3EVUA

Crystal structure of calcium bound dimeric gcamp2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
410
structure length
393
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 123
structure length 393
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evuA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evuA01
1QX2A 1EXRA 1V1FA 2BE4A 3LF4B 1KFXL 2V4EC 2BCAA 4J88A 2KFFA 1QJTA 1NCYA 1TIZA 2M7LA 1K2HA 4H3MA 4YGAA 3VHTB 3CB9A 3SVOA 4M2PA 1NPQA 5DPHA 2LUXA 4Q04A 1ALWA 1KWOB 4J8AA 2L98A 3BQ3A 5CPVA 1YX8A 3EVVA 5AXIA 2P4MA 2A54B 1DJWA 2RH7A 4AS8A 4IL1A 1K90D 3DQ9A 1B7TY 1CDLA 2LLTA 4W7CA 1XO5A 2F2PA 1QX7A 1KK8C 2M29A 4ZIOA 1PVAA 3DQ8A 2G9BA 1UUSA 3VROA 1BJFA 4LJBA 2C9JA 2JQ6A 1EMAA 2JNXA 1TNXA 3ST4A 1CM4A 3U8AA 4N1GA 1LVCD 4R6DA 1QS7A 2LUCA 3OSRA 1YHIA 3C1VA 2V4EB 4P5OE 4D1EA 1M31A 3GJ2A 1RMOA 1WLMA 1J7RA 4GGFA 2LVKA 3A4UB 1DF0B 1B47A 1NX3A 4N3DA 1ZMZA 4XYNA 2H6VA 3E5TA 1FF1A 2YE1A 5ER4X 3I5HB 3DQCA 5EXCI 4I2YA 1OQPA 5HBDA 4JGEA 4HQ8A 4HRHA 2CT9A 2LHIA 1EH2A 5LTRA 3DQ2A 4LJDA 3K21A 4MZKA 1YUUA 1OMRA 1QASA 1EMBA 2K0JA 2JRFA 1IKUA 4W6AA 1QXTA 3CBEA 2VAEA 2OTBA 1JFJA 4Z4MA 2ZRTA 3SG7A 1CV7A 2LM5A 4ORAB 3AAKA 1CB1A 4M2OA 5DRFA 2BCXA 3KEVA 2JU0A 3SSVA 2KI4C 3VRRA 1K94A 4I5JA 5DQMA 5TNCA 3LVAA 1XK4C 3RLZA 5DU0A 4JWQA 2VZXA 2G6YA 3AAJA 2AMIA 4GOBA 1K93D 2O29A 4PCWA 3VICA 1S6IA 2ARLA 1QTXA 3ZUFA 2ZNDA 1H4BA 1KYSA 5D69A 1PSRA 1LINA 4JPZB 3EVPA 2QLGA 1LA0A 4BY4A 2JULA 3TDUA 2MA2A 2A52B 2I18A 3DQMA 4LQUA 3AI5A 2P6BB 1SPYA 4CPVA 4GUKA 1Q80A 4MLWA 1QVIZ 2GGMA 1XFUO 1C7VA 3DQEA 1ZGPA 4WRIA 4N1FA 2VVJA 2VVIA 1UURA 2ZRSA 2JC2A 2G3OA 3CFHA 3OX5A 2HFCA 1YUTA 2KI4B 2DUEA 1PK0D 1HUYA 3TMRA 1G4YR 2DDCA 4LJDC 2L4IA 5AQBB 5BTTA 1A75B 2HGYA 1G8IA 2CCMA 2GGZA 1RROA 4AOMA 4AQJA 3ICBA 1CDNA 4W77A 2NXQA 3DQDA 1JF2A 3SVRA 2BBMA 3SSYA 1PULA 1FW4A 2IB5A 5CSFA 1Y0VH 2PALA 3BOWA 1IQ3A 2A50B 1NYAA 1SK6D 3M0WA 3G9AA 3PIBA 1OXEA 2PSRA 4W6IA 1TCOB 2JWWA 1PSBA 3CD9A 1C07A 3AKOA 3CZTX 2LVIA 3BXAA 4MEWA 3NSOA 2B1UA 5I2LA 1BMOA 2MBXA 2OTGC 3I19A 4EDSA 3SSKA 2BKHB 5HGEA 1ZUZA 1M46A 1KQVA 5CSNA 1XVJA 3ST0A 4ZF4A 3W1DA 3CFAA 4WQ2A 2Z6YA 2JNFA 2WHUA 1WY9A 2QLHA 4DXIA 1RMMA 1H6RA 1CLBA 1SBJA 4GPLB 3NSLA 4W6SA 2R2IA 2H5OA 2KGBC 3A8RA 2JADA 4DKMA 2ZKMX 1AHRA 2G16B 4M2QA 4L13A 1HQVA 5DPJA 1M45A 4XOVA 3TUYC 1KK7Z 5DTYA 4Q7UA 1RMPA 4OQWA 3ZTFA 2POXA 1B8RA 5D7FA 4MBEA 4LQTA 2ZNEA 2EMDA 3DQ6A 2F8PA 2A56B 3DPZA 3KO0A 3UG0A 2M1KB 2PMYA 2EC6B 1G33A 4XOWA 2AH8A 1K8UA 1EMEA 1GGZA 1BFPA 2RGIA 2CBLA 2H5PA 4NDDA 3M24A 1IJ6A 1QLSA 2BE6A 2MLEC 2DD7A 2VADA 1LA3A 2F3ZA 3SJSA 3JTDC 1JBYA 4HE4A 4KPIA 2YE0A 3LSAA 1OMVA 4KAGA 2DUFA 2ZMUA 2Y5IA 1PALA 1B8CA 3SVSA 2ZO7A 3DQFA 1JBZA 1DF0A 3TZ1A 3D0YA 4NDBA 3TUYB 1K9KA 5I2OA 2MJWB 2QT2A 3DF0B 1WRZA 1F55A 5FVIA 2H9WA 1QIWA 3I5GC 1L2OC 2ICRA 5IBWA 1NX0A 2WIQA 2KQYA 2KAXA 4GBAA 4KGFA 2F2OA 4B30B 4DIRA 2L51A 3DQ7A 4LW5A 4W6MA 1JFKA 1ZACA 1ALVA 4EULA 4MSPA 2IB6A 1MOUA 1ODBA 4DKNA 4RTCA 1YR5A 4KEXA 2BL0C 1DJIA 5CSIA 3BUWB 1BOCA 4UTSA 3JTDB 2JXCA 4MZLA 3VRPA 3QRXA 2BTJA 1NUBA 5J3XA 2QLEA 5FVFA 4ZBLA 4W7AA 2KHNA 2O2BA 1NX1A 3CD1A 2QLIA 2QRFA 4BY5A 3DQHA 4EDOA 2HPWA 3OB1B 3E5WA 1YRTB 4W6KA 3LF3A 3PN7C 1ZOTB 1RRXA 2IOVA 2OKWA 4W7EA 4W74A 4C0JA 1ZGQA 1X02A 3CR5X 5AANA 4W6PA 4WQ3A 2A46A 2Y0GA 4OR9B 1F8HA 3CR2A 1L2OB 3WHTB 4DXOA 5DKNA 1QLKA 4PE7A 4OCIA 1JBAA 2L0PA 2CXJA 1B8LA 2LMTA 4W6FA 2JPTA 2IE2A 3PJ7A 2LC5A 1UISA 1QXPA 1S6ZA 2IS9A 1DVIA 3MSEB 2BL0B 1NIWA 2KYFA 1KFUS 3CFFA 3U0KA 4Q9XA 1MXEA 1BR4B 3DPWA 2OJKA 1MF8B 2KSPA 1TOPA 4YBHB 4ZF5A 4R1EA 3SVUA 1A75A 2L2EA 4YI9A 5K89A 5B8IB 1KQMC 2O5GA 1Q4AA 1D1OA 4IK1A 2OS8C 3BXKA 1EMLA 3M22A 3PN7B 5AFPA 4JQ0D 1S5GZ 1AVSA 3CGLA 2LANA 1ZGOA 1S36A 2Z6XA 4JF9A 4ORBB 5FVGA 3WLCA 1SKTA 1U5IB 1QY3A 3H1RA 3CTNA 5HZTA 1S3PA 4Q9WA 1DJXA 3EKHA 2G6EA 1KP5A 2WOSA 3H1OA 3EK8A 4Q7TA 1GGWA 1QYOA 3EVRA 2JT8A 4QJ4B 3IP2A 3P8UA 1MR8A 3GK1A 2WSNA 1EJ3A 2G3DB 3SSPA 1CMFA 2JOJA 4KW8A 4YGDB 4OGSA 2G5ZB 1ZFSA 1KK8B 2FL1A 3PLFB 4GFTA 1A03A 2TN4A 2KQ6A 1RECA 4KW4A 3LL8B 5CSJA 1FI6A 1MYWA 4W76A 3FIAA 4B5YA 2WURA 2QU1A 1H8BA 4HQCA 2GX2A 4W6JA 4JEOA 1S5GY 4DS7A 2B3QA 4TZGA 2KNEA 2M7NA 5BQLA 3DQ5A 1F71A 3S05A 4E68A 3DQJA 5DTXA 4W69A 2WCEA 2Q91A 2ZO6A 1A2XA 2KGRA 2JZIA 4W7RA 5DPIA 2PXSA 1DT7B 3O78A 2Y1MA 1SYMA 2HQWA 2PASA 3DPXA 4IK5A 5KTYA 1TN4A 1B9CA 3ST3A 3LLEA 4H47A 3WHUB 4J89A 1SY9A 1E8AA 4DRWA 4HQ9A 2H61A 5FHVA 3HX4A 3E5VA 2Q6PA 4KF5A 5DTZA 3SIBA 2WCBA 4IK8A 2OPOA 4YI8A 1QYFA 1CLLA 1SL8A 5HZSA 4FTGA 4GGFC 2AAOA 4W7DA 1Q4BA 3SIAA 1L7ZA 3OGOA 2I94A 2Z1OA 2M9GA 4HVFA 2LAPA 4MRXA 1MOVA 1GL4A 2K61A 2H5RA 4MZJA 2G2SB 4ZFSA 1KCYA 2NCPA 3DF0A 2PRUA 4ORNA 1KFUL 2LP2A 4JRBA 1YX7A 3DQ1A 4YGCB 1CDMA 4PHNA 2KFGA 3DQUA 3SSLA 4C0LA 1V1GA 2MLFC 3KHEA 2JTTA 2CNPA 4RYWA 4JC2A 4B30A 5I8NA 1J1DA 5ER5A 4CFQA 5HZUA 1BR1B 1UWOA 1N65A 1F4OA 1CFFA 1RFJA 1YJFA 3LA1A 1QVIY 4IK4A 2EHBA 2HQKA 2H8QA 1JC1A 1NCXA 2WC8A 4P1QA 1Y1XA 1J7OA 3WXAA 1XQMA 4IK9A 1GJYA 2EGDA 1BG1A 5DPGA 4PDZA 2M3WA 3SVEA 3H4SE 4ETOA 1TNPA 2WORA 4PALA 1EG4A 4DUQA 3PALA 1SMGA 4ANJA 3LK1A 2JT0A 4A4CA 1SR6C 1S26D 2VRGA 2HF5A 2E6WA 4Z4KA 2OGRA 1S1EA 4ZF3A 2PVBA 3ZNIA 1K96A 3UFZA 3GK4X 3VHTA 2AWMA 1RM9A 1F4QA 3VK1A 1EMFA 1W7IB 4HSZA 4C0KA 3NT9A 1OXFA 3PSRA 4PE4A 1UHKA 1EG3A 1W7UA 1JC0A 4QJ5B 1WLZA 2O60A 1IRJA 1CFCA 4N5XA 4PHMA 2AWJA 1S6JA 1KSOA 1W7JB 3ADFA 3VRQA 3RWTA 4A4BA 1SCVA 1R2UA 4YRUA 2OTGB 2HETA 3KCSA 3I5IC 1H4UA 4W6HA 1OMDA 4ZCVA 3WCKA 3SSHA 3TDIA 2QLGB 4XGYA 4XVPA 4W6TA 2NZ0A 3O2PA 2AHAA 1SR6B 2JXLA 2V4EA 2GW4B 3KPXA 3LK0A 2ZMWA 4CIDA 2HJOA 1KSMA 4F0ZB 2K8MB 1HCJA 5EXBA 3JVTC 2LLUA 2L5XB 1EMMA 5DKQA 2I2RE 4DCKA 1GQMA 5JOLA 1KK7Y 1F0BA 1JC2A 1MXLC 2Q57A 3O6BA 1FI5A 3ZWHA 1YURA 3RM1A 1OSAA 3EK7A 2OKYA 2LVJA 2V53A 3O4YA 4XJKB 2M1UA 3EK4A 5GQQC 3VGOA 3DVEA 2A48A 2H5QA 5BTTB 3A8SA 3GL4A 4DXMA 1TRFA 4CFRA 2L4HA 5J2OA 1GFLA 3ZUJA 2ZN8A 3I5IB 2KDHA 1OE9B 1WRKA 3I5FC 2FJUB 1QATA 3BUOB 1SW8A 1YRUB 4I5KA 4PE0A 2QPTA 2AWLA 4MRYA 3U0LA 4ZB1A 5DKRA 1KWOC 1SRAA 4DXPA 5HKWA 1B1GA 1J1EA 3BOWB 2LNKA 5EB7A 2KBIA 1CNPA 4L9MA 4EN1A 4I5LB 2K2AA 4YGBB 1XA5A 5G08A 1XFZO 5AEQA 4EMQA 2KYCA 3OX6A 1XFVO 2HPSA 4PPJA 2KI6C 4W6LA 2EMNA 5KSZA 1GGXA 3F45A 1XFXO 3BX9A 2DUIA 4GAOA 3AI4A 1F70A 1Q4CA 1W7SA 3I5GB 2ZN9A 3SS0A 4ORCB 5LK4A 4R6BA 1EMKA 3GEXA 4GGNA 5F9GA 2QACA 2MAZA 1MQ1A 1WDCC 2GW3A 2LMUA 1W7TA 3AKAA 2H2KA 3SVNA 2FCDA 1DTLA 5KU1A 3I5FB 3E3RA 4OKHA 1YUSA 1C7WA 4FQOA 5H87A 1XFWO 3I5HC 3PJ5A 2BKIB 1BU3A 1OZSA 4PHJA 1XK4A 3CR4X 2KI6D 2K7BA 2LHLA 4NQGA 3LS3A 2K2FA 1VRKA 3WNXB 1Y1UA 4GNKB 1XYDA 1YTZC 1CKKA 3DQNA 4BDUA 1FBVA 3WLDA 3CS1A 1SL7A 4DXNA 3O77A 5EB6A 1CFDA 1IH0A 2KFHA 1DJGA 2COLB 3U8CA 3D10A 4H3NA 1TNQA 2FZUA 2BBNA 4PE1A 5EHUA 3DQ3A 4U8DA 2DDDA 1PRWA 3DVJA 4TNCA 2A53B 2LMVA 3VRNA 1XAEA 2BCBA 1WDCB 1MHOA 1UHHA 1SNLA 1M39A 1QIVA 3BXCA 2VVHA 1F54A 3D0YB 5AERA 3TS5C 4KW9A 1CLMA 4I5NB 2B3PA 3KF9A 3U8PA 1S6CA 1M63B 2QZ0A 2M0RA 1FPWA 4W6NA 5T3IA 2JTZA 4AQIA 1KQMB 4ZCUA 5LTPA 2DUGA 1K9UA 1BLQA 3W1CA 4HREE 2JT3A 2OS8B 4ICBA 4RYSA 4W75A 3SG4A 4U2VA 2NLNA 4PFEA 1OXDA 1UHIA 5BPJA 1RJVA 3U0NA 3SVDA 1J7QA 5HLVA 2M97A 1IQ5A 2ISDA 4OY4A 2HRSA 1QV1A 3BXBA 4QJ3B 3LVDA 3DVKA 1Y1AA 3GB3A 3IQQA 2A47A 1AP4A 1YHHA 1YZWA 4IK3A 1JSAA 2KAYA 3TS5B 2WISA 2G6XA 3LCPC 3TDZA 1Y6WA 4W72A 4OJ0A 5HZOA 4W6GA 3ED8A 4GF6B 5H89A 1JF0A 2KAVA 5HLOA 4UPGA 2WSOA 1J55A 4NWSA 1A4PA 3GOFA 3SG5A 3FS7A 1BODA 1OZOA 3DQ4A 2K7OA 4MVFA 1RTP1 1K9PA 1NSHA 3PM8A 5DQBA 4L1IA 4W6OA 1UP5A 3CLNA 2M8UA 2M49B 3MGFA 3DQLA 1IGVA 2LVVA 3IR8A 3PJBA 2DD9A 4HRGA 1YVHA 4YGEB 1MWNA 3FWBA 1YHGA 4XJKA 5EBJA 1SCMC 2WHTA 1EL4A 1Q4EA 2CTNA 2LE9B 5EJUA 3SG2A 1TNWA 5PALA 4W73A 3U0MA 4H48A 1LKJA 2WCFA 4AR7A 3NEZA 1KYPA 5DTLA 1K95A 1CFPA 3NSIA 2KOTA 1DMOA 2LCPA 1TTXA 2MRDA 1XSSA 3V3DA 2AUCA 2G2BA 1IJ5A 1TCFA 3DQIA 2Y4QA 5DRGA 3KCTA 4LJCA 5DY6A 2EC6C 4KA9A 4CLNA 4JFGA 2HCGA 3ZULA 4OV2A 3P28A 3ST2A 1IWQA 2H61C 4W6BA 4TZAA 1KFXS 2E30A 1DGUA 3PATA 3SVCA 3NSKA 4P76A 2SASA 2GX0A 1XMZA 1N2DA 4KF5C 3IQOA 1SCMB 2Y1NA 5HYDA 2YFPA 1IG5A 4W7FA 2GV5A 4W6UA 3CGAA 3OP0A 2FCEA 2HQ8A 1YJ2A 3OB2B 1OOJA 3BYAA 3OSQA 3SSTA 4KF4A 3K1KA 1NWDA 3BUNB 5I2QA 3DQOA 4PHKA 1HT9A 4W6DA 1EMCA 3GJ1A 3EVUA 2AWKA 1DJHA 1DJYA 2KBMA 3TMTA 4OHSA 2L50A 1AJ4A 5HW9A 1SL9A 4W6CA 1AJ5A 3SG3A 1QX5B 1CTRA 3DD4A 4H3LA 3DVMA 4KGEA 2O24A 3GK2A 1PVBA 3DQKA 4XL5A 2Z6ZA 5BT0A 2DOQA 1LXFC 1AUIB 1WRLA 1NX2A 4Q7RA 4USLA 2EMOA 3NXAA 1J7PA 1RK9A 2DUHA 4W6RA 1AK8A 4PPKA 1EMGA 3PFVA 2LP3A 1U5IA 1C4FA 5JJGA 5FYXA 4DXQA 1NP8A 3RWAA 1RWYA 2ZFDA 2I7AA 3CWGA 2LV7A 2NCOA 5F6TA 4MN0A 1YVLA 3NEDA 1JWDA 2SCPA 3LVCA 5HKZA 3FWCA 3HCMA 1CMGA 2HQZA 1DGVA 5H88A 2F33A 3NT3A 4IZNA 1G7KA 3BUMB 1NCZA 3NF0A 4PPLA 1MUXA 3BUXB 3IF7A 3AKBA 1N0YA 5HKYA 2WNDA 2C9IA 2Q4UA 1B4CA 1CDPA 1Z1PA 3DQAA 4L12A 2F3YA 2OTEA 3OHMB 3SVBA 2FWQA 1A29A 1BF5A 2A4JA 2LLSA 3SG6A 1QV0A 1JUOA 5LTQA 2WHSA 2BECA 1UHJA 2FOTA 2K7DA 1BT6A 3EKJA 2YDZA 4ZINA 3SV5A 1Z1QA 1Q73A 5EXUA 1R6PA 1XA9A 4OVNF 1B7TZ 2HGDA 4GESB 3JVTB 1UHNA 1F09A 2K7CA 1CM1A 1DJZA 4W7XA 2PXWA 1XFYO 2D8NA 4NDCA 1QYQA 5KTGA 1Q4DA 3SRYA 1ZUXA 2MHHA 1B9AA 4P2YB 1YFPA 1KYRA
chains in the Genus database with same CATH superfamily
3NHIA 3R1OA 1QX2A 1EXRA 1V1FA 2BE4A 3LF4B 1KFXL 2V4EC 2BCAA 4J88A 2KFFA 1QJTA 1NCYA 1TIZA 2M7LA 1K2HA 4H3MA 1SSEB 4YGAA 3VHTB 3CB9A 3SVOA 4M2PA 1NPQA 5DPHA 2LUXA 4Q04A 1ALWA 1KWOB 4J8AA 2L98A 3BQ3A 5CPVA 1YX8A 3EVVA 5AXIA 2P4MA 2A54B 1DJWA 2RH7A 4AS8A 4IL1A 1K90D 3DQ9A 1B7TY 1CDLA 2LLTA 4W7CA 3BJHA 3Q8IA 1XO5A 2F2PA 1QX7A 1KK8C 1C3ZA 2M29A 4ZIOA 1PVAA 3DQ8A 2G9BA 1UUSA 3VROA 1BJFA 4LJBA 2C9JA 2JQ6A 1EMAA 2JNXA 1TNXA 2ERBA 3ST4A 1CM4A 3U8AA 4N1GA 1LVCD 4R6DA 1QS7A 2LUCA 3OSRA 1YHIA 3C1VA 2V4EB 4P5OE 1C3YA 4D1EA 1M31A 3GJ2A 1RMOA 1WLMA 1J7RA 4GGFA 2LVKA 3A4UB 1DF0B 1B47A 1NX3A 4N3DA 1ZMZA 4XYNA 2H6VA 3E5TA 1FF1A 2P71A 2YE1A 5ER4X 3I5HB 3DQCA 5EXCI 4I2YA 1OQPA 5HBDA 4JGEA 4HQ8A 4HRHA 2CT9A 2LHIA 1EH2A 5LTRA 3DQ2A 4LJDA 3K21A 4MZKA 1YUUA 1OMRA 3PM2A 1QASA 1EMBA 2K0JA 2JRFA 1IKUA 4W6AA 2QEHA 1QXTA 3CBEA 2VAEA 2OTBA 1JFJA 4Z4MA 2ZRTA 3SG7A 1CV7A 2LM5A 4ORAB 3AAKA 1CB1A 4M2OA 5DRFA 2BCXA 3KEVA 2JU0A 3SSVA 2KI4C 3VRRA 1K94A 4I5JA 5DQMA 5TNCA 3LVAA 1XK4C 3RLZA 3CZ2A 5DU0A 4JWQA 2VZXA 2G6YA 3AAJA 2AMIA 4GOBA 1K93D 2O29A 3B87A 4PCWA 3VICA 1S6IA 2ARLA 1QTXA 3ZUFA 2ZNDA 1H4BA 1KYSA 5D69A 1PSRA 1LINA 4JPZB 3EVPA 2QLGA 1LA0A 4BY4A 2JULA 3TDUA 1XFRA 2MA2A 2A52B 2I18A 3DQMA 4LQUA 3AI5A 2P6BB 1SPYA 4CPVA 4GUKA 1Q80A 4MLWA 1QVIZ 2GGMA 1XFUO 3B88A 1C7VA 3DQEA 1ZGPA 4WRIA 4N1FA 2VVJA 2VVIA 1UURA 2ZRSA 2JC2A 2G3OA 3DY9A 3CFHA 3OX5A 2HFCA 1YUTA 5EL2A 2KI4B 2DUEA 5FI6A 1PK0D 1HUYA 3TMRA 1G4YR 2DDCA 4LJDC 2L4IA 5AQBB 1OOHA 5BTTA 1TWOA 1A75B 2HGYA 1G8IA 2CCMA 2GGZA 1RROA 4AOMA 4AQJA 3ICBA 1CDNA 4W77A 2NXQA 3DQDA 1JF2A 3SVRA 2BBMA 3SSYA 1PULA 2QEBA 1FW4A 2IB5A 5CSFA 1Y0VH 2PALA 3BOWA 4INXA 1IQ3A 2A50B 1NYAA 1SK6D 3M0WA 3G9AA 3PIBA 1OXEA 2PSRA 4W6IA 1TCOB 2JWWA 1PSBA 3CD9A 1C07A 3AKOA 3CZTX 2LVIA 3BXAA 4MEWA 3NSOA 2B1UA 5I2LA 1BMOA 2MBXA 2OTGC 3I19A 4EDSA 3SSKA 2BKHB 5HGEA 1ZUZA 1M46A 1KQVA 5CSNA 1XVJA 3ST0A 4ZF4A 3W1DA 3CFAA 4WQ2A 2Z6YA 2JNFA 2WHUA 1WY9A 2QLHA 4DXIA 1RMMA 1H6RA 1CLBA 1SBJA 4GPLB 3NSLA 4W6SA 2R2IA 2H5OA 2YGUA 2KGBC 3A8RA 2JADA 4DKMA 2ZKMX 1AHRA 2G16B 4M2QA 4L13A 1HQVA 5DPJA 1M45A 4XOVA 3TUYC 1KK7Z 5DTYA 4Q7UA 1RMPA 4OQWA 3ZTFA 3NHTA 2POXA 1B8RA 5D7FA 4MBEA 4LQTA 2ZNEA 2EMDA 3DQ6A 2F8PA 2A56B 3DPZA 3KO0A 3UG0A 2M1KB 2PMYA 2EC6B 1G33A 1OW4A 4XOWA 2AH8A 1K8UA 3FE8A 1EMEA 1GGZA 3UO9A 1BFPA 2RGIA 2CBLA 2H5PA 4NDDA 3M24A 1IJ6A 1QLSA 2BE6A 2MLEC 2DD7A 2VADA 1LA3A 2F3ZA 3SJSA 3JTDC 1JBYA 4HE4A 4KPIA 2YE0A 3LSAA 1OMVA 4KAGA 2DUFA 2ZMUA 2Y5IA 1PALA 1B8CA 3SVSA 2ZO7A 3DQFA 1JBZA 1DF0A 3TZ1A 1P28A 3S0DA 3D0YA 4NDBA 3TUYB 1K9KA 5I2OA 2MJWB 2QT2A 3DF0B 1WRZA 1F55A 5FVIA 2H9WA 1QIWA 3I5GC 1L2OC 2ICRA 5IBWA 1NX0A 2WIQA 2KQYA 2KAXA 4GBAA 4KGFA 2F2OA 4B30B 4DIRA 2L51A 3CYZA 3DQ7A 4LW5A 4W6MA 1JFKA 3DYEA 1ZACA 1ALVA 4EULA 4MSPA 2IB6A 1MOUA 1ODBA 4DKNA 4RTCA 1YR5A 4KEXA 2BL0C 1DJIA 5CSIA 4OZDA 3BUWB 1BOCA 3OBVA 4UTSA 1DQEA 3JTDB 2JXCA 4MZLA 3VRPA 3QRXA 2BTJA 1NUBA 5J3XA 2QLEA 1DELA 5FVFA 4ZBLA 4W7AA 2KHNA 2PYQA 2O2BA 1NX1A 3CD1A 1OOIX 2QLIA 2QRFA 4BY5A 3SS3A 3DQHA 4EDOA 2HPWA 3OB1B 3E5WA 1YRTB 4W6KA 3LF3A 3PN7C 1ZOTB 1RRXA 2IOVA 2OKWA 4W7EA 4W74A 3BFAA 4C0JA 1ZGQA 4JD9A 1X02A 3CR5X 5AANA 4W6PA 4WQ3A 2A46A 2Y0GA 4OR9B 1F8HA 3CR2A 1L2OB 3WHTB 4DXOA 3V2LA 5DKNA 1QLKA 4PE7A 4OCIA 1JBAA 2L0PA 2CXJA 1B8LA 2LMTA 4W6FA 2JPTA 2IE2A 3PJ7A 2LC5A 1UISA 1QXPA 1S6ZA 2IS9A 4IJ7A 1DVIA 3MSEB 2BL0B 1NIWA 2KYFA 1KFUS 3CFFA 3U0KA 4Q9XA 1MXEA 1BR4B 3DPWA 2OJKA 1MF8B 2KSPA 1TOPA 4YBHB 4ZF5A 4R1EA 3SVUA 1A75A 2L2EA 4YI9A 5K89A 5B8IB 3S0EA 1KQMC 4KYNA 2O5GA 1Q4AA 1D1OA 4IK1A 2OS8C 3BXKA 1EMLA 3PN7B 3M22A 5AFPA 4JQ0D 1S5GZ 1AVSA 3CGLA 2LANA 1ZGOA 1S36A 2Z6XA 3CZ0A 4JF9A 3R72A 4ORBB 5FVGA 3WLCA 1SKTA 1U5IB 1QY3A 3H1RA 3CTNA 5HZTA 1S3PA 4Q9WA 1DJXA 3EKHA 1LS8A 2G6EA 1KP5A 3D78A 2WOSA 3H1OA 2QDIA 3EK8A 4Q7TA 1GGWA 1QYOA 3EVRA 2JT8A 4QJ4B 3IP2A 3P8UA 1MR8A 3GK1A 2WSNA 3B7AA 1EJ3A 2G3DB 3SSPA 1CMFA 2JOJA 4KW8A 4YGDB 4OGSA 2G5ZB 1ZFSA 1KK8B 2FL1A 3PLFB 4GFTA 1A03A 2TN4A 2KQ6A 1RECA 4KW4A 3LL8B 5CSJA 1FI6A 1MYWA 4W76A 3FIAA 4B5YA 2WURA 2QU1A 1H8BA 4HQCA 2GX2A 4W6JA 4JEOA 1S5GY 4DS7A 2B3QA 4TZGA 2KNEA 2M7NA 5BQLA 3DQ5A 1F71A 3S05A 4E68A 3DQJA 2KLEA 5DTXA 4W69A 2WCEA 2Q91A 2ZO6A 1A2XA 2KGRA 2JZIA 4W7RA 5DPIA 2PXSA 1DT7B 1T14A 3O78A 2Y1MA 1SYMA 2HQWA 2PASA 4PT1A 3DPXA 4IK5A 5KTYA 1TN4A 1B9CA 3ST3A 3LLEA 4H47A 3WHUB 4J89A 1SY9A 1E8AA 4DRWA 1ORGA 4HQ9A 2H61A 5FHVA 3HX4A 3E5VA 2Q6PA 3BFHA 4KF5A 1Z2CB 5DTZA 3SIBA 2WCBA 2OPOA 4YI8A 4IK8A 1QYFA 1CLLA 1SL8A 5HZSA 4FTGA 4GGFC 2AAOA 3D77A 4W7DA 1Q4BA 3SIAA 1L7ZA 3OGOA 2I94A 2Z1OA 2M9GA 4HVFA 2LAPA 4MRXA 1MOVA 1GL4A 2K61A 2H5RA 4MZJA 2G2SB 4ZFSA 1KCYA 2NCPA 3DF0A 2PRUA 4ORNA 1KFUL 5DICA 2LP2A 4JRBA 1YX7A 3DQ1A 3OGNA 4YGCB 1CDMA 4PHNA 2KFGA 3DQUA 3SSLA 4C0LA 1V1GA 2MLFC 3KHEA 3CZ1A 2JTTA 2CNPA 4RYWA 3D73A 4JC2A 4B30A 1TUZA 5I8NA 1J1DA 5ER5A 4CFQA 3FE9A 5HZUA 1BR1B 1UWOA 1DC1A 1N65A 1F4OA 1CFFA 1RFJA 1YJFA 3LA1A 1QVIY 4IK4A 3S0BA 2QEOA 2EHBA 2HQKA 2H8QA 1JC1A 1NCXA 1W9ZA 2WC8A 4P1QA 1Y1XA 1J7OA 3WXAA 1XQMA 4IK9A 1GJYA 2EGDA 1BG1A 5DPGA 4PDZA 1OOFA 2M3WA 3SVEA 3H4SE 4ETOA 1TNPA 2L5YA 2WORA 4PALA 1EG4A 4DUQA 3PALA 1SMGA 4ANJA 3LK1A 2JT0A 4A4CA 1SR6C 1S26D 2VRGA 2HF5A 2E6WA 4Z4KA 2OGRA 1S1EA 4ZF3A 2PVBA 3ZNIA 1K96A 3UFZA 3GK4X 3VHTA 3EG5B 2FJYA 2AWMA 1RM9A 3R1VA 1F4QA 3VK1A 1EMFA 1W7IB 4HSZA 4C0KA 3NT9A 1OXFA 3PSRA 4PE4A 3S0AA 1UHKA 1EG3A 2WCLA 1W7UA 1JC0A 4QJ5B 1WLZA 2O60A 1IRJA 1CFCA 4N5XA 4PHMA 2AWJA 1S6JA 1KSOA 1W7JB 3ADFA 3VRQA 3RWTA 4A4BA 1SCVA 1R2UA 4YRUA 2OTGB 2HETA 3KCSA 3I5IC 1H4UA 4W6HA 1OMDA 4ZCVA 3WCKA 3L4LA 3SSHA 3TDIA 2QLGB 4XGYA 4XVPA 4W6TA 2NZ0A 3O2PA 2AHAA 1SR6B 2JXLA 2V4EA 2GW4B 3KPXA 3LK0A 2ZMWA 4CIDA 2HJOA 1KSMA 4F0ZB 2K8MB 1HCJA 5EXBA 3L47A 3JVTC 2LLUA 3S0FA 2L5XB 1EMMA 5DKQA 2I2RE 4DCKA 1GQMA 5JOLA 1KK7Y 1F0BA 1JC2A 1MXLC 2Q57A 3O6BA 1FI5A 3ZWHA 1YURA 3RM1A 2K60A 1OSAA 3EK7A 2OKYA 2LVJA 2V53A 3O4YA 4XJKB 2M1UA 3EK4A 5GQQC 3VGOA 3DVEA 3PJIA 2A48A 2H5QA 5BTTB 3A8SA 3GL4A 4DXMA 1TRFA 4CFRA 2L4HA 5J2OA 1GFLA 3ZUJA 2ZN8A 3I5IB 2KDHA 1OE9B 1WRKA 3I5FC 2FJUB 1QATA 3BUOB 3L4AA 1SW8A 1YRUB 4I5KA 4PE0A 2QPTA 2AWLA 4MRYA 3U0LA 4ZB1A 2WCHA 5DKRA 1KWOC 1SRAA 4DXPA 2WCJA 5HKWA 1B1GA 1J1EA 3BOWB 2LNKA 5EB7A 2KBIA 1OOGA 1CNPA 4F7FA 4L9MA 4EN1A 4I5LB 2K2AA 4YGBB 1XA5A 5G08A 1XFZO 5AEQA 4EMQA 2KYCA 3OX6A 1XFVO 2HPSA 4PPJA 2KI6C 4W6LA 2EMNA 5KSZA 3NGVA 1GGXA 3F45A 1XFXO 3BX9A 2DUIA 4GAOA 3AI4A 1F70A 1Q4CA 1W7SA 3I5GB 2ZN9A 3SS0A 4ORCB 5LK4A 4R6BA 1EMKA 3GEXA 3DXLA 4GGNA 5F9GA 2QACA 2MAZA 1MQ1A 1WDCC 2GW3A 2LMUA 1W7TA 3AKAA 2H2KA 3SVNA 2FCDA 2BNXA 1DTLA 5KU1A 3I5FB 3E3RA 4OKHA 1YUSA 1C7WA 4FQOA 5H87A 1XFWO 3I5HC 3D75A 3PJ5A 2BKIB 1BU3A 1OZSA 4PHJA 1XK4A 3CR4X 2KI6D 2K7BA 2LHLA 4NQGA 3LS3A 2K2FA 1VRKA 3WNXB 1Y1UA 2KPHA 1XYDA 4GNKB 1YTZC 3SS5A 1CKKA 3DQNA 4BDUA 1FBVA 3VB1A 3WLDA 3CS1A 1SL7A 4DXNA 3O77A 5EB6A 1CFDA 1IH0A 2KFHA 1DJGA 2COLB 3U8CA 2L2CA 3D10A 4H3NA 1TNQA 2FZUA 2BBNA 4PE1A 5EHUA 2WC5A 3DQ3A 4U8DA 2DDDA 1PRWA 3DVJA 1TUJA 4TNCA 2A53B 2LMVA 3VRNA 1XAEA 2BCBA 1WDCB 1MHOA 1UHHA 2WC6A 5I94A 1SNLA 1M39A 1QIVA 3BXCA 2VVHA 1F54A 3D0YB 4FQTA 5AERA 3TS5C 3IVTA 4KW9A 1CLMA 4I5NB 2B3PA 3FE6A 3KF9A 3U8PA 1S6CA 1M63B 2QZ0A 2M0RA 1FPWA 4W6NA 5T3IA 2JTZA 1GM0A 4AQIA 1KQMB 4ZCUA 3BFBA 5LTPA 2DUGA 5FI7A 4INWA 1IIOA 1K9UA 1BLQA 3W1CA 4HREE 2JT3A 3K1EA 2OS8B 4ICBA 4RYSA 4W75A 3SG4A 4U2VA 2NLNA 4PFEA 1OXDA 1UHIA 5BPJA 1RJVA 2GTEA 3SS4A 3B86A 3O4XA 3U0NA 3SVDA 1J7QA 5HLVA 2M97A 1IQ5A 2ISDA 4OY4A 1DEKA 2HRSA 1QV1A 3BXBA 4QJ3B 3LVDA 3DVKA 1Y1AA 3GB3A 3IQQA 2A47A 1AP4A 1YHHA 1YZWA 4IK3A 1JSAA 2KAYA 3TS5B 2WISA 2G6XA 5FI2A 3LCPC 3TDZA 1Y6WA 2WCMA 4W72A 4OJ0A 5HZOA 4W6GA 3ED8A 1QWVA 4GF6B 5H89A 1JF0A 2KAVA 5HLOA 4UPGA 2WSOA 1J55A 4NWSA 1A4PA 3GOFA 3SG5A 3FS7A 1BODA 1OZOA 3DQ4A 2K7OA 4MVFA 1RTP1 1K9PA 3D74A 1NSHA 3PM8A 5DQBA 4L1IA 4W6OA 1UP5A 3CLNA 2M8UA 2M49B 3MGFA 3DQLA 1IGVA 2LVVA 3IR8A 3PJBA 3RZSA 2WCKA 2DD9A 4HRGA 1YVHA 2H8VA 4YGEB 3S0GA 1MWNA 3FWBA 1YHGA 4XJKA 5EBJA 1SCMC 2WHTA 2PQLA 1EL4A 1Q4EA 2CTNA 2LE9B 5EJUA 3SG2A 1TNWA 5PALA 4W73A 3U0MA 4H48A 1LKJA 2WCFA 4AR7A 3NEZA 1KYPA 5DTLA 1K95A 1CFPA 3NSIA 3CDNA 2KOTA 1DMOA 2LCPA 1TTXA 2MRDA 3DZTA 3UNWA 1XSSA 3R1PA 3V3DA 2AUCA 2G2BA 1IJ5A 1TCFA 3DQIA 2Y4QA 5DRGA 3KCTA 4LJCA 5DY6A 2EC6C 4KA9A 4CLNA 4JFGA 2HCGA 3ZULA 4OV2A 3P28A 3ST2A 1IWQA 2H61C 4W6BA 4TZAA 1KFXS 2E30A 1DGUA 3PATA 3SVCA 3NSKA 4P76A 2SASA 2GX0A 1XMZA 1N2DA 4KF5C 3CABA 3IQOA 1SCMB 2Y1NA 5HYDA 2YFPA 1IG5A 4W7FA 2JPOA 2GV5A 4W6UA 2P70A 3CGAA 3OP0A 2FCEA 2HQ8A 1YJ2A 3OB2B 1OOJA 3BYAA 3OSQA 3SSTA 4KF4A 3K1KA 2BAPA 1NWDA 3BUNB 5I2QA 3DQOA 4PHKA 1HT9A 4W6DA 1EMCA 3GJ1A 3EVUA 2AWKA 1DJHA 1DJYA 2KBMA 3TMTA 4OHSA 2L50A 1AJ4A 5HW9A 1SL9A 4W6CA 1AJ5A 3SG3A 1QX5B 1CTRA 3DD4A 4H3LA 3DVMA 4KGEA 2KLDA 2O24A 3D76A 3GK2A 1PVBA 3DQKA 4XL5A 2Z6ZA 5BT0A 2DOQA 1LXFC 1AUIB 1WRLA 1NX2A 4Q7RA 2QEVA 4USLA 2EMOA 3NXAA 1J7PA 1RK9A 2DUHA 4W6RA 1AK8A 4PPKA 1EMGA 3PFVA 2LP3A 1U5IA 5D3OA 1C4FA 5JJGA 5FYXA 4DXQA 1NP8A 3RWAA 1Z4HA 1RWYA 2ZFDA 2I7AA 3CWGA 2LV7A 2NCOA 5F6TA 4MN0A 1YVLA 3NEDA 1JWDA 2SCPA 3LVCA 5HKZA 3FWCA 3HCMA 1CMGA 2HQZA 1DGVA 5H88A 2F33A 3NT3A 4IZNA 1G7KA 3BUMB 1NCZA 3NF0A 4PPLA 1MUXA 3BUXB 3IF7A 4JKTA 3AKBA 1N0YA 5HKYA 2WNDA 2C9IA 2Q4UA 3B6XA 1CDPA 1B4CA 1Z1PA 3DQAA 4L12A 2F3YA 2OTEA 3OHMB 3SVBA 2FWQA 1A29A 1BF5A 2A4JA 2LLSA 3SG6A 1QV0A 1JUOA 5LTQA 2WHSA 2BECA 1UHJA 2FOTA 3N7HA 2K7DA 5HL1A 1BT6A 3EKJA 2YDZA 4ZINA 3SV5A 1Z1QA 1Q73A 5EXUA 1R6PA 1XA9A 4OVNF 1B7TZ 2HGDA 3QMEA 4GESB 3JVTB 1UHNA 1F09A 2K7CA 1CM1A 1DJZA 4W7XA 2PXWA 1XFYO 2D8NA 4NDCA 1QYQA 5KTGA 1Q4DA 3SRYA 1ZUXA 2MHHA 1B9AA 4P2YB 1YFPA 1KYRA
chains in the Genus database with same CATH topology
1QX2A 1EXRA 1V1FA 2BE4A 3LF4B 1KFXL 2V4EC 2BCAA 4J88A 2KFFA 1QJTA 1NCYA 1TIZA 2M7LA 1K2HA 4H3MA 4YGAA 3VHTB 3CB9A 3SVOA 4M2PA 1NPQA 5DPHA 2LUXA 4Q04A 1ALWA 1KWOB 4J8AA 2L98A 3BQ3A 5CPVA 1YX8A 3EVVA 5AXIA 2P4MA 2A54B 1DJWA 2RH7A 4AS8A 4IL1A 1K90D 3DQ9A 1B7TY 1CDLA 2LLTA 4W7CA 1XO5A 2F2PA 1QX7A 1KK8C 2M29A 4ZIOA 1PVAA 3DQ8A 2G9BA 1UUSA 3VROA 1BJFA 4LJBA 2C9JA 2JQ6A 1EMAA 2JNXA 1TNXA 3ST4A 1CM4A 3U8AA 4N1GA 1LVCD 4R6DA 1QS7A 2LUCA 3OSRA 1YHIA 3C1VA 2V4EB 4P5OE 4D1EA 1M31A 3GJ2A 1RMOA 1WLMA 1J7RA 4GGFA 2LVKA 3A4UB 1DF0B 1B47A 1NX3A 4N3DA 1ZMZA 4XYNA 2H6VA 3E5TA 1FF1A 2YE1A 5ER4X 3I5HB 3DQCA 5EXCI 4I2YA 1OQPA 5HBDA 4JGEA 4HQ8A 4HRHA 2CT9A 2LHIA 1EH2A 5LTRA 3DQ2A 4LJDA 3K21A 4MZKA 1YUUA 1OMRA 1QASA 1EMBA 2K0JA 2JRFA 1IKUA 4W6AA 1QXTA 3CBEA 2VAEA 2OTBA 1JFJA 4Z4MA 2ZRTA 3SG7A 1CV7A 2LM5A 4ORAB 3AAKA 1CB1A 4M2OA 5DRFA 2BCXA 3KEVA 2JU0A 3SSVA 2KI4C 3VRRA 1K94A 4I5JA 5DQMA 5TNCA 3LVAA 1XK4C 3RLZA 5DU0A 4JWQA 2VZXA 2G6YA 3AAJA 2AMIA 4GOBA 1K93D 2O29A 4PCWA 3VICA 1S6IA 2ARLA 1QTXA 3ZUFA 2ZNDA 1H4BA 1KYSA 5D69A 1PSRA 1LINA 4JPZB 3EVPA 2QLGA 1LA0A 4BY4A 2JULA 3TDUA 2MA2A 2A52B 2I18A 3DQMA 4LQUA 3AI5A 2P6BB 1SPYA 4CPVA 4GUKA 1Q80A 4MLWA 1QVIZ 2GGMA 1XFUO 1C7VA 3DQEA 1ZGPA 4WRIA 4N1FA 2VVJA 2VVIA 1UURA 2ZRSA 2JC2A 2G3OA 3CFHA 3OX5A 2HFCA 1YUTA 2KI4B 2DUEA 1PK0D 1HUYA 3TMRA 1G4YR 2DDCA 4LJDC 2L4IA 5AQBB 5BTTA 1A75B 2HGYA 1G8IA 2CCMA 2GGZA 1RROA 4AOMA 4AQJA 3ICBA 1CDNA 4W77A 2NXQA 3DQDA 1JF2A 3SVRA 2BBMA 3SSYA 1PULA 1FW4A 2IB5A 5CSFA 1Y0VH 2PALA 3BOWA 1IQ3A 2A50B 1NYAA 1SK6D 3M0WA 3G9AA 3PIBA 1OXEA 2PSRA 4W6IA 1TCOB 2JWWA 1PSBA 3CD9A 1C07A 3AKOA 3CZTX 2LVIA 3BXAA 4MEWA 3NSOA 2B1UA 5I2LA 1BMOA 2MBXA 2OTGC 3I19A 4EDSA 3SSKA 2BKHB 5HGEA 1ZUZA 1M46A 1KQVA 5CSNA 1XVJA 3ST0A 4ZF4A 3W1DA 3CFAA 4WQ2A 2Z6YA 2JNFA 2WHUA 1WY9A 2QLHA 4DXIA 1RMMA 1H6RA 1CLBA 1SBJA 4GPLB 3NSLA 4W6SA 2R2IA 2H5OA 2KGBC 3A8RA 2JADA 4DKMA 2ZKMX 1AHRA 2G16B 4M2QA 4L13A 1HQVA 5DPJA 1M45A 4XOVA 3TUYC 1KK7Z 5DTYA 4Q7UA 1RMPA 4OQWA 3ZTFA 2POXA 1B8RA 5D7FA 4MBEA 4LQTA 2ZNEA 2EMDA 3DQ6A 2F8PA 2A56B 3DPZA 3KO0A 3UG0A 2M1KB 2PMYA 2EC6B 1G33A 4XOWA 2AH8A 1K8UA 1EMEA 1GGZA 1BFPA 2RGIA 2CBLA 2H5PA 4NDDA 3M24A 1IJ6A 1QLSA 2BE6A 2MLEC 2DD7A 2VADA 1LA3A 2F3ZA 3SJSA 3JTDC 1JBYA 4HE4A 4KPIA 2YE0A 3LSAA 1OMVA 4KAGA 2DUFA 2ZMUA 2Y5IA 1PALA 1B8CA 3SVSA 2ZO7A 3DQFA 1JBZA 1DF0A 3TZ1A 3D0YA 4NDBA 3TUYB 1K9KA 5I2OA 2MJWB 2QT2A 3DF0B 1WRZA 1F55A 5FVIA 2H9WA 1QIWA 3I5GC 1L2OC 2ICRA 5IBWA 1NX0A 2WIQA 2KQYA 2KAXA 4GBAA 4KGFA 2F2OA 4B30B 4DIRA 2L51A 3DQ7A 4LW5A 4W6MA 1JFKA 1ZACA 1ALVA 4EULA 4MSPA 2IB6A 1MOUA 1ODBA 4DKNA 4RTCA 1YR5A 4KEXA 2BL0C 1DJIA 5CSIA 3BUWB 1BOCA 4UTSA 3JTDB 2JXCA 4MZLA 3VRPA 3QRXA 2BTJA 1NUBA 5J3XA 2QLEA 5FVFA 4ZBLA 4W7AA 2KHNA 2O2BA 1NX1A 3CD1A 2QLIA 2QRFA 4BY5A 3DQHA 4EDOA 2HPWA 3OB1B 3E5WA 1YRTB 4W6KA 3LF3A 3PN7C 1ZOTB 1RRXA 2IOVA 2OKWA 4W7EA 4W74A 4C0JA 1ZGQA 1X02A 3CR5X 5AANA 4W6PA 4WQ3A 2A46A 2Y0GA 4OR9B 1F8HA 3CR2A 1L2OB 3WHTB 4DXOA 5DKNA 1QLKA 4PE7A 4OCIA 1JBAA 2L0PA 2CXJA 1B8LA 2LMTA 4W6FA 2JPTA 2IE2A 3PJ7A 2LC5A 1UISA 1QXPA 1S6ZA 2IS9A 1DVIA 3MSEB 2BL0B 1NIWA 2KYFA 1KFUS 3CFFA 3U0KA 4Q9XA 1MXEA 1BR4B 3DPWA 2OJKA 1MF8B 2KSPA 1TOPA 4YBHB 4ZF5A 4R1EA 3SVUA 1A75A 2L2EA 4YI9A 5K89A 5B8IB 1KQMC 2O5GA 1Q4AA 1D1OA 4IK1A 2OS8C 3BXKA 1EMLA 3M22A 3PN7B 5AFPA 4JQ0D 1S5GZ 1AVSA 3CGLA 2LANA 1ZGOA 1S36A 2Z6XA 4JF9A 4ORBB 5FVGA 3WLCA 1SKTA 1U5IB 1QY3A 3H1RA 3CTNA 5HZTA 1S3PA 4Q9WA 1DJXA 3EKHA 2G6EA 1KP5A 2WOSA 3H1OA 3EK8A 4Q7TA 1GGWA 1QYOA 3EVRA 2JT8A 4QJ4B 3IP2A 3P8UA 1MR8A 3GK1A 2WSNA 1EJ3A 2G3DB 3SSPA 1CMFA 2JOJA 4KW8A 4YGDB 4OGSA 2G5ZB 1ZFSA 1KK8B 2FL1A 3PLFB 4GFTA 1A03A 2TN4A 2KQ6A 1RECA 4KW4A 3LL8B 5CSJA 1FI6A 1MYWA 4W76A 3FIAA 4B5YA 2WURA 2QU1A 1H8BA 4HQCA 2GX2A 4W6JA 4JEOA 1S5GY 4DS7A 2B3QA 4TZGA 2KNEA 2M7NA 5BQLA 3DQ5A 1F71A 3S05A 4E68A 3DQJA 5DTXA 4W69A 2WCEA 2Q91A 2ZO6A 1A2XA 2KGRA 2JZIA 4W7RA 5DPIA 2PXSA 1DT7B 3O78A 2Y1MA 1SYMA 2HQWA 2PASA 3DPXA 4IK5A 5KTYA 1TN4A 1B9CA 3ST3A 3LLEA 4H47A 3WHUB 4J89A 1SY9A 1E8AA 4DRWA 4HQ9A 2H61A 5FHVA 3HX4A 3E5VA 2Q6PA 4KF5A 5DTZA 3SIBA 2WCBA 4IK8A 2OPOA 4YI8A 1QYFA 1CLLA 1SL8A 5HZSA 4FTGA 4GGFC 2AAOA 4W7DA 1Q4BA 3SIAA 1L7ZA 3OGOA 2I94A 2Z1OA 2M9GA 4HVFA 2LAPA 4MRXA 1MOVA 1GL4A 2K61A 2H5RA 4MZJA 2G2SB 4ZFSA 1KCYA 2NCPA 3DF0A 2PRUA 4ORNA 1KFUL 2LP2A 4JRBA 1YX7A 3DQ1A 4YGCB 1CDMA 4PHNA 2KFGA 3DQUA 3SSLA 4C0LA 1V1GA 2MLFC 3KHEA 2JTTA 2CNPA 4RYWA 4JC2A 4B30A 5I8NA 1J1DA 5ER5A 4CFQA 5HZUA 1BR1B 1UWOA 1N65A 1F4OA 1CFFA 1RFJA 1YJFA 3LA1A 1QVIY 4IK4A 2EHBA 2HQKA 2H8QA 1JC1A 1NCXA 2WC8A 4P1QA 1Y1XA 1J7OA 3WXAA 1XQMA 4IK9A 1GJYA 2EGDA 1BG1A 5DPGA 4PDZA 2M3WA 3SVEA 3H4SE 4ETOA 1TNPA 2WORA 4PALA 1EG4A 4DUQA 3PALA 1SMGA 4ANJA 3LK1A 2JT0A 4A4CA 1SR6C 1S26D 2VRGA 2HF5A 2E6WA 4Z4KA 2OGRA 1S1EA 4ZF3A 2PVBA 3ZNIA 1K96A 3UFZA 3GK4X 3VHTA 2AWMA 1RM9A 1F4QA 3VK1A 1EMFA 1W7IB 4HSZA 4C0KA 3NT9A 1OXFA 3PSRA 4PE4A 1UHKA 1EG3A 1W7UA 1JC0A 4QJ5B 1WLZA 2O60A 1IRJA 1CFCA 4N5XA 4PHMA 2AWJA 1S6JA 1KSOA 1W7JB 3ADFA 3VRQA 3RWTA 4A4BA 1SCVA 1R2UA 4YRUA 2OTGB 2HETA 3KCSA 3I5IC 1H4UA 4W6HA 1OMDA 4ZCVA 3WCKA 3SSHA 3TDIA 2QLGB 4XGYA 4XVPA 4W6TA 2NZ0A 3O2PA 2AHAA 1SR6B 2JXLA 2V4EA 2GW4B 3KPXA 3LK0A 2ZMWA 4CIDA 2HJOA 1KSMA 4F0ZB 2K8MB 1HCJA 5EXBA 3JVTC 2LLUA 2L5XB 1EMMA 5DKQA 2I2RE 4DCKA 1GQMA 5JOLA 1KK7Y 1F0BA 1JC2A 1MXLC 2Q57A 3O6BA 1FI5A 3ZWHA 1YURA 3RM1A 1OSAA 3EK7A 2OKYA 2LVJA 2V53A 3O4YA 4XJKB 2M1UA 3EK4A 5GQQC 3VGOA 3DVEA 2A48A 2H5QA 5BTTB 3A8SA 3GL4A 4DXMA 1TRFA 4CFRA 2L4HA 5J2OA 1GFLA 3ZUJA 2ZN8A 3I5IB 2KDHA 1OE9B 1WRKA 3I5FC 2FJUB 1QATA 3BUOB 1SW8A 1YRUB 4I5KA 4PE0A 2QPTA 2AWLA 4MRYA 3U0LA 4ZB1A 5DKRA 1KWOC 1SRAA 4DXPA 5HKWA 1B1GA 1J1EA 3BOWB 2LNKA 5EB7A 2KBIA 1CNPA 4L9MA 4EN1A 4I5LB 2K2AA 4YGBB 1XA5A 5G08A 1XFZO 5AEQA 4EMQA 2KYCA 3OX6A 1XFVO 2HPSA 4PPJA 2KI6C 4W6LA 2EMNA 5KSZA 1GGXA 3F45A 1XFXO 3BX9A 2DUIA 4GAOA 3AI4A 1F70A 1Q4CA 1W7SA 3I5GB 2ZN9A 3SS0A 4ORCB 5LK4A 4R6BA 1EMKA 3GEXA 4GGNA 5F9GA 2QACA 2MAZA 1MQ1A 1WDCC 2GW3A 2LMUA 1W7TA 3AKAA 2H2KA 3SVNA 2FCDA 1DTLA 5KU1A 3I5FB 3E3RA 4OKHA 1YUSA 1C7WA 4FQOA 5H87A 1XFWO 3I5HC 3PJ5A 2BKIB 1BU3A 1OZSA 4PHJA 1XK4A 3CR4X 2KI6D 2K7BA 2LHLA 4NQGA 3LS3A 2K2FA 1VRKA 3WNXB 1Y1UA 4GNKB 1XYDA 1YTZC 1CKKA 3DQNA 4BDUA 1FBVA 3WLDA 3CS1A 1SL7A 4DXNA 3O77A 5EB6A 1CFDA 1IH0A 2KFHA 1DJGA 2COLB 3U8CA 3D10A 4H3NA 1TNQA 2FZUA 2BBNA 4PE1A 5EHUA 3DQ3A 4U8DA 2DDDA 1PRWA 3DVJA 4TNCA 2A53B 2LMVA 3VRNA 1XAEA 2BCBA 1WDCB 1MHOA 1UHHA 1SNLA 1M39A 1QIVA 3BXCA 2VVHA 1F54A 3D0YB 5AERA 3TS5C 4KW9A 1CLMA 4I5NB 2B3PA 3KF9A 3U8PA 1S6CA 1M63B 2QZ0A 2M0RA 1FPWA 4W6NA 5T3IA 2JTZA 4AQIA 1KQMB 4ZCUA 5LTPA 2DUGA 1K9UA 1BLQA 3W1CA 4HREE 2JT3A 2OS8B 4ICBA 4RYSA 4W75A 3SG4A 4U2VA 2NLNA 4PFEA 1OXDA 1UHIA 5BPJA 1RJVA 3U0NA 3SVDA 1J7QA 5HLVA 2M97A 1IQ5A 2ISDA 4OY4A 2HRSA 1QV1A 3BXBA 4QJ3B 3LVDA 3DVKA 1Y1AA 3GB3A 3IQQA 2A47A 1AP4A 1YHHA 1YZWA 4IK3A 1JSAA 2KAYA 3TS5B 2WISA 2G6XA 3LCPC 3TDZA 1Y6WA 4W72A 4OJ0A 5HZOA 4W6GA 3ED8A 4GF6B 5H89A 1JF0A 2KAVA 5HLOA 4UPGA 2WSOA 1J55A 4NWSA 1A4PA 3GOFA 3SG5A 3FS7A 1BODA 1OZOA 3DQ4A 2K7OA 4MVFA 1RTP1 1K9PA 1NSHA 3PM8A 5DQBA 4L1IA 4W6OA 1UP5A 3CLNA 2M8UA 2M49B 3MGFA 3DQLA 1IGVA 2LVVA 3IR8A 3PJBA 2DD9A 4HRGA 1YVHA 4YGEB 1MWNA 3FWBA 1YHGA 4XJKA 5EBJA 1SCMC 2WHTA 1EL4A 1Q4EA 2CTNA 2LE9B 5EJUA 3SG2A 1TNWA 5PALA 4W73A 3U0MA 4H48A 1LKJA 2WCFA 4AR7A 3NEZA 1KYPA 5DTLA 1K95A 1CFPA 3NSIA 2KOTA 1DMOA 2LCPA 1TTXA 2MRDA 1XSSA 3V3DA 2AUCA 2G2BA 1IJ5A 1TCFA 3DQIA 2Y4QA 5DRGA 3KCTA 4LJCA 5DY6A 2EC6C 4KA9A 4CLNA 4JFGA 2HCGA 3ZULA 4OV2A 3P28A 3ST2A 1IWQA 2H61C 4W6BA 4TZAA 1KFXS 2E30A 1DGUA 3PATA 3SVCA 3NSKA 4P76A 2SASA 2GX0A 1XMZA 1N2DA 4KF5C 3IQOA 1SCMB 2Y1NA 5HYDA 2YFPA 1IG5A 4W7FA 2GV5A 4W6UA 3CGAA 3OP0A 2FCEA 2HQ8A 1YJ2A 3OB2B 1OOJA 3BYAA 3OSQA 3SSTA 4KF4A 3K1KA 1NWDA 3BUNB 5I2QA 3DQOA 4PHKA 1HT9A 4W6DA 1EMCA 3GJ1A 3EVUA 2AWKA 1DJHA 1DJYA 2KBMA 3TMTA 4OHSA 2L50A 1AJ4A 5HW9A 1SL9A 4W6CA 1AJ5A 3SG3A 1QX5B 1CTRA 3DD4A 4H3LA 3DVMA 4KGEA 2O24A 3GK2A 1PVBA 3DQKA 4XL5A 2Z6ZA 5BT0A 2DOQA 1LXFC 1AUIB 1WRLA 1NX2A 4Q7RA 4USLA 2EMOA 3NXAA 1J7PA 1RK9A 2DUHA 4W6RA 1AK8A 4PPKA 1EMGA 3PFVA 2LP3A 1U5IA 1C4FA 5JJGA 5FYXA 4DXQA 1NP8A 3RWAA 1RWYA 2ZFDA 2I7AA 3CWGA 2LV7A 2NCOA 5F6TA 4MN0A 1YVLA 3NEDA 1JWDA 2SCPA 3LVCA 5HKZA 3FWCA 3HCMA 1CMGA 2HQZA 1DGVA 5H88A 2F33A 3NT3A 4IZNA 1G7KA 3BUMB 1NCZA 3NF0A 4PPLA 1MUXA 3BUXB 3IF7A 3AKBA 1N0YA 5HKYA 2WNDA 2C9IA 2Q4UA 1B4CA 1CDPA 1Z1PA 3DQAA 4L12A 2F3YA 2OTEA 3OHMB 3SVBA 2FWQA 1A29A 1BF5A 2A4JA 2LLSA 3SG6A 1QV0A 1JUOA 5LTQA 2WHSA 2BECA 1UHJA 2FOTA 2K7DA 1BT6A 3EKJA 2YDZA 4ZINA 3SV5A 1Z1QA 1Q73A 5EXUA 1R6PA 1XA9A 4OVNF 1B7TZ 2HGDA 4GESB 3JVTB 1UHNA 1F09A 2K7CA 1CM1A 1DJZA 4W7XA 2PXWA 1XFYO 2D8NA 4NDCA 1QYQA 5KTGA 1Q4DA 3SRYA 1ZUXA 2MHHA 1B9AA 4P2YB 1YFPA 1KYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QX2 A;  1EXR A;  1V1F A;  2BE4 A;  3LF4 B;  1KFX L;  2V4E C;  2BCA A;  4J88 A;  2KFF A;  1QJT A;  1NCY A;  1TIZ A;  2M7L A;  1K2H A;  4H3M A;  4YGA A;  3VHT B;  3CB9 A;  3SVO A;  4M2P A;  1NPQ A;  5DPH A;  2LUX A;  4Q04 A;  1ALW A;  1KWO B;  4J8A A;  2L98 A;  3BQ3 A;  5CPV A;  1YX8 A;  3EVV A;  5AXI A;  2P4M A;  2A54 B;  1DJW A;  2RH7 A;  4AS8 A;  4IL1 A;  1K90 D;  3DQ9 A;  1B7T Y;  1CDL A;  2LLT A;  4W7C A;  1XO5 A;  2F2P A;  1QX7 A;  1KK8 C;  2M29 A;  4ZIO A;  1PVA A;  3DQ8 A;  2G9B A;  1UUS A;  3VRO A;  1BJF A;  4LJB A;  2C9J A;  2JQ6 A;  1EMA A;  2JNX A;  1TNX A;  3ST4 A;  1CM4 A;  3U8A A;  4N1G A;  1LVC D;  4R6D A;  1QS7 A;  2LUC A;  3OSR A;  1YHI A;  3C1V A;  2V4E B;  4P5O E;  4D1E A;  1M31 A;  3GJ2 A;  1RMO A;  1WLM A;  1J7R A;  4GGF A;  2LVK A;  3A4U B;  1DF0 B;  1B47 A;  1NX3 A;  4N3D A;  1ZMZ A;  4XYN A;  2H6V A;  3E5T A;  1FF1 A;  2YE1 A;  5ER4 X;  3I5H B;  3DQC A;  5EXC I;  4I2Y A;  1OQP A;  5HBD A;  4JGE A;  4HQ8 A;  4HRH A;  2CT9 A;  2LHI A;  1EH2 A;  5LTR A;  3DQ2 A;  4LJD A;  3K21 A;  4MZK A;  1YUU A;  1OMR A;  1QAS A;  1EMB A;  2K0J A;  2JRF A;  1IKU A;  4W6A A;  1QXT A;  3CBE A;  2VAE A;  2OTB A;  1JFJ A;  4Z4M A;  2ZRT A;  3SG7 A;  1CV7 A;  2LM5 A;  4ORA B;  3AAK A;  1CB1 A;  4M2O A;  5DRF A;  2BCX A;  3KEV A;  2JU0 A;  3SSV A;  2KI4 C;  3VRR A;  1K94 A;  4I5J A;  5DQM A;  5TNC A;  3LVA A;  1XK4 C;  3RLZ A;  5DU0 A;  4JWQ A;  2VZX A;  2G6Y A;  3AAJ A;  2AMI A;  4GOB A;  1K93 D;  2O29 A;  4PCW A;  3VIC A;  1S6I A;  2ARL A;  1QTX A;  3ZUF A;  2ZND A;  1H4B A;  1KYS A;  5D69 A;  1PSR A;  1LIN A;  4JPZ B;  3EVP A;  2QLG A;  1LA0 A;  4BY4 A;  2JUL A;  3TDU A;  2MA2 A;  2A52 B;  2I18 A;  3DQM A;  4LQU A;  3AI5 A;  2P6B B;  1SPY A;  4CPV A;  4GUK A;  1Q80 A;  4MLW A;  1QVI Z;  2GGM A;  1XFU O;  1C7V A;  3DQE A;  1ZGP A;  4WRI A;  4N1F A;  2VVJ A;  2VVI A;  1UUR A;  2ZRS A;  2JC2 A;  2G3O A;  3CFH A;  3OX5 A;  2HFC A;  1YUT A;  2KI4 B;  2DUE A;  1PK0 D;  1HUY A;  3TMR A;  1G4Y R;  2DDC A;  4LJD C;  2L4I A;  5AQB B;  5BTT A;  1A75 B;  2HGY A;  1G8I A;  2CCM A;  2GGZ A;  1RRO A;  4AOM A;  4AQJ A;  3ICB A;  1CDN A;  4W77 A;  2NXQ A;  3DQD A;  1JF2 A;  3SVR A;  2BBM A;  3SSY A;  1PUL A;  1FW4 A;  2IB5 A;  5CSF A;  1Y0V H;  2PAL A;  3BOW A;  1IQ3 A;  2A50 B;  1NYA A;  1SK6 D;  3M0W A;  3G9A A;  3PIB A;  1OXE A;  2PSR A;  4W6I A;  1TCO B;  2JWW A;  1PSB A;  3CD9 A;  1C07 A;  3AKO A;  3CZT X;  2LVI A;  3BXA A;  4MEW A;  3NSO A;  2B1U A;  5I2L A;  1BMO A;  2MBX A;  2OTG C;  3I19 A;  4EDS A;  3SSK A;  2BKH B;  5HGE A;  1ZUZ A;  1M46 A;  1KQV A;  5CSN A;  1XVJ A;  3ST0 A;  4ZF4 A;  3W1D A;  3CFA A;  4WQ2 A;  2Z6Y A;  2JNF A;  2WHU A;  1WY9 A;  2QLH A;  4DXI A;  1RMM A;  1H6R A;  1CLB A;  1SBJ A;  4GPL B;  3NSL A;  4W6S A;  2R2I A;  2H5O A;  2KGB C;  3A8R A;  2JAD A;  4DKM A;  2ZKM X;  1AHR A;  2G16 B;  4M2Q A;  4L13 A;  1HQV A;  5DPJ A;  1M45 A;  4XOV A;  3TUY C;  1KK7 Z;  5DTY A;  4Q7U A;  1RMP A;  4OQW A;  3ZTF A;  2POX A;  1B8R A;  5D7F A;  4MBE A;  4LQT A;  2ZNE A;  2EMD A;  3DQ6 A;  2F8P A;  2A56 B;  3DPZ A;  3KO0 A;  3UG0 A;  2M1K B;  2PMY A;  2EC6 B;  1G33 A;  4XOW A;  2AH8 A;  1K8U A;  1EME A;  1GGZ A;  1BFP A;  2RGI A;  2CBL A;  2H5P A;  4NDD A;  3M24 A;  1IJ6 A;  1QLS A;  2BE6 A;  2MLE C;  2DD7 A;  2VAD A;  1LA3 A;  2F3Z A;  3SJS A;  3JTD C;  1JBY A;  4HE4 A;  4KPI A;  2YE0 A;  3LSA A;  1OMV A;  4KAG A;  2DUF A;  2ZMU A;  2Y5I A;  1PAL A;  1B8C A;  3SVS A;  2ZO7 A;  3DQF A;  1JBZ A;  1DF0 A;  3TZ1 A;  3D0Y A;  4NDB A;  3TUY B;  1K9K A;  5I2O A;  2MJW B;  2QT2 A;  3DF0 B;  1WRZ A;  1F55 A;  5FVI A;  2H9W A;  1QIW A;  3I5G C;  1L2O C;  2ICR A;  5IBW A;  1NX0 A;  2WIQ A;  2KQY A;  2KAX A;  4GBA A;  4KGF A;  2F2O A;  4B30 B;  4DIR A;  2L51 A;  3DQ7 A;  4LW5 A;  4W6M A;  1JFK A;  1ZAC A;  1ALV A;  4EUL A;  4MSP A;  2IB6 A;  1MOU A;  1ODB A;  4DKN A;  4RTC A;  1YR5 A;  4KEX A;  2BL0 C;  1DJI A;  5CSI A;  3BUW B;  1BOC A;  4UTS A;  3JTD B;  2JXC A;  4MZL A;  3VRP A;  3QRX A;  2BTJ A;  1NUB A;  5J3X A;  2QLE A;  5FVF A;  4ZBL A;  4W7A A;  2KHN A;  2O2B A;  1NX1 A;  3CD1 A;  2QLI A;  2QRF A;  4BY5 A;  3DQH A;  4EDO A;  2HPW A;  3OB1 B;  3E5W A;  1YRT B;  4W6K A;  3LF3 A;  3PN7 C;  1ZOT B;  1RRX A;  2IOV A;  2OKW A;  4W7E A;  4W74 A;  4C0J A;  1ZGQ A;  1X02 A;  3CR5 X;  5AAN A;  4W6P A;  4WQ3 A;  2A46 A;  2Y0G A;  4OR9 B;  1F8H A;  3CR2 A;  1L2O B;  3WHT B;  4DXO A;  5DKN A;  1QLK A;  4PE7 A;  4OCI A;  1JBA A;  2L0P A;  2CXJ A;  1B8L A;  2LMT A;  4W6F A;  2JPT A;  2IE2 A;  3PJ7 A;  2LC5 A;  1UIS A;  1QXP A;  1S6Z A;  2IS9 A;  1DVI A;  3MSE B;  2BL0 B;  1NIW A;  2KYF A;  1KFU S;  3CFF A;  3U0K A;  4Q9X A;  1MXE A;  1BR4 B;  3DPW A;  2OJK A;  1MF8 B;  2KSP A;  1TOP A;  4YBH B;  4ZF5 A;  4R1E A;  3SVU A;  1A75 A;  2L2E A;  4YI9 A;  5K89 A;  5B8I B;  1KQM C;  2O5G A;  1Q4A A;  1D1O A;  4IK1 A;  2OS8 C;  3BXK A;  1EML A;  3M22 A;  3PN7 B;  5AFP A;  4JQ0 D;  1S5G Z;  1AVS A;  3CGL A;  2LAN A;  1ZGO A;  1S36 A;  2Z6X A;  4JF9 A;  4ORB B;  5FVG A;  3WLC A;  1SKT A;  1U5I B;  1QY3 A;  3H1R A;  3CTN A;  5HZT A;  1S3P A;  4Q9W A;  1DJX A;  3EKH A;  2G6E A;  1KP5 A;  2WOS A;  3H1O A;  3EK8 A;  4Q7T A;  1GGW A;  1QYO A;  3EVR A;  2JT8 A;  4QJ4 B;  3IP2 A;  3P8U A;  1MR8 A;  3GK1 A;  2WSN A;  1EJ3 A;  2G3D B;  3SSP A;  1CMF A;  2JOJ A;  4KW8 A;  4YGD B;  4OGS A;  2G5Z B;  1ZFS A;  1KK8 B;  2FL1 A;  3PLF B;  4GFT A;  1A03 A;  2TN4 A;  2KQ6 A;  1REC A;  4KW4 A;  3LL8 B;  5CSJ A;  1FI6 A;  1MYW A;  4W76 A;  3FIA A;  4B5Y A;  2WUR A;  2QU1 A;  1H8B A;  4HQC A;  2GX2 A;  4W6J A;  4JEO A;  1S5G Y;  4DS7 A;  2B3Q A;  4TZG A;  2KNE A;  2M7N A;  5BQL A;  3DQ5 A;  1F71 A;  3S05 A;  4E68 A;  3DQJ A;  5DTX A;  4W69 A;  2WCE A;  2Q91 A;  2ZO6 A;  1A2X A;  2KGR A;  2JZI A;  4W7R A;  5DPI A;  2PXS A;  1DT7 B;  3O78 A;  2Y1M A;  1SYM A;  2HQW A;  2PAS A;  3DPX A;  4IK5 A;  5KTY A;  1TN4 A;  1B9C A;  3ST3 A;  3LLE A;  4H47 A;  3WHU B;  4J89 A;  1SY9 A;  1E8A A;  4DRW A;  4HQ9 A;  2H61 A;  5FHV A;  3HX4 A;  3E5V A;  2Q6P A;  4KF5 A;  5DTZ A;  3SIB A;  2WCB A;  4IK8 A;  2OPO A;  4YI8 A;  1QYF A;  1CLL A;  1SL8 A;  5HZS A;  4FTG A;  4GGF C;  2AAO A;  4W7D A;  1Q4B A;  3SIA A;  1L7Z A;  3OGO A;  2I94 A;  2Z1O A;  2M9G A;  4HVF A;  2LAP A;  4MRX A;  1MOV A;  1GL4 A;  2K61 A;  2H5R A;  4MZJ A;  2G2S B;  4ZFS A;  1KCY A;  2NCP A;  3DF0 A;  2PRU A;  4ORN A;  1KFU L;  2LP2 A;  4JRB A;  1YX7 A;  3DQ1 A;  4YGC B;  1CDM A;  4PHN A;  2KFG A;  3DQU A;  3SSL A;  4C0L A;  1V1G A;  2MLF C;  3KHE A;  2JTT A;  2CNP A;  4RYW A;  4JC2 A;  4B30 A;  5I8N A;  1J1D A;  5ER5 A;  4CFQ A;  5HZU A;  1BR1 B;  1UWO A;  1N65 A;  1F4O A;  1CFF A;  1RFJ A;  1YJF A;  3LA1 A;  1QVI Y;  4IK4 A;  2EHB A;  2HQK A;  2H8Q A;  1JC1 A;  1NCX A;  2WC8 A;  4P1Q A;  1Y1X A;  1J7O A;  3WXA A;  1XQM A;  4IK9 A;  1GJY A;  2EGD A;  1BG1 A;  5DPG A;  4PDZ A;  2M3W A;  3SVE A;  3H4S E;  4ETO A;  1TNP A;  2WOR A;  4PAL A;  1EG4 A;  4DUQ A;  3PAL A;  1SMG A;  4ANJ A;  3LK1 A;  2JT0 A;  4A4C A;  1SR6 C;  1S26 D;  2VRG A;  2HF5 A;  2E6W A;  4Z4K A;  2OGR A;  1S1E A;  4ZF3 A;  2PVB A;  3ZNI A;  1K96 A;  3UFZ A;  3GK4 X;  3VHT A;  2AWM A;  1RM9 A;  1F4Q A;  3VK1 A;  1EMF A;  1W7I B;  4HSZ A;  4C0K A;  3NT9 A;  1OXF A;  3PSR A;  4PE4 A;  1UHK A;  1EG3 A;  1W7U A;  1JC0 A;  4QJ5 B;  1WLZ A;  2O60 A;  1IRJ A;  1CFC A;  4N5X A;  4PHM A;  2AWJ A;  1S6J A;  1KSO A;  1W7J B;  3ADF A;  3VRQ A;  3RWT A;  4A4B A;  1SCV A;  1R2U A;  4YRU A;  2OTG B;  2HET A;  3KCS A;  3I5I C;  1H4U A;  4W6H A;  1OMD A;  4ZCV A;  3WCK A;  3SSH A;  3TDI A;  2QLG B;  4XGY A;  4XVP A;  4W6T A;  2NZ0 A;  3O2P A;  2AHA A;  1SR6 B;  2JXL A;  2V4E A;  2GW4 B;  3KPX A;  3LK0 A;  2ZMW A;  4CID A;  2HJO A;  1KSM A;  4F0Z B;  2K8M B;  1HCJ A;  5EXB A;  3JVT C;  2LLU A;  2L5X B;  1EMM A;  5DKQ A;  2I2R E;  4DCK A;  1GQM A;  5JOL A;  1KK7 Y;  1F0B A;  1JC2 A;  1MXL C;  2Q57 A;  3O6B A;  1FI5 A;  3ZWH A;  1YUR A;  3RM1 A;  1OSA A;  3EK7 A;  2OKY A;  2LVJ A;  2V53 A;  3O4Y A;  4XJK B;  2M1U A;  3EK4 A;  5GQQ C;  3VGO A;  3DVE A;  2A48 A;  2H5Q A;  5BTT B;  3A8S A;  3GL4 A;  4DXM A;  1TRF A;  4CFR A;  2L4H A;  5J2O A;  1GFL A;  3ZUJ A;  2ZN8 A;  3I5I B;  2KDH A;  1OE9 B;  1WRK A;  3I5F C;  2FJU B;  1QAT A;  3BUO B;  1SW8 A;  1YRU B;  4I5K A;  4PE0 A;  2QPT A;  2AWL A;  4MRY A;  3U0L A;  4ZB1 A;  5DKR A;  1KWO C;  1SRA A;  4DXP A;  5HKW A;  1B1G A;  1J1E A;  3BOW B;  2LNK A;  5EB7 A;  2KBI A;  1CNP A;  4L9M A;  4EN1 A;  4I5L B;  2K2A A;  4YGB B;  1XA5 A;  5G08 A;  1XFZ O;  5AEQ A;  4EMQ A;  2KYC A;  3OX6 A;  1XFV O;  2HPS A;  4PPJ A;  2KI6 C;  4W6L A;  2EMN A;  5KSZ A;  1GGX A;  3F45 A;  1XFX O;  3BX9 A;  2DUI A;  4GAO A;  3AI4 A;  1F70 A;  1Q4C A;  1W7S A;  3I5G B;  2ZN9 A;  3SS0 A;  4ORC B;  5LK4 A;  4R6B A;  1EMK A;  3GEX A;  4GGN A;  5F9G A;  2QAC A;  2MAZ A;  1MQ1 A;  1WDC C;  2GW3 A;  2LMU A;  1W7T A;  3AKA A;  2H2K A;  3SVN A;  2FCD A;  1DTL A;  5KU1 A;  3I5F B;  3E3R A;  4OKH A;  1YUS A;  1C7W A;  4FQO A;  5H87 A;  1XFW O;  3I5H C;  3PJ5 A;  2BKI B;  1BU3 A;  1OZS A;  4PHJ A;  1XK4 A;  3CR4 X;  2KI6 D;  2K7B A;  2LHL A;  4NQG A;  3LS3 A;  2K2F A;  1VRK A;  3WNX B;  1Y1U A;  4GNK B;  1XYD A;  1YTZ C;  1CKK A;  3DQN A;  4BDU A;  1FBV A;  3WLD A;  3CS1 A;  1SL7 A;  4DXN A;  3O77 A;  5EB6 A;  1CFD A;  1IH0 A;  2KFH A;  1DJG A;  2COL B;  3U8C A;  3D10 A;  4H3N A;  1TNQ A;  2FZU A;  2BBN A;  4PE1 A;  5EHU A;  3DQ3 A;  4U8D A;  2DDD A;  1PRW A;  3DVJ A;  4TNC A;  2A53 B;  2LMV A;  3VRN A;  1XAE A;  2BCB A;  1WDC B;  1MHO A;  1UHH A;  1SNL A;  1M39 A;  1QIV A;  3BXC A;  2VVH A;  1F54 A;  3D0Y B;  5AER A;  3TS5 C;  4KW9 A;  1CLM A;  4I5N B;  2B3P A;  3KF9 A;  3U8P A;  1S6C A;  1M63 B;  2QZ0 A;  2M0R A;  1FPW A;  4W6N A;  5T3I A;  2JTZ A;  4AQI A;  1KQM B;  4ZCU A;  5LTP A;  2DUG A;  1K9U A;  1BLQ A;  3W1C A;  4HRE E;  2JT3 A;  2OS8 B;  4ICB A;  4RYS A;  4W75 A;  3SG4 A;  4U2V A;  2NLN A;  4PFE A;  1OXD A;  1UHI A;  5BPJ A;  1RJV A;  3U0N A;  3SVD A;  1J7Q A;  5HLV A;  2M97 A;  1IQ5 A;  2ISD A;  4OY4 A;  2HRS A;  1QV1 A;  3BXB A;  4QJ3 B;  3LVD A;  3DVK A;  1Y1A A;  3GB3 A;  3IQQ A;  2A47 A;  1AP4 A;  1YHH A;  1YZW A;  4IK3 A;  1JSA A;  2KAY A;  3TS5 B;  2WIS A;  2G6X A;  3LCP C;  3TDZ A;  1Y6W A;  4W72 A;  4OJ0 A;  5HZO A;  4W6G A;  3ED8 A;  4GF6 B;  5H89 A;  1JF0 A;  2KAV A;  5HLO A;  4UPG A;  2WSO A;  1J55 A;  4NWS A;  1A4P A;  3GOF A;  3SG5 A;  3FS7 A;  1BOD A;  1OZO A;  3DQ4 A;  2K7O A;  4MVF A;  1RTP 1;  1K9P A;  1NSH A;  3PM8 A;  5DQB A;  4L1I A;  4W6O A;  1UP5 A;  3CLN A;  2M8U A;  2M49 B;  3MGF A;  3DQL A;  1IGV A;  2LVV A;  3IR8 A;  3PJB A;  2DD9 A;  4HRG A;  1YVH A;  4YGE B;  1MWN A;  3FWB A;  1YHG A;  4XJK A;  5EBJ A;  1SCM C;  2WHT A;  1EL4 A;  1Q4E A;  2CTN A;  2LE9 B;  5EJU A;  3SG2 A;  1TNW A;  5PAL A;  4W73 A;  3U0M A;  4H48 A;  1LKJ A;  2WCF A;  4AR7 A;  3NEZ A;  1KYP A;  5DTL A;  1K95 A;  1CFP A;  3NSI A;  2KOT A;  1DMO A;  2LCP A;  1TTX A;  2MRD A;  1XSS A;  3V3D A;  2AUC A;  2G2B A;  1IJ5 A;  1TCF A;  3DQI A;  2Y4Q A;  5DRG A;  3KCT A;  4LJC A;  5DY6 A;  2EC6 C;  4KA9 A;  4CLN A;  4JFG A;  2HCG A;  3ZUL A;  4OV2 A;  3P28 A;  3ST2 A;  1IWQ A;  2H61 C;  4W6B A;  4TZA A;  1KFX S;  2E30 A;  1DGU A;  3PAT A;  3SVC A;  3NSK A;  4P76 A;  2SAS A;  2GX0 A;  1XMZ A;  1N2D A;  4KF5 C;  3IQO A;  1SCM B;  2Y1N A;  5HYD A;  2YFP A;  1IG5 A;  4W7F A;  2GV5 A;  4W6U A;  3CGA A;  3OP0 A;  2FCE A;  2HQ8 A;  1YJ2 A;  3OB2 B;  1OOJ A;  3BYA A;  3OSQ A;  3SST A;  4KF4 A;  3K1K A;  1NWD A;  3BUN B;  5I2Q A;  3DQO A;  4PHK A;  1HT9 A;  4W6D A;  1EMC A;  3GJ1 A;  3EVU A;  2AWK A;  1DJH A;  1DJY A;  2KBM A;  3TMT A;  4OHS A;  2L50 A;  1AJ4 A;  5HW9 A;  1SL9 A;  4W6C A;  1AJ5 A;  3SG3 A;  1QX5 B;  1CTR A;  3DD4 A;  4H3L A;  3DVM A;  4KGE A;  2O24 A;  3GK2 A;  1PVB A;  3DQK A;  4XL5 A;  2Z6Z A;  5BT0 A;  2DOQ A;  1LXF C;  1AUI B;  1WRL A;  1NX2 A;  4Q7R A;  4USL A;  2EMO A;  3NXA A;  1J7P A;  1RK9 A;  2DUH A;  4W6R A;  1AK8 A;  4PPK A;  1EMG A;  3PFV A;  2LP3 A;  1U5I A;  1C4F A;  5JJG A;  5FYX A;  4DXQ A;  1NP8 A;  3RWA A;  1RWY A;  2ZFD A;  2I7A A;  3CWG A;  2LV7 A;  2NCO A;  5F6T A;  4MN0 A;  1YVL A;  3NED A;  1JWD A;  2SCP A;  3LVC A;  5HKZ A;  3FWC A;  3HCM A;  1CMG A;  2HQZ A;  1DGV A;  5H88 A;  2F33 A;  3NT3 A;  4IZN A;  1G7K A;  3BUM B;  1NCZ A;  3NF0 A;  4PPL A;  1MUX A;  3BUX B;  3IF7 A;  3AKB A;  1N0Y A;  5HKY A;  2WND A;  2C9I A;  2Q4U A;  1B4C A;  1CDP A;  1Z1P A;  3DQA A;  4L12 A;  2F3Y A;  2OTE A;  3OHM B;  3SVB A;  2FWQ A;  1A29 A;  1BF5 A;  2A4J A;  2LLS A;  3SG6 A;  1QV0 A;  1JUO A;  5LTQ A;  2WHS A;  2BEC A;  1UHJ A;  2FOT A;  2K7D A;  1BT6 A;  3EKJ A;  2YDZ A;  4ZIN A;  3SV5 A;  1Z1Q A;  1Q73 A;  5EXU A;  1R6P A;  1XA9 A;  4OVN F;  1B7T Z;  2HGD A;  4GES B;  3JVT B;  1UHN A;  1F09 A;  2K7C A;  1CM1 A;  1DJZ A;  4W7X A;  2PXW A;  1XFY O;  2D8N A;  4NDC A;  1QYQ A;  5KTG A;  1Q4D A;  3SRY A;  1ZUX A;  2MHH A;  1B9A A;  4P2Y B;  1YFP A;  1KYR A; 
#chains in the Genus database with same CATH topology
 3NHI A;  3R1O A;  1QX2 A;  1EXR A;  1V1F A;  2BE4 A;  3LF4 B;  1KFX L;  2V4E C;  2BCA A;  4J88 A;  2KFF A;  1QJT A;  1NCY A;  1TIZ A;  2M7L A;  1K2H A;  4H3M A;  1SSE B;  4YGA A;  3VHT B;  3CB9 A;  3SVO A;  4M2P A;  1NPQ A;  5DPH A;  2LUX A;  4Q04 A;  1ALW A;  1KWO B;  4J8A A;  2L98 A;  3BQ3 A;  5CPV A;  1YX8 A;  3EVV A;  5AXI A;  2P4M A;  2A54 B;  1DJW A;  2RH7 A;  4AS8 A;  4IL1 A;  1K90 D;  3DQ9 A;  1B7T Y;  1CDL A;  2LLT A;  4W7C A;  3BJH A;  3Q8I A;  1XO5 A;  2F2P A;  1QX7 A;  1KK8 C;  1C3Z A;  2M29 A;  4ZIO A;  1PVA A;  3DQ8 A;  2G9B A;  1UUS A;  3VRO A;  1BJF A;  4LJB A;  2C9J A;  2JQ6 A;  1EMA A;  2JNX A;  1TNX A;  2ERB A;  3ST4 A;  1CM4 A;  3U8A A;  4N1G A;  1LVC D;  4R6D A;  1QS7 A;  2LUC A;  3OSR A;  1YHI A;  3C1V A;  2V4E B;  4P5O E;  1C3Y A;  4D1E A;  1M31 A;  3GJ2 A;  1RMO A;  1WLM A;  1J7R A;  4GGF A;  2LVK A;  3A4U B;  1DF0 B;  1B47 A;  1NX3 A;  4N3D A;  1ZMZ A;  4XYN A;  2H6V A;  3E5T A;  1FF1 A;  2P71 A;  2YE1 A;  5ER4 X;  3I5H B;  3DQC A;  5EXC I;  4I2Y A;  1OQP A;  5HBD A;  4JGE A;  4HQ8 A;  4HRH A;  2CT9 A;  2LHI A;  1EH2 A;  5LTR A;  3DQ2 A;  4LJD A;  3K21 A;  4MZK A;  1YUU A;  1OMR A;  3PM2 A;  1QAS A;  1EMB A;  2K0J A;  2JRF A;  1IKU A;  4W6A A;  2QEH A;  1QXT A;  3CBE A;  2VAE A;  2OTB A;  1JFJ A;  4Z4M A;  2ZRT A;  3SG7 A;  1CV7 A;  2LM5 A;  4ORA B;  3AAK A;  1CB1 A;  4M2O A;  5DRF A;  2BCX A;  3KEV A;  2JU0 A;  3SSV A;  2KI4 C;  3VRR A;  1K94 A;  4I5J A;  5DQM A;  5TNC A;  3LVA A;  1XK4 C;  3RLZ A;  3CZ2 A;  5DU0 A;  4JWQ A;  2VZX A;  2G6Y A;  3AAJ A;  2AMI A;  4GOB A;  1K93 D;  2O29 A;  3B87 A;  4PCW A;  3VIC A;  1S6I A;  2ARL A;  1QTX A;  3ZUF A;  2ZND A;  1H4B A;  1KYS A;  5D69 A;  1PSR A;  1LIN A;  4JPZ B;  3EVP A;  2QLG A;  1LA0 A;  4BY4 A;  2JUL A;  3TDU A;  1XFR A;  2MA2 A;  2A52 B;  2I18 A;  3DQM A;  4LQU A;  3AI5 A;  2P6B B;  1SPY A;  4CPV A;  4GUK A;  1Q80 A;  4MLW A;  1QVI Z;  2GGM A;  1XFU O;  3B88 A;  1C7V A;  3DQE A;  1ZGP A;  4WRI A;  4N1F A;  2VVJ A;  2VVI A;  1UUR A;  2ZRS A;  2JC2 A;  2G3O A;  3DY9 A;  3CFH A;  3OX5 A;  2HFC A;  1YUT A;  5EL2 A;  2KI4 B;  2DUE A;  5FI6 A;  1PK0 D;  1HUY A;  3TMR A;  1G4Y R;  2DDC A;  4LJD C;  2L4I A;  5AQB B;  1OOH A;  5BTT A;  1TWO A;  1A75 B;  2HGY A;  1G8I A;  2CCM A;  2GGZ A;  1RRO A;  4AOM A;  4AQJ A;  3ICB A;  1CDN A;  4W77 A;  2NXQ A;  3DQD A;  1JF2 A;  3SVR A;  2BBM A;  3SSY A;  1PUL A;  2QEB A;  1FW4 A;  2IB5 A;  5CSF A;  1Y0V H;  2PAL A;  3BOW A;  4INX A;  1IQ3 A;  2A50 B;  1NYA A;  1SK6 D;  3M0W A;  3G9A A;  3PIB A;  1OXE A;  2PSR A;  4W6I A;  1TCO B;  2JWW A;  1PSB A;  3CD9 A;  1C07 A;  3AKO A;  3CZT X;  2LVI A;  3BXA A;  4MEW A;  3NSO A;  2B1U A;  5I2L A;  1BMO A;  2MBX A;  2OTG C;  3I19 A;  4EDS A;  3SSK A;  2BKH B;  5HGE A;  1ZUZ A;  1M46 A;  1KQV A;  5CSN A;  1XVJ A;  3ST0 A;  4ZF4 A;  3W1D A;  3CFA A;  4WQ2 A;  2Z6Y A;  2JNF A;  2WHU A;  1WY9 A;  2QLH A;  4DXI A;  1RMM A;  1H6R A;  1CLB A;  1SBJ A;  4GPL B;  3NSL A;  4W6S A;  2R2I A;  2H5O A;  2YGU A;  2KGB C;  3A8R A;  2JAD A;  4DKM A;  2ZKM X;  1AHR A;  2G16 B;  4M2Q A;  4L13 A;  1HQV A;  5DPJ A;  1M45 A;  4XOV A;  3TUY C;  1KK7 Z;  5DTY A;  4Q7U A;  1RMP A;  4OQW A;  3ZTF A;  3NHT A;  2POX A;  1B8R A;  5D7F A;  4MBE A;  4LQT A;  2ZNE A;  2EMD A;  3DQ6 A;  2F8P A;  2A56 B;  3DPZ A;  3KO0 A;  3UG0 A;  2M1K B;  2PMY A;  2EC6 B;  1G33 A;  1OW4 A;  4XOW A;  2AH8 A;  1K8U A;  3FE8 A;  1EME A;  1GGZ A;  3UO9 A;  1BFP A;  2RGI A;  2CBL A;  2H5P A;  4NDD A;  3M24 A;  1IJ6 A;  1QLS A;  2BE6 A;  2MLE C;  2DD7 A;  2VAD A;  1LA3 A;  2F3Z A;  3SJS A;  3JTD C;  1JBY A;  4HE4 A;  4KPI A;  2YE0 A;  3LSA A;  1OMV A;  4KAG A;  2DUF A;  2ZMU A;  2Y5I A;  1PAL A;  1B8C A;  3SVS A;  2ZO7 A;  3DQF A;  1JBZ A;  1DF0 A;  3TZ1 A;  1P28 A;  3S0D A;  3D0Y A;  4NDB A;  3TUY B;  1K9K A;  5I2O A;  2MJW B;  2QT2 A;  3DF0 B;  1WRZ A;  1F55 A;  5FVI A;  2H9W A;  1QIW A;  3I5G C;  1L2O C;  2ICR A;  5IBW A;  1NX0 A;  2WIQ A;  2KQY A;  2KAX A;  4GBA A;  4KGF A;  2F2O A;  4B30 B;  4DIR A;  2L51 A;  3CYZ A;  3DQ7 A;  4LW5 A;  4W6M A;  1JFK A;  3DYE A;  1ZAC A;  1ALV A;  4EUL A;  4MSP A;  2IB6 A;  1MOU A;  1ODB A;  4DKN A;  4RTC A;  1YR5 A;  4KEX A;  2BL0 C;  1DJI A;  5CSI A;  4OZD A;  3BUW B;  1BOC A;  3OBV A;  4UTS A;  1DQE A;  3JTD B;  2JXC A;  4MZL A;  3VRP A;  3QRX A;  2BTJ A;  1NUB A;  5J3X A;  2QLE A;  1DEL A;  5FVF A;  4ZBL A;  4W7A A;  2KHN A;  2PYQ A;  2O2B A;  1NX1 A;  3CD1 A;  1OOI X;  2QLI A;  2QRF A;  4BY5 A;  3SS3 A;  3DQH A;  4EDO A;  2HPW A;  3OB1 B;  3E5W A;  1YRT B;  4W6K A;  3LF3 A;  3PN7 C;  1ZOT B;  1RRX A;  2IOV A;  2OKW A;  4W7E A;  4W74 A;  3BFA A;  4C0J A;  1ZGQ A;  4JD9 A;  1X02 A;  3CR5 X;  5AAN A;  4W6P A;  4WQ3 A;  2A46 A;  2Y0G A;  4OR9 B;  1F8H A;  3CR2 A;  1L2O B;  3WHT B;  4DXO A;  3V2L A;  5DKN A;  1QLK A;  4PE7 A;  4OCI A;  1JBA A;  2L0P A;  2CXJ A;  1B8L A;  2LMT A;  4W6F A;  2JPT A;  2IE2 A;  3PJ7 A;  2LC5 A;  1UIS A;  1QXP A;  1S6Z A;  2IS9 A;  4IJ7 A;  1DVI A;  3MSE B;  2BL0 B;  1NIW A;  2KYF A;  1KFU S;  3CFF A;  3U0K A;  4Q9X A;  1MXE A;  1BR4 B;  3DPW A;  2OJK A;  1MF8 B;  2KSP A;  1TOP A;  4YBH B;  4ZF5 A;  4R1E A;  3SVU A;  1A75 A;  2L2E A;  4YI9 A;  5K89 A;  5B8I B;  3S0E A;  1KQM C;  4KYN A;  2O5G A;  1Q4A A;  1D1O A;  4IK1 A;  2OS8 C;  3BXK A;  1EML A;  3PN7 B;  3M22 A;  5AFP A;  4JQ0 D;  1S5G Z;  1AVS A;  3CGL A;  2LAN A;  1ZGO A;  1S36 A;  2Z6X A;  3CZ0 A;  4JF9 A;  3R72 A;  4ORB B;  5FVG A;  3WLC A;  1SKT A;  1U5I B;  1QY3 A;  3H1R A;  3CTN A;  5HZT A;  1S3P A;  4Q9W A;  1DJX A;  3EKH A;  1LS8 A;  2G6E A;  1KP5 A;  3D78 A;  2WOS A;  3H1O A;  2QDI A;  3EK8 A;  4Q7T A;  1GGW A;  1QYO A;  3EVR A;  2JT8 A;  4QJ4 B;  3IP2 A;  3P8U A;  1MR8 A;  3GK1 A;  2WSN A;  3B7A A;  1EJ3 A;  2G3D B;  3SSP A;  1CMF A;  2JOJ A;  4KW8 A;  4YGD B;  4OGS A;  2G5Z B;  1ZFS A;  1KK8 B;  2FL1 A;  3PLF B;  4GFT A;  1A03 A;  2TN4 A;  2KQ6 A;  1REC A;  4KW4 A;  3LL8 B;  5CSJ A;  1FI6 A;  1MYW A;  4W76 A;  3FIA A;  4B5Y A;  2WUR A;  2QU1 A;  1H8B A;  4HQC A;  2GX2 A;  4W6J A;  4JEO A;  1S5G Y;  4DS7 A;  2B3Q A;  4TZG A;  2KNE A;  2M7N A;  5BQL A;  3DQ5 A;  1F71 A;  3S05 A;  4E68 A;  3DQJ A;  2KLE A;  5DTX A;  4W69 A;  2WCE A;  2Q91 A;  2ZO6 A;  1A2X A;  2KGR A;  2JZI A;  4W7R A;  5DPI A;  2PXS A;  1DT7 B;  1T14 A;  3O78 A;  2Y1M A;  1SYM A;  2HQW A;  2PAS A;  4PT1 A;  3DPX A;  4IK5 A;  5KTY A;  1TN4 A;  1B9C A;  3ST3 A;  3LLE A;  4H47 A;  3WHU B;  4J89 A;  1SY9 A;  1E8A A;  4DRW A;  1ORG A;  4HQ9 A;  2H61 A;  5FHV A;  3HX4 A;  3E5V A;  2Q6P A;  3BFH A;  4KF5 A;  1Z2C B;  5DTZ A;  3SIB A;  2WCB A;  2OPO A;  4YI8 A;  4IK8 A;  1QYF A;  1CLL A;  1SL8 A;  5HZS A;  4FTG A;  4GGF C;  2AAO A;  3D77 A;  4W7D A;  1Q4B A;  3SIA A;  1L7Z A;  3OGO A;  2I94 A;  2Z1O A;  2M9G A;  4HVF A;  2LAP A;  4MRX A;  1MOV A;  1GL4 A;  2K61 A;  2H5R A;  4MZJ A;  2G2S B;  4ZFS A;  1KCY A;  2NCP A;  3DF0 A;  2PRU A;  4ORN A;  1KFU L;  5DIC A;  2LP2 A;  4JRB A;  1YX7 A;  3DQ1 A;  3OGN A;  4YGC B;  1CDM A;  4PHN A;  2KFG A;  3DQU A;  3SSL A;  4C0L A;  1V1G A;  2MLF C;  3KHE A;  3CZ1 A;  2JTT A;  2CNP A;  4RYW A;  3D73 A;  4JC2 A;  4B30 A;  1TUZ A;  5I8N A;  1J1D A;  5ER5 A;  4CFQ A;  3FE9 A;  5HZU A;  1BR1 B;  1UWO A;  1DC1 A;  1N65 A;  1F4O A;  1CFF A;  1RFJ A;  1YJF A;  3LA1 A;  1QVI Y;  4IK4 A;  3S0B A;  2QEO A;  2EHB A;  2HQK A;  2H8Q A;  1JC1 A;  1NCX A;  1W9Z A;  2WC8 A;  4P1Q A;  1Y1X A;  1J7O A;  3WXA A;  1XQM A;  4IK9 A;  1GJY A;  2EGD A;  1BG1 A;  5DPG A;  4PDZ A;  1OOF A;  2M3W A;  3SVE A;  3H4S E;  4ETO A;  1TNP A;  2L5Y A;  2WOR A;  4PAL A;  1EG4 A;  4DUQ A;  3PAL A;  1SMG A;  4ANJ A;  3LK1 A;  2JT0 A;  4A4C A;  1SR6 C;  1S26 D;  2VRG A;  2HF5 A;  2E6W A;  4Z4K A;  2OGR A;  1S1E A;  4ZF3 A;  2PVB A;  3ZNI A;  1K96 A;  3UFZ A;  3GK4 X;  3VHT A;  3EG5 B;  2FJY A;  2AWM A;  1RM9 A;  3R1V A;  1F4Q A;  3VK1 A;  1EMF A;  1W7I B;  4HSZ A;  4C0K A;  3NT9 A;  1OXF A;  3PSR A;  4PE4 A;  3S0A A;  1UHK A;  1EG3 A;  2WCL A;  1W7U A;  1JC0 A;  4QJ5 B;  1WLZ A;  2O60 A;  1IRJ A;  1CFC A;  4N5X A;  4PHM A;  2AWJ A;  1S6J A;  1KSO A;  1W7J B;  3ADF A;  3VRQ A;  3RWT A;  4A4B A;  1SCV A;  1R2U A;  4YRU A;  2OTG B;  2HET A;  3KCS A;  3I5I C;  1H4U A;  4W6H A;  1OMD A;  4ZCV A;  3WCK A;  3L4L A;  3SSH A;  3TDI A;  2QLG B;  4XGY A;  4XVP A;  4W6T A;  2NZ0 A;  3O2P A;  2AHA A;  1SR6 B;  2JXL A;  2V4E A;  2GW4 B;  3KPX A;  3LK0 A;  2ZMW A;  4CID A;  2HJO A;  1KSM A;  4F0Z B;  2K8M B;  1HCJ A;  5EXB A;  3L47 A;  3JVT C;  2LLU A;  3S0F A;  2L5X B;  1EMM A;  5DKQ A;  2I2R E;  4DCK A;  1GQM A;  5JOL A;  1KK7 Y;  1F0B A;  1JC2 A;  1MXL C;  2Q57 A;  3O6B A;  1FI5 A;  3ZWH A;  1YUR A;  3RM1 A;  2K60 A;  1OSA A;  3EK7 A;  2OKY A;  2LVJ A;  2V53 A;  3O4Y A;  4XJK B;  2M1U A;  3EK4 A;  5GQQ C;  3VGO A;  3DVE A;  3PJI A;  2A48 A;  2H5Q A;  5BTT B;  3A8S A;  3GL4 A;  4DXM A;  1TRF A;  4CFR A;  2L4H A;  5J2O A;  1GFL A;  3ZUJ A;  2ZN8 A;  3I5I B;  2KDH A;  1OE9 B;  1WRK A;  3I5F C;  2FJU B;  1QAT A;  3BUO B;  3L4A A;  1SW8 A;  1YRU B;  4I5K A;  4PE0 A;  2QPT A;  2AWL A;  4MRY A;  3U0L A;  4ZB1 A;  2WCH A;  5DKR A;  1KWO C;  1SRA A;  4DXP A;  2WCJ A;  5HKW A;  1B1G A;  1J1E A;  3BOW B;  2LNK A;  5EB7 A;  2KBI A;  1OOG A;  1CNP A;  4F7F A;  4L9M A;  4EN1 A;  4I5L B;  2K2A A;  4YGB B;  1XA5 A;  5G08 A;  1XFZ O;  5AEQ A;  4EMQ A;  2KYC A;  3OX6 A;  1XFV O;  2HPS A;  4PPJ A;  2KI6 C;  4W6L A;  2EMN A;  5KSZ A;  3NGV A;  1GGX A;  3F45 A;  1XFX O;  3BX9 A;  2DUI A;  4GAO A;  3AI4 A;  1F70 A;  1Q4C A;  1W7S A;  3I5G B;  2ZN9 A;  3SS0 A;  4ORC B;  5LK4 A;  4R6B A;  1EMK A;  3GEX A;  3DXL A;  4GGN A;  5F9G A;  2QAC A;  2MAZ A;  1MQ1 A;  1WDC C;  2GW3 A;  2LMU A;  1W7T A;  3AKA A;  2H2K A;  3SVN A;  2FCD A;  2BNX A;  1DTL A;  5KU1 A;  3I5F B;  3E3R A;  4OKH A;  1YUS A;  1C7W A;  4FQO A;  5H87 A;  1XFW O;  3I5H C;  3D75 A;  3PJ5 A;  2BKI B;  1BU3 A;  1OZS A;  4PHJ A;  1XK4 A;  3CR4 X;  2KI6 D;  2K7B A;  2LHL A;  4NQG A;  3LS3 A;  2K2F A;  1VRK A;  3WNX B;  1Y1U A;  2KPH A;  1XYD A;  4GNK B;  1YTZ C;  3SS5 A;  1CKK A;  3DQN A;  4BDU A;  1FBV A;  3VB1 A;  3WLD A;  3CS1 A;  1SL7 A;  4DXN A;  3O77 A;  5EB6 A;  1CFD A;  1IH0 A;  2KFH A;  1DJG A;  2COL B;  3U8C A;  2L2C A;  3D10 A;  4H3N A;  1TNQ A;  2FZU A;  2BBN A;  4PE1 A;  5EHU A;  2WC5 A;  3DQ3 A;  4U8D A;  2DDD A;  1PRW A;  3DVJ A;  1TUJ A;  4TNC A;  2A53 B;  2LMV A;  3VRN A;  1XAE A;  2BCB A;  1WDC B;  1MHO A;  1UHH A;  2WC6 A;  5I94 A;  1SNL A;  1M39 A;  1QIV A;  3BXC A;  2VVH A;  1F54 A;  3D0Y B;  4FQT A;  5AER A;  3TS5 C;  3IVT A;  4KW9 A;  1CLM A;  4I5N B;  2B3P A;  3FE6 A;  3KF9 A;  3U8P A;  1S6C A;  1M63 B;  2QZ0 A;  2M0R A;  1FPW A;  4W6N A;  5T3I A;  2JTZ A;  1GM0 A;  4AQI A;  1KQM B;  4ZCU A;  3BFB A;  5LTP A;  2DUG A;  5FI7 A;  4INW A;  1IIO A;  1K9U A;  1BLQ A;  3W1C A;  4HRE E;  2JT3 A;  3K1E A;  2OS8 B;  4ICB A;  4RYS A;  4W75 A;  3SG4 A;  4U2V A;  2NLN A;  4PFE A;  1OXD A;  1UHI A;  5BPJ A;  1RJV A;  2GTE A;  3SS4 A;  3B86 A;  3O4X A;  3U0N A;  3SVD A;  1J7Q A;  5HLV A;  2M97 A;  1IQ5 A;  2ISD A;  4OY4 A;  1DEK A;  2HRS A;  1QV1 A;  3BXB A;  4QJ3 B;  3LVD A;  3DVK A;  1Y1A A;  3GB3 A;  3IQQ A;  2A47 A;  1AP4 A;  1YHH A;  1YZW A;  4IK3 A;  1JSA A;  2KAY A;  3TS5 B;  2WIS A;  2G6X A;  5FI2 A;  3LCP C;  3TDZ A;  1Y6W A;  2WCM A;  4W72 A;  4OJ0 A;  5HZO A;  4W6G A;  3ED8 A;  1QWV A;  4GF6 B;  5H89 A;  1JF0 A;  2KAV A;  5HLO A;  4UPG A;  2WSO A;  1J55 A;  4NWS A;  1A4P A;  3GOF A;  3SG5 A;  3FS7 A;  1BOD A;  1OZO A;  3DQ4 A;  2K7O A;  4MVF A;  1RTP 1;  1K9P A;  3D74 A;  1NSH A;  3PM8 A;  5DQB A;  4L1I A;  4W6O A;  1UP5 A;  3CLN A;  2M8U A;  2M49 B;  3MGF A;  3DQL A;  1IGV A;  2LVV A;  3IR8 A;  3PJB A;  3RZS A;  2WCK A;  2DD9 A;  4HRG A;  1YVH A;  2H8V A;  4YGE B;  3S0G A;  1MWN A;  3FWB A;  1YHG A;  4XJK A;  5EBJ A;  1SCM C;  2WHT A;  2PQL A;  1EL4 A;  1Q4E A;  2CTN A;  2LE9 B;  5EJU A;  3SG2 A;  1TNW A;  5PAL A;  4W73 A;  3U0M A;  4H48 A;  1LKJ A;  2WCF A;  4AR7 A;  3NEZ A;  1KYP A;  5DTL A;  1K95 A;  1CFP A;  3NSI A;  3CDN A;  2KOT A;  1DMO A;  2LCP A;  1TTX A;  2MRD A;  3DZT A;  3UNW A;  1XSS A;  3R1P A;  3V3D A;  2AUC A;  2G2B A;  1IJ5 A;  1TCF A;  3DQI A;  2Y4Q A;  5DRG A;  3KCT A;  4LJC A;  5DY6 A;  2EC6 C;  4KA9 A;  4CLN A;  4JFG A;  2HCG A;  3ZUL A;  4OV2 A;  3P28 A;  3ST2 A;  1IWQ A;  2H61 C;  4W6B A;  4TZA A;  1KFX S;  2E30 A;  1DGU A;  3PAT A;  3SVC A;  3NSK A;  4P76 A;  2SAS A;  2GX0 A;  1XMZ A;  1N2D A;  4KF5 C;  3CAB A;  3IQO A;  1SCM B;  2Y1N A;  5HYD A;  2YFP A;  1IG5 A;  4W7F A;  2JPO A;  2GV5 A;  4W6U A;  2P70 A;  3CGA A;  3OP0 A;  2FCE A;  2HQ8 A;  1YJ2 A;  3OB2 B;  1OOJ A;  3BYA A;  3OSQ A;  3SST A;  4KF4 A;  3K1K A;  2BAP A;  1NWD A;  3BUN B;  5I2Q A;  3DQO A;  4PHK A;  1HT9 A;  4W6D A;  1EMC A;  3GJ1 A;  3EVU A;  2AWK A;  1DJH A;  1DJY A;  2KBM A;  3TMT A;  4OHS A;  2L50 A;  1AJ4 A;  5HW9 A;  1SL9 A;  4W6C A;  1AJ5 A;  3SG3 A;  1QX5 B;  1CTR A;  3DD4 A;  4H3L A;  3DVM A;  4KGE A;  2KLD A;  2O24 A;  3D76 A;  3GK2 A;  1PVB A;  3DQK A;  4XL5 A;  2Z6Z A;  5BT0 A;  2DOQ A;  1LXF C;  1AUI B;  1WRL A;  1NX2 A;  4Q7R A;  2QEV A;  4USL A;  2EMO A;  3NXA A;  1J7P A;  1RK9 A;  2DUH A;  4W6R A;  1AK8 A;  4PPK A;  1EMG A;  3PFV A;  2LP3 A;  1U5I A;  5D3O A;  1C4F A;  5JJG A;  5FYX A;  4DXQ A;  1NP8 A;  3RWA A;  1Z4H A;  1RWY A;  2ZFD A;  2I7A A;  3CWG A;  2LV7 A;  2NCO A;  5F6T A;  4MN0 A;  1YVL A;  3NED A;  1JWD A;  2SCP A;  3LVC A;  5HKZ A;  3FWC A;  3HCM A;  1CMG A;  2HQZ A;  1DGV A;  5H88 A;  2F33 A;  3NT3 A;  4IZN A;  1G7K A;  3BUM B;  1NCZ A;  3NF0 A;  4PPL A;  1MUX A;  3BUX B;  3IF7 A;  4JKT A;  3AKB A;  1N0Y A;  5HKY A;  2WND A;  2C9I A;  2Q4U A;  3B6X A;  1CDP A;  1B4C A;  1Z1P A;  3DQA A;  4L12 A;  2F3Y A;  2OTE A;  3OHM B;  3SVB A;  2FWQ A;  1A29 A;  1BF5 A;  2A4J A;  2LLS A;  3SG6 A;  1QV0 A;  1JUO A;  5LTQ A;  2WHS A;  2BEC A;  1UHJ A;  2FOT A;  3N7H A;  2K7D A;  5HL1 A;  1BT6 A;  3EKJ A;  2YDZ A;  4ZIN A;  3SV5 A;  1Z1Q A;  1Q73 A;  5EXU A;  1R6P A;  1XA9 A;  4OVN F;  1B7T Z;  2HGD A;  3QME A;  4GES B;  3JVT B;  1UHN A;  1F09 A;  2K7C A;  1CM1 A;  1DJZ A;  4W7X A;  2PXW A;  1XFY O;  2D8N A;  4NDC A;  1QYQ A;  5KTG A;  1Q4D A;  3SRY A;  1ZUX A;  2MHH A;  1B9A A;  4P2Y B;  1YFP A;  1KYR A; 
#chains in the Genus database with same CATH homology
 1QX2 A;  1EXR A;  1V1F A;  2BE4 A;  3LF4 B;  1KFX L;  2V4E C;  2BCA A;  4J88 A;  2KFF A;  1QJT A;  1NCY A;  1TIZ A;  2M7L A;  1K2H A;  4H3M A;  4YGA A;  3VHT B;  3CB9 A;  3SVO A;  4M2P A;  1NPQ A;  5DPH A;  2LUX A;  4Q04 A;  1ALW A;  1KWO B;  4J8A A;  2L98 A;  3BQ3 A;  5CPV A;  1YX8 A;  3EVV A;  5AXI A;  2P4M A;  2A54 B;  1DJW A;  2RH7 A;  4AS8 A;  4IL1 A;  1K90 D;  3DQ9 A;  1B7T Y;  1CDL A;  2LLT A;  4W7C A;  1XO5 A;  2F2P A;  1QX7 A;  1KK8 C;  2M29 A;  4ZIO A;  1PVA A;  3DQ8 A;  2G9B A;  1UUS A;  3VRO A;  1BJF A;  4LJB A;  2C9J A;  2JQ6 A;  1EMA A;  2JNX A;  1TNX A;  3ST4 A;  1CM4 A;  3U8A A;  4N1G A;  1LVC D;  4R6D A;  1QS7 A;  2LUC A;  3OSR A;  1YHI A;  3C1V A;  2V4E B;  4P5O E;  4D1E A;  1M31 A;  3GJ2 A;  1RMO A;  1WLM A;  1J7R A;  4GGF A;  2LVK A;  3A4U B;  1DF0 B;  1B47 A;  1NX3 A;  4N3D A;  1ZMZ A;  4XYN A;  2H6V A;  3E5T A;  1FF1 A;  2YE1 A;  5ER4 X;  3I5H B;  3DQC A;  5EXC I;  4I2Y A;  1OQP A;  5HBD A;  4JGE A;  4HQ8 A;  4HRH A;  2CT9 A;  2LHI A;  1EH2 A;  5LTR A;  3DQ2 A;  4LJD A;  3K21 A;  4MZK A;  1YUU A;  1OMR A;  1QAS A;  1EMB A;  2K0J A;  2JRF A;  1IKU A;  4W6A A;  1QXT A;  3CBE A;  2VAE A;  2OTB A;  1JFJ A;  4Z4M A;  2ZRT A;  3SG7 A;  1CV7 A;  2LM5 A;  4ORA B;  3AAK A;  1CB1 A;  4M2O A;  5DRF A;  2BCX A;  3KEV A;  2JU0 A;  3SSV A;  2KI4 C;  3VRR A;  1K94 A;  4I5J A;  5DQM A;  5TNC A;  3LVA A;  1XK4 C;  3RLZ A;  5DU0 A;  4JWQ A;  2VZX A;  2G6Y A;  3AAJ A;  2AMI A;  4GOB A;  1K93 D;  2O29 A;  4PCW A;  3VIC A;  1S6I A;  2ARL A;  1QTX A;  3ZUF A;  2ZND A;  1H4B A;  1KYS A;  5D69 A;  1PSR A;  1LIN A;  4JPZ B;  3EVP A;  2QLG A;  1LA0 A;  4BY4 A;  2JUL A;  3TDU A;  2MA2 A;  2A52 B;  2I18 A;  3DQM A;  4LQU A;  3AI5 A;  2P6B B;  1SPY A;  4CPV A;  4GUK A;  1Q80 A;  4MLW A;  1QVI Z;  2GGM A;  1XFU O;  1C7V A;  3DQE A;  1ZGP A;  4WRI A;  4N1F A;  2VVJ A;  2VVI A;  1UUR A;  2ZRS A;  2JC2 A;  2G3O A;  3CFH A;  3OX5 A;  2HFC A;  1YUT A;  2KI4 B;  2DUE A;  1PK0 D;  1HUY A;  3TMR A;  1G4Y R;  2DDC A;  4LJD C;  2L4I A;  5AQB B;  5BTT A;  1A75 B;  2HGY A;  1G8I A;  2CCM A;  2GGZ A;  1RRO A;  4AOM A;  4AQJ A;  3ICB A;  1CDN A;  4W77 A;  2NXQ A;  3DQD A;  1JF2 A;  3SVR A;  2BBM A;  3SSY A;  1PUL A;  1FW4 A;  2IB5 A;  5CSF A;  1Y0V H;  2PAL A;  3BOW A;  1IQ3 A;  2A50 B;  1NYA A;  1SK6 D;  3M0W A;  3G9A A;  3PIB A;  1OXE A;  2PSR A;  4W6I A;  1TCO B;  2JWW A;  1PSB A;  3CD9 A;  1C07 A;  3AKO A;  3CZT X;  2LVI A;  3BXA A;  4MEW A;  3NSO A;  2B1U A;  5I2L A;  1BMO A;  2MBX A;  2OTG C;  3I19 A;  4EDS A;  3SSK A;  2BKH B;  5HGE A;  1ZUZ A;  1M46 A;  1KQV A;  5CSN A;  1XVJ A;  3ST0 A;  4ZF4 A;  3W1D A;  3CFA A;  4WQ2 A;  2Z6Y A;  2JNF A;  2WHU A;  1WY9 A;  2QLH A;  4DXI A;  1RMM A;  1H6R A;  1CLB A;  1SBJ A;  4GPL B;  3NSL A;  4W6S A;  2R2I A;  2H5O A;  2KGB C;  3A8R A;  2JAD A;  4DKM A;  2ZKM X;  1AHR A;  2G16 B;  4M2Q A;  4L13 A;  1HQV A;  5DPJ A;  1M45 A;  4XOV A;  3TUY C;  1KK7 Z;  5DTY A;  4Q7U A;  1RMP A;  4OQW A;  3ZTF A;  2POX A;  1B8R A;  5D7F A;  4MBE A;  4LQT A;  2ZNE A;  2EMD A;  3DQ6 A;  2F8P A;  2A56 B;  3DPZ A;  3KO0 A;  3UG0 A;  2M1K B;  2PMY A;  2EC6 B;  1G33 A;  4XOW A;  2AH8 A;  1K8U A;  1EME A;  1GGZ A;  1BFP A;  2RGI A;  2CBL A;  2H5P A;  4NDD A;  3M24 A;  1IJ6 A;  1QLS A;  2BE6 A;  2MLE C;  2DD7 A;  2VAD A;  1LA3 A;  2F3Z A;  3SJS A;  3JTD C;  1JBY A;  4HE4 A;  4KPI A;  2YE0 A;  3LSA A;  1OMV A;  4KAG A;  2DUF A;  2ZMU A;  2Y5I A;  1PAL A;  1B8C A;  3SVS A;  2ZO7 A;  3DQF A;  1JBZ A;  1DF0 A;  3TZ1 A;  3D0Y A;  4NDB A;  3TUY B;  1K9K A;  5I2O A;  2MJW B;  2QT2 A;  3DF0 B;  1WRZ A;  1F55 A;  5FVI A;  2H9W A;  1QIW A;  3I5G C;  1L2O C;  2ICR A;  5IBW A;  1NX0 A;  2WIQ A;  2KQY A;  2KAX A;  4GBA A;  4KGF A;  2F2O A;  4B30 B;  4DIR A;  2L51 A;  3DQ7 A;  4LW5 A;  4W6M A;  1JFK A;  1ZAC A;  1ALV A;  4EUL A;  4MSP A;  2IB6 A;  1MOU A;  1ODB A;  4DKN A;  4RTC A;  1YR5 A;  4KEX A;  2BL0 C;  1DJI A;  5CSI A;  3BUW B;  1BOC A;  4UTS A;  3JTD B;  2JXC A;  4MZL A;  3VRP A;  3QRX A;  2BTJ A;  1NUB A;  5J3X A;  2QLE A;  5FVF A;  4ZBL A;  4W7A A;  2KHN A;  2O2B A;  1NX1 A;  3CD1 A;  2QLI A;  2QRF A;  4BY5 A;  3DQH A;  4EDO A;  2HPW A;  3OB1 B;  3E5W A;  1YRT B;  4W6K A;  3LF3 A;  3PN7 C;  1ZOT B;  1RRX A;  2IOV A;  2OKW A;  4W7E A;  4W74 A;  4C0J A;  1ZGQ A;  1X02 A;  3CR5 X;  5AAN A;  4W6P A;  4WQ3 A;  2A46 A;  2Y0G A;  4OR9 B;  1F8H A;  3CR2 A;  1L2O B;  3WHT B;  4DXO A;  5DKN A;  1QLK A;  4PE7 A;  4OCI A;  1JBA A;  2L0P A;  2CXJ A;  1B8L A;  2LMT A;  4W6F A;  2JPT A;  2IE2 A;  3PJ7 A;  2LC5 A;  1UIS A;  1QXP A;  1S6Z A;  2IS9 A;  1DVI A;  3MSE B;  2BL0 B;  1NIW A;  2KYF A;  1KFU S;  3CFF A;  3U0K A;  4Q9X A;  1MXE A;  1BR4 B;  3DPW A;  2OJK A;  1MF8 B;  2KSP A;  1TOP A;  4YBH B;  4ZF5 A;  4R1E A;  3SVU A;  1A75 A;  2L2E A;  4YI9 A;  5K89 A;  5B8I B;  1KQM C;  2O5G A;  1Q4A A;  1D1O A;  4IK1 A;  2OS8 C;  3BXK A;  1EML A;  3M22 A;  3PN7 B;  5AFP A;  4JQ0 D;  1S5G Z;  1AVS A;  3CGL A;  2LAN A;  1ZGO A;  1S36 A;  2Z6X A;  4JF9 A;  4ORB B;  5FVG A;  3WLC A;  1SKT A;  1U5I B;  1QY3 A;  3H1R A;  3CTN A;  5HZT A;  1S3P A;  4Q9W A;  1DJX A;  3EKH A;  2G6E A;  1KP5 A;  2WOS A;  3H1O A;  3EK8 A;  4Q7T A;  1GGW A;  1QYO A;  3EVR A;  2JT8 A;  4QJ4 B;  3IP2 A;  3P8U A;  1MR8 A;  3GK1 A;  2WSN A;  1EJ3 A;  2G3D B;  3SSP A;  1CMF A;  2JOJ A;  4KW8 A;  4YGD B;  4OGS A;  2G5Z B;  1ZFS A;  1KK8 B;  2FL1 A;  3PLF B;  4GFT A;  1A03 A;  2TN4 A;  2KQ6 A;  1REC A;  4KW4 A;  3LL8 B;  5CSJ A;  1FI6 A;  1MYW A;  4W76 A;  3FIA A;  4B5Y A;  2WUR A;  2QU1 A;  1H8B A;  4HQC A;  2GX2 A;  4W6J A;  4JEO A;  1S5G Y;  4DS7 A;  2B3Q A;  4TZG A;  2KNE A;  2M7N A;  5BQL A;  3DQ5 A;  1F71 A;  3S05 A;  4E68 A;  3DQJ A;  5DTX A;  4W69 A;  2WCE A;  2Q91 A;  2ZO6 A;  1A2X A;  2KGR A;  2JZI A;  4W7R A;  5DPI A;  2PXS A;  1DT7 B;  3O78 A;  2Y1M A;  1SYM A;  2HQW A;  2PAS A;  3DPX A;  4IK5 A;  5KTY A;  1TN4 A;  1B9C A;  3ST3 A;  3LLE A;  4H47 A;  3WHU B;  4J89 A;  1SY9 A;  1E8A A;  4DRW A;  4HQ9 A;  2H61 A;  5FHV A;  3HX4 A;  3E5V A;  2Q6P A;  4KF5 A;  5DTZ A;  3SIB A;  2WCB A;  4IK8 A;  2OPO A;  4YI8 A;  1QYF A;  1CLL A;  1SL8 A;  5HZS A;  4FTG A;  4GGF C;  2AAO A;  4W7D A;  1Q4B A;  3SIA A;  1L7Z A;  3OGO A;  2I94 A;  2Z1O A;  2M9G A;  4HVF A;  2LAP A;  4MRX A;  1MOV A;  1GL4 A;  2K61 A;  2H5R A;  4MZJ A;  2G2S B;  4ZFS A;  1KCY A;  2NCP A;  3DF0 A;  2PRU A;  4ORN A;  1KFU L;  2LP2 A;  4JRB A;  1YX7 A;  3DQ1 A;  4YGC B;  1CDM A;  4PHN A;  2KFG A;  3DQU A;  3SSL A;  4C0L A;  1V1G A;  2MLF C;  3KHE A;  2JTT A;  2CNP A;  4RYW A;  4JC2 A;  4B30 A;  5I8N A;  1J1D A;  5ER5 A;  4CFQ A;  5HZU A;  1BR1 B;  1UWO A;  1N65 A;  1F4O A;  1CFF A;  1RFJ A;  1YJF A;  3LA1 A;  1QVI Y;  4IK4 A;  2EHB A;  2HQK A;  2H8Q A;  1JC1 A;  1NCX A;  2WC8 A;  4P1Q A;  1Y1X A;  1J7O A;  3WXA A;  1XQM A;  4IK9 A;  1GJY A;  2EGD A;  1BG1 A;  5DPG A;  4PDZ A;  2M3W A;  3SVE A;  3H4S E;  4ETO A;  1TNP A;  2WOR A;  4PAL A;  1EG4 A;  4DUQ A;  3PAL A;  1SMG A;  4ANJ A;  3LK1 A;  2JT0 A;  4A4C A;  1SR6 C;  1S26 D;  2VRG A;  2HF5 A;  2E6W A;  4Z4K A;  2OGR A;  1S1E A;  4ZF3 A;  2PVB A;  3ZNI A;  1K96 A;  3UFZ A;  3GK4 X;  3VHT A;  2AWM A;  1RM9 A;  1F4Q A;  3VK1 A;  1EMF A;  1W7I B;  4HSZ A;  4C0K A;  3NT9 A;  1OXF A;  3PSR A;  4PE4 A;  1UHK A;  1EG3 A;  1W7U A;  1JC0 A;  4QJ5 B;  1WLZ A;  2O60 A;  1IRJ A;  1CFC A;  4N5X A;  4PHM A;  2AWJ A;  1S6J A;  1KSO A;  1W7J B;  3ADF A;  3VRQ A;  3RWT A;  4A4B A;  1SCV A;  1R2U A;  4YRU A;  2OTG B;  2HET A;  3KCS A;  3I5I C;  1H4U A;  4W6H A;  1OMD A;  4ZCV A;  3WCK A;  3SSH A;  3TDI A;  2QLG B;  4XGY A;  4XVP A;  4W6T A;  2NZ0 A;  3O2P A;  2AHA A;  1SR6 B;  2JXL A;  2V4E A;  2GW4 B;  3KPX A;  3LK0 A;  2ZMW A;  4CID A;  2HJO A;  1KSM A;  4F0Z B;  2K8M B;  1HCJ A;  5EXB A;  3JVT C;  2LLU A;  2L5X B;  1EMM A;  5DKQ A;  2I2R E;  4DCK A;  1GQM A;  5JOL A;  1KK7 Y;  1F0B A;  1JC2 A;  1MXL C;  2Q57 A;  3O6B A;  1FI5 A;  3ZWH A;  1YUR A;  3RM1 A;  1OSA A;  3EK7 A;  2OKY A;  2LVJ A;  2V53 A;  3O4Y A;  4XJK B;  2M1U A;  3EK4 A;  5GQQ C;  3VGO A;  3DVE A;  2A48 A;  2H5Q A;  5BTT B;  3A8S A;  3GL4 A;  4DXM A;  1TRF A;  4CFR A;  2L4H A;  5J2O A;  1GFL A;  3ZUJ A;  2ZN8 A;  3I5I B;  2KDH A;  1OE9 B;  1WRK A;  3I5F C;  2FJU B;  1QAT A;  3BUO B;  1SW8 A;  1YRU B;  4I5K A;  4PE0 A;  2QPT A;  2AWL A;  4MRY A;  3U0L A;  4ZB1 A;  5DKR A;  1KWO C;  1SRA A;  4DXP A;  5HKW A;  1B1G A;  1J1E A;  3BOW B;  2LNK A;  5EB7 A;  2KBI A;  1CNP A;  4L9M A;  4EN1 A;  4I5L B;  2K2A A;  4YGB B;  1XA5 A;  5G08 A;  1XFZ O;  5AEQ A;  4EMQ A;  2KYC A;  3OX6 A;  1XFV O;  2HPS A;  4PPJ A;  2KI6 C;  4W6L A;  2EMN A;  5KSZ A;  1GGX A;  3F45 A;  1XFX O;  3BX9 A;  2DUI A;  4GAO A;  3AI4 A;  1F70 A;  1Q4C A;  1W7S A;  3I5G B;  2ZN9 A;  3SS0 A;  4ORC B;  5LK4 A;  4R6B A;  1EMK A;  3GEX A;  4GGN A;  5F9G A;  2QAC A;  2MAZ A;  1MQ1 A;  1WDC C;  2GW3 A;  2LMU A;  1W7T A;  3AKA A;  2H2K A;  3SVN A;  2FCD A;  1DTL A;  5KU1 A;  3I5F B;  3E3R A;  4OKH A;  1YUS A;  1C7W A;  4FQO A;  5H87 A;  1XFW O;  3I5H C;  3PJ5 A;  2BKI B;  1BU3 A;  1OZS A;  4PHJ A;  1XK4 A;  3CR4 X;  2KI6 D;  2K7B A;  2LHL A;  4NQG A;  3LS3 A;  2K2F A;  1VRK A;  3WNX B;  1Y1U A;  4GNK B;  1XYD A;  1YTZ C;  1CKK A;  3DQN A;  4BDU A;  1FBV A;  3WLD A;  3CS1 A;  1SL7 A;  4DXN A;  3O77 A;  5EB6 A;  1CFD A;  1IH0 A;  2KFH A;  1DJG A;  2COL B;  3U8C A;  3D10 A;  4H3N A;  1TNQ A;  2FZU A;  2BBN A;  4PE1 A;  5EHU A;  3DQ3 A;  4U8D A;  2DDD A;  1PRW A;  3DVJ A;  4TNC A;  2A53 B;  2LMV A;  3VRN A;  1XAE A;  2BCB A;  1WDC B;  1MHO A;  1UHH A;  1SNL A;  1M39 A;  1QIV A;  3BXC A;  2VVH A;  1F54 A;  3D0Y B;  5AER A;  3TS5 C;  4KW9 A;  1CLM A;  4I5N B;  2B3P A;  3KF9 A;  3U8P A;  1S6C A;  1M63 B;  2QZ0 A;  2M0R A;  1FPW A;  4W6N A;  5T3I A;  2JTZ A;  4AQI A;  1KQM B;  4ZCU A;  5LTP A;  2DUG A;  1K9U A;  1BLQ A;  3W1C A;  4HRE E;  2JT3 A;  2OS8 B;  4ICB A;  4RYS A;  4W75 A;  3SG4 A;  4U2V A;  2NLN A;  4PFE A;  1OXD A;  1UHI A;  5BPJ A;  1RJV A;  3U0N A;  3SVD A;  1J7Q A;  5HLV A;  2M97 A;  1IQ5 A;  2ISD A;  4OY4 A;  2HRS A;  1QV1 A;  3BXB A;  4QJ3 B;  3LVD A;  3DVK A;  1Y1A A;  3GB3 A;  3IQQ A;  2A47 A;  1AP4 A;  1YHH A;  1YZW A;  4IK3 A;  1JSA A;  2KAY A;  3TS5 B;  2WIS A;  2G6X A;  3LCP C;  3TDZ A;  1Y6W A;  4W72 A;  4OJ0 A;  5HZO A;  4W6G A;  3ED8 A;  4GF6 B;  5H89 A;  1JF0 A;  2KAV A;  5HLO A;  4UPG A;  2WSO A;  1J55 A;  4NWS A;  1A4P A;  3GOF A;  3SG5 A;  3FS7 A;  1BOD A;  1OZO A;  3DQ4 A;  2K7O A;  4MVF A;  1RTP 1;  1K9P A;  1NSH A;  3PM8 A;  5DQB A;  4L1I A;  4W6O A;  1UP5 A;  3CLN A;  2M8U A;  2M49 B;  3MGF A;  3DQL A;  1IGV A;  2LVV A;  3IR8 A;  3PJB A;  2DD9 A;  4HRG A;  1YVH A;  4YGE B;  1MWN A;  3FWB A;  1YHG A;  4XJK A;  5EBJ A;  1SCM C;  2WHT A;  1EL4 A;  1Q4E A;  2CTN A;  2LE9 B;  5EJU A;  3SG2 A;  1TNW A;  5PAL A;  4W73 A;  3U0M A;  4H48 A;  1LKJ A;  2WCF A;  4AR7 A;  3NEZ A;  1KYP A;  5DTL A;  1K95 A;  1CFP A;  3NSI A;  2KOT A;  1DMO A;  2LCP A;  1TTX A;  2MRD A;  1XSS A;  3V3D A;  2AUC A;  2G2B A;  1IJ5 A;  1TCF A;  3DQI A;  2Y4Q A;  5DRG A;  3KCT A;  4LJC A;  5DY6 A;  2EC6 C;  4KA9 A;  4CLN A;  4JFG A;  2HCG A;  3ZUL A;  4OV2 A;  3P28 A;  3ST2 A;  1IWQ A;  2H61 C;  4W6B A;  4TZA A;  1KFX S;  2E30 A;  1DGU A;  3PAT A;  3SVC A;  3NSK A;  4P76 A;  2SAS A;  2GX0 A;  1XMZ A;  1N2D A;  4KF5 C;  3IQO A;  1SCM B;  2Y1N A;  5HYD A;  2YFP A;  1IG5 A;  4W7F A;  2GV5 A;  4W6U A;  3CGA A;  3OP0 A;  2FCE A;  2HQ8 A;  1YJ2 A;  3OB2 B;  1OOJ A;  3BYA A;  3OSQ A;  3SST A;  4KF4 A;  3K1K A;  1NWD A;  3BUN B;  5I2Q A;  3DQO A;  4PHK A;  1HT9 A;  4W6D A;  1EMC A;  3GJ1 A;  3EVU A;  2AWK A;  1DJH A;  1DJY A;  2KBM A;  3TMT A;  4OHS A;  2L50 A;  1AJ4 A;  5HW9 A;  1SL9 A;  4W6C A;  1AJ5 A;  3SG3 A;  1QX5 B;  1CTR A;  3DD4 A;  4H3L A;  3DVM A;  4KGE A;  2O24 A;  3GK2 A;  1PVB A;  3DQK A;  4XL5 A;  2Z6Z A;  5BT0 A;  2DOQ A;  1LXF C;  1AUI B;  1WRL A;  1NX2 A;  4Q7R A;  4USL A;  2EMO A;  3NXA A;  1J7P A;  1RK9 A;  2DUH A;  4W6R A;  1AK8 A;  4PPK A;  1EMG A;  3PFV A;  2LP3 A;  1U5I A;  1C4F A;  5JJG A;  5FYX A;  4DXQ A;  1NP8 A;  3RWA A;  1RWY A;  2ZFD A;  2I7A A;  3CWG A;  2LV7 A;  2NCO A;  5F6T A;  4MN0 A;  1YVL A;  3NED A;  1JWD A;  2SCP A;  3LVC A;  5HKZ A;  3FWC A;  3HCM A;  1CMG A;  2HQZ A;  1DGV A;  5H88 A;  2F33 A;  3NT3 A;  4IZN A;  1G7K A;  3BUM B;  1NCZ A;  3NF0 A;  4PPL A;  1MUX A;  3BUX B;  3IF7 A;  3AKB A;  1N0Y A;  5HKY A;  2WND A;  2C9I A;  2Q4U A;  1B4C A;  1CDP A;  1Z1P A;  3DQA A;  4L12 A;  2F3Y A;  2OTE A;  3OHM B;  3SVB A;  2FWQ A;  1A29 A;  1BF5 A;  2A4J A;  2LLS A;  3SG6 A;  1QV0 A;  1JUO A;  5LTQ A;  2WHS A;  2BEC A;  1UHJ A;  2FOT A;  2K7D A;  1BT6 A;  3EKJ A;  2YDZ A;  4ZIN A;  3SV5 A;  1Z1Q A;  1Q73 A;  5EXU A;  1R6P A;  1XA9 A;  4OVN F;  1B7T Z;  2HGD A;  4GES B;  3JVT B;  1UHN A;  1F09 A;  2K7C A;  1CM1 A;  1DJZ A;  4W7X A;  2PXW A;  1XFY O;  2D8N A;  4NDC A;  1QYQ A;  5KTG A;  1Q4D A;  3SRY A;  1ZUX A;  2MHH A;  1B9A A;  4P2Y B;  1YFP A;  1KYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...