2QLEA

Gfp/s205v mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
226
Chain Sequence
GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQVALSKDPNEKRDHMVLLEFVTAAGITHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title An alternative excited-state proton transfer pathway in green fluorescent protein variant S205V.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 65
structure length 226
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2qleA00
3DQ6A 4KF5A 3SG7A 2EMDA 3SVUA 1HUYA 3DQKA 3BX9A 4W6BA 4Q7UA 2AWLA 3SRYA 1B9CA 2QT2A 3DQJA 3VHTA 2Z6ZA 4DXNA 4ZF3A 4W6NA 4EMQA 3CFFA 2YFPA 1GFLA 1MOUA 4OJ0A 4LQTA 5LTRA 4IK4A 3LA1A 2C9IA 2IB5A 4GESB 3LVAA 1F09A 2WHUA 4H48A 1C4FA 4W7EA 1H6RA 4UTSA 1H4UA 2H9WA 2ICRA 3AKOA 2DUGA 4W6CA 1EMCA 1RMPA 3LVDA 4W73A 1Q4DA 2GX2A 3IR8A 4ZBLA 3SVSA 3E5VA 4JFGA 4P76A 4KGEA 2QLEA 3KCTA 4XOVA 3DQAA 2BTJA 3CD1A 3CFHA 3U0KA 2Z6XA 3M22A 3BXBA 4GOBA 4KW8A 2EMOA 5EHUA 2WSNA 3H1OA 3SVDA 4I2YA 3DQLA 3PJ7A 1Q4CA 1XAEA 4JF9A 5HZSA 4W6OA 1XMZA 4W6GA 3V3DA 4W7RA 4R6DA 1F0BA 4JEOA 5DTZA 3WLDA 2IE2A 4KW4A 3RWTA 2Q6PA 1W7UA 1ZGOA 1GL4A 1KYSA 3BXAA 2G6YA 3DPWA 3EKHA 2O2BA 5DTYA 5FHVA 3ST2A 1YJFA 3DQ9A 3LF3A 2DUEA 4W7AA 4LJDA 1UISA 2AHAA 4W6PA 2DDCA 1W7SA 1YFPA 3SV5A 5DY6A 3GEXA 5BT0A 1YHIA 3EVVA 2A56B 4W7XA 2HFCA 3DQMA 4ANJA 1XA9A 3EVRA 3NT3A 1YZWA 3UG0A 1RM9A 4B5YA 2HGYA 3GL4A 3DQ7A 1EMBA 2H5RA 3OSRA 3DQCA 3DQ4A 4W75A 4ZINA 3ZULA 2HCGA 2DD9A 3WLCA 3SG4A 2VADA 4R6BA 3ST0A 5BTTB 3SG5A 2Y0GA 1QXTA 4DKMA 2JADA 5BQLA 4RTCA 2ZO7A 5H89A 1QYOA 4IK3A 3SSLA 3O78A 4OQWA 1EMKA 4ZF4A 3SG6A 1GGXA 3CBEA 4PPJA 2DUFA 4PFEA 2OTBA 4Q9WA 3CB9A 4W6KA 4HVFA 4P1QA 3DQNA 2WIQA 3A8SA 4XL5A 3K1KA 4LJDC 2OTEA 2HQZA 4IK1A 2FWQA 3IP2A 4Z4KA 3VHTB 2YDZA 3PJ5A 4KEXA 2G6EA 2QRFA 2GW4B 2A46A 3U0NA 2DD7A 2FL1A 2P4MA 5DPJA 3U0MA 3MGFA 5FVGA 4U2VA 4DXQA 4H3MA 5DTXA 1YHHA 3SS0A 1RMOA 4DXOA 4J8AA 4Z4MA 2A50B 2B3PA 5DRGA 1Z1PA 2VVHA 4ZF5A 4JRBA 1YHGA 4IZNA 5EJUA 3ZTFA 5LTPA 1EMGA 2HJOA 4AR7A 2HPWA 2ARLA 3BXCA 3DQOA 4DXPA 4LJCA 4W7CA 5DPIA 2POXA 5DPHA 4LJBA 1KP5A 2EMNA 4KAGA 4ZIOA 2VZXA 4OY4A 1QYFA 4AS8A 4RYWA 3PIBA 3SSYA 1EMAA 4W69A 2H6VA 2QLHA 1MYWA 2A52B 3CD9A 3ADFA 3EVUA 2VVJA 3DQ2A 1JBYA 3G9AA 3SVCA 4Q7TA 2WHTA 3ST3A 5EBJA 1OXDA 4JC2A 4H3NA 5DRFA 5KTGA 4IK8A 3ED8A 1JBZA 4W6AA 3GJ2A 4W6IA 4DKNA 3U0LA 2V4EC 1RRXA 2A54B 4N3DA 1BFPA 3EK7A 1EMMA 4W6FA 3SG2A 4W6SA 5LK4A 4IK9A 3LS3A 4HQ9A 4W6RA 3DQHA 4W6TA 3SSTA 2PXWA 4XGYA 1XQMA 3DQ3A 3NEDA 4XOWA 4PPKA 1OXFA 2HGDA 3DPZA 2C9JA 5HZUA 2ZO6A 3S05A 2IB6A 3TMTA 2B3QA 4HE4A 4TZGA 5HW9A 4KA9A 1EMLA 2IOVA 1CV7A 4IK5A 5DQMA 3E5WA 4EDSA 3EKJA 3LVCA 4DXMA 4H47A 1S6ZA 2ZMUA 1HCJA 4W6JA 5F9GA 3AI4A 4W6HA 3P8UA 3SSHA 4J88A 4OHSA 2A53B 4LW5A 2HRSA 4W77A 4PPLA 4W6MA 4BDUA 4J89A 5EXBA 1Z1QA 3WCKA 2V4EA 1W7TA 2O24A 5EB6A 5FVIA 3ZUJA 1Q4EA 3EK8A 1JC1A 2PXSA 5EB7A 3W1DA 2WISA 3NF0A 2V4EB 4L12A 4W6UA 2AH8A 1XSSA 1MOVA 3P28A 2G3OA 2ZMWA 4L1IA 3GJ1A 1KYRA 1ZUXA 3U8PA 4W76A 3TMRA 3I19A 4W74A 3SSPA 3ZUFA 1EMFA 3OGOA 2YE0A 4EULA 2RH7A 2GW3A 5LTQA 4EN1A 4B30A 5HBDA 3U8CA 5DQBA 1EMEA 1Q4AA 4TZAA 3CFAA 2DDDA 3KCSA 4ORNA 2A48A 3LSAA 3SSVA 4XVPA 4HQ8A 2VVIA 3OSQA 3EVPA 3SVEA 2YE1A 4KPIA 3NT9A 1Q4BA 2QU1A 4B30B 1YJ2A 5EXUA 3LF4B 4LQUA 4H3LA 5HGEA 3SSKA 2AWMA 1ZGQA 5HZOA 3M24A 4ZB1A 2QLIA 3DQUA 2H5PA 3VK1A 2A47A 4OGSA 4W72A 3E5TA 2OKYA 5J2OA 1RMMA 3DQFA 4W7FA 2OKWA 3W1CA 4L13A 2HQKA 3ST4A 2G2SB 2OJKA 2H8QA 4W6DA 2WSOA 2G5ZB 4KF4A 4NWSA 2Z6YA 4ZFSA 2O29A 4KF5C 3RWAA 4Q7RA 3AI5A 3GB3A 2AWJA 4HQCA 5AQBB 1QYQA 4KGFA 1JC0A 1QY3A 5H88A 3O77A 3SVNA 4W7DA 3H1RA 3SVOA 2G6XA 2WHSA 1Q73A 1ZGPA 2QLGA 5DU0A 4KW9A 2Z1OA 4GF6B 3EK4A 5T3IA 1OXEA 4Q9XA 3U8AA 2G16B 2G3DB 4JGEA 1G7KA 5DPGA 3DQIA 5FVFA 2H5OA 3SG3A 2QLGB 2VAEA 3DPXA 3DQEA 3VICA 3DQDA 3CGLA 5BTTA 2DUHA 2OGRA 3DQ1A 1KYPA 3SVRA 4W6LA 3PJBA 5HZTA 2WURA 2AWKA 2FZUA 3NEZA 3DQ5A 2QZ0A 2GX0A 3SVBA 2H5QA 3UFZA 4RYSA 2Q57A 4DXIA 4EDOA 5H87A 3DQ8A 2DUIA 5DTLA 5EXCI
chains in the Genus database with same CATH superfamily
3DQ6A 4KF5A 3SG7A 2EMDA 3SVUA 1HUYA 3DQKA 3BX9A 4W6BA 4Q7UA 2AWLA 3SRYA 1B9CA 2QT2A 3DQJA 3VHTA 2Z6ZA 4DXNA 4ZF3A 4W6NA 4EMQA 3CFFA 2YFPA 1GFLA 1MOUA 4OJ0A 4LQTA 5LTRA 4IK4A 3LA1A 2C9IA 2IB5A 4GESB 3LVAA 1F09A 2WHUA 4H48A 1C4FA 4W7EA 1H6RA 4UTSA 1H4UA 2H9WA 2ICRA 3AKOA 2DUGA 4W6CA 1EMCA 1RMPA 3LVDA 4W73A 1Q4DA 2GX2A 3IR8A 4ZBLA 3SVSA 3E5VA 4JFGA 4P76A 4KGEA 2QLEA 3KCTA 4XOVA 3DQAA 2BTJA 3CD1A 3CFHA 3U0KA 2Z6XA 3M22A 3BXBA 4GOBA 4KW8A 2EMOA 5EHUA 2WSNA 3H1OA 3SVDA 4I2YA 3DQLA 3PJ7A 1Q4CA 1XAEA 4JF9A 5HZSA 4W6OA 1XMZA 4W6GA 3V3DA 4W7RA 4R6DA 1F0BA 4JEOA 5DTZA 3WLDA 2IE2A 4KW4A 3RWTA 2Q6PA 1W7UA 1ZGOA 1GL4A 1KYSA 3BXAA 2G6YA 3DPWA 3EKHA 2O2BA 5DTYA 5FHVA 3ST2A 1YJFA 3DQ9A 3LF3A 2DUEA 4W7AA 4LJDA 1UISA 2AHAA 4W6PA 2DDCA 1W7SA 1YFPA 3SV5A 5DY6A 3GEXA 5BT0A 1YHIA 3EVVA 2A56B 4W7XA 2HFCA 3DQMA 4ANJA 1XA9A 3EVRA 3NT3A 1YZWA 3UG0A 1RM9A 4B5YA 2HGYA 3GL4A 3DQ7A 1EMBA 2H5RA 3OSRA 3DQCA 3DQ4A 4W75A 4ZINA 3ZULA 2HCGA 2DD9A 3WLCA 3SG4A 2VADA 4R6BA 3ST0A 5BTTB 3SG5A 2Y0GA 1QXTA 4DKMA 2JADA 5BQLA 4RTCA 2ZO7A 5H89A 1QYOA 4IK3A 3SSLA 3O78A 4OQWA 1EMKA 4ZF4A 3SG6A 1GGXA 3CBEA 4PPJA 2DUFA 4PFEA 2OTBA 4Q9WA 3CB9A 4W6KA 4HVFA 4P1QA 3DQNA 2WIQA 3A8SA 4XL5A 3K1KA 4LJDC 2OTEA 2HQZA 4IK1A 2FWQA 3IP2A 4Z4KA 3VHTB 2YDZA 3PJ5A 4KEXA 2G6EA 2QRFA 2GW4B 2A46A 3U0NA 2DD7A 2FL1A 2P4MA 5DPJA 3U0MA 3MGFA 5FVGA 4U2VA 4DXQA 4H3MA 5DTXA 1YHHA 3SS0A 1RMOA 4DXOA 4J8AA 4Z4MA 2A50B 2B3PA 5DRGA 1Z1PA 2VVHA 4ZF5A 4JRBA 1YHGA 4IZNA 5EJUA 3ZTFA 5LTPA 1EMGA 2HJOA 4AR7A 2HPWA 2ARLA 3BXCA 3DQOA 4DXPA 4LJCA 4W7CA 5DPIA 2POXA 5DPHA 4LJBA 1KP5A 2EMNA 4KAGA 4ZIOA 2VZXA 4OY4A 1QYFA 4AS8A 4RYWA 3PIBA 3SSYA 1EMAA 4W69A 2H6VA 2QLHA 1MYWA 2A52B 3CD9A 3ADFA 3EVUA 2VVJA 3DQ2A 1JBYA 3G9AA 3SVCA 4Q7TA 2WHTA 3ST3A 5EBJA 1OXDA 4JC2A 4H3NA 5DRFA 5KTGA 4IK8A 3ED8A 1JBZA 4W6AA 3GJ2A 4W6IA 4DKNA 3U0LA 2V4EC 1RRXA 2A54B 4N3DA 1BFPA 3EK7A 1EMMA 4W6FA 3SG2A 4W6SA 5LK4A 4IK9A 3LS3A 4HQ9A 4W6RA 3DQHA 4W6TA 3SSTA 2PXWA 4XGYA 1XQMA 3DQ3A 3NEDA 4XOWA 4PPKA 1OXFA 2HGDA 3DPZA 2C9JA 5HZUA 2ZO6A 3S05A 2IB6A 3TMTA 2B3QA 4HE4A 4TZGA 5HW9A 4KA9A 1EMLA 2IOVA 1CV7A 4IK5A 5DQMA 3E5WA 4EDSA 3EKJA 3LVCA 4DXMA 4H47A 1S6ZA 2ZMUA 1HCJA 4W6JA 5F9GA 3AI4A 4W6HA 3P8UA 3SSHA 4J88A 4OHSA 2A53B 4LW5A 2HRSA 4W77A 4PPLA 4W6MA 4BDUA 4J89A 5EXBA 1Z1QA 3WCKA 2V4EA 1W7TA 2O24A 5EB6A 5FVIA 3ZUJA 1Q4EA 3EK8A 1JC1A 2PXSA 5EB7A 3W1DA 2WISA 3NF0A 2V4EB 4L12A 4W6UA 2AH8A 1XSSA 1MOVA 3P28A 2G3OA 2ZMWA 4L1IA 3GJ1A 1KYRA 1ZUXA 3U8PA 4W76A 3TMRA 3I19A 4W74A 3SSPA 3ZUFA 1EMFA 3OGOA 2YE0A 4EULA 2RH7A 2GW3A 5LTQA 4EN1A 4B30A 5HBDA 3U8CA 5DQBA 1EMEA 1Q4AA 4TZAA 3CFAA 2DDDA 3KCSA 4ORNA 2A48A 3LSAA 3SSVA 4XVPA 4HQ8A 2VVIA 3OSQA 3EVPA 3SVEA 2YE1A 4KPIA 3NT9A 1Q4BA 2QU1A 4B30B 1YJ2A 5EXUA 3LF4B 4LQUA 4H3LA 5HGEA 3SSKA 2AWMA 1ZGQA 5HZOA 3M24A 4ZB1A 2QLIA 3DQUA 2H5PA 3VK1A 2A47A 4OGSA 4W72A 3E5TA 2OKYA 5J2OA 1RMMA 3DQFA 4W7FA 2OKWA 3W1CA 4L13A 2HQKA 3ST4A 2G2SB 2OJKA 2H8QA 4W6DA 2WSOA 2G5ZB 4KF4A 4NWSA 2Z6YA 4ZFSA 2O29A 4KF5C 3RWAA 4Q7RA 3AI5A 3GB3A 2AWJA 4HQCA 5AQBB 1QYQA 4KGFA 1JC0A 1QY3A 5H88A 3O77A 3SVNA 4W7DA 3H1RA 3SVOA 2G6XA 2WHSA 1Q73A 1ZGPA 2QLGA 5DU0A 4KW9A 2Z1OA 4GF6B 3EK4A 5T3IA 1OXEA 4Q9XA 3U8AA 2G16B 2G3DB 4JGEA 1G7KA 5DPGA 3DQIA 5FVFA 2H5OA 3SG3A 2QLGB 2VAEA 3DPXA 3DQEA 3VICA 3DQDA 3CGLA 5BTTA 2DUHA 2OGRA 3DQ1A 1KYPA 3SVRA 4W6LA 3PJBA 5HZTA 2WURA 2AWKA 2FZUA 3NEZA 3DQ5A 2QZ0A 2GX0A 3SVBA 2H5QA 3UFZA 4RYSA 2Q57A 4DXIA 4EDOA 5H87A 3DQ8A 2DUIA 5DTLA 5EXCI
chains in the Genus database with same CATH topology
3DQ6A 4KF5A 3SG7A 2EMDA 3SVUA 1HUYA 3DQKA 3BX9A 4W6BA 4Q7UA 2AWLA 3SRYA 1B9CA 2QT2A 3DQJA 3VHTA 2Z6ZA 4DXNA 4ZF3A 4W6NA 4EMQA 3CFFA 2YFPA 1GFLA 1MOUA 4OJ0A 4LQTA 5LTRA 4IK4A 3LA1A 2C9IA 2IB5A 4GESB 3LVAA 1F09A 2WHUA 4H48A 1C4FA 4W7EA 1H6RA 4UTSA 1H4UA 2H9WA 2ICRA 3AKOA 2DUGA 4W6CA 1EMCA 1RMPA 3LVDA 4W73A 1Q4DA 2GX2A 3IR8A 4ZBLA 3SVSA 3E5VA 4JFGA 4P76A 4KGEA 2QLEA 3KCTA 4XOVA 3DQAA 2BTJA 3CD1A 3CFHA 3U0KA 2Z6XA 3M22A 3BXBA 4GOBA 4KW8A 2EMOA 5EHUA 2WSNA 3H1OA 3SVDA 4I2YA 3DQLA 3PJ7A 1Q4CA 1XAEA 4JF9A 5HZSA 4W6OA 1XMZA 4W6GA 3V3DA 4W7RA 4R6DA 1F0BA 4JEOA 5DTZA 3WLDA 2IE2A 4KW4A 3RWTA 2Q6PA 1W7UA 1ZGOA 1GL4A 1KYSA 3BXAA 2G6YA 3DPWA 3EKHA 2O2BA 5DTYA 5FHVA 3ST2A 1YJFA 3DQ9A 3LF3A 2DUEA 4W7AA 4LJDA 1UISA 2AHAA 4W6PA 2DDCA 1W7SA 1YFPA 3SV5A 5DY6A 3GEXA 5BT0A 1YHIA 3EVVA 2A56B 4W7XA 2HFCA 3DQMA 4ANJA 1XA9A 3EVRA 3NT3A 1YZWA 3UG0A 1RM9A 4B5YA 2HGYA 3GL4A 3DQ7A 1EMBA 2H5RA 3OSRA 3DQCA 3DQ4A 4W75A 4ZINA 3ZULA 2HCGA 2DD9A 3WLCA 3SG4A 2VADA 4R6BA 3ST0A 5BTTB 3SG5A 2Y0GA 1QXTA 4DKMA 2JADA 5BQLA 4RTCA 2ZO7A 5H89A 1QYOA 4IK3A 3SSLA 3O78A 4OQWA 1EMKA 4ZF4A 3SG6A 1GGXA 3CBEA 4PPJA 2DUFA 4PFEA 2OTBA 4Q9WA 3CB9A 4W6KA 4HVFA 4P1QA 3DQNA 2WIQA 3A8SA 4XL5A 3K1KA 4LJDC 2OTEA 2HQZA 4IK1A 2FWQA 3IP2A 4Z4KA 3VHTB 2YDZA 3PJ5A 4KEXA 2G6EA 2QRFA 2GW4B 2A46A 3U0NA 2DD7A 2FL1A 2P4MA 5DPJA 3U0MA 3MGFA 5FVGA 4U2VA 4DXQA 4H3MA 5DTXA 1YHHA 3SS0A 1RMOA 4DXOA 4J8AA 4Z4MA 2A50B 2B3PA 5DRGA 1Z1PA 2VVHA 4ZF5A 4JRBA 1YHGA 4IZNA 5EJUA 3ZTFA 5LTPA 1EMGA 2HJOA 4AR7A 2HPWA 2ARLA 3BXCA 3DQOA 4DXPA 4LJCA 4W7CA 5DPIA 2POXA 5DPHA 4LJBA 1KP5A 2EMNA 4KAGA 4ZIOA 2VZXA 4OY4A 1QYFA 4AS8A 4RYWA 3PIBA 3SSYA 1EMAA 4W69A 2H6VA 2QLHA 1MYWA 2A52B 3CD9A 3ADFA 3EVUA 2VVJA 3DQ2A 1JBYA 3G9AA 3SVCA 4Q7TA 2WHTA 3ST3A 5EBJA 1OXDA 4JC2A 4H3NA 5DRFA 5KTGA 4IK8A 3ED8A 1JBZA 4W6AA 3GJ2A 4W6IA 4DKNA 3U0LA 2V4EC 1RRXA 2A54B 4N3DA 1BFPA 3EK7A 1EMMA 4W6FA 3SG2A 4W6SA 5LK4A 4IK9A 3LS3A 4HQ9A 4W6RA 3DQHA 4W6TA 3SSTA 2PXWA 4XGYA 1XQMA 3DQ3A 3NEDA 4XOWA 4PPKA 1OXFA 2HGDA 3DPZA 2C9JA 5HZUA 2ZO6A 3S05A 2IB6A 3TMTA 2B3QA 4HE4A 4TZGA 5HW9A 4KA9A 1EMLA 2IOVA 1CV7A 4IK5A 5DQMA 3E5WA 4EDSA 3EKJA 3LVCA 4DXMA 4H47A 1S6ZA 2ZMUA 1HCJA 4W6JA 5F9GA 3AI4A 4W6HA 3P8UA 3SSHA 4J88A 4OHSA 2A53B 4LW5A 2HRSA 4W77A 4PPLA 4W6MA 4BDUA 4J89A 5EXBA 1Z1QA 3WCKA 2V4EA 1W7TA 2O24A 5EB6A 5FVIA 3ZUJA 1Q4EA 3EK8A 1JC1A 2PXSA 5EB7A 3W1DA 2WISA 3NF0A 2V4EB 4L12A 4W6UA 2AH8A 1XSSA 1MOVA 3P28A 2G3OA 2ZMWA 4L1IA 3GJ1A 1KYRA 1ZUXA 3U8PA 4W76A 3TMRA 3I19A 4W74A 3SSPA 3ZUFA 1EMFA 3OGOA 2YE0A 4EULA 2RH7A 2GW3A 5LTQA 4EN1A 4B30A 5HBDA 3U8CA 5DQBA 1EMEA 1Q4AA 4TZAA 3CFAA 2DDDA 3KCSA 4ORNA 2A48A 3LSAA 3SSVA 4XVPA 4HQ8A 2VVIA 3OSQA 3EVPA 3SVEA 2YE1A 4KPIA 3NT9A 1Q4BA 2QU1A 4B30B 1YJ2A 5EXUA 3LF4B 4LQUA 4H3LA 5HGEA 3SSKA 2AWMA 1ZGQA 5HZOA 3M24A 4ZB1A 2QLIA 3DQUA 2H5PA 3VK1A 2A47A 4OGSA 4W72A 3E5TA 2OKYA 5J2OA 1RMMA 3DQFA 4W7FA 2OKWA 3W1CA 4L13A 2HQKA 3ST4A 2G2SB 2OJKA 2H8QA 4W6DA 2WSOA 2G5ZB 4KF4A 4NWSA 2Z6YA 4ZFSA 2O29A 4KF5C 3RWAA 4Q7RA 3AI5A 3GB3A 2AWJA 4HQCA 5AQBB 1QYQA 4KGFA 1JC0A 1QY3A 5H88A 3O77A 3SVNA 4W7DA 3H1RA 3SVOA 2G6XA 2WHSA 1Q73A 1ZGPA 2QLGA 5DU0A 4KW9A 2Z1OA 4GF6B 3EK4A 5T3IA 1OXEA 4Q9XA 3U8AA 2G16B 2G3DB 4JGEA 1G7KA 5DPGA 3DQIA 5FVFA 2H5OA 3SG3A 2QLGB 2VAEA 3DPXA 3DQEA 3VICA 3DQDA 3CGLA 5BTTA 2DUHA 2OGRA 3DQ1A 1KYPA 3SVRA 4W6LA 3PJBA 5HZTA 2WURA 2AWKA 2FZUA 3NEZA 3DQ5A 2QZ0A 2GX0A 3SVBA 2H5QA 3UFZA 4RYSA 2Q57A 4DXIA 4EDOA 5H87A 3DQ8A 2DUIA 5DTLA 5EXCI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ6 A;  4KF5 A;  3SG7 A;  2EMD A;  3SVU A;  1HUY A;  3DQK A;  3BX9 A;  4W6B A;  4Q7U A;  2AWL A;  3SRY A;  1B9C A;  2QT2 A;  3DQJ A;  3VHT A;  2Z6Z A;  4DXN A;  4ZF3 A;  4W6N A;  4EMQ A;  3CFF A;  2YFP A;  1GFL A;  1MOU A;  4OJ0 A;  4LQT A;  5LTR A;  4IK4 A;  3LA1 A;  2C9I A;  2IB5 A;  4GES B;  3LVA A;  1F09 A;  2WHU A;  4H48 A;  1C4F A;  4W7E A;  1H6R A;  4UTS A;  1H4U A;  2H9W A;  2ICR A;  3AKO A;  2DUG A;  4W6C A;  1EMC A;  1RMP A;  3LVD A;  4W73 A;  1Q4D A;  2GX2 A;  3IR8 A;  4ZBL A;  3SVS A;  3E5V A;  4JFG A;  4P76 A;  4KGE A;  2QLE A;  3KCT A;  4XOV A;  3DQA A;  2BTJ A;  3CD1 A;  3CFH A;  3U0K A;  2Z6X A;  3M22 A;  3BXB A;  4GOB A;  4KW8 A;  2EMO A;  5EHU A;  2WSN A;  3H1O A;  3SVD A;  4I2Y A;  3DQL A;  3PJ7 A;  1Q4C A;  1XAE A;  4JF9 A;  5HZS A;  4W6O A;  1XMZ A;  4W6G A;  3V3D A;  4W7R A;  4R6D A;  1F0B A;  4JEO A;  5DTZ A;  3WLD A;  2IE2 A;  4KW4 A;  3RWT A;  2Q6P A;  1W7U A;  1ZGO A;  1GL4 A;  1KYS A;  3BXA A;  2G6Y A;  3DPW A;  3EKH A;  2O2B A;  5DTY A;  5FHV A;  3ST2 A;  1YJF A;  3DQ9 A;  3LF3 A;  2DUE A;  4W7A A;  4LJD A;  1UIS A;  2AHA A;  4W6P A;  2DDC A;  1W7S A;  1YFP A;  3SV5 A;  5DY6 A;  3GEX A;  5BT0 A;  1YHI A;  3EVV A;  2A56 B;  4W7X A;  2HFC A;  3DQM A;  4ANJ A;  1XA9 A;  3EVR A;  3NT3 A;  1YZW A;  3UG0 A;  1RM9 A;  4B5Y A;  2HGY A;  3GL4 A;  3DQ7 A;  1EMB A;  2H5R A;  3OSR A;  3DQC A;  3DQ4 A;  4W75 A;  4ZIN A;  3ZUL A;  2HCG A;  2DD9 A;  3WLC A;  3SG4 A;  2VAD A;  4R6B A;  3ST0 A;  5BTT B;  3SG5 A;  2Y0G A;  1QXT A;  4DKM A;  2JAD A;  5BQL A;  4RTC A;  2ZO7 A;  5H89 A;  1QYO A;  4IK3 A;  3SSL A;  3O78 A;  4OQW A;  1EMK A;  4ZF4 A;  3SG6 A;  1GGX A;  3CBE A;  4PPJ A;  2DUF A;  4PFE A;  2OTB A;  4Q9W A;  3CB9 A;  4W6K A;  4HVF A;  4P1Q A;  3DQN A;  2WIQ A;  3A8S A;  4XL5 A;  3K1K A;  4LJD C;  2OTE A;  2HQZ A;  4IK1 A;  2FWQ A;  3IP2 A;  4Z4K A;  3VHT B;  2YDZ A;  3PJ5 A;  4KEX A;  2G6E A;  2QRF A;  2GW4 B;  2A46 A;  3U0N A;  2DD7 A;  2FL1 A;  2P4M A;  5DPJ A;  3U0M A;  3MGF A;  5FVG A;  4U2V A;  4DXQ A;  4H3M A;  5DTX A;  1YHH A;  3SS0 A;  1RMO A;  4DXO A;  4J8A A;  4Z4M A;  2A50 B;  2B3P A;  5DRG A;  1Z1P A;  2VVH A;  4ZF5 A;  4JRB A;  1YHG A;  4IZN A;  5EJU A;  3ZTF A;  5LTP A;  1EMG A;  2HJO A;  4AR7 A;  2HPW A;  2ARL A;  3BXC A;  3DQO A;  4DXP A;  4LJC A;  4W7C A;  5DPI A;  2POX A;  5DPH A;  4LJB A;  1KP5 A;  2EMN A;  4KAG A;  4ZIO A;  2VZX A;  4OY4 A;  1QYF A;  4AS8 A;  4RYW A;  3PIB A;  3SSY A;  1EMA A;  4W69 A;  2H6V A;  2QLH A;  1MYW A;  2A52 B;  3CD9 A;  3ADF A;  3EVU A;  2VVJ A;  3DQ2 A;  1JBY A;  3G9A A;  3SVC A;  4Q7T A;  2WHT A;  3ST3 A;  5EBJ A;  1OXD A;  4JC2 A;  4H3N A;  5DRF A;  5KTG A;  4IK8 A;  3ED8 A;  1JBZ A;  4W6A A;  3GJ2 A;  4W6I A;  4DKN A;  3U0L A;  2V4E C;  1RRX A;  2A54 B;  4N3D A;  1BFP A;  3EK7 A;  1EMM A;  4W6F A;  3SG2 A;  4W6S A;  5LK4 A;  4IK9 A;  3LS3 A;  4HQ9 A;  4W6R A;  3DQH A;  4W6T A;  3SST A;  2PXW A;  4XGY A;  1XQM A;  3DQ3 A;  3NED A;  4XOW A;  4PPK A;  1OXF A;  2HGD A;  3DPZ A;  2C9J A;  5HZU A;  2ZO6 A;  3S05 A;  2IB6 A;  3TMT A;  2B3Q A;  4HE4 A;  4TZG A;  5HW9 A;  4KA9 A;  1EML A;  2IOV A;  1CV7 A;  4IK5 A;  5DQM A;  3E5W A;  4EDS A;  3EKJ A;  3LVC A;  4DXM A;  4H47 A;  1S6Z A;  2ZMU A;  1HCJ A;  4W6J A;  5F9G A;  3AI4 A;  4W6H A;  3P8U A;  3SSH A;  4J88 A;  4OHS A;  2A53 B;  4LW5 A;  2HRS A;  4W77 A;  4PPL A;  4W6M A;  4BDU A;  4J89 A;  5EXB A;  1Z1Q A;  3WCK A;  2V4E A;  1W7T A;  2O24 A;  5EB6 A;  5FVI A;  3ZUJ A;  1Q4E A;  3EK8 A;  1JC1 A;  2PXS A;  5EB7 A;  3W1D A;  2WIS A;  3NF0 A;  2V4E B;  4L12 A;  4W6U A;  2AH8 A;  1XSS A;  1MOV A;  3P28 A;  2G3O A;  2ZMW A;  4L1I A;  3GJ1 A;  1KYR A;  1ZUX A;  3U8P A;  4W76 A;  3TMR A;  3I19 A;  4W74 A;  3SSP A;  3ZUF A;  1EMF A;  3OGO A;  2YE0 A;  4EUL A;  2RH7 A;  2GW3 A;  5LTQ A;  4EN1 A;  4B30 A;  5HBD A;  3U8C A;  5DQB A;  1EME A;  1Q4A A;  4TZA A;  3CFA A;  2DDD A;  3KCS A;  4ORN A;  2A48 A;  3LSA A;  3SSV A;  4XVP A;  4HQ8 A;  2VVI A;  3OSQ A;  3EVP A;  3SVE A;  2YE1 A;  4KPI A;  3NT9 A;  1Q4B A;  2QU1 A;  4B30 B;  1YJ2 A;  5EXU A;  3LF4 B;  4LQU A;  4H3L A;  5HGE A;  3SSK A;  2AWM A;  1ZGQ A;  5HZO A;  3M24 A;  4ZB1 A;  2QLI A;  3DQU A;  2H5P A;  3VK1 A;  2A47 A;  4OGS A;  4W72 A;  3E5T A;  2OKY A;  5J2O A;  1RMM A;  3DQF A;  4W7F A;  2OKW A;  3W1C A;  4L13 A;  2HQK A;  3ST4 A;  2G2S B;  2OJK A;  2H8Q A;  4W6D A;  2WSO A;  2G5Z B;  4KF4 A;  4NWS A;  2Z6Y A;  4ZFS A;  2O29 A;  4KF5 C;  3RWA A;  4Q7R A;  3AI5 A;  3GB3 A;  2AWJ A;  4HQC A;  5AQB B;  1QYQ A;  4KGF A;  1JC0 A;  1QY3 A;  5H88 A;  3O77 A;  3SVN A;  4W7D A;  3H1R A;  3SVO A;  2G6X A;  2WHS A;  1Q73 A;  1ZGP A;  2QLG A;  5DU0 A;  4KW9 A;  2Z1O A;  4GF6 B;  3EK4 A;  5T3I A;  1OXE A;  4Q9X A;  3U8A A;  2G16 B;  2G3D B;  4JGE A;  1G7K A;  5DPG A;  3DQI A;  5FVF A;  2H5O A;  3SG3 A;  2QLG B;  2VAE A;  3DPX A;  3DQE A;  3VIC A;  3DQD A;  3CGL A;  5BTT A;  2DUH A;  2OGR A;  3DQ1 A;  1KYP A;  3SVR A;  4W6L A;  3PJB A;  5HZT A;  2WUR A;  2AWK A;  2FZU A;  3NEZ A;  3DQ5 A;  2QZ0 A;  2GX0 A;  3SVB A;  2H5Q A;  3UFZ A;  4RYS A;  2Q57 A;  4DXI A;  4EDO A;  5H87 A;  3DQ8 A;  2DUI A;  5DTL A;  5EXC I; 
#chains in the Genus database with same CATH topology
 3DQ6 A;  4KF5 A;  3SG7 A;  2EMD A;  3SVU A;  1HUY A;  3DQK A;  3BX9 A;  4W6B A;  4Q7U A;  2AWL A;  3SRY A;  1B9C A;  2QT2 A;  3DQJ A;  3VHT A;  2Z6Z A;  4DXN A;  4ZF3 A;  4W6N A;  4EMQ A;  3CFF A;  2YFP A;  1GFL A;  1MOU A;  4OJ0 A;  4LQT A;  5LTR A;  4IK4 A;  3LA1 A;  2C9I A;  2IB5 A;  4GES B;  3LVA A;  1F09 A;  2WHU A;  4H48 A;  1C4F A;  4W7E A;  1H6R A;  4UTS A;  1H4U A;  2H9W A;  2ICR A;  3AKO A;  2DUG A;  4W6C A;  1EMC A;  1RMP A;  3LVD A;  4W73 A;  1Q4D A;  2GX2 A;  3IR8 A;  4ZBL A;  3SVS A;  3E5V A;  4JFG A;  4P76 A;  4KGE A;  2QLE A;  3KCT A;  4XOV A;  3DQA A;  2BTJ A;  3CD1 A;  3CFH A;  3U0K A;  2Z6X A;  3M22 A;  3BXB A;  4GOB A;  4KW8 A;  2EMO A;  5EHU A;  2WSN A;  3H1O A;  3SVD A;  4I2Y A;  3DQL A;  3PJ7 A;  1Q4C A;  1XAE A;  4JF9 A;  5HZS A;  4W6O A;  1XMZ A;  4W6G A;  3V3D A;  4W7R A;  4R6D A;  1F0B A;  4JEO A;  5DTZ A;  3WLD A;  2IE2 A;  4KW4 A;  3RWT A;  2Q6P A;  1W7U A;  1ZGO A;  1GL4 A;  1KYS A;  3BXA A;  2G6Y A;  3DPW A;  3EKH A;  2O2B A;  5DTY A;  5FHV A;  3ST2 A;  1YJF A;  3DQ9 A;  3LF3 A;  2DUE A;  4W7A A;  4LJD A;  1UIS A;  2AHA A;  4W6P A;  2DDC A;  1W7S A;  1YFP A;  3SV5 A;  5DY6 A;  3GEX A;  5BT0 A;  1YHI A;  3EVV A;  2A56 B;  4W7X A;  2HFC A;  3DQM A;  4ANJ A;  1XA9 A;  3EVR A;  3NT3 A;  1YZW A;  3UG0 A;  1RM9 A;  4B5Y A;  2HGY A;  3GL4 A;  3DQ7 A;  1EMB A;  2H5R A;  3OSR A;  3DQC A;  3DQ4 A;  4W75 A;  4ZIN A;  3ZUL A;  2HCG A;  2DD9 A;  3WLC A;  3SG4 A;  2VAD A;  4R6B A;  3ST0 A;  5BTT B;  3SG5 A;  2Y0G A;  1QXT A;  4DKM A;  2JAD A;  5BQL A;  4RTC A;  2ZO7 A;  5H89 A;  1QYO A;  4IK3 A;  3SSL A;  3O78 A;  4OQW A;  1EMK A;  4ZF4 A;  3SG6 A;  1GGX A;  3CBE A;  4PPJ A;  2DUF A;  4PFE A;  2OTB A;  4Q9W A;  3CB9 A;  4W6K A;  4HVF A;  4P1Q A;  3DQN A;  2WIQ A;  3A8S A;  4XL5 A;  3K1K A;  4LJD C;  2OTE A;  2HQZ A;  4IK1 A;  2FWQ A;  3IP2 A;  4Z4K A;  3VHT B;  2YDZ A;  3PJ5 A;  4KEX A;  2G6E A;  2QRF A;  2GW4 B;  2A46 A;  3U0N A;  2DD7 A;  2FL1 A;  2P4M A;  5DPJ A;  3U0M A;  3MGF A;  5FVG A;  4U2V A;  4DXQ A;  4H3M A;  5DTX A;  1YHH A;  3SS0 A;  1RMO A;  4DXO A;  4J8A A;  4Z4M A;  2A50 B;  2B3P A;  5DRG A;  1Z1P A;  2VVH A;  4ZF5 A;  4JRB A;  1YHG A;  4IZN A;  5EJU A;  3ZTF A;  5LTP A;  1EMG A;  2HJO A;  4AR7 A;  2HPW A;  2ARL A;  3BXC A;  3DQO A;  4DXP A;  4LJC A;  4W7C A;  5DPI A;  2POX A;  5DPH A;  4LJB A;  1KP5 A;  2EMN A;  4KAG A;  4ZIO A;  2VZX A;  4OY4 A;  1QYF A;  4AS8 A;  4RYW A;  3PIB A;  3SSY A;  1EMA A;  4W69 A;  2H6V A;  2QLH A;  1MYW A;  2A52 B;  3CD9 A;  3ADF A;  3EVU A;  2VVJ A;  3DQ2 A;  1JBY A;  3G9A A;  3SVC A;  4Q7T A;  2WHT A;  3ST3 A;  5EBJ A;  1OXD A;  4JC2 A;  4H3N A;  5DRF A;  5KTG A;  4IK8 A;  3ED8 A;  1JBZ A;  4W6A A;  3GJ2 A;  4W6I A;  4DKN A;  3U0L A;  2V4E C;  1RRX A;  2A54 B;  4N3D A;  1BFP A;  3EK7 A;  1EMM A;  4W6F A;  3SG2 A;  4W6S A;  5LK4 A;  4IK9 A;  3LS3 A;  4HQ9 A;  4W6R A;  3DQH A;  4W6T A;  3SST A;  2PXW A;  4XGY A;  1XQM A;  3DQ3 A;  3NED A;  4XOW A;  4PPK A;  1OXF A;  2HGD A;  3DPZ A;  2C9J A;  5HZU A;  2ZO6 A;  3S05 A;  2IB6 A;  3TMT A;  2B3Q A;  4HE4 A;  4TZG A;  5HW9 A;  4KA9 A;  1EML A;  2IOV A;  1CV7 A;  4IK5 A;  5DQM A;  3E5W A;  4EDS A;  3EKJ A;  3LVC A;  4DXM A;  4H47 A;  1S6Z A;  2ZMU A;  1HCJ A;  4W6J A;  5F9G A;  3AI4 A;  4W6H A;  3P8U A;  3SSH A;  4J88 A;  4OHS A;  2A53 B;  4LW5 A;  2HRS A;  4W77 A;  4PPL A;  4W6M A;  4BDU A;  4J89 A;  5EXB A;  1Z1Q A;  3WCK A;  2V4E A;  1W7T A;  2O24 A;  5EB6 A;  5FVI A;  3ZUJ A;  1Q4E A;  3EK8 A;  1JC1 A;  2PXS A;  5EB7 A;  3W1D A;  2WIS A;  3NF0 A;  2V4E B;  4L12 A;  4W6U A;  2AH8 A;  1XSS A;  1MOV A;  3P28 A;  2G3O A;  2ZMW A;  4L1I A;  3GJ1 A;  1KYR A;  1ZUX A;  3U8P A;  4W76 A;  3TMR A;  3I19 A;  4W74 A;  3SSP A;  3ZUF A;  1EMF A;  3OGO A;  2YE0 A;  4EUL A;  2RH7 A;  2GW3 A;  5LTQ A;  4EN1 A;  4B30 A;  5HBD A;  3U8C A;  5DQB A;  1EME A;  1Q4A A;  4TZA A;  3CFA A;  2DDD A;  3KCS A;  4ORN A;  2A48 A;  3LSA A;  3SSV A;  4XVP A;  4HQ8 A;  2VVI A;  3OSQ A;  3EVP A;  3SVE A;  2YE1 A;  4KPI A;  3NT9 A;  1Q4B A;  2QU1 A;  4B30 B;  1YJ2 A;  5EXU A;  3LF4 B;  4LQU A;  4H3L A;  5HGE A;  3SSK A;  2AWM A;  1ZGQ A;  5HZO A;  3M24 A;  4ZB1 A;  2QLI A;  3DQU A;  2H5P A;  3VK1 A;  2A47 A;  4OGS A;  4W72 A;  3E5T A;  2OKY A;  5J2O A;  1RMM A;  3DQF A;  4W7F A;  2OKW A;  3W1C A;  4L13 A;  2HQK A;  3ST4 A;  2G2S B;  2OJK A;  2H8Q A;  4W6D A;  2WSO A;  2G5Z B;  4KF4 A;  4NWS A;  2Z6Y A;  4ZFS A;  2O29 A;  4KF5 C;  3RWA A;  4Q7R A;  3AI5 A;  3GB3 A;  2AWJ A;  4HQC A;  5AQB B;  1QYQ A;  4KGF A;  1JC0 A;  1QY3 A;  5H88 A;  3O77 A;  3SVN A;  4W7D A;  3H1R A;  3SVO A;  2G6X A;  2WHS A;  1Q73 A;  1ZGP A;  2QLG A;  5DU0 A;  4KW9 A;  2Z1O A;  4GF6 B;  3EK4 A;  5T3I A;  1OXE A;  4Q9X A;  3U8A A;  2G16 B;  2G3D B;  4JGE A;  1G7K A;  5DPG A;  3DQI A;  5FVF A;  2H5O A;  3SG3 A;  2QLG B;  2VAE A;  3DPX A;  3DQE A;  3VIC A;  3DQD A;  3CGL A;  5BTT A;  2DUH A;  2OGR A;  3DQ1 A;  1KYP A;  3SVR A;  4W6L A;  3PJB A;  5HZT A;  2WUR A;  2AWK A;  2FZU A;  3NEZ A;  3DQ5 A;  2QZ0 A;  2GX0 A;  3SVB A;  2H5Q A;  3UFZ A;  4RYS A;  2Q57 A;  4DXI A;  4EDO A;  5H87 A;  3DQ8 A;  2DUI A;  5DTL A;  5EXC I; 
#chains in the Genus database with same CATH homology
 3DQ6 A;  4KF5 A;  3SG7 A;  2EMD A;  3SVU A;  1HUY A;  3DQK A;  3BX9 A;  4W6B A;  4Q7U A;  2AWL A;  3SRY A;  1B9C A;  2QT2 A;  3DQJ A;  3VHT A;  2Z6Z A;  4DXN A;  4ZF3 A;  4W6N A;  4EMQ A;  3CFF A;  2YFP A;  1GFL A;  1MOU A;  4OJ0 A;  4LQT A;  5LTR A;  4IK4 A;  3LA1 A;  2C9I A;  2IB5 A;  4GES B;  3LVA A;  1F09 A;  2WHU A;  4H48 A;  1C4F A;  4W7E A;  1H6R A;  4UTS A;  1H4U A;  2H9W A;  2ICR A;  3AKO A;  2DUG A;  4W6C A;  1EMC A;  1RMP A;  3LVD A;  4W73 A;  1Q4D A;  2GX2 A;  3IR8 A;  4ZBL A;  3SVS A;  3E5V A;  4JFG A;  4P76 A;  4KGE A;  2QLE A;  3KCT A;  4XOV A;  3DQA A;  2BTJ A;  3CD1 A;  3CFH A;  3U0K A;  2Z6X A;  3M22 A;  3BXB A;  4GOB A;  4KW8 A;  2EMO A;  5EHU A;  2WSN A;  3H1O A;  3SVD A;  4I2Y A;  3DQL A;  3PJ7 A;  1Q4C A;  1XAE A;  4JF9 A;  5HZS A;  4W6O A;  1XMZ A;  4W6G A;  3V3D A;  4W7R A;  4R6D A;  1F0B A;  4JEO A;  5DTZ A;  3WLD A;  2IE2 A;  4KW4 A;  3RWT A;  2Q6P A;  1W7U A;  1ZGO A;  1GL4 A;  1KYS A;  3BXA A;  2G6Y A;  3DPW A;  3EKH A;  2O2B A;  5DTY A;  5FHV A;  3ST2 A;  1YJF A;  3DQ9 A;  3LF3 A;  2DUE A;  4W7A A;  4LJD A;  1UIS A;  2AHA A;  4W6P A;  2DDC A;  1W7S A;  1YFP A;  3SV5 A;  5DY6 A;  3GEX A;  5BT0 A;  1YHI A;  3EVV A;  2A56 B;  4W7X A;  2HFC A;  3DQM A;  4ANJ A;  1XA9 A;  3EVR A;  3NT3 A;  1YZW A;  3UG0 A;  1RM9 A;  4B5Y A;  2HGY A;  3GL4 A;  3DQ7 A;  1EMB A;  2H5R A;  3OSR A;  3DQC A;  3DQ4 A;  4W75 A;  4ZIN A;  3ZUL A;  2HCG A;  2DD9 A;  3WLC A;  3SG4 A;  2VAD A;  4R6B A;  3ST0 A;  5BTT B;  3SG5 A;  2Y0G A;  1QXT A;  4DKM A;  2JAD A;  5BQL A;  4RTC A;  2ZO7 A;  5H89 A;  1QYO A;  4IK3 A;  3SSL A;  3O78 A;  4OQW A;  1EMK A;  4ZF4 A;  3SG6 A;  1GGX A;  3CBE A;  4PPJ A;  2DUF A;  4PFE A;  2OTB A;  4Q9W A;  3CB9 A;  4W6K A;  4HVF A;  4P1Q A;  3DQN A;  2WIQ A;  3A8S A;  4XL5 A;  3K1K A;  4LJD C;  2OTE A;  2HQZ A;  4IK1 A;  2FWQ A;  3IP2 A;  4Z4K A;  3VHT B;  2YDZ A;  3PJ5 A;  4KEX A;  2G6E A;  2QRF A;  2GW4 B;  2A46 A;  3U0N A;  2DD7 A;  2FL1 A;  2P4M A;  5DPJ A;  3U0M A;  3MGF A;  5FVG A;  4U2V A;  4DXQ A;  4H3M A;  5DTX A;  1YHH A;  3SS0 A;  1RMO A;  4DXO A;  4J8A A;  4Z4M A;  2A50 B;  2B3P A;  5DRG A;  1Z1P A;  2VVH A;  4ZF5 A;  4JRB A;  1YHG A;  4IZN A;  5EJU A;  3ZTF A;  5LTP A;  1EMG A;  2HJO A;  4AR7 A;  2HPW A;  2ARL A;  3BXC A;  3DQO A;  4DXP A;  4LJC A;  4W7C A;  5DPI A;  2POX A;  5DPH A;  4LJB A;  1KP5 A;  2EMN A;  4KAG A;  4ZIO A;  2VZX A;  4OY4 A;  1QYF A;  4AS8 A;  4RYW A;  3PIB A;  3SSY A;  1EMA A;  4W69 A;  2H6V A;  2QLH A;  1MYW A;  2A52 B;  3CD9 A;  3ADF A;  3EVU A;  2VVJ A;  3DQ2 A;  1JBY A;  3G9A A;  3SVC A;  4Q7T A;  2WHT A;  3ST3 A;  5EBJ A;  1OXD A;  4JC2 A;  4H3N A;  5DRF A;  5KTG A;  4IK8 A;  3ED8 A;  1JBZ A;  4W6A A;  3GJ2 A;  4W6I A;  4DKN A;  3U0L A;  2V4E C;  1RRX A;  2A54 B;  4N3D A;  1BFP A;  3EK7 A;  1EMM A;  4W6F A;  3SG2 A;  4W6S A;  5LK4 A;  4IK9 A;  3LS3 A;  4HQ9 A;  4W6R A;  3DQH A;  4W6T A;  3SST A;  2PXW A;  4XGY A;  1XQM A;  3DQ3 A;  3NED A;  4XOW A;  4PPK A;  1OXF A;  2HGD A;  3DPZ A;  2C9J A;  5HZU A;  2ZO6 A;  3S05 A;  2IB6 A;  3TMT A;  2B3Q A;  4HE4 A;  4TZG A;  5HW9 A;  4KA9 A;  1EML A;  2IOV A;  1CV7 A;  4IK5 A;  5DQM A;  3E5W A;  4EDS A;  3EKJ A;  3LVC A;  4DXM A;  4H47 A;  1S6Z A;  2ZMU A;  1HCJ A;  4W6J A;  5F9G A;  3AI4 A;  4W6H A;  3P8U A;  3SSH A;  4J88 A;  4OHS A;  2A53 B;  4LW5 A;  2HRS A;  4W77 A;  4PPL A;  4W6M A;  4BDU A;  4J89 A;  5EXB A;  1Z1Q A;  3WCK A;  2V4E A;  1W7T A;  2O24 A;  5EB6 A;  5FVI A;  3ZUJ A;  1Q4E A;  3EK8 A;  1JC1 A;  2PXS A;  5EB7 A;  3W1D A;  2WIS A;  3NF0 A;  2V4E B;  4L12 A;  4W6U A;  2AH8 A;  1XSS A;  1MOV A;  3P28 A;  2G3O A;  2ZMW A;  4L1I A;  3GJ1 A;  1KYR A;  1ZUX A;  3U8P A;  4W76 A;  3TMR A;  3I19 A;  4W74 A;  3SSP A;  3ZUF A;  1EMF A;  3OGO A;  2YE0 A;  4EUL A;  2RH7 A;  2GW3 A;  5LTQ A;  4EN1 A;  4B30 A;  5HBD A;  3U8C A;  5DQB A;  1EME A;  1Q4A A;  4TZA A;  3CFA A;  2DDD A;  3KCS A;  4ORN A;  2A48 A;  3LSA A;  3SSV A;  4XVP A;  4HQ8 A;  2VVI A;  3OSQ A;  3EVP A;  3SVE A;  2YE1 A;  4KPI A;  3NT9 A;  1Q4B A;  2QU1 A;  4B30 B;  1YJ2 A;  5EXU A;  3LF4 B;  4LQU A;  4H3L A;  5HGE A;  3SSK A;  2AWM A;  1ZGQ A;  5HZO A;  3M24 A;  4ZB1 A;  2QLI A;  3DQU A;  2H5P A;  3VK1 A;  2A47 A;  4OGS A;  4W72 A;  3E5T A;  2OKY A;  5J2O A;  1RMM A;  3DQF A;  4W7F A;  2OKW A;  3W1C A;  4L13 A;  2HQK A;  3ST4 A;  2G2S B;  2OJK A;  2H8Q A;  4W6D A;  2WSO A;  2G5Z B;  4KF4 A;  4NWS A;  2Z6Y A;  4ZFS A;  2O29 A;  4KF5 C;  3RWA A;  4Q7R A;  3AI5 A;  3GB3 A;  2AWJ A;  4HQC A;  5AQB B;  1QYQ A;  4KGF A;  1JC0 A;  1QY3 A;  5H88 A;  3O77 A;  3SVN A;  4W7D A;  3H1R A;  3SVO A;  2G6X A;  2WHS A;  1Q73 A;  1ZGP A;  2QLG A;  5DU0 A;  4KW9 A;  2Z1O A;  4GF6 B;  3EK4 A;  5T3I A;  1OXE A;  4Q9X A;  3U8A A;  2G16 B;  2G3D B;  4JGE A;  1G7K A;  5DPG A;  3DQI A;  5FVF A;  2H5O A;  3SG3 A;  2QLG B;  2VAE A;  3DPX A;  3DQE A;  3VIC A;  3DQD A;  3CGL A;  5BTT A;  2DUH A;  2OGR A;  3DQ1 A;  1KYP A;  3SVR A;  4W6L A;  3PJB A;  5HZT A;  2WUR A;  2AWK A;  2FZU A;  3NEZ A;  3DQ5 A;  2QZ0 A;  2GX0 A;  3SVB A;  2H5Q A;  3UFZ A;  4RYS A;  2Q57 A;  4DXI A;  4EDO A;  5H87 A;  3DQ8 A;  2DUI A;  5DTL A;  5EXC I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...