ9 A;  4W7F A;  1RMM A;  2C9I A;  1YJ2 A;  3DQO A;  3GJ1 A;  3O77 A;  2PXS A;  1H6R A;  4W6L A;  4GOB A;  5DRF A;  2PXW A;  5FHV A;  3DQ7 A;  3LVD A;  4DKM A;  3UFZ A;  2Z6Y A;  4IK4 A;  4W6M A;  3CFH A;  2YDZ A;  2DUE A;  1HUY A;  1ZGP A;  3CFF A;  5LK4 A;  2G3O A;  1Q4A A;  3OSR A;  4H3L A;  3SSY A;  4LQT A;  1XAE A;  4GF6 B;  4KW4 A;  2VVH A;  4H3N A;  4W7E A;  3SV5 A;  2A54 B;  4W6P A;  2GW3 A;  3DQE A;  3CBE A;  2O24 A;  2Y0G A;  3TMT A;  3LF3 A;  2Q6P A;  3LS3 A;  2G16 B;  2G6E A;  3DQC A;  3ST2 A;  2OKY A;  5AQB B;  2Z1O A;  5DQM A;  2V4E B;  1MOV A;  5DTY A;  5DPI A;  3GJ2 A;  2A50 B;  3U0M A;  2C9J A;  3PJ7 A;  4Q9X A;  3CD1 A;  5EBJ A;  3DQM A;  5DPG A;  3SRY A;  3U0N A;  4H47 A;  3ZUL A;  2H5O A;  4EMQ A;  4W6G A;  5DU0 A;  3SVC A;  2WSO A;  4ZB1 A;  4TZA A;  5EXB A;  1Z1Q A;  1QYQ A;  4W76 A;  2IOV A;  3CD9 A;  2YE0 A;  3H1O A;  4XL5 A;  4W6J A;  1ZUX A;  4PPK A;  2GW4 B;  3PJB A;  2FL1 A;  4LW5 A;  4KPI A;  2EMO A;  3NEZ A;  1EMK A;  4ANJ A;  4DKN A;  3E5T A;  2GX0 A;  3DQI A;  3MGF A;  5DRG A;  3VK1 A;  4JEO A;  2WHU A;  3PJ5 A;  4PPJ A;  4W77 A;  3M24 A;  2DUF A;  1YHI A;  4W6T A;  4HVF A;  4KW8 A;  2YE1 A;  5EHU A;  2QZ0 A;  5FVG A;  2DD7 A;  2DDC A;  2YFP A; 
#chains in the Genus database with same CATH homology
 4KA9 A;  5BQL A;  2Z6Z A;  3TMR A;  2EMD A;  5FVF A;  5LTP A;  1XMZ A;  3LA1 A;  2OTB A;  3O78 A;  2WHT A;  5EB7 A;  2H6V A;  3LVA A;  2H9W A;  3EVV A;  2HCG A;  4W69 A;  2WIS A;  2B3P A;  3BX9 A;  3SG6 A;  1JC0 A;  4JFG A;  2Q57 A;  2B3Q A;  2WSN A;  1KYS A;  4W6U A;  2DUI A;  1W7T A;  2A53 B;  3EK4 A;  1GFL A;  1XSS A;  2ZMW A;  3SSL A;  1EMB A;  3ZUF A;  1Q4E A;  5BT0 A;  2A52 B;  3DPZ A;  3U8P A;  3SG4 A;  3EKJ A;  3AI5 A;  2RH7 A;  1Q4D A;  4DXI A;  5BTT B;  2VVJ A;  3AI4 A;  3DQD A;  3VHT B;  4XGY A;  3VIC A;  4Q7U A;  4IK5 A;  3NT3 A;  4DXN A;  5DPH A;  4B30 B;  3ADF A;  4LJC A;  4W6C A;  3P28 A;  2AWM A;  4LJB A;  4RYS A;  1XA9 A;  2AWK A;  4ZIO A;  2QLH A;  3DQH A;  4Q7T A;  2P4M A;  4IK3 A;  2HFC A;  3AKO A;  4L13 A;  4B5Y A;  5HZS A;  2DDD A;  2VAD A;  5HZU A;  5KTG A;  4EDS A;  2H5P A;  1F0B A;  5J2O A;  1JC1 A;  5DQB A;  2AWL A;  2AWJ A;  3SVB A;  4KF5 C;  2A47 A;  4XOV A;  1RMO A;  3DQ8 A;  4W6K A;  4W6N A;  2DD9 A;  2H5Q A;  4ZIN A;  1KYP A;  4U2V A;  1Z1P A;  1KP5 A;  3H1R A;  2HGY A;  5EB6 A;  4PPL A;  5HW9 A;  3GEX A;  2V4E C;  2G2S B;  1JBZ A;  3DQJ A;  1H4U A;  3CB9 A;  4W6D A;  3EK8 A;  4ZBL A;  1YFP A;  2IB5 A;  2EMN A;  4DXO A;  2IE2 A;  3SVE A;  2WUR A;  1S6Z A;  2QLE A;  2QLG B;  1YJF A;  4KF5 A;  4HE4 A;  3OGO A;  3SSH A;  4ZFS A;  1EMA A;  4JF9 A;  3U8A A;  5HZT A;  1QY3 A;  4ZF5 A;  2G5Z B;  4XVP A;  4H48 A;  4Z4M A;  3NED A;  4KGF A;  4RTC A;  2OTE A;  4R6D A;  5EXU A;  3SG7 A;  2V4E A;  3DPX A;  3CGL A;  2AHA A;  4HQ8 A;  3A8S A;  2VZX A;  1XQM A;  4W72 A;  3WLC A;  3SG3 A;  3ST4 A;  3U0K A;  2QLG A;  3SVD A;  3OSQ A;  4KGE A;  3BXC A;  2FZU A;  4H3M A;  2G6X A;  2FWQ A;  4JC2 A;  4L12 A;  3SSP A;  4LJD C;  4PFE A;  4RYW A;  4KF4 A;  5F9G A;  1F09 A;  4P1Q A;  2HPW A;  2WHS A;  4AS8 A;  3K1K A;  4DXM A;  4Z4K A;  3SVN A;  3S05 A;  3LVC A;  3NF0 A;  3IR8 A;  1B9C A;  5FVI A;  3BXA A;  4EN1 A;  3ED8 A;  4KAG A;  4L1I A;  4P76 A;  4XOW A;  1OXD A;  1EMG A;  3LF4 B;  4I2Y A;  4OY4 A;  3EVU A;  4DXP A;  3RWA A;  1QXT A;  2VVI A;  3SVO A;  1G7K A;  4N3D A;  3IP2 A;  4LJD A;  5LTR A;  3ZTF A;  1YHH A;  3DQ4 A;  3WLD A;  3UG0 A;  3U8C A;  2ZO7 A;  3DQN A;  5DTX A;  2G6Y A;  4W7R A;  3EKH A;  3GB3 A;  3DQ3 A;  5DTZ A;  2POX A;  1OXE A;  4KW9 A;  3E5W A;  2OKW A;  4W7X A;  4W75 A;  3SSK A;  5DTL A;  5H87 A;  2ZMU A;  3W1C A;  1EMM A;  1MOU A;  3G9A A;  3ST3 A;  2IB6 A;  2HQZ A;  4EUL A;  2QRF A;  4W7C A;  1Q73 A;  4TZG A;  1RMP A;  1OXF A;  4OJ0 A;  4R6B A;  3SG2 A;  3DQ2 A;  1YHG A;  3SVR A;  1HCJ A;  4W6A A;  3ST0 A;  3DQ6 A;  4OHS A;  1C4F A;  5BTT A;  3EVP A;  3SVU A;  4OGS A;  2G3D B;  3W1D A;  3VHT A;  3EVR A;  3LSA A;  4UTS A;  3DQ1 A;  3SG5 A;  2AH8 A;  2ZO6 A;  4B30 A;  1BFP A;  2DUG A;  4J88 A;  1EMC A;  2HQK A;  4IZN A;  5EJU A;  3RWT A;  2H8Q A;  2HRS A;  4OQW A;  1YZW A;  4W7A A;  2BTJ A;  3U0L A;  2O29 A;  2QLI A;  3KCS A;  2O2B A;  5T3I A;  3KCT A;  3DQ5 A;  3P8U A;  4W7D A;  1EME A;  3I19 A;  4J89 A;  4BDU A;  5DPJ A;  1EMF A;  4AR7 A;  3E5V A;  4IK1 A;  4LQU A;  1QYO A;  1EML A;  1RRX A;  1Q4C A;  3SVS A;  4HQ9 A;  1MYW A;  3DPW A;  3SSV A;  3NT9 A;  4KEX A;  5DY6 A;  2QU1 A;  2OJK A;  4W6O A;  1ZGQ A;  1QYF A;  2JAD A;  3DQA A;  5HGE A;  5LTQ A;  1GL4 A;  3ZUJ A;  4W74 A;  3SS0 A;  2OGR A;  4JRB A;  4ORN A;  4EDO A;  3DQL A;  3DQK A;  4Q7R A;  4GES B;  1W7S A;  1KYR A;  3EK7 A;  4W6B A;  3DQU A;  2WIQ A;  3M22 A;  2H5R A;  1W7U A;  4ZF3 A;  4W6F A;  2HGD A;  1ZGO A;  1RM9 A;  4JGE A;  1UIS A;  1Q4B A;  2A48 A;  4IK8 A;  2VAE A;  3DQF A;  2DUH A;  4W6I A;  2Z6X A;  4W6H A;  5HZO A;  3GL4 A;  4Q9W A;  3V3D A;  5H88 A;  4NWS A;  4DXQ A;  4IK9 A;  5HBD A;  1CV7 A;  3SST A;  4ZF4 A;  2A46 A;  3WCK A;  3BXB A;  2QT2 A;  2HJO A;  5EXC I;  5H89 A;  1JBY A;  2GX2 A;  4J8A A;  4W6R A;  1GGX A;  4W73 A;  2ARL A;  4HQC A;  2A56 B;  3CFA A;  2ICR A;  3PIB A;  4W6S A;  3DQ9 A;  4W7F A;  1RMM A;  2C9I A;  1YJ2 A;  3DQO A;  3GJ1 A;  3O77 A;  2PXS A;  1H6R A;  4W6L A;  4GOB A;  5DRF A;  2PXW A;  5FHV A;  3DQ7 A;  3LVD A;  4DKM A;  3UFZ A;  2Z6Y A;  4IK4 A;  4W6M A;  3CFH A;  2YDZ A;  2DUE A;  1HUY A;  1ZGP A;  3CFF A;  5LK4 A;  2G3O A;  1Q4A A;  3OSR A;  4H3L A;  3SSY A;  4LQT A;  1XAE A;  4GF6 B;  4KW4 A;  2VVH A;  4H3N A;  4W7E A;  3SV5 A;  2A54 B;  4W6P A;  2GW3 A;  3DQE A;  3CBE A;  2O24 A;  2Y0G A;  3TMT A;  3LF3 A;  2Q6P A;  3LS3 A;  2G16 B;  2G6E A;  3DQC A;  3ST2 A;  2OKY A;  5AQB B;  2Z1O A;  5DQM A;  2V4E B;  1MOV A;  5DTY A;  5DPI A;  3GJ2 A;  2A50 B;  3U0M A;  2C9J A;  3PJ7 A;  4Q9X A;  3CD1 A;  5EBJ A;  3DQM A;  5DPG A;  3SRY A;  3U0N A;  4H47 A;  3ZUL A;  2H5O A;  4EMQ A;  4W6G A;  5DU0 A;  3SVC A;  2WSO A;  4ZB1 A;  4TZA A;  5EXB A;  1Z1Q A;  1QYQ A;  4W76 A;  2IOV A;  3CD9 A;  2YE0 A;  3H1O A;  4XL5 A;  4W6J A;  1ZUX A;  4PPK A;  2GW4 B;  3PJB A;  2FL1 A;  4LW5 A;  4KPI A;  2EMO A;  3NEZ A;  1EMK A;  4ANJ A;  4DKN A;  3E5T A;  2GX0 A;  3DQI A;  3MGF A;  5DRG A;  3VK1 A;  4JEO A;  2WHU A;  3PJ5 A;  4PPJ A;  4W77 A;  3M24 A;  2DUF A;  1YHI A;  4W6T A;  4HVF A;  4KW8 A;  2YE1 A;  5EHU A;  2QZ0 A;  5FVG A;  2DD7 A;  2DDC A;  2YFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...