3EVUA

Crystal structure of calcium bound dimeric gcamp2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
410
structure length
393
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 123
structure length 393
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evuA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evuA01
1LVCD 1JUOA 2Q91A 2R2IA 4OY4A 4N1GA 5LTPA 1TOPA 1SR6C 3EVUA 4ORAB 3OB1B 4OJ0A 2F3YA 1DJXA 1DJYA 3OHMB 1DJIA 3IR8A 4XL5A 1UP5A 4I5LB 1H4BA 1K9KA 3CR4X 2AH8A 3H4SE 1JWDA 1LKJA 1TTXA 1X02A 4YGBB 4W7AA 3WXAA 4C0JA 2ZN9A 3PSRA 4HQCA 1CLBA 3AAKA 4DXOA 4H3LA 3VHTA 1M46A 3AKAA 5I8NA 2KI6D 1PSBA 1EG3A 2QT2A 3GB3A 1NSHA 4AQJA 3WLDA 3I19A 5DQBA 2MJWB 3SVNA 1F4QA 2LMTA 2O24A 2CTNA 3I5HC 2LE9B 4YBHB 5DQMA 2LMVA 5DRFA 3SVCA 1YX8A 3LVCA 1AK8A 2ZMUA 2MA2A 3SVSA 2ZNDA 1XVJA 2LLTA 1EMMA 1JFJA 3CR5X 3ED8A 3SSTA 2LMUA 2B3PA 1AJ4A 3GEXA 3WCKA 2LP2A 4KF5C 4ICBA 1Y1AA 2NXQA 4W6RA 5H89A 4W6FA 3CFFA 4AR7A 1KFXL 5AXIA 4I2YA 4HQ8A 2VADA 4EULA 1E8AA 1YHGA 4WQ2A 1XK4C 2D8NA 1J7QA 3LF4B 3TMTA 4CPVA 3U0KA 2JULA 2WNDA 2M49B 4LW5A 1A03A 1K94A 4I5KA 3CR2A 3DQ3A 5HZTA 1BLQA 5DKNA 1BU3A 3LS3A 4JRBA 4MZKA 2M1UA 2OGRA 2WCEA 3OX5A 3CD9A 1QIWA 1TCOB 4N3DA 2V53A 2FCEA 2Q57A 1YUUA 5HKWA 2AWJA 3EK8A 3SSPA 3GK4X 4BY5A 1EMAA 3ZTFA 1OXFA 1XFWO 1RRXA 3CTNA 4W7EA 1J7RA 1YX7A 5H87A 4JWQA 5EJUA 2NLNA 1DT7B 1LINA 2POXA 5HZOA 3OSRA 2A53B 2IE2A 2BKHB 4NDCA 4KEXA 1H4UA 1KQVA 1JBYA 2E6WA 4L1IA 3RWAA 3IQOA 4BY4A 1Y0VH 2KYFA 2FOTA 3SG5A 2ZRSA 1CNPA 2G16B 5KSZA 5DPJA 4UTSA 3BOWB 4U8DA 1ZUXA 4W6KA 2VZXA 1XYDA 4W6TA 2PMYA 2QLHA 2KI4B 1GJYA 4C0LA 2JT0A 3O2PA 1RJVA 2QPTA 1SW8A 1Z1PA 2SASA 2V4EC 1SCVA 2LCPA 4Q9XA 2IOVA 1WRKA 1ZGOA 1CM4A 1KYPA 2Z6XA 5HLOA 1G7KA 3JVTB 3RM1A 4P5OE 2HJOA 3DQ5A 3DQNA 2NCPA 2I7AA 4H47A 1J1DA 2A48A 3EK4A 1TRFA 4W6IA 1SRAA 1SL8A 4LJDA 1LXFC 2K61A 2HFCA 1QJTA 1EMLA 3TDZA 1YJ2A 1S26D 1IQ3A 4NDDA 1ZOTB 1UUSA 1W7UA 1B7TZ 2CNPA 2BTJA 1UHKA 2H5OA 1UHNA 3EVPA 1PALA 1BOCA 3SVUA 3ST0A 1F8HA 2TN4A 1YRUB 3A8RA 1L2OB 2VVIA 3PJBA 1K93D 3CZTX 4QJ4B 3SG7A 4MZLA 4OR9B 4CLNA 4PE1A 2JNXA 4NDBA 3DQ7A 1B4CA 2QU1A 1UISA 3TZ1A 2KI4C 1UWOA 3SSYA 1XA9A 2O2BA 3KO0A 3VRNA 4EN1A 2EMNA 4IK8A 3JVTC 1NCXA 2WURA 4P2YB 4MZJA 1QASA 2JT8A 2QLGA 2PVBA 4H3MA 5EXBA 1QVIZ 3SSKA 1W7TA 1DF0A 1IWQA 1CDPA 1ZFSA 2PASA 2PRUA 4W6HA 1YVLA 3U8AA 4ORNA 1XAEA 4GOBA 4IL1A 1LA3A 1BFPA 4ZF4A 2H5QA 4H48A 1MUXA 1FF1A 3DQFA 2KNEA 3SVOA 3LK1A 2LVKA 5G08A 1IKUA 4CFRA 3BXCA 3HCMA 4A4BA 2KGRA 4GGFA 4L9MA 4DKNA 2JNFA 3CD1A 2FZUA 2KAXA 3UFZA 1PRWA 1L2OC 2JZIA 4HRHA 2G3OA 2JOJA 3BUWB 2OKYA 2ZO7A 1YVHA 1MOVA 2OS8B 3E3RA 5ER5A 3PLFB 2H5PA 3DPXA 1S6ZA 1TNPA 3PFVA 1S5GY 4MRYA 1U5IA 5F6TA 4IZNA 4YGEB 5DTYA 4FQOA 4KGFA 1HQVA 1NUBA 1ODBA 2EMDA 5T3IA 2K8MB 4QJ5B 2KAVA 2HQZA 2DOQA 1JBZA 2ZO6A 1CMFA 1W7SA 1JFKA 3U0NA 1ZMZA 2JXCA 1M63B 1FW4A 3ICBA 5KTYA 4GBAA 3SG2A 1G4YR 1EL4A 5HKZA 1F4OA 1TCFA 4XYNA 2HRSA 5FHVA 3ST4A 1FPWA 2HF5A 3OSQA 4PE0A 4W7RA 2Y1NA 2IB6A 5EB6A 1SBJA 2JPTA 5FVFA 2M9GA 5CSNA 2LM5A 1W7IB 2I2RE 4M2OA 3AKBA 2MLEC 5DPIA 2KFGA 2LVIA 1CV7A 3DF0B 2DDDA 2M29A 3SG4A 1Q80A 4USLA 4W73A 1SL7A 1R6PA 2DDCA 1KK7Y 1N0YA 1OXEA 2OS8C 1C7WA 5ER4X 4XJKA 2HPWA 1PVAA 1UHJA 2AHAA 3ADFA 2L98A 5GQQC 3A4UB 2FCDA 5FVGA 3SS0A 4CIDA 4B30A 5BTTB 4IK4A 4YGCB 1NIWA 1J7OA 2BE6A 3CFHA 4GPLB 1JF0A 2DUIA 4W6AA 3FWCA 2HGYA 3LCPC 2ZKMX 1W7JB 3KF9A 3DVMA 3ZUFA 5IBWA 3DQHA 1RROA 1QV1A 1A75B 1YFPA 3BXAA 3VK1A 1B9AA 1B8LA 4W6BA 2WISA 4R6BA 2WCFA 2LLSA 1OZOA 4GUKA 1AHRA 3SIAA 1ALWA 2LHLA 2ICRA 3V3DA 1GGZA 2P6BB 1EMGA 5EXCI 1KFXS 1Q4AA 4DS7A 1QS7A 1KK8B 1GGXA 4WRIA 1RFJA 2KSPA 4NWSA 4ORCB 2B3QA 2KYCA 1QYQA 2G3DB 1MF8B 3TUYB 4E68A 5LTRA 3BXKA 1MR8A 3TDIA 1Y1XA 1OMDA 2DUHA 3NT9A 4W6GA 4W77A 2KOTA 5FVIA 1S36A 2I18A 2V4EA 3I5GB 4FTGA 5CSJA 3A8SA 2QZ0A 4OGSA 4BDUA 2DUFA 3GJ2A 2JU0A 1WRZA 2QRFA 4ZINA 1F54A 2DD7A 5DRGA 4Q9WA 2LC5A 4HQ9A 4PCWA 1WLMA 2MHHA 1OQPA 3DQEA 2Q4UA 2BL0B 4W6NA 3DQ9A 1FI5A 4TZAA 2QLEA 3I5FB 3K21A 2K7DA 3U8PA 1B47A 3RLZA 2OTEA 4YRUA 1CFPA 2LAPA 4KGEA 2RGIA 3ST2A 2A52B 1G8IA 3PATA 4MN0A 2A4JA 1NX2A 2ZFDA 2B1UA 2M7LA 2G2SB 1B8RA 4KW8A 1BODA 2K7OA 4WQ3A 3S05A 1UHIA 1B7TY 5DPHA 1YTZC 3P28A 3G9AA 1XFUO 3VHTB 1H8BA 2WOSA 1LA0A 5HZSA 3TMRA 2F8PA 1NCZA 1KK8C 4YGDB 2VVJA 3VICA 2JADA 3TUYC 5JJGA 2YE0A 3LF3A 4W6CA 3PIBA 4W74A 1H6RA 2G6YA 1MHOA 4PDZA 2Y5IA 4I5NB 4DXQA 4RYSA 5LTQA 3I5GC 3GOFA 5K89A 4W6UA 1JSAA 1EG4A 1DJHA 1EMBA 4MRXA 4LQTA 1CFDA 2PSRA 1QIVA 4R6DA 3DQAA 3SVEA 2BL0C 1QVIY 3RWTA 3I5FC 2H61C 1BR4B 5EHUA 1KFUL 1IQ5A 1BF5A 4QJ3B 4PFEA 2AUCA 4C0KA 2ISDA 1MQ1A 1HT9A 1K96A 3C1VA 3DQ4A 2KBMA 3NSLA 3M0WA 1UURA 3PJ5A 4OKHA 1A2XA 1CLLA 3SV5A 1CDLA 2G5ZB 2CCMA 2Y0GA 3DQOA 4W6DA 4GGNA 4W6LA 1CLMA 3DQDA 3SSVA 2HCGA 1YUTA 1NPQA 1D1OA 5AEQA 4PHJA 3MSEB 1R2UA 2H9WA 1QYFA 4DIRA 2O5GA 2WHUA 1MXLC 1IH0A 3KPXA 1K9UA 3NSOA 1JF2A 4B5YA 2DUEA 2NZ0A 1J1EA 5BQLA 2JXLA 3ZUJA 3EK7A 5CSIA 2G9BA 3GK1A 2FJUB 2K2AA 5H88A 5EBJA 1NWDA 1RECA 4HRGA 3DQCA 2KHNA 3PM8A 2A56B 2C9JA 3NT3A 1K95A 1J55A 4OCIA 3SRYA 3GL4A 3VROA 3DPWA 3DQUA 1KQMB 1B8CA 2K7BA 3LA1A 3CS1A 4XOVA 5D69A 2GX0A 3DVEA 2E30A 4HSZA 4NQGA 2LNKA 3PALA 1AP4A 2MLFC 3BUOB 4KW4A 2P4MA 2HETA 2GV5A 5I2LA 3VRPA 1SCMB 3BX9A 2A46A 3AKOA 3K1KA 5DTZA 2A47A 3KCTA 1YHIA 1F70A 1XFYO 2C9IA 4L12A 3F45A 4OV2A 3AAJA 4GFTA 1CMGA 1IRJA 2BBNA 2OTBA 3SJSA 4IK5A 1QV0A 1HCJA 1K8UA 2Z6ZA 3FIAA 1HUYA 1QXPA 3DQ1A 3P8UA 1C07A 4W6PA 1TNXA 3D0YB 3ZULA 2CXJA 4IK9A 4M2QA 3LVAA 4Z4MA 2JTTA 5DPGA 1GFLA 4ANJA 5KU1A 3IP2A 1DGUA 1A29A 1YR5A 1KQMC 1QTXA 2KAYA 2WORA 3SVRA 4DXMA 4W76A 4Q7UA 1RMMA 2WC8A 1K2HA 3SVDA 1YJFA 4KF4A 2ZRTA 5HZUA 2LANA 2IB5A 5BT0A 3W1DA 5HYDA 2HQWA 2G6XA 4Q7RA 1C7VA 3KCSA 1S6CA 3D10A 5HW9A 1WLZA 1M45A 2DD9A 3CLNA 4HE4A 2M1KB 5DKRA 1GGWA 3WNXB 2EMOA 2L5XB 1KCYA 3FS7A 2AWLA 3M22A 3DQ8A 1ZGQA 5DU0A 2BE4A 1SYMA 1EXRA 2MRDA 1OMVA 2JTZA 3CBEA 1OSAA 2QLGB 5AERA 1S3PA 4KF5A 1DF0B 4OHSA 2Z1OA 4KPIA 2PXWA 4YI8A 4MSPA 4JPZB 2LHIA 4LJDC 1DVIA 2K2FA 1QYOA 3NSIA 1XSSA 5I2QA 2L0PA 1XK4A 4U2VA 2LVJA 1V1GA 4W6JA 1RTP1 3EVVA 2RH7A 5DY6A 1A4PA 1B9CA 3O4YA 1F71A 1EMKA 3OP0A 2Y1MA 3AI5A 2DUGA 3DPZA 2COLB 1C4FA 4KW9A 3U8CA 1Y1UA 2LUCA 2M97A 1TIZA 4PPKA 4AOMA 4HREE 5I2OA 3NSKA 2AMIA 4H3NA 1U5IB 2HQKA 1OXDA 1PULA 3ST3A 1K9PA 2WCBA 2HQ8A 2ARLA 2BCBA 3ZWHA 4RYWA 1ZGPA 1KSMA 1DTLA 1ZACA 1MYWA 2JT3A 2H5RA 4EDOA 1CTRA 2SCPA 2A50B 4XOWA 4F0ZB 1JBAA 1QATA 2H61A 4TZGA 2ZMWA 3O6BA 3PN7B 4W6MA 2NCOA 5HGEA 2YE1A 1UHHA 3QRXA 2BECA 1WRLA 1RK9A 1RMOA 4DKMA 5DKQA 2WSOA 1DJZA 4P1QA 2LP3A 4W7XA 4GGFC 1BG1A 2YDZA 3VGOA 3DQJA 1QX5B 2K7CA 1Q4DA 3NEDA 1F09A 4GNKB 4W72A 3TS5B 2G2BA 2F33A 2H6VA 1S5GZ 3BQ3A 4MEWA 4XJKB 3CGAA 3BYAA 3DD4A 1F0BA 4I5JA 3SG6A 1M31A 4GESB 4J89A 2VRGA 2MAZA 1PSRA 1JC0A 3AI4A 4B30B 5AQBB 3DQKA 1NCYA 5HBDA 1BMOA 1M39A 4JEOA 2WHSA 2M7NA 3CWGA 4LJBA 2PXSA 1S6JA 2KFFA 4PALA 1CM1A 3FWBA 5J2OA 3PN7C 5HKYA 1IG5A 5LK4A 1ZUZA 3E5WA 4MVFA 1YZWA 4PE4A 1CFFA 4YGAA 2Z6YA 2EC6B 1KFUS 5CPVA 1SMGA 4PHKA 2AWMA 1EMEA 4EDSA 1TNWA 4IK3A 3DVKA 4OQWA 4GAOA 2M0RA 1G33A 4ORBB 3BOWA 1KK7Z 5DTLA 2PALA 4ZCUA 4N5XA 3JTDB 1VRKA 4KA9A 5AANA 3TS5C 3EKJA 2L4IA 2G6EA 5J3XA 2LLUA 5BPJA 3CB9A 2GGMA 1BT6A 3O77A 2BCXA 3H1OA 1DGVA 3EVRA 2V4EB 1OE9B 1XFZO 3LK0A 2F2OA 2EGDA 1CDNA 3SIBA 4ZFSA 2IS9A 4N1FA 4J88A 2L51A 2I94A 4ZB1A 3LLEA 2VVHA 3I5IB 1NX3A 4LQUA 1OZSA 3CFAA 1FI6A 3BXBA 5B8IB 2H2KA 1SNLA 4OVNF 2WIQA 2L50A 5AFPA 2K0JA 4KAGA 2LV7A 1EMCA 3VRQA 3DQLA 1KWOB 4CFQA 2GW4B 1YRTB 4PPLA 5TNCA 1WDCB 1JC1A 4Z4KA 3IF7A 4DRWA 2EC6C 4P76A 1AJ5A 1L7ZA 5JOLA 3SG3A 5CSFA 1SKTA 1YHHA 2M3WA 2JC2A 2KQ6A 1IJ5A 1K90D 1Q4EA 4ZBLA 1QXTA 2LVVA 3BUNB 3JTDC 1EH2A 3WHTB 2FL1A 1Y6WA 1B1GA 2A54B 3BUXB 1TNQA 4MLWA 4D1EA 3U0LA 1XMZA 4IK1A 2F2PA 2KI6C 1SK6D 1XO5A 5EB7A 4MBEA 3KHEA 3GJ1A 3SSHA 1F55A 5PALA 1FBVA 1CB1A 5EXUA 1SPYA 3D0YA 3I5IC 2EHBA 1Q73A 3H1RA 3ZNIA 3UG0A 2YFPA 3OGOA 1OMRA 4A4CA 4M2PA 1XFXO 2L2EA 4W7FA 1DJWA 5FYXA 1ALVA 2OKWA 2BCAA 2L4HA 2JWWA 4HVFA 1KWOC 2KQYA 1RM9A 1WDCC 4JQ0D 5DTXA 4W7DA 4DXIA 2HPSA 1QLKA 2QACA 3SSLA 3WHUB 2O29A 4W75A 4PHMA 2JQ6A 3VRRA 3M24A 1QLSA 2KGBC 3HX4A 2GX2A 4ETOA 4W69A 3OX6A 4R1EA 4XGYA 1KYSA 4PPJA 2JRFA 2ZNEA 1CDMA 1DMOA 2VAEA 3WLCA 1TN4A 3DQMA 1MWNA 3LL8B 2KBIA 2GGZA 1IJ6A 4DCKA 3EKHA 1KYRA 1PVBA 1WY9A 1DJGA 1BJFA 1BR1B 4ZF5A 1XFVO 1SY9A 2OTGB 1AUIB 4YI9A 1EJ3A 4DUQA 4Q7TA 2MBXA 3SVBA 1XQMA 3DVJA 1SCMC 2HGDA 3DQ2A 1JC2A 4W6SA 3DF0A 3GK2A 2Y4QA 3PJ7A 4PHNA 1J7PA 4Q04A 4W6OA 1Q4CA 1RWYA 1NX1A 2ZN8A 1NYAA 3W1CA 3OB2B 1OOJA 2H8QA 4W7CA 1Z1QA 1SL9A 3LVDA 2QLIA 4GF6B 3NF0A 3CGLA 5KTGA 5BTTA 1S6IA 2M8UA 2BKIB 1SR6B 3E5TA 4L13A 2AAOA 1MXEA 3DQ6A 3IQQA 1Q4BA 2KFHA 4PE7A 1IGVA 1GL4A 4LJCA 2WHTA 4UPGA 2KDHA 4EMQA 2CT9A 1PK0D 2WSNA 4XVPA 2BBMA 2CBLA 4DXPA 4JFGA 3U0MA 1XA5A 1NX0A 1A75A 2O60A 1QY3A 3E5VA 1KP5A 1AVSA 4JF9A 3NXAA 2AWKA 1N65A 2GW3A 1YUSA 1YURA 1V1FA 2OTGC 3MGFA 5D7FA 4AS8A 4J8AA 3DQIA 3TDUA 3LSAA 4AQIA 2OJKA 4ZF3A 4ZCVA 4ZIOA 2F3ZA 1CKKA 2LUXA 1QX2A 4JGEA 5HLVA 3I5HB 1NP8A 1CFCA 4TNCA 1MOUA 1N2DA 1RMPA 1KSOA 3O78A 4RTCA 5F9GA 3NEZA 2FWQA 4JC2A 1S1EA 2Q6PA 1EMFA 2OPOA 4DXNA 1GQMA 3KEVA 3BUMB 1QX7A
chains in the Genus database with same CATH superfamily
1LVCD 3B87A 1JUOA 3EG5B 2Q91A 2R2IA 4OY4A 4N1GA 5LTPA 3BFAA 1TOPA 1SR6C 3EVUA 4ORAB 3OB1B 4OJ0A 2F3YA 1DJXA 2FJYA 1DJYA 3OHMB 1DJIA 3IR8A 4XL5A 1UP5A 4I5LB 1H4BA 1K9KA 3CR4X 2AH8A 3H4SE 1JWDA 1LKJA 1TTXA 1X02A 4YGBB 4W7AA 3WXAA 4C0JA 2ZN9A 3PSRA 3S0GA 4HQCA 1CLBA 3AAKA 4DXOA 4H3LA 3S0DA 3VHTA 1M46A 3AKAA 3D76A 4INWA 2KI6D 1PSBA 5I8NA 3FE6A 1EG3A 2QT2A 3GB3A 1NSHA 4AQJA 3WLDA 3I19A 2KPHA 5DQBA 2MJWB 3SVNA 3UO9A 1F4QA 2LMTA 2O24A 2CTNA 3I5HC 2LE9B 4YBHB 5DQMA 2LMVA 5DRFA 3SVCA 1YX8A 3LVCA 1AK8A 2ZMUA 2MA2A 3SVSA 2ZNDA 1XVJA 2LLTA 1EMMA 1JFJA 1DEKA 3CR5X 3ED8A 3SSTA 2LMUA 2B3PA 1AJ4A 3GEXA 3WCKA 2LP2A 2WC5A 4KF5C 4ICBA 1Y1AA 2NXQA 4W6RA 5H89A 4W6FA 3CFFA 4AR7A 1KFXL 5AXIA 3S0FA 2BAPA 4I2YA 4HQ8A 3CZ0A 2VADA 4EULA 1E8AA 1YHGA 4WQ2A 1XK4C 2D8NA 1J7QA 3LF4B 3TMTA 4CPVA 3U0KA 2JULA 2WNDA 2M49B 4LW5A 1A03A 1K94A 1W9ZA 2QEVA 4I5KA 3CR2A 3DQ3A 5HZTA 1BLQA 5DKNA 1BU3A 3LS3A 4JRBA 4MZKA 2M1UA 2OGRA 2WCEA 3OX5A 3CD9A 5FI7A 1QIWA 2H8VA 1TCOB 4N3DA 2V53A 2FCEA 2Q57A 1YUUA 5HKWA 3N7HA 2AWJA 3EK8A 3SSPA 3GK4X 4BY5A 2BNXA 1EMAA 3ZTFA 2KLEA 1OXFA 1XFWO 1RRXA 3CTNA 4W7EA 1J7RA 1YX7A 5H87A 3BJHA 4JWQA 5EJUA 2NLNA 1DT7B 1LINA 2POXA 3B7AA 5HZOA 3OSRA 2A53B 2IE2A 2BKHB 3CZ2A 4NDCA 4KEXA 1H4UA 1KQVA 1JBYA 2E6WA 4L1IA 3RWAA 3IQOA 4BY4A 1Y0VH 2KYFA 2FOTA 1C3YA 3SG5A 2ZRSA 1CNPA 2G16B 5KSZA 5DPJA 4UTSA 3BOWB 4U8DA 1ZUXA 4W6KA 2VZXA 1XYDA 4W6TA 2PMYA 2QLHA 2KI4B 1GJYA 4C0LA 2JT0A 3O2PA 1RJVA 2QPTA 1SW8A 1Z1PA 2SASA 2V4EC 1SCVA 2LCPA 2IOVA 1WRKA 4Q9XA 1ZGOA 1CM4A 1KYPA 2Z6XA 5HLOA 1G7KA 3JVTB 3RM1A 4P5OE 2HJOA 3DQ5A 3DQNA 2NCPA 2I7AA 4H47A 1J1DA 2A48A 3EK4A 1DELA 1TRFA 4W6IA 1SRAA 1SL8A 4LJDA 1LXFC 3V2LA 2K61A 2HFCA 1QJTA 1EMLA 3TDZA 1YJ2A 1S26D 1IQ3A 4NDDA 1ZOTB 1UUSA 1W7UA 1B7TZ 2CNPA 2BTJA 1UHKA 2H5OA 1UHNA 3EVPA 1PALA 1BOCA 3SVUA 2ERBA 3ST0A 1F8HA 2TN4A 1YRUB 3A8RA 1L2OB 2VVIA 3PJBA 1K93D 3CZTX 2WCJA 4QJ4B 3SG7A 4MZLA 3BFHA 4OR9B 4CLNA 4PE1A 2JNXA 4NDBA 3DQ7A 1B4CA 2QU1A 1UISA 3TZ1A 2KI4C 1UWOA 3SSYA 1XA9A 2O2BA 3KO0A 3VRNA 3BFBA 4EN1A 2EMNA 4IK8A 3JVTC 1NCXA 2WURA 4P2YB 4MZJA 1QASA 2JT8A 1IIOA 2QLGA 2PVBA 4H3MA 5EXBA 1QVIZ 3SSKA 1W7TA 1DF0A 1IWQA 1CDPA 1ZFSA 2PASA 2PRUA 5I94A 4W6HA 1YVLA 3U8AA 4ORNA 1XAEA 4GOBA 4IL1A 1LA3A 1BFPA 3NHTA 4ZF4A 2H5QA 4H48A 1MUXA 1FF1A 3DQFA 2KNEA 3SVOA 3LK1A 2LVKA 5G08A 1IKUA 4CFRA 3BXCA 3HCMA 4A4BA 2KGRA 4GGFA 4L9MA 4DKNA 2JNFA 3CD1A 2FZUA 2KAXA 3UFZA 1PRWA 1L2OC 2JZIA 4HRHA 2G3OA 2JOJA 3BUWB 2OKYA 2ZO7A 1YVHA 1MOVA 2OS8B 3E3RA 5ER5A 3PLFB 1GM0A 2H5PA 3DPXA 1S6ZA 1TNPA 3PFVA 1S5GY 4MRYA 1U5IA 5F6TA 4IZNA 4YGEB 5DTYA 4FQOA 4KGFA 1HQVA 1NUBA 1ODBA 2EMDA 5T3IA 2K8MB 4QJ5B 2KAVA 2HQZA 2DOQA 1JBZA 2ZO6A 1CMFA 1W7SA 1JFKA 3U0NA 1ZMZA 2JXCA 1M63B 1FW4A 3ICBA 5KTYA 4GBAA 3SG2A 1G4YR 1EL4A 3NHIA 5HKZA 1F4OA 1TCFA 4XYNA 2HRSA 5FHVA 3ST4A 1FPWA 2HF5A 3OSQA 4PE0A 4W7RA 2Y1NA 2IB6A 5EB6A 1SBJA 2JPTA 5FVFA 2M9GA 5CSNA 2LM5A 1W7IB 2I2RE 4M2OA 3AKBA 2MLEC 5DPIA 2KFGA 2LVIA 1CV7A 3DF0B 2DDDA 2M29A 3SG4A 1Q80A 4USLA 4W73A 1SL7A 1R6PA 2DDCA 1KK7Y 1N0YA 1OXEA 2OS8C 1C7WA 5ER4X 4XJKA 2HPWA 2WCKA 1PVAA 1UHJA 2AHAA 3ADFA 2L98A 5GQQC 3A4UB 2FCDA 5FVGA 3SS0A 4CIDA 4B30A 5BTTB 4IK4A 4YGCB 1NIWA 1J7OA 3S0BA 2BE6A 3CFHA 4GPLB 1JF0A 2DUIA 4W6AA 3FWCA 2HGYA 3LCPC 2ZKMX 1W7JB 3KF9A 3DVMA 3ZUFA 5IBWA 3DQHA 1RROA 1QV1A 1A75B 1YFPA 3BXAA 3VK1A 1B9AA 1B8LA 4W6BA 2WISA 4R6BA 3RZSA 2WCFA 2LLSA 1OZOA 4GUKA 1AHRA 3SIAA 1ALWA 2LHLA 2ICRA 3V3DA 2K60A 3D73A 1GGZA 2P6BB 1EMGA 5EXCI 1KFXS 1Q4AA 4DS7A 1QS7A 1KK8B 2WCLA 1GGXA 4WRIA 1RFJA 2KSPA 4NWSA 4ORCB 2B3QA 2KYCA 4IJ7A 1QYQA 2G3DB 1MF8B 3TUYB 4E68A 5LTRA 3BXKA 1MR8A 3TDIA 1Y1XA 1OMDA 2DUHA 3NT9A 4W6GA 4W77A 2KOTA 5FVIA 1S36A 2I18A 2V4EA 3I5GB 4FTGA 5CSJA 3A8SA 2QZ0A 4OGSA 4BDUA 2DUFA 3GJ2A 2JU0A 1WRZA 2QRFA 4ZINA 1F54A 2DD7A 5DRGA 4Q9WA 3S0AA 2LC5A 4HQ9A 4PCWA 1WLMA 2MHHA 1OQPA 3DQEA 2Q4UA 2BL0B 4W6NA 3DQ9A 1FI5A 4TZAA 2QLEA 3I5FB 3K21A 3CZ1A 1OW4A 3L4LA 2K7DA 3IVTA 4F7FA 1B47A 3U8PA 3RLZA 2OTEA 4YRUA 1CFPA 2LAPA 4KGEA 2RGIA 3ST2A 2A52B 1G8IA 3PATA 4MN0A 2A4JA 1NX2A 2ZFDA 2B1UA 2M7LA 2G2SB 1B8RA 4KW8A 1BODA 2K7OA 4WQ3A 3S05A 1UHIA 1B7TY 5DPHA 1YTZC 3P28A 3G9AA 1XFUO 3VHTB 1H8BA 2WOSA 1LA0A 1ORGA 5HZSA 3TMRA 2F8PA 1NCZA 1KK8C 3R1OA 4YGDB 2VVJA 3VICA 2JADA 2QEHA 3TUYC 5JJGA 2YE0A 3LF3A 4W6CA 3PIBA 4W74A 1H6RA 2G6YA 1MHOA 4PDZA 2Y5IA 4I5NB 4DXQA 4RYSA 5LTQA 3I5GC 3GOFA 5K89A 4W6UA 1JSAA 1EG4A 1DJHA 1EMBA 4MRXA 4LQTA 1CFDA 2PSRA 1QIVA 4R6DA 3DQAA 3SVEA 2BL0C 1QVIY 3RWTA 3I5FC 2H61C 1BR4B 5EHUA 1KFUL 1IQ5A 1BF5A 4QJ3B 4PFEA 2AUCA 4C0KA 2ISDA 1MQ1A 1HT9A 1K96A 3C1VA 3DQ4A 2KBMA 3O4XA 3NSLA 3M0WA 1UURA 3R1VA 3PJ5A 4OKHA 1A2XA 1CLLA 3SV5A 1CDLA 2G5ZB 2CCMA 2Y0GA 3DQOA 4W6DA 4GGNA 4W6LA 1CLMA 3DQDA 1QWVA 3SSVA 2HCGA 1YUTA 1NPQA 1D1OA 5AEQA 4PHJA 5EL2A 4PT1A 3MSEB 1R2UA 2H9WA 1LS8A 1QYFA 4DIRA 2O5GA 2WHUA 1MXLC 1IH0A 3KPXA 1K9UA 3NSOA 1JF2A 4B5YA 2DUEA 3R1PA 5D3OA 2NZ0A 1J1EA 5BQLA 2JXLA 3ZUJA 2P70A 3EK7A 5CSIA 2G9BA 3GK1A 2FJUB 2P71A 2K2AA 5H88A 5EBJA 1NWDA 1RECA 4HRGA 3DQCA 2KHNA 2PQLA 3PM8A 2A56B 3NT3A 2C9JA 1K95A 1J55A 1TWOA 4OCIA 3SRYA 3GL4A 3VROA 3DPWA 3DQUA 1KQMB 2JPOA 1B8CA 2K7BA 3LA1A 3CS1A 4XOVA 5D69A 2GX0A 3DVEA 2E30A 4HSZA 4NQGA 2LNKA 3PALA 1AP4A 2MLFC 3BUOB 4KW4A 2P4MA 2HETA 2GV5A 5I2LA 3VRPA 1SCMB 3BX9A 2A46A 3AKOA 3K1KA 3DYEA 5DTZA 2A47A 3KCTA 1YHIA 1F70A 1XFYO 2C9IA 4L12A 3F45A 4OV2A 3AAJA 4GFTA 1CMGA 1IRJA 2BBNA 2OTBA 3SJSA 4IK5A 1QV0A 1HCJA 1K8UA 2Z6ZA 2GTEA 3FIAA 1HUYA 1QXPA 2L2CA 3DQ1A 3P8UA 1C07A 4W6PA 1TNXA 3D0YB 3ZULA 2CXJA 4IK9A 4M2QA 3LVAA 4Z4MA 2JTTA 5DPGA 1GFLA 4ANJA 5KU1A 3IP2A 1DGUA 1A29A 1YR5A 1KQMC 1QTXA 2KAYA 2WORA 3SVRA 3R72A 3VB1A 4DXMA 4W76A 2KLDA 4Q7UA 1RMMA 2WC8A 1K2HA 3D77A 3SVDA 1YJFA 4KF4A 2ZRTA 5HZUA 2LANA 2IB5A 5BT0A 3W1DA 5HYDA 2HQWA 2G6XA 4Q7RA 3CABA 1DC1A 1C7VA 3KCSA 1S6CA 3D10A 5HW9A 1WLZA 1M45A 2DD9A 3CLNA 4HE4A 2M1KB 5DKRA 1GGWA 3WNXB 2EMOA 2L5XB 1KCYA 3FS7A 2AWLA 3M22A 3DQ8A 1ZGQA 5DU0A 2BE4A 1SYMA 1EXRA 2MRDA 1OMVA 2JTZA 3CBEA 1OSAA 2QLGB 5AERA 1S3PA 4KF5A 1DF0B 4OHSA 2Z1OA 4KPIA 2PXWA 4YI8A 4MSPA 4JPZB 2LHIA 4LJDC 1DVIA 2K2FA 3OGNA 1QYOA 3NSIA 1XSSA 5I2QA 2L0PA 1XK4A 4U2VA 2LVJA 1V1GA 1RTP1 3EVVA 2RH7A 4W6JA 5DY6A 1A4PA 1B9CA 3O4YA 1F71A 1EMKA 3OP0A 2Y1MA 2PYQA 3AI5A 1TUJA 2DUGA 3DPZA 2COLB 1C4FA 4KW9A 3U8CA 1Y1UA 2LUCA 2M97A 1TIZA 4PPKA 4AOMA 4HREE 5I2OA 3NSKA 2AMIA 4H3NA 1U5IB 2HQKA 1OXDA 1PULA 3ST3A 1K9PA 2WCBA 2HQ8A 2ARLA 2BCBA 3ZWHA 4RYWA 1ZGPA 1KSMA 1DTLA 1ZACA 1MYWA 2JT3A 2H5RA 4EDOA 1CTRA 2SCPA 2A50B 4XOWA 4F0ZB 1JBAA 1QATA 2H61A 4TZGA 2ZMWA 3O6BA 1Z4HA 3PN7B 4W6MA 2NCOA 5HGEA 2YE1A 1UHHA 3QRXA 2BECA 4JD9A 1WRLA 1RK9A 1RMOA 4DKMA 5DKQA 2WSOA 1T14A 1DJZA 4P1QA 2LP3A 4W7XA 4GGFC 1BG1A 2YDZA 3VGOA 3DQJA 1QX5B 2K7CA 1Q4DA 3NEDA 1F09A 4GNKB 4W72A 3TS5B 2QEBA 2G2BA 2F33A 2H6VA 1S5GZ 3BQ3A 4MEWA 4XJKB 3CGAA 3BYAA 3DD4A 1F0BA 4I5JA 3SG6A 1M31A 1Z2CB 3DZTA 4GESB 5DICA 4J89A 2VRGA 2MAZA 1PSRA 1JC0A 3AI4A 4B30B 5AQBB 3DQKA 1NCYA 5HBDA 1BMOA 1M39A 4JEOA 2WHSA 2M7NA 3CWGA 4LJBA 2PXSA 1S6JA 2KFFA 4PALA 1CM1A 3FWBA 5J2OA 3PN7C 5HKYA 2WCHA 1IG5A 5LK4A 1ZUZA 3E5WA 4MVFA 1YZWA 4PE4A 1CFFA 3CYZA 4YGAA 2Z6YA 2EC6B 1KFUS 5CPVA 1SMGA 4PHKA 2AWMA 1EMEA 4EDSA 3B6XA 1TNWA 4IK3A 3DVKA 4OQWA 4GAOA 2M0RA 1G33A 4ORBB 3BOWA 1KK7Z 5DTLA 2PALA 4ZCUA 4N5XA 3JTDB 1VRKA 3PJIA 4KA9A 5AANA 5HL1A 3TS5C 3EKJA 2L4IA 3SS4A 2G6EA 5J3XA 2LLUA 5BPJA 3CB9A 2GGMA 1BT6A 3O77A 2BCXA 3QMEA 3SS3A 3H1OA 1DGVA 3EVRA 4FQTA 2V4EB 1OE9B 2WC6A 1XFZO 3LK0A 2F2OA 2EGDA 1CDNA 3SIBA 4ZFSA 2IS9A 4N1FA 4J88A 3D78A 2L51A 2I94A 4ZB1A 3LLEA 3PM2A 2VVHA 3I5IB 3DY9A 1NX3A 4LQUA 1OZSA 3CFAA 1FI6A 3BXBA 5B8IB 2H2KA 1SNLA 4OVNF 2WIQA 2L50A 5AFPA 2K0JA 4KAGA 2LV7A 1EMCA 3VRQA 3DQLA 1KWOB 4CFQA 2GW4B 1YRTB 4PPLA 5TNCA 1WDCB 1JC1A 1P28A 3OBVA 1C3ZA 4Z4KA 3IF7A 4DRWA 2EC6C 4KYNA 4P76A 1AJ5A 1L7ZA 5JOLA 3SG3A 5CSFA 1SKTA 1YHHA 2M3WA 2JC2A 2KQ6A 1IJ5A 1K90D 1Q4EA 4ZBLA 1QXTA 2LVVA 3BUNB 3JTDC 3L47A 1EH2A 3WHTB 2FL1A 1Y6WA 1B1GA 2A54B 3BUXB 1TNQA 4MLWA 4D1EA 3U0LA 1XMZA 4IK1A 3DXLA 2F2PA 2KI6C 1SK6D 1XO5A 5EB7A 4MBEA 3KHEA 3GJ1A 3SSHA 1F55A 2YGUA 5PALA 1FBVA 1CB1A 5EXUA 1SPYA 3S0EA 3D0YA 3L4AA 3I5IC 2EHBA 1Q73A 3H1RA 3ZNIA 1SSEB 3UG0A 2YFPA 3OGOA 1OMRA 4A4CA 4M2PA 1XFXO 2L2EA 4W7FA 1DJWA 5FYXA 1ALVA 2OKWA 2BCAA 2L4HA 2JWWA 4HVFA 1KWOC 2KQYA 1RM9A 1WDCC 4JQ0D 5DTXA 2QDIA 4W7DA 4DXIA 2HPSA 1QLKA 3CDNA 2QACA 3SSLA 3WHUB 2O29A 4W75A 4PHMA 1DQEA 2JQ6A 3VRRA 3M24A 1QLSA 2KGBC 3HX4A 2GX2A 1OOIX 4ETOA 4W69A 3OX6A 4R1EA 4XGYA 1KYSA 4PPJA 2JRFA 2ZNEA 1CDMA 5FI2A 2QEOA 1DMOA 2VAEA 3K1EA 3WLCA 1TN4A 3DQMA 1MWNA 3LL8B 2KBIA 2GGZA 1IJ6A 4DCKA 3FE8A 3EKHA 1KYRA 1PVBA 1WY9A 1DJGA 1BJFA 1XFRA 1BR1B 4ZF5A 1XFVO 1SY9A 2OTGB 3B88A 1AUIB 4YI9A 1EJ3A 4DUQA 4Q7TA 2MBXA 3SVBA 1XQMA 3DVJA 1SCMC 2HGDA 3DQ2A 1TUZA 1JC2A 4W6SA 3DF0A 3Q8IA 3D75A 3GK2A 2Y4QA 3PJ7A 4PHNA 1J7PA 4Q04A 4W6OA 1Q4CA 1RWYA 1NX1A 2ZN8A 1NYAA 3W1CA 3OB2B 1OOJA 2H8QA 4W7CA 1Z1QA 1SL9A 3LVDA 2QLIA 4GF6B 3NF0A 3CGLA 5KTGA 5BTTA 1S6IA 2M8UA 2BKIB 3B86A 1SR6B 3E5TA 4L13A 2AAOA 1MXEA 1OOFA 3DQ6A 3IQQA 1Q4BA 4JKTA 2KFHA 4PE7A 1IGVA 1GL4A 4LJCA 2WHTA 4UPGA 2KDHA 4EMQA 2CT9A 1PK0D 2WSNA 4XVPA 4OZDA 2BBMA 2CBLA 4DXPA 4JFGA 3U0MA 1XA5A 1NX0A 1A75A 2O60A 1QY3A 3E5VA 1KP5A 1AVSA 1OOGA 4JF9A 3FE9A 3NXAA 2AWKA 3SS5A 2GW3A 1N65A 1YUSA 1YURA 1V1FA 2OTGC 3MGFA 5D7FA 4AS8A 4J8AA 2WCMA 3DQIA 4INXA 3D74A 3TDUA 1OOHA 3NGVA 3LSAA 4AQIA 2OJKA 4ZF3A 3UNWA 5FI6A 4ZCVA 4ZIOA 2F3ZA 1CKKA 2LUXA 1QX2A 2L5YA 4JGEA 5HLVA 3I5HB 1NP8A 1CFCA 4TNCA 1MOUA 1N2DA 1RMPA 1KSOA 3O78A 4RTCA 5F9GA 3NEZA 2FWQA 4JC2A 1S1EA 2Q6PA 1EMFA 2OPOA 4DXNA 1GQMA 3KEVA 3BUMB 1QX7A
chains in the Genus database with same CATH topology
1LVCD 1JUOA 2Q91A 2R2IA 4OY4A 4N1GA 5LTPA 1TOPA 1SR6C 3EVUA 4ORAB 3OB1B 4OJ0A 2F3YA 1DJXA 1DJYA 3OHMB 1DJIA 3IR8A 4XL5A 1UP5A 4I5LB 1H4BA 1K9KA 3CR4X 2AH8A 3H4SE 1JWDA 1LKJA 1TTXA 1X02A 4YGBB 4W7AA 3WXAA 4C0JA 2ZN9A 3PSRA 4HQCA 1CLBA 3AAKA 4DXOA 4H3LA 3VHTA 1M46A 3AKAA 5I8NA 2KI6D 1PSBA 1EG3A 2QT2A 3GB3A 1NSHA 4AQJA 3WLDA 3I19A 5DQBA 2MJWB 3SVNA 1F4QA 2LMTA 2O24A 2CTNA 3I5HC 2LE9B 4YBHB 5DQMA 2LMVA 5DRFA 3SVCA 1YX8A 3LVCA 1AK8A 2ZMUA 2MA2A 3SVSA 2ZNDA 1XVJA 2LLTA 1EMMA 1JFJA 3CR5X 3ED8A 3SSTA 2LMUA 2B3PA 1AJ4A 3GEXA 3WCKA 2LP2A 4KF5C 4ICBA 1Y1AA 2NXQA 4W6RA 5H89A 4W6FA 3CFFA 4AR7A 1KFXL 5AXIA 4I2YA 4HQ8A 2VADA 4EULA 1E8AA 1YHGA 4WQ2A 1XK4C 2D8NA 1J7QA 3LF4B 3TMTA 4CPVA 3U0KA 2JULA 2WNDA 2M49B 4LW5A 1A03A 1K94A 4I5KA 3CR2A 3DQ3A 5HZTA 1BLQA 5DKNA 1BU3A 3LS3A 4JRBA 4MZKA 2M1UA 2OGRA 2WCEA 3OX5A 3CD9A 1QIWA 1TCOB 4N3DA 2V53A 2FCEA 2Q57A 1YUUA 5HKWA 2AWJA 3EK8A 3SSPA 3GK4X 4BY5A 1EMAA 3ZTFA 1OXFA 1XFWO 1RRXA 3CTNA 4W7EA 1J7RA 1YX7A 5H87A 4JWQA 5EJUA 2NLNA 1DT7B 1LINA 2POXA 5HZOA 3OSRA 2A53B 2IE2A 2BKHB 4NDCA 4KEXA 1H4UA 1KQVA 1JBYA 2E6WA 4L1IA 3RWAA 3IQOA 4BY4A 1Y0VH 2KYFA 2FOTA 3SG5A 2ZRSA 1CNPA 2G16B 5KSZA 5DPJA 4UTSA 3BOWB 4U8DA 1ZUXA 4W6KA 2VZXA 1XYDA 4W6TA 2PMYA 2QLHA 2KI4B 1GJYA 4C0LA 2JT0A 3O2PA 1RJVA 2QPTA 1SW8A 1Z1PA 2SASA 2V4EC 1SCVA 2LCPA 4Q9XA 2IOVA 1WRKA 1ZGOA 1CM4A 1KYPA 2Z6XA 5HLOA 1G7KA 3JVTB 3RM1A 4P5OE 2HJOA 3DQ5A 3DQNA 2NCPA 2I7AA 4H47A 1J1DA 2A48A 3EK4A 1TRFA 4W6IA 1SRAA 1SL8A 4LJDA 1LXFC 2K61A 2HFCA 1QJTA 1EMLA 3TDZA 1YJ2A 1S26D 1IQ3A 4NDDA 1ZOTB 1UUSA 1W7UA 1B7TZ 2CNPA 2BTJA 1UHKA 2H5OA 1UHNA 3EVPA 1PALA 1BOCA 3SVUA 3ST0A 1F8HA 2TN4A 1YRUB 3A8RA 1L2OB 2VVIA 3PJBA 1K93D 3CZTX 4QJ4B 3SG7A 4MZLA 4OR9B 4CLNA 4PE1A 2JNXA 4NDBA 3DQ7A 1B4CA 2QU1A 1UISA 3TZ1A 2KI4C 1UWOA 3SSYA 1XA9A 2O2BA 3KO0A 3VRNA 4EN1A 2EMNA 4IK8A 3JVTC 1NCXA 2WURA 4P2YB 4MZJA 1QASA 2JT8A 2QLGA 2PVBA 4H3MA 5EXBA 1QVIZ 3SSKA 1W7TA 1DF0A 1IWQA 1CDPA 1ZFSA 2PASA 2PRUA 4W6HA 1YVLA 3U8AA 4ORNA 1XAEA 4GOBA 4IL1A 1LA3A 1BFPA 4ZF4A 2H5QA 4H48A 1MUXA 1FF1A 3DQFA 2KNEA 3SVOA 3LK1A 2LVKA 5G08A 1IKUA 4CFRA 3BXCA 3HCMA 4A4BA 2KGRA 4GGFA 4L9MA 4DKNA 2JNFA 3CD1A 2FZUA 2KAXA 3UFZA 1PRWA 1L2OC 2JZIA 4HRHA 2G3OA 2JOJA 3BUWB 2OKYA 2ZO7A 1YVHA 1MOVA 2OS8B 3E3RA 5ER5A 3PLFB 2H5PA 3DPXA 1S6ZA 1TNPA 3PFVA 1S5GY 4MRYA 1U5IA 5F6TA 4IZNA 4YGEB 5DTYA 4FQOA 4KGFA 1HQVA 1NUBA 1ODBA 2EMDA 5T3IA 2K8MB 4QJ5B 2KAVA 2HQZA 2DOQA 1JBZA 2ZO6A 1CMFA 1W7SA 1JFKA 3U0NA 1ZMZA 2JXCA 1M63B 1FW4A 3ICBA 5KTYA 4GBAA 3SG2A 1G4YR 1EL4A 5HKZA 1F4OA 1TCFA 4XYNA 2HRSA 5FHVA 3ST4A 1FPWA 2HF5A 3OSQA 4PE0A 4W7RA 2Y1NA 2IB6A 5EB6A 1SBJA 2JPTA 5FVFA 2M9GA 5CSNA 2LM5A 1W7IB 2I2RE 4M2OA 3AKBA 2MLEC 5DPIA 2KFGA 2LVIA 1CV7A 3DF0B 2DDDA 2M29A 3SG4A 1Q80A 4USLA 4W73A 1SL7A 1R6PA 2DDCA 1KK7Y 1N0YA 1OXEA 2OS8C 1C7WA 5ER4X 4XJKA 2HPWA 1PVAA 1UHJA 2AHAA 3ADFA 2L98A 5GQQC 3A4UB 2FCDA 5FVGA 3SS0A 4CIDA 4B30A 5BTTB 4IK4A 4YGCB 1NIWA 1J7OA 2BE6A 3CFHA 4GPLB 1JF0A 2DUIA 4W6AA 3FWCA 2HGYA 3LCPC 2ZKMX 1W7JB 3KF9A 3DVMA 3ZUFA 5IBWA 3DQHA 1RROA 1QV1A 1A75B 1YFPA 3BXAA 3VK1A 1B9AA 1B8LA 4W6BA 2WISA 4R6BA 2WCFA 2LLSA 1OZOA 4GUKA 1AHRA 3SIAA 1ALWA 2LHLA 2ICRA 3V3DA 1GGZA 2P6BB 1EMGA 5EXCI 1KFXS 1Q4AA 4DS7A 1QS7A 1KK8B 1GGXA 4WRIA 1RFJA 2KSPA 4NWSA 4ORCB 2B3QA 2KYCA 1QYQA 2G3DB 1MF8B 3TUYB 4E68A 5LTRA 3BXKA 1MR8A 3TDIA 1Y1XA 1OMDA 2DUHA 3NT9A 4W6GA 4W77A 2KOTA 5FVIA 1S36A 2I18A 2V4EA 3I5GB 4FTGA 5CSJA 3A8SA 2QZ0A 4OGSA 4BDUA 2DUFA 3GJ2A 2JU0A 1WRZA 2QRFA 4ZINA 1F54A 2DD7A 5DRGA 4Q9WA 2LC5A 4HQ9A 4PCWA 1WLMA 2MHHA 1OQPA 3DQEA 2Q4UA 2BL0B 4W6NA 3DQ9A 1FI5A 4TZAA 2QLEA 3I5FB 3K21A 2K7DA 3U8PA 1B47A 3RLZA 2OTEA 4YRUA 1CFPA 2LAPA 4KGEA 2RGIA 3ST2A 2A52B 1G8IA 3PATA 4MN0A 2A4JA 1NX2A 2ZFDA 2B1UA 2M7LA 2G2SB 1B8RA 4KW8A 1BODA 2K7OA 4WQ3A 3S05A 1UHIA 1B7TY 5DPHA 1YTZC 3P28A 3G9AA 1XFUO 3VHTB 1H8BA 2WOSA 1LA0A 5HZSA 3TMRA 2F8PA 1NCZA 1KK8C 4YGDB 2VVJA 3VICA 2JADA 3TUYC 5JJGA 2YE0A 3LF3A 4W6CA 3PIBA 4W74A 1H6RA 2G6YA 1MHOA 4PDZA 2Y5IA 4I5NB 4DXQA 4RYSA 5LTQA 3I5GC 3GOFA 5K89A 4W6UA 1JSAA 1EG4A 1DJHA 1EMBA 4MRXA 4LQTA 1CFDA 2PSRA 1QIVA 4R6DA 3DQAA 3SVEA 2BL0C 1QVIY 3RWTA 3I5FC 2H61C 1BR4B 5EHUA 1KFUL 1IQ5A 1BF5A 4QJ3B 4PFEA 2AUCA 4C0KA 2ISDA 1MQ1A 1HT9A 1K96A 3C1VA 3DQ4A 2KBMA 3NSLA 3M0WA 1UURA 3PJ5A 4OKHA 1A2XA 1CLLA 3SV5A 1CDLA 2G5ZB 2CCMA 2Y0GA 3DQOA 4W6DA 4GGNA 4W6LA 1CLMA 3DQDA 3SSVA 2HCGA 1YUTA 1NPQA 1D1OA 5AEQA 4PHJA 3MSEB 1R2UA 2H9WA 1QYFA 4DIRA 2O5GA 2WHUA 1MXLC 1IH0A 3KPXA 1K9UA 3NSOA 1JF2A 4B5YA 2DUEA 2NZ0A 1J1EA 5BQLA 2JXLA 3ZUJA 3EK7A 5CSIA 2G9BA 3GK1A 2FJUB 2K2AA 5H88A 5EBJA 1NWDA 1RECA 4HRGA 3DQCA 2KHNA 3PM8A 2A56B 2C9JA 3NT3A 1K95A 1J55A 4OCIA 3SRYA 3GL4A 3VROA 3DPWA 3DQUA 1KQMB 1B8CA 2K7BA 3LA1A 3CS1A 4XOVA 5D69A 2GX0A 3DVEA 2E30A 4HSZA 4NQGA 2LNKA 3PALA 1AP4A 2MLFC 3BUOB 4KW4A 2P4MA 2HETA 2GV5A 5I2LA 3VRPA 1SCMB 3BX9A 2A46A 3AKOA 3K1KA 5DTZA 2A47A 3KCTA 1YHIA 1F70A 1XFYO 2C9IA 4L12A 3F45A 4OV2A 3AAJA 4GFTA 1CMGA 1IRJA 2BBNA 2OTBA 3SJSA 4IK5A 1QV0A 1HCJA 1K8UA 2Z6ZA 3FIAA 1HUYA 1QXPA 3DQ1A 3P8UA 1C07A 4W6PA 1TNXA 3D0YB 3ZULA 2CXJA 4IK9A 4M2QA 3LVAA 4Z4MA 2JTTA 5DPGA 1GFLA 4ANJA 5KU1A 3IP2A 1DGUA 1A29A 1YR5A 1KQMC 1QTXA 2KAYA 2WORA 3SVRA 4DXMA 4W76A 4Q7UA 1RMMA 2WC8A 1K2HA 3SVDA 1YJFA 4KF4A 2ZRTA 5HZUA 2LANA 2IB5A 5BT0A 3W1DA 5HYDA 2HQWA 2G6XA 4Q7RA 1C7VA 3KCSA 1S6CA 3D10A 5HW9A 1WLZA 1M45A 2DD9A 3CLNA 4HE4A 2M1KB 5DKRA 1GGWA 3WNXB 2EMOA 2L5XB 1KCYA 3FS7A 2AWLA 3M22A 3DQ8A 1ZGQA 5DU0A 2BE4A 1SYMA 1EXRA 2MRDA 1OMVA 2JTZA 3CBEA 1OSAA 2QLGB 5AERA 1S3PA 4KF5A 1DF0B 4OHSA 2Z1OA 4KPIA 2PXWA 4YI8A 4MSPA 4JPZB 2LHIA 4LJDC 1DVIA 2K2FA 1QYOA 3NSIA 1XSSA 5I2QA 2L0PA 1XK4A 4U2VA 2LVJA 1V1GA 4W6JA 1RTP1 3EVVA 2RH7A 5DY6A 1A4PA 1B9CA 3O4YA 1F71A 1EMKA 3OP0A 2Y1MA 3AI5A 2DUGA 3DPZA 2COLB 1C4FA 4KW9A 3U8CA 1Y1UA 2LUCA 2M97A 1TIZA 4PPKA 4AOMA 4HREE 5I2OA 3NSKA 2AMIA 4H3NA 1U5IB 2HQKA 1OXDA 1PULA 3ST3A 1K9PA 2WCBA 2HQ8A 2ARLA 2BCBA 3ZWHA 4RYWA 1ZGPA 1KSMA 1DTLA 1ZACA 1MYWA 2JT3A 2H5RA 4EDOA 1CTRA 2SCPA 2A50B 4XOWA 4F0ZB 1JBAA 1QATA 2H61A 4TZGA 2ZMWA 3O6BA 3PN7B 4W6MA 2NCOA 5HGEA 2YE1A 1UHHA 3QRXA 2BECA 1WRLA 1RK9A 1RMOA 4DKMA 5DKQA 2WSOA 1DJZA 4P1QA 2LP3A 4W7XA 4GGFC 1BG1A 2YDZA 3VGOA 3DQJA 1QX5B 2K7CA 1Q4DA 3NEDA 1F09A 4GNKB 4W72A 3TS5B 2G2BA 2F33A 2H6VA 1S5GZ 3BQ3A 4MEWA 4XJKB 3CGAA 3BYAA 3DD4A 1F0BA 4I5JA 3SG6A 1M31A 4GESB 4J89A 2VRGA 2MAZA 1PSRA 1JC0A 3AI4A 4B30B 5AQBB 3DQKA 1NCYA 5HBDA 1BMOA 1M39A 4JEOA 2WHSA 2M7NA 3CWGA 4LJBA 2PXSA 1S6JA 2KFFA 4PALA 1CM1A 3FWBA 5J2OA 3PN7C 5HKYA 1IG5A 5LK4A 1ZUZA 3E5WA 4MVFA 1YZWA 4PE4A 1CFFA 4YGAA 2Z6YA 2EC6B 1KFUS 5CPVA 1SMGA 4PHKA 2AWMA 1EMEA 4EDSA 1TNWA 4IK3A 3DVKA 4OQWA 4GAOA 2M0RA 1G33A 4ORBB 3BOWA 1KK7Z 5DTLA 2PALA 4ZCUA 4N5XA 3JTDB 1VRKA 4KA9A 5AANA 3TS5C 3EKJA 2L4IA 2G6EA 5J3XA 2LLUA 5BPJA 3CB9A 2GGMA 1BT6A 3O77A 2BCXA 3H1OA 1DGVA 3EVRA 2V4EB 1OE9B 1XFZO 3LK0A 2F2OA 2EGDA 1CDNA 3SIBA 4ZFSA 2IS9A 4N1FA 4J88A 2L51A 2I94A 4ZB1A 3LLEA 2VVHA 3I5IB 1NX3A 4LQUA 1OZSA 3CFAA 1FI6A 3BXBA 5B8IB 2H2KA 1SNLA 4OVNF 2WIQA 2L50A 5AFPA 2K0JA 4KAGA 2LV7A 1EMCA 3VRQA 3DQLA 1KWOB 4CFQA 2GW4B 1YRTB 4PPLA 5TNCA 1WDCB 1JC1A 4Z4KA 3IF7A 4DRWA 2EC6C 4P76A 1AJ5A 1L7ZA 5JOLA 3SG3A 5CSFA 1SKTA 1YHHA 2M3WA 2JC2A 2KQ6A 1IJ5A 1K90D 1Q4EA 4ZBLA 1QXTA 2LVVA 3BUNB 3JTDC 1EH2A 3WHTB 2FL1A 1Y6WA 1B1GA 2A54B 3BUXB 1TNQA 4MLWA 4D1EA 3U0LA 1XMZA 4IK1A 2F2PA 2KI6C 1SK6D 1XO5A 5EB7A 4MBEA 3KHEA 3GJ1A 3SSHA 1F55A 5PALA 1FBVA 1CB1A 5EXUA 1SPYA 3D0YA 3I5IC 2EHBA 1Q73A 3H1RA 3ZNIA 3UG0A 2YFPA 3OGOA 1OMRA 4A4CA 4M2PA 1XFXO 2L2EA 4W7FA 1DJWA 5FYXA 1ALVA 2OKWA 2BCAA 2L4HA 2JWWA 4HVFA 1KWOC 2KQYA 1RM9A 1WDCC 4JQ0D 5DTXA 4W7DA 4DXIA 2HPSA 1QLKA 2QACA 3SSLA 3WHUB 2O29A 4W75A 4PHMA 2JQ6A 3VRRA 3M24A 1QLSA 2KGBC 3HX4A 2GX2A 4ETOA 4W69A 3OX6A 4R1EA 4XGYA 1KYSA 4PPJA 2JRFA 2ZNEA 1CDMA 1DMOA 2VAEA 3WLCA 1TN4A 3DQMA 1MWNA 3LL8B 2KBIA 2GGZA 1IJ6A 4DCKA 3EKHA 1KYRA 1PVBA 1WY9A 1DJGA 1BJFA 1BR1B 4ZF5A 1XFVO 1SY9A 2OTGB 1AUIB 4YI9A 1EJ3A 4DUQA 4Q7TA 2MBXA 3SVBA 1XQMA 3DVJA 1SCMC 2HGDA 3DQ2A 1JC2A 4W6SA 3DF0A 3GK2A 2Y4QA 3PJ7A 4PHNA 1J7PA 4Q04A 4W6OA 1Q4CA 1RWYA 1NX1A 2ZN8A 1NYAA 3W1CA 3OB2B 1OOJA 2H8QA 4W7CA 1Z1QA 1SL9A 3LVDA 2QLIA 4GF6B 3NF0A 3CGLA 5KTGA 5BTTA 1S6IA 2M8UA 2BKIB 1SR6B 3E5TA 4L13A 2AAOA 1MXEA 3DQ6A 3IQQA 1Q4BA 2KFHA 4PE7A 1IGVA 1GL4A 4LJCA 2WHTA 4UPGA 2KDHA 4EMQA 2CT9A 1PK0D 2WSNA 4XVPA 2BBMA 2CBLA 4DXPA 4JFGA 3U0MA 1XA5A 1NX0A 1A75A 2O60A 1QY3A 3E5VA 1KP5A 1AVSA 4JF9A 3NXAA 2AWKA 1N65A 2GW3A 1YUSA 1YURA 1V1FA 2OTGC 3MGFA 5D7FA 4AS8A 4J8AA 3DQIA 3TDUA 3LSAA 4AQIA 2OJKA 4ZF3A 4ZCVA 4ZIOA 2F3ZA 1CKKA 2LUXA 1QX2A 4JGEA 5HLVA 3I5HB 1NP8A 1CFCA 4TNCA 1MOUA 1N2DA 1RMPA 1KSOA 3O78A 4RTCA 5F9GA 3NEZA 2FWQA 4JC2A 1S1EA 2Q6PA 1EMFA 2OPOA 4DXNA 1GQMA 3KEVA 3BUMB 1QX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVC D;  1JUO A;  2Q91 A;  2R2I A;  4OY4 A;  4N1G A;  5LTP A;  1TOP A;  1SR6 C;  3EVU A;  4ORA B;  3OB1 B;  4OJ0 A;  2F3Y A;  1DJX A;  1DJY A;  3OHM B;  1DJI A;  3IR8 A;  4XL5 A;  1UP5 A;  4I5L B;  1H4B A;  1K9K A;  3CR4 X;  2AH8 A;  3H4S E;  1JWD A;  1LKJ A;  1TTX A;  1X02 A;  4YGB B;  4W7A A;  3WXA A;  4C0J A;  2ZN9 A;  3PSR A;  4HQC A;  1CLB A;  3AAK A;  4DXO A;  4H3L A;  3VHT A;  1M46 A;  3AKA A;  5I8N A;  2KI6 D;  1PSB A;  1EG3 A;  2QT2 A;  3GB3 A;  1NSH A;  4AQJ A;  3WLD A;  3I19 A;  5DQB A;  2MJW B;  3SVN A;  1F4Q A;  2LMT A;  2O24 A;  2CTN A;  3I5H C;  2LE9 B;  4YBH B;  5DQM A;  2LMV A;  5DRF A;  3SVC A;  1YX8 A;  3LVC A;  1AK8 A;  2ZMU A;  2MA2 A;  3SVS A;  2ZND A;  1XVJ A;  2LLT A;  1EMM A;  1JFJ A;  3CR5 X;  3ED8 A;  3SST A;  2LMU A;  2B3P A;  1AJ4 A;  3GEX A;  3WCK A;  2LP2 A;  4KF5 C;  4ICB A;  1Y1A A;  2NXQ A;  4W6R A;  5H89 A;  4W6F A;  3CFF A;  4AR7 A;  1KFX L;  5AXI A;  4I2Y A;  4HQ8 A;  2VAD A;  4EUL A;  1E8A A;  1YHG A;  4WQ2 A;  1XK4 C;  2D8N A;  1J7Q A;  3LF4 B;  3TMT A;  4CPV A;  3U0K A;  2JUL A;  2WND A;  2M49 B;  4LW5 A;  1A03 A;  1K94 A;  4I5K A;  3CR2 A;  3DQ3 A;  5HZT A;  1BLQ A;  5DKN A;  1BU3 A;  3LS3 A;  4JRB A;  4MZK A;  2M1U A;  2OGR A;  2WCE A;  3OX5 A;  3CD9 A;  1QIW A;  1TCO B;  4N3D A;  2V53 A;  2FCE A;  2Q57 A;  1YUU A;  5HKW A;  2AWJ A;  3EK8 A;  3SSP A;  3GK4 X;  4BY5 A;  1EMA A;  3ZTF A;  1OXF A;  1XFW O;  1RRX A;  3CTN A;  4W7E A;  1J7R A;  1YX7 A;  5H87 A;  4JWQ A;  5EJU A;  2NLN A;  1DT7 B;  1LIN A;  2POX A;  5HZO A;  3OSR A;  2A53 B;  2IE2 A;  2BKH B;  4NDC A;  4KEX A;  1H4U A;  1KQV A;  1JBY A;  2E6W A;  4L1I A;  3RWA A;  3IQO A;  4BY4 A;  1Y0V H;  2KYF A;  2FOT A;  3SG5 A;  2ZRS A;  1CNP A;  2G16 B;  5KSZ A;  5DPJ A;  4UTS A;  3BOW B;  4U8D A;  1ZUX A;  4W6K A;  2VZX A;  1XYD A;  4W6T A;  2PMY A;  2QLH A;  2KI4 B;  1GJY A;  4C0L A;  2JT0 A;  3O2P A;  1RJV A;  2QPT A;  1SW8 A;  1Z1P A;  2SAS A;  2V4E C;  1SCV A;  2LCP A;  4Q9X A;  2IOV A;  1WRK A;  1ZGO A;  1CM4 A;  1KYP A;  2Z6X A;  5HLO A;  1G7K A;  3JVT B;  3RM1 A;  4P5O E;  2HJO A;  3DQ5 A;  3DQN A;  2NCP A;  2I7A A;  4H47 A;  1J1D A;  2A48 A;  3EK4 A;  1TRF A;  4W6I A;  1SRA A;  1SL8 A;  4LJD A;  1LXF C;  2K61 A;  2HFC A;  1QJT A;  1EML A;  3TDZ A;  1YJ2 A;  1S26 D;  1IQ3 A;  4NDD A;  1ZOT B;  1UUS A;  1W7U A;  1B7T Z;  2CNP A;  2BTJ A;  1UHK A;  2H5O A;  1UHN A;  3EVP A;  1PAL A;  1BOC A;  3SVU A;  3ST0 A;  1F8H A;  2TN4 A;  1YRU B;  3A8R A;  1L2O B;  2VVI A;  3PJB A;  1K93 D;  3CZT X;  4QJ4 B;  3SG7 A;  4MZL A;  4OR9 B;  4CLN A;  4PE1 A;  2JNX A;  4NDB A;  3DQ7 A;  1B4C A;  2QU1 A;  1UIS A;  3TZ1 A;  2KI4 C;  1UWO A;  3SSY A;  1XA9 A;  2O2B A;  3KO0 A;  3VRN A;  4EN1 A;  2EMN A;  4IK8 A;  3JVT C;  1NCX A;  2WUR A;  4P2Y B;  4MZJ A;  1QAS A;  2JT8 A;  2QLG A;  2PVB A;  4H3M A;  5EXB A;  1QVI Z;  3SSK A;  1W7T A;  1DF0 A;  1IWQ A;  1CDP A;  1ZFS A;  2PAS A;  2PRU A;  4W6H A;  1YVL A;  3U8A A;  4ORN A;  1XAE A;  4GOB A;  4IL1 A;  1LA3 A;  1BFP A;  4ZF4 A;  2H5Q A;  4H48 A;  1MUX A;  1FF1 A;  3DQF A;  2KNE A;  3SVO A;  3LK1 A;  2LVK A;  5G08 A;  1IKU A;  4CFR A;  3BXC A;  3HCM A;  4A4B A;  2KGR A;  4GGF A;  4L9M A;  4DKN A;  2JNF A;  3CD1 A;  2FZU A;  2KAX A;  3UFZ A;  1PRW A;  1L2O C;  2JZI A;  4HRH A;  2G3O A;  2JOJ A;  3BUW B;  2OKY A;  2ZO7 A;  1YVH A;  1MOV A;  2OS8 B;  3E3R A;  5ER5 A;  3PLF B;  2H5P A;  3DPX A;  1S6Z A;  1TNP A;  3PFV A;  1S5G Y;  4MRY A;  1U5I A;  5F6T A;  4IZN A;  4YGE B;  5DTY A;  4FQO A;  4KGF A;  1HQV A;  1NUB A;  1ODB A;  2EMD A;  5T3I A;  2K8M B;  4QJ5 B;  2KAV A;  2HQZ A;  2DOQ A;  1JBZ A;  2ZO6 A;  1CMF A;  1W7S A;  1JFK A;  3U0N A;  1ZMZ A;  2JXC A;  1M63 B;  1FW4 A;  3ICB A;  5KTY A;  4GBA A;  3SG2 A;  1G4Y R;  1EL4 A;  5HKZ A;  1F4O A;  1TCF A;  4XYN A;  2HRS A;  5FHV A;  3ST4 A;  1FPW A;  2HF5 A;  3OSQ A;  4PE0 A;  4W7R A;  2Y1N A;  2IB6 A;  5EB6 A;  1SBJ A;  2JPT A;  5FVF A;  2M9G A;  5CSN A;  2LM5 A;  1W7I B;  2I2R E;  4M2O A;  3AKB A;  2MLE C;  5DPI A;  2KFG A;  2LVI A;  1CV7 A;  3DF0 B;  2DDD A;  2M29 A;  3SG4 A;  1Q80 A;  4USL A;  4W73 A;  1SL7 A;  1R6P A;  2DDC A;  1KK7 Y;  1N0Y A;  1OXE A;  2OS8 C;  1C7W A;  5ER4 X;  4XJK A;  2HPW A;  1PVA A;  1UHJ A;  2AHA A;  3ADF A;  2L98 A;  5GQQ C;  3A4U B;  2FCD A;  5FVG A;  3SS0 A;  4CID A;  4B30 A;  5BTT B;  4IK4 A;  4YGC B;  1NIW A;  1J7O A;  2BE6 A;  3CFH A;  4GPL B;  1JF0 A;  2DUI A;  4W6A A;  3FWC A;  2HGY A;  3LCP C;  2ZKM X;  1W7J B;  3KF9 A;  3DVM A;  3ZUF A;  5IBW A;  3DQH A;  1RRO A;  1QV1 A;  1A75 B;  1YFP A;  3BXA A;  3VK1 A;  1B9A A;  1B8L A;  4W6B A;  2WIS A;  4R6B A;  2WCF A;  2LLS A;  1OZO A;  4GUK A;  1AHR A;  3SIA A;  1ALW A;  2LHL A;  2ICR A;  3V3D A;  1GGZ A;  2P6B B;  1EMG A;  5EXC I;  1KFX S;  1Q4A A;  4DS7 A;  1QS7 A;  1KK8 B;  1GGX A;  4WRI A;  1RFJ A;  2KSP A;  4NWS A;  4ORC B;  2B3Q A;  2KYC A;  1QYQ A;  2G3D B;  1MF8 B;  3TUY B;  4E68 A;  5LTR A;  3BXK A;  1MR8 A;  3TDI A;  1Y1X A;  1OMD A;  2DUH A;  3NT9 A;  4W6G A;  4W77 A;  2KOT A;  5FVI A;  1S36 A;  2I18 A;  2V4E A;  3I5G B;  4FTG A;  5CSJ A;  3A8S A;  2QZ0 A;  4OGS A;  4BDU A;  2DUF A;  3GJ2 A;  2JU0 A;  1WRZ A;  2QRF A;  4ZIN A;  1F54 A;  2DD7 A;  5DRG A;  4Q9W A;  2LC5 A;  4HQ9 A;  4PCW A;  1WLM A;  2MHH A;  1OQP A;  3DQE A;  2Q4U A;  2BL0 B;  4W6N A;  3DQ9 A;  1FI5 A;  4TZA A;  2QLE A;  3I5F B;  3K21 A;  2K7D A;  3U8P A;  1B47 A;  3RLZ A;  2OTE A;  4YRU A;  1CFP A;  2LAP A;  4KGE A;  2RGI A;  3ST2 A;  2A52 B;  1G8I A;  3PAT A;  4MN0 A;  2A4J A;  1NX2 A;  2ZFD A;  2B1U A;  2M7L A;  2G2S B;  1B8R A;  4KW8 A;  1BOD A;  2K7O A;  4WQ3 A;  3S05 A;  1UHI A;  1B7T Y;  5DPH A;  1YTZ C;  3P28 A;  3G9A A;  1XFU O;  3VHT B;  1H8B A;  2WOS A;  1LA0 A;  5HZS A;  3TMR A;  2F8P A;  1NCZ A;  1KK8 C;  4YGD B;  2VVJ A;  3VIC A;  2JAD A;  3TUY C;  5JJG A;  2YE0 A;  3LF3 A;  4W6C A;  3PIB A;  4W74 A;  1H6R A;  2G6Y A;  1MHO A;  4PDZ A;  2Y5I A;  4I5N B;  4DXQ A;  4RYS A;  5LTQ A;  3I5G C;  3GOF A;  5K89 A;  4W6U A;  1JSA A;  1EG4 A;  1DJH A;  1EMB A;  4MRX A;  4LQT A;  1CFD A;  2PSR A;  1QIV A;  4R6D A;  3DQA A;  3SVE A;  2BL0 C;  1QVI Y;  3RWT A;  3I5F C;  2H61 C;  1BR4 B;  5EHU A;  1KFU L;  1IQ5 A;  1BF5 A;  4QJ3 B;  4PFE A;  2AUC A;  4C0K A;  2ISD A;  1MQ1 A;  1HT9 A;  1K96 A;  3C1V A;  3DQ4 A;  2KBM A;  3NSL A;  3M0W A;  1UUR A;  3PJ5 A;  4OKH A;  1A2X A;  1CLL A;  3SV5 A;  1CDL A;  2G5Z B;  2CCM A;  2Y0G A;  3DQO A;  4W6D A;  4GGN A;  4W6L A;  1CLM A;  3DQD A;  3SSV A;  2HCG A;  1YUT A;  1NPQ A;  1D1O A;  5AEQ A;  4PHJ A;  3MSE B;  1R2U A;  2H9W A;  1QYF A;  4DIR A;  2O5G A;  2WHU A;  1MXL C;  1IH0 A;  3KPX A;  1K9U A;  3NSO A;  1JF2 A;  4B5Y A;  2DUE A;  2NZ0 A;  1J1E A;  5BQL A;  2JXL A;  3ZUJ A;  3EK7 A;  5CSI A;  2G9B A;  3GK1 A;  2FJU B;  2K2A A;  5H88 A;  5EBJ A;  1NWD A;  1REC A;  4HRG A;  3DQC A;  2KHN A;  3PM8 A;  2A56 B;  2C9J A;  3NT3 A;  1K95 A;  1J55 A;  4OCI A;  3SRY A;  3GL4 A;  3VRO A;  3DPW A;  3DQU A;  1KQM B;  1B8C A;  2K7B A;  3LA1 A;  3CS1 A;  4XOV A;  5D69 A;  2GX0 A;  3DVE A;  2E30 A;  4HSZ A;  4NQG A;  2LNK A;  3PAL A;  1AP4 A;  2MLF C;  3BUO B;  4KW4 A;  2P4M A;  2HET A;  2GV5 A;  5I2L A;  3VRP A;  1SCM B;  3BX9 A;  2A46 A;  3AKO A;  3K1K A;  5DTZ A;  2A47 A;  3KCT A;  1YHI A;  1F70 A;  1XFY O;  2C9I A;  4L12 A;  3F45 A;  4OV2 A;  3AAJ A;  4GFT A;  1CMG A;  1IRJ A;  2BBN A;  2OTB A;  3SJS A;  4IK5 A;  1QV0 A;  1HCJ A;  1K8U A;  2Z6Z A;  3FIA A;  1HUY A;  1QXP A;  3DQ1 A;  3P8U A;  1C07 A;  4W6P A;  1TNX A;  3D0Y B;  3ZUL A;  2CXJ A;  4IK9 A;  4M2Q A;  3LVA A;  4Z4M A;  2JTT A;  5DPG A;  1GFL A;  4ANJ A;  5KU1 A;  3IP2 A;  1DGU A;  1A29 A;  1YR5 A;  1KQM C;  1QTX A;  2KAY A;  2WOR A;  3SVR A;  4DXM A;  4W76 A;  4Q7U A;  1RMM A;  2WC8 A;  1K2H A;  3SVD A;  1YJF A;  4KF4 A;  2ZRT A;  5HZU A;  2LAN A;  2IB5 A;  5BT0 A;  3W1D A;  5HYD A;  2HQW A;  2G6X A;  4Q7R A;  1C7V A;  3KCS A;  1S6C A;  3D10 A;  5HW9 A;  1WLZ A;  1M45 A;  2DD9 A;  3CLN A;  4HE4 A;  2M1K B;  5DKR A;  1GGW A;  3WNX B;  2EMO A;  2L5X B;  1KCY A;  3FS7 A;  2AWL A;  3M22 A;  3DQ8 A;  1ZGQ A;  5DU0 A;  2BE4 A;  1SYM A;  1EXR A;  2MRD A;  1OMV A;  2JTZ A;  3CBE A;  1OSA A;  2QLG B;  5AER A;  1S3P A;  4KF5 A;  1DF0 B;  4OHS A;  2Z1O A;  4KPI A;  2PXW A;  4YI8 A;  4MSP A;  4JPZ B;  2LHI A;  4LJD C;  1DVI A;  2K2F A;  1QYO A;  3NSI A;  1XSS A;  5I2Q A;  2L0P A;  1XK4 A;  4U2V A;  2LVJ A;  1V1G A;  4W6J A;  1RTP 1;  3EVV A;  2RH7 A;  5DY6 A;  1A4P A;  1B9C A;  3O4Y A;  1F71 A;  1EMK A;  3OP0 A;  2Y1M A;  3AI5 A;  2DUG A;  3DPZ A;  2COL B;  1C4F A;  4KW9 A;  3U8C A;  1Y1U A;  2LUC A;  2M97 A;  1TIZ A;  4PPK A;  4AOM A;  4HRE E;  5I2O A;  3NSK A;  2AMI A;  4H3N A;  1U5I B;  2HQK A;  1OXD A;  1PUL A;  3ST3 A;  1K9P A;  2WCB A;  2HQ8 A;  2ARL A;  2BCB A;  3ZWH A;  4RYW A;  1ZGP A;  1KSM A;  1DTL A;  1ZAC A;  1MYW A;  2JT3 A;  2H5R A;  4EDO A;  1CTR A;  2SCP A;  2A50 B;  4XOW A;  4F0Z B;  1JBA A;  1QAT A;  2H61 A;  4TZG A;  2ZMW A;  3O6B A;  3PN7 B;  4W6M A;  2NCO A;  5HGE A;  2YE1 A;  1UHH A;  3QRX A;  2BEC A;  1WRL A;  1RK9 A;  1RMO A;  4DKM A;  5DKQ A;  2WSO A;  1DJZ A;  4P1Q A;  2LP3 A;  4W7X A;  4GGF C;  1BG1 A;  2YDZ A;  3VGO A;  3DQJ A;  1QX5 B;  2K7C A;  1Q4D A;  3NED A;  1F09 A;  4GNK B;  4W72 A;  3TS5 B;  2G2B A;  2F33 A;  2H6V A;  1S5G Z;  3BQ3 A;  4MEW A;  4XJK B;  3CGA A;  3BYA A;  3DD4 A;  1F0B A;  4I5J A;  3SG6 A;  1M31 A;  4GES B;  4J89 A;  2VRG A;  2MAZ A;  1PSR A;  1JC0 A;  3AI4 A;  4B30 B;  5AQB B;  3DQK A;  1NCY A;  5HBD A;  1BMO A;  1M39 A;  4JEO A;  2WHS A;  2M7N A;  3CWG A;  4LJB A;  2PXS A;  1S6J A;  2KFF A;  4PAL A;  1CM1 A;  3FWB A;  5J2O A;  3PN7 C;  5HKY A;  1IG5 A;  5LK4 A;  1ZUZ A;  3E5W A;  4MVF A;  1YZW A;  4PE4 A;  1CFF A;  4YGA A;  2Z6Y A;  2EC6 B;  1KFU S;  5CPV A;  1SMG A;  4PHK A;  2AWM A;  1EME A;  4EDS A;  1TNW A;  4IK3 A;  3DVK A;  4OQW A;  4GAO A;  2M0R A;  1G33 A;  4ORB B;  3BOW A;  1KK7 Z;  5DTL A;  2PAL A;  4ZCU A;  4N5X A;  3JTD B;  1VRK A;  4KA9 A;  5AAN A;  3TS5 C;  3EKJ A;  2L4I A;  2G6E A;  5J3X A;  2LLU A;  5BPJ A;  3CB9 A;  2GGM A;  1BT6 A;  3O77 A;  2BCX A;  3H1O A;  1DGV A;  3EVR A;  2V4E B;  1OE9 B;  1XFZ O;  3LK0 A;  2F2O A;  2EGD A;  1CDN A;  3SIB A;  4ZFS A;  2IS9 A;  4N1F A;  4J88 A;  2L51 A;  2I94 A;  4ZB1 A;  3LLE A;  2VVH A;  3I5I B;  1NX3 A;  4LQU A;  1OZS A;  3CFA A;  1FI6 A;  3BXB A;  5B8I B;  2H2K A;  1SNL A;  4OVN F;  2WIQ A;  2L50 A;  5AFP A;  2K0J A;  4KAG A;  2LV7 A;  1EMC A;  3VRQ A;  3DQL A;  1KWO B;  4CFQ A;  2GW4 B;  1YRT B;  4PPL A;  5TNC A;  1WDC B;  1JC1 A;  4Z4K A;  3IF7 A;  4DRW A;  2EC6 C;  4P76 A;  1AJ5 A;  1L7Z A;  5JOL A;  3SG3 A;  5CSF A;  1SKT A;  1YHH A;  2M3W A;  2JC2 A;  2KQ6 A;  1IJ5 A;  1K90 D;  1Q4E A;  4ZBL A;  1QXT A;  2LVV A;  3BUN B;  3JTD C;  1EH2 A;  3WHT B;  2FL1 A;  1Y6W A;  1B1G A;  2A54 B;  3BUX B;  1TNQ A;  4MLW A;  4D1E A;  3U0L A;  1XMZ A;  4IK1 A;  2F2P A;  2KI6 C;  1SK6 D;  1XO5 A;  5EB7 A;  4MBE A;  3KHE A;  3GJ1 A;  3SSH A;  1F55 A;  5PAL A;  1FBV A;  1CB1 A;  5EXU A;  1SPY A;  3D0Y A;  3I5I C;  2EHB A;  1Q73 A;  3H1R A;  3ZNI A;  3UG0 A;  2YFP A;  3OGO A;  1OMR A;  4A4C A;  4M2P A;  1XFX O;  2L2E A;  4W7F A;  1DJW A;  5FYX A;  1ALV A;  2OKW A;  2BCA A;  2L4H A;  2JWW A;  4HVF A;  1KWO C;  2KQY A;  1RM9 A;  1WDC C;  4JQ0 D;  5DTX A;  4W7D A;  4DXI A;  2HPS A;  1QLK A;  2QAC A;  3SSL A;  3WHU B;  2O29 A;  4W75 A;  4PHM A;  2JQ6 A;  3VRR A;  3M24 A;  1QLS A;  2KGB C;  3HX4 A;  2GX2 A;  4ETO A;  4W69 A;  3OX6 A;  4R1E A;  4XGY A;  1KYS A;  4PPJ A;  2JRF A;  2ZNE A;  1CDM A;  1DMO A;  2VAE A;  3WLC A;  1TN4 A;  3DQM A;  1MWN A;  3LL8 B;  2KBI A;  2GGZ A;  1IJ6 A;  4DCK A;  3EKH A;  1KYR A;  1PVB A;  1WY9 A;  1DJG A;  1BJF A;  1BR1 B;  4ZF5 A;  1XFV O;  1SY9 A;  2OTG B;  1AUI B;  4YI9 A;  1EJ3 A;  4DUQ A;  4Q7T A;  2MBX A;  3SVB A;  1XQM A;  3DVJ A;  1SCM C;  2HGD A;  3DQ2 A;  1JC2 A;  4W6S A;  3DF0 A;  3GK2 A;  2Y4Q A;  3PJ7 A;  4PHN A;  1J7P A;  4Q04 A;  4W6O A;  1Q4C A;  1RWY A;  1NX1 A;  2ZN8 A;  1NYA A;  3W1C A;  3OB2 B;  1OOJ A;  2H8Q A;  4W7C A;  1Z1Q A;  1SL9 A;  3LVD A;  2QLI A;  4GF6 B;  3NF0 A;  3CGL A;  5KTG A;  5BTT A;  1S6I A;  2M8U A;  2BKI B;  1SR6 B;  3E5T A;  4L13 A;  2AAO A;  1MXE A;  3DQ6 A;  3IQQ A;  1Q4B A;  2KFH A;  4PE7 A;  1IGV A;  1GL4 A;  4LJC A;  2WHT A;  4UPG A;  2KDH A;  4EMQ A;  2CT9 A;  1PK0 D;  2WSN A;  4XVP A;  2BBM A;  2CBL A;  4DXP A;  4JFG A;  3U0M A;  1XA5 A;  1NX0 A;  1A75 A;  2O60 A;  1QY3 A;  3E5V A;  1KP5 A;  1AVS A;  4JF9 A;  3NXA A;  2AWK A;  1N65 A;  2GW3 A;  1YUS A;  1YUR A;  1V1F A;  2OTG C;  3MGF A;  5D7F A;  4AS8 A;  4J8A A;  3DQI A;  3TDU A;  3LSA A;  4AQI A;  2OJK A;  4ZF3 A;  4ZCV A;  4ZIO A;  2F3Z A;  1CKK A;  2LUX A;  1QX2 A;  4JGE A;  5HLV A;  3I5H B;  1NP8 A;  1CFC A;  4TNC A;  1MOU A;  1N2D A;  1RMP A;  1KSO A;  3O78 A;  4RTC A;  5F9G A;  3NEZ A;  2FWQ A;  4JC2 A;  1S1E A;  2Q6P A;  1EMF A;  2OPO A;  4DXN A;  1GQM A;  3KEV A;  3BUM B;  1QX7 A; 
#chains in the Genus database with same CATH topology
 1LVC D;  3B87 A;  1JUO A;  3EG5 B;  2Q91 A;  2R2I A;  4OY4 A;  4N1G A;  5LTP A;  3BFA A;  1TOP A;  1SR6 C;  3EVU A;  4ORA B;  3OB1 B;  4OJ0 A;  2F3Y A;  1DJX A;  2FJY A;  1DJY A;  3OHM B;  1DJI A;  3IR8 A;  4XL5 A;  1UP5 A;  4I5L B;  1H4B A;  1K9K A;  3CR4 X;  2AH8 A;  3H4S E;  1JWD A;  1LKJ A;  1TTX A;  1X02 A;  4YGB B;  4W7A A;  3WXA A;  4C0J A;  2ZN9 A;  3PSR A;  3S0G A;  4HQC A;  1CLB A;  3AAK A;  4DXO A;  4H3L A;  3S0D A;  3VHT A;  1M46 A;  3AKA A;  3D76 A;  4INW A;  2KI6 D;  1PSB A;  5I8N A;  3FE6 A;  1EG3 A;  2QT2 A;  3GB3 A;  1NSH A;  4AQJ A;  3WLD A;  3I19 A;  2KPH A;  5DQB A;  2MJW B;  3SVN A;  3UO9 A;  1F4Q A;  2LMT A;  2O24 A;  2CTN A;  3I5H C;  2LE9 B;  4YBH B;  5DQM A;  2LMV A;  5DRF A;  3SVC A;  1YX8 A;  3LVC A;  1AK8 A;  2ZMU A;  2MA2 A;  3SVS A;  2ZND A;  1XVJ A;  2LLT A;  1EMM A;  1JFJ A;  1DEK A;  3CR5 X;  3ED8 A;  3SST A;  2LMU A;  2B3P A;  1AJ4 A;  3GEX A;  3WCK A;  2LP2 A;  2WC5 A;  4KF5 C;  4ICB A;  1Y1A A;  2NXQ A;  4W6R A;  5H89 A;  4W6F A;  3CFF A;  4AR7 A;  1KFX L;  5AXI A;  3S0F A;  2BAP A;  4I2Y A;  4HQ8 A;  3CZ0 A;  2VAD A;  4EUL A;  1E8A A;  1YHG A;  4WQ2 A;  1XK4 C;  2D8N A;  1J7Q A;  3LF4 B;  3TMT A;  4CPV A;  3U0K A;  2JUL A;  2WND A;  2M49 B;  4LW5 A;  1A03 A;  1K94 A;  1W9Z A;  2QEV A;  4I5K A;  3CR2 A;  3DQ3 A;  5HZT A;  1BLQ A;  5DKN A;  1BU3 A;  3LS3 A;  4JRB A;  4MZK A;  2M1U A;  2OGR A;  2WCE A;  3OX5 A;  3CD9 A;  5FI7 A;  1QIW A;  2H8V A;  1TCO B;  4N3D A;  2V53 A;  2FCE A;  2Q57 A;  1YUU A;  5HKW A;  3N7H A;  2AWJ A;  3EK8 A;  3SSP A;  3GK4 X;  4BY5 A;  2BNX A;  1EMA A;  3ZTF A;  2KLE A;  1OXF A;  1XFW O;  1RRX A;  3CTN A;  4W7E A;  1J7R A;  1YX7 A;  5H87 A;  3BJH A;  4JWQ A;  5EJU A;  2NLN A;  1DT7 B;  1LIN A;  2POX A;  3B7A A;  5HZO A;  3OSR A;  2A53 B;  2IE2 A;  2BKH B;  3CZ2 A;  4NDC A;  4KEX A;  1H4U A;  1KQV A;  1JBY A;  2E6W A;  4L1I A;  3RWA A;  3IQO A;  4BY4 A;  1Y0V H;  2KYF A;  2FOT A;  1C3Y A;  3SG5 A;  2ZRS A;  1CNP A;  2G16 B;  5KSZ A;  5DPJ A;  4UTS A;  3BOW B;  4U8D A;  1ZUX A;  4W6K A;  2VZX A;  1XYD A;  4W6T A;  2PMY A;  2QLH A;  2KI4 B;  1GJY A;  4C0L A;  2JT0 A;  3O2P A;  1RJV A;  2QPT A;  1SW8 A;  1Z1P A;  2SAS A;  2V4E C;  1SCV A;  2LCP A;  2IOV A;  1WRK A;  4Q9X A;  1ZGO A;  1CM4 A;  1KYP A;  2Z6X A;  5HLO A;  1G7K A;  3JVT B;  3RM1 A;  4P5O E;  2HJO A;  3DQ5 A;  3DQN A;  2NCP A;  2I7A A;  4H47 A;  1J1D A;  2A48 A;  3EK4 A;  1DEL A;  1TRF A;  4W6I A;  1SRA A;  1SL8 A;  4LJD A;  1LXF C;  3V2L A;  2K61 A;  2HFC A;  1QJT A;  1EML A;  3TDZ A;  1YJ2 A;  1S26 D;  1IQ3 A;  4NDD A;  1ZOT B;  1UUS A;  1W7U A;  1B7T Z;  2CNP A;  2BTJ A;  1UHK A;  2H5O A;  1UHN A;  3EVP A;  1PAL A;  1BOC A;  3SVU A;  2ERB A;  3ST0 A;  1F8H A;  2TN4 A;  1YRU B;  3A8R A;  1L2O B;  2VVI A;  3PJB A;  1K93 D;  3CZT X;  2WCJ A;  4QJ4 B;  3SG7 A;  4MZL A;  3BFH A;  4OR9 B;  4CLN A;  4PE1 A;  2JNX A;  4NDB A;  3DQ7 A;  1B4C A;  2QU1 A;  1UIS A;  3TZ1 A;  2KI4 C;  1UWO A;  3SSY A;  1XA9 A;  2O2B A;  3KO0 A;  3VRN A;  3BFB A;  4EN1 A;  2EMN A;  4IK8 A;  3JVT C;  1NCX A;  2WUR A;  4P2Y B;  4MZJ A;  1QAS A;  2JT8 A;  1IIO A;  2QLG A;  2PVB A;  4H3M A;  5EXB A;  1QVI Z;  3SSK A;  1W7T A;  1DF0 A;  1IWQ A;  1CDP A;  1ZFS A;  2PAS A;  2PRU A;  5I94 A;  4W6H A;  1YVL A;  3U8A A;  4ORN A;  1XAE A;  4GOB A;  4IL1 A;  1LA3 A;  1BFP A;  3NHT A;  4ZF4 A;  2H5Q A;  4H48 A;  1MUX A;  1FF1 A;  3DQF A;  2KNE A;  3SVO A;  3LK1 A;  2LVK A;  5G08 A;  1IKU A;  4CFR A;  3BXC A;  3HCM A;  4A4B A;  2KGR A;  4GGF A;  4L9M A;  4DKN A;  2JNF A;  3CD1 A;  2FZU A;  2KAX A;  3UFZ A;  1PRW A;  1L2O C;  2JZI A;  4HRH A;  2G3O A;  2JOJ A;  3BUW B;  2OKY A;  2ZO7 A;  1YVH A;  1MOV A;  2OS8 B;  3E3R A;  5ER5 A;  3PLF B;  1GM0 A;  2H5P A;  3DPX A;  1S6Z A;  1TNP A;  3PFV A;  1S5G Y;  4MRY A;  1U5I A;  5F6T A;  4IZN A;  4YGE B;  5DTY A;  4FQO A;  4KGF A;  1HQV A;  1NUB A;  1ODB A;  2EMD A;  5T3I A;  2K8M B;  4QJ5 B;  2KAV A;  2HQZ A;  2DOQ A;  1JBZ A;  2ZO6 A;  1CMF A;  1W7S A;  1JFK A;  3U0N A;  1ZMZ A;  2JXC A;  1M63 B;  1FW4 A;  3ICB A;  5KTY A;  4GBA A;  3SG2 A;  1G4Y R;  1EL4 A;  3NHI A;  5HKZ A;  1F4O A;  1TCF A;  4XYN A;  2HRS A;  5FHV A;  3ST4 A;  1FPW A;  2HF5 A;  3OSQ A;  4PE0 A;  4W7R A;  2Y1N A;  2IB6 A;  5EB6 A;  1SBJ A;  2JPT A;  5FVF A;  2M9G A;  5CSN A;  2LM5 A;  1W7I B;  2I2R E;  4M2O A;  3AKB A;  2MLE C;  5DPI A;  2KFG A;  2LVI A;  1CV7 A;  3DF0 B;  2DDD A;  2M29 A;  3SG4 A;  1Q80 A;  4USL A;  4W73 A;  1SL7 A;  1R6P A;  2DDC A;  1KK7 Y;  1N0Y A;  1OXE A;  2OS8 C;  1C7W A;  5ER4 X;  4XJK A;  2HPW A;  2WCK A;  1PVA A;  1UHJ A;  2AHA A;  3ADF A;  2L98 A;  5GQQ C;  3A4U B;  2FCD A;  5FVG A;  3SS0 A;  4CID A;  4B30 A;  5BTT B;  4IK4 A;  4YGC B;  1NIW A;  1J7O A;  3S0B A;  2BE6 A;  3CFH A;  4GPL B;  1JF0 A;  2DUI A;  4W6A A;  3FWC A;  2HGY A;  3LCP C;  2ZKM X;  1W7J B;  3KF9 A;  3DVM A;  3ZUF A;  5IBW A;  3DQH A;  1RRO A;  1QV1 A;  1A75 B;  1YFP A;  3BXA A;  3VK1 A;  1B9A A;  1B8L A;  4W6B A;  2WIS A;  4R6B A;  3RZS A;  2WCF A;  2LLS A;  1OZO A;  4GUK A;  1AHR A;  3SIA A;  1ALW A;  2LHL A;  2ICR A;  3V3D A;  2K60 A;  3D73 A;  1GGZ A;  2P6B B;  1EMG A;  5EXC I;  1KFX S;  1Q4A A;  4DS7 A;  1QS7 A;  1KK8 B;  2WCL A;  1GGX A;  4WRI A;  1RFJ A;  2KSP A;  4NWS A;  4ORC B;  2B3Q A;  2KYC A;  4IJ7 A;  1QYQ A;  2G3D B;  1MF8 B;  3TUY B;  4E68 A;  5LTR A;  3BXK A;  1MR8 A;  3TDI A;  1Y1X A;  1OMD A;  2DUH A;  3NT9 A;  4W6G A;  4W77 A;  2KOT A;  5FVI A;  1S36 A;  2I18 A;  2V4E A;  3I5G B;  4FTG A;  5CSJ A;  3A8S A;  2QZ0 A;  4OGS A;  4BDU A;  2DUF A;  3GJ2 A;  2JU0 A;  1WRZ A;  2QRF A;  4ZIN A;  1F54 A;  2DD7 A;  5DRG A;  4Q9W A;  3S0A A;  2LC5 A;  4HQ9 A;  4PCW A;  1WLM A;  2MHH A;  1OQP A;  3DQE A;  2Q4U A;  2BL0 B;  4W6N A;  3DQ9 A;  1FI5 A;  4TZA A;  2QLE A;  3I5F B;  3K21 A;  3CZ1 A;  1OW4 A;  3L4L A;  2K7D A;  3IVT A;  4F7F A;  1B47 A;  3U8P A;  3RLZ A;  2OTE A;  4YRU A;  1CFP A;  2LAP A;  4KGE A;  2RGI A;  3ST2 A;  2A52 B;  1G8I A;  3PAT A;  4MN0 A;  2A4J A;  1NX2 A;  2ZFD A;  2B1U A;  2M7L A;  2G2S B;  1B8R A;  4KW8 A;  1BOD A;  2K7O A;  4WQ3 A;  3S05 A;  1UHI A;  1B7T Y;  5DPH A;  1YTZ C;  3P28 A;  3G9A A;  1XFU O;  3VHT B;  1H8B A;  2WOS A;  1LA0 A;  1ORG A;  5HZS A;  3TMR A;  2F8P A;  1NCZ A;  1KK8 C;  3R1O A;  4YGD B;  2VVJ A;  3VIC A;  2JAD A;  2QEH A;  3TUY C;  5JJG A;  2YE0 A;  3LF3 A;  4W6C A;  3PIB A;  4W74 A;  1H6R A;  2G6Y A;  1MHO A;  4PDZ A;  2Y5I A;  4I5N B;  4DXQ A;  4RYS A;  5LTQ A;  3I5G C;  3GOF A;  5K89 A;  4W6U A;  1JSA A;  1EG4 A;  1DJH A;  1EMB A;  4MRX A;  4LQT A;  1CFD A;  2PSR A;  1QIV A;  4R6D A;  3DQA A;  3SVE A;  2BL0 C;  1QVI Y;  3RWT A;  3I5F C;  2H61 C;  1BR4 B;  5EHU A;  1KFU L;  1IQ5 A;  1BF5 A;  4QJ3 B;  4PFE A;  2AUC A;  4C0K A;  2ISD A;  1MQ1 A;  1HT9 A;  1K96 A;  3C1V A;  3DQ4 A;  2KBM A;  3O4X A;  3NSL A;  3M0W A;  1UUR A;  3R1V A;  3PJ5 A;  4OKH A;  1A2X A;  1CLL A;  3SV5 A;  1CDL A;  2G5Z B;  2CCM A;  2Y0G A;  3DQO A;  4W6D A;  4GGN A;  4W6L A;  1CLM A;  3DQD A;  1QWV A;  3SSV A;  2HCG A;  1YUT A;  1NPQ A;  1D1O A;  5AEQ A;  4PHJ A;  5EL2 A;  4PT1 A;  3MSE B;  1R2U A;  2H9W A;  1LS8 A;  1QYF A;  4DIR A;  2O5G A;  2WHU A;  1MXL C;  1IH0 A;  3KPX A;  1K9U A;  3NSO A;  1JF2 A;  4B5Y A;  2DUE A;  3R1P A;  5D3O A;  2NZ0 A;  1J1E A;  5BQL A;  2JXL A;  3ZUJ A;  2P70 A;  3EK7 A;  5CSI A;  2G9B A;  3GK1 A;  2FJU B;  2P71 A;  2K2A A;  5H88 A;  5EBJ A;  1NWD A;  1REC A;  4HRG A;  3DQC A;  2KHN A;  2PQL A;  3PM8 A;  2A56 B;  3NT3 A;  2C9J A;  1K95 A;  1J55 A;  1TWO A;  4OCI A;  3SRY A;  3GL4 A;  3VRO A;  3DPW A;  3DQU A;  1KQM B;  2JPO A;  1B8C A;  2K7B A;  3LA1 A;  3CS1 A;  4XOV A;  5D69 A;  2GX0 A;  3DVE A;  2E30 A;  4HSZ A;  4NQG A;  2LNK A;  3PAL A;  1AP4 A;  2MLF C;  3BUO B;  4KW4 A;  2P4M A;  2HET A;  2GV5 A;  5I2L A;  3VRP A;  1SCM B;  3BX9 A;  2A46 A;  3AKO A;  3K1K A;  3DYE A;  5DTZ A;  2A47 A;  3KCT A;  1YHI A;  1F70 A;  1XFY O;  2C9I A;  4L12 A;  3F45 A;  4OV2 A;  3AAJ A;  4GFT A;  1CMG A;  1IRJ A;  2BBN A;  2OTB A;  3SJS A;  4IK5 A;  1QV0 A;  1HCJ A;  1K8U A;  2Z6Z A;  2GTE A;  3FIA A;  1HUY A;  1QXP A;  2L2C A;  3DQ1 A;  3P8U A;  1C07 A;  4W6P A;  1TNX A;  3D0Y B;  3ZUL A;  2CXJ A;  4IK9 A;  4M2Q A;  3LVA A;  4Z4M A;  2JTT A;  5DPG A;  1GFL A;  4ANJ A;  5KU1 A;  3IP2 A;  1DGU A;  1A29 A;  1YR5 A;  1KQM C;  1QTX A;  2KAY A;  2WOR A;  3SVR A;  3R72 A;  3VB1 A;  4DXM A;  4W76 A;  2KLD A;  4Q7U A;  1RMM A;  2WC8 A;  1K2H A;  3D77 A;  3SVD A;  1YJF A;  4KF4 A;  2ZRT A;  5HZU A;  2LAN A;  2IB5 A;  5BT0 A;  3W1D A;  5HYD A;  2HQW A;  2G6X A;  4Q7R A;  3CAB A;  1DC1 A;  1C7V A;  3KCS A;  1S6C A;  3D10 A;  5HW9 A;  1WLZ A;  1M45 A;  2DD9 A;  3CLN A;  4HE4 A;  2M1K B;  5DKR A;  1GGW A;  3WNX B;  2EMO A;  2L5X B;  1KCY A;  3FS7 A;  2AWL A;  3M22 A;  3DQ8 A;  1ZGQ A;  5DU0 A;  2BE4 A;  1SYM A;  1EXR A;  2MRD A;  1OMV A;  2JTZ A;  3CBE A;  1OSA A;  2QLG B;  5AER A;  1S3P A;  4KF5 A;  1DF0 B;  4OHS A;  2Z1O A;  4KPI A;  2PXW A;  4YI8 A;  4MSP A;  4JPZ B;  2LHI A;  4LJD C;  1DVI A;  2K2F A;  3OGN A;  1QYO A;  3NSI A;  1XSS A;  5I2Q A;  2L0P A;  1XK4 A;  4U2V A;  2LVJ A;  1V1G A;  1RTP 1;  3EVV A;  2RH7 A;  4W6J A;  5DY6 A;  1A4P A;  1B9C A;  3O4Y A;  1F71 A;  1EMK A;  3OP0 A;  2Y1M A;  2PYQ A;  3AI5 A;  1TUJ A;  2DUG A;  3DPZ A;  2COL B;  1C4F A;  4KW9 A;  3U8C A;  1Y1U A;  2LUC A;  2M97 A;  1TIZ A;  4PPK A;  4AOM A;  4HRE E;  5I2O A;  3NSK A;  2AMI A;  4H3N A;  1U5I B;  2HQK A;  1OXD A;  1PUL A;  3ST3 A;  1K9P A;  2WCB A;  2HQ8 A;  2ARL A;  2BCB A;  3ZWH A;  4RYW A;  1ZGP A;  1KSM A;  1DTL A;  1ZAC A;  1MYW A;  2JT3 A;  2H5R A;  4EDO A;  1CTR A;  2SCP A;  2A50 B;  4XOW A;  4F0Z B;  1JBA A;  1QAT A;  2H61 A;  4TZG A;  2ZMW A;  3O6B A;  1Z4H A;  3PN7 B;  4W6M A;  2NCO A;  5HGE A;  2YE1 A;  1UHH A;  3QRX A;  2BEC A;  4JD9 A;  1WRL A;  1RK9 A;  1RMO A;  4DKM A;  5DKQ A;  2WSO A;  1T14 A;  1DJZ A;  4P1Q A;  2LP3 A;  4W7X A;  4GGF C;  1BG1 A;  2YDZ A;  3VGO A;  3DQJ A;  1QX5 B;  2K7C A;  1Q4D A;  3NED A;  1F09 A;  4GNK B;  4W72 A;  3TS5 B;  2QEB A;  2G2B A;  2F33 A;  2H6V A;  1S5G Z;  3BQ3 A;  4MEW A;  4XJK B;  3CGA A;  3BYA A;  3DD4 A;  1F0B A;  4I5J A;  3SG6 A;  1M31 A;  1Z2C B;  3DZT A;  4GES B;  5DIC A;  4J89 A;  2VRG A;  2MAZ A;  1PSR A;  1JC0 A;  3AI4 A;  4B30 B;  5AQB B;  3DQK A;  1NCY A;  5HBD A;  1BMO A;  1M39 A;  4JEO A;  2WHS A;  2M7N A;  3CWG A;  4LJB A;  2PXS A;  1S6J A;  2KFF A;  4PAL A;  1CM1 A;  3FWB A;  5J2O A;  3PN7 C;  5HKY A;  2WCH A;  1IG5 A;  5LK4 A;  1ZUZ A;  3E5W A;  4MVF A;  1YZW A;  4PE4 A;  1CFF A;  3CYZ A;  4YGA A;  2Z6Y A;  2EC6 B;  1KFU S;  5CPV A;  1SMG A;  4PHK A;  2AWM A;  1EME A;  4EDS A;  3B6X A;  1TNW A;  4IK3 A;  3DVK A;  4OQW A;  4GAO A;  2M0R A;  1G33 A;  4ORB B;  3BOW A;  1KK7 Z;  5DTL A;  2PAL A;  4ZCU A;  4N5X A;  3JTD B;  1VRK A;  3PJI A;  4KA9 A;  5AAN A;  5HL1 A;  3TS5 C;  3EKJ A;  2L4I A;  3SS4 A;  2G6E A;  5J3X A;  2LLU A;  5BPJ A;  3CB9 A;  2GGM A;  1BT6 A;  3O77 A;  2BCX A;  3QME A;  3SS3 A;  3H1O A;  1DGV A;  3EVR A;  4FQT A;  2V4E B;  1OE9 B;  2WC6 A;  1XFZ O;  3LK0 A;  2F2O A;  2EGD A;  1CDN A;  3SIB A;  4ZFS A;  2IS9 A;  4N1F A;  4J88 A;  3D78 A;  2L51 A;  2I94 A;  4ZB1 A;  3LLE A;  3PM2 A;  2VVH A;  3I5I B;  3DY9 A;  1NX3 A;  4LQU A;  1OZS A;  3CFA A;  1FI6 A;  3BXB A;  5B8I B;  2H2K A;  1SNL A;  4OVN F;  2WIQ A;  2L50 A;  5AFP A;  2K0J A;  4KAG A;  2LV7 A;  1EMC A;  3VRQ A;  3DQL A;  1KWO B;  4CFQ A;  2GW4 B;  1YRT B;  4PPL A;  5TNC A;  1WDC B;  1JC1 A;  1P28 A;  3OBV A;  1C3Z A;  4Z4K A;  3IF7 A;  4DRW A;  2EC6 C;  4KYN A;  4P76 A;  1AJ5 A;  1L7Z A;  5JOL A;  3SG3 A;  5CSF A;  1SKT A;  1YHH A;  2M3W A;  2JC2 A;  2KQ6 A;  1IJ5 A;  1K90 D;  1Q4E A;  4ZBL A;  1QXT A;  2LVV A;  3BUN B;  3JTD C;  3L47 A;  1EH2 A;  3WHT B;  2FL1 A;  1Y6W A;  1B1G A;  2A54 B;  3BUX B;  1TNQ A;  4MLW A;  4D1E A;  3U0L A;  1XMZ A;  4IK1 A;  3DXL A;  2F2P A;  2KI6 C;  1SK6 D;  1XO5 A;  5EB7 A;  4MBE A;  3KHE A;  3GJ1 A;  3SSH A;  1F55 A;  2YGU A;  5PAL A;  1FBV A;  1CB1 A;  5EXU A;  1SPY A;  3S0E A;  3D0Y A;  3L4A A;  3I5I C;  2EHB A;  1Q73 A;  3H1R A;  3ZNI A;  1SSE B;  3UG0 A;  2YFP A;  3OGO A;  1OMR A;  4A4C A;  4M2P A;  1XFX O;  2L2E A;  4W7F A;  1DJW A;  5FYX A;  1ALV A;  2OKW A;  2BCA A;  2L4H A;  2JWW A;  4HVF A;  1KWO C;  2KQY A;  1RM9 A;  1WDC C;  4JQ0 D;  5DTX A;  2QDI A;  4W7D A;  4DXI A;  2HPS A;  1QLK A;  3CDN A;  2QAC A;  3SSL A;  3WHU B;  2O29 A;  4W75 A;  4PHM A;  1DQE A;  2JQ6 A;  3VRR A;  3M24 A;  1QLS A;  2KGB C;  3HX4 A;  2GX2 A;  1OOI X;  4ETO A;  4W69 A;  3OX6 A;  4R1E A;  4XGY A;  1KYS A;  4PPJ A;  2JRF A;  2ZNE A;  1CDM A;  5FI2 A;  2QEO A;  1DMO A;  2VAE A;  3K1E A;  3WLC A;  1TN4 A;  3DQM A;  1MWN A;  3LL8 B;  2KBI A;  2GGZ A;  1IJ6 A;  4DCK A;  3FE8 A;  3EKH A;  1KYR A;  1PVB A;  1WY9 A;  1DJG A;  1BJF A;  1XFR A;  1BR1 B;  4ZF5 A;  1XFV O;  1SY9 A;  2OTG B;  3B88 A;  1AUI B;  4YI9 A;  1EJ3 A;  4DUQ A;  4Q7T A;  2MBX A;  3SVB A;  1XQM A;  3DVJ A;  1SCM C;  2HGD A;  3DQ2 A;  1TUZ A;  1JC2 A;  4W6S A;  3DF0 A;  3Q8I A;  3D75 A;  3GK2 A;  2Y4Q A;  3PJ7 A;  4PHN A;  1J7P A;  4Q04 A;  4W6O A;  1Q4C A;  1RWY A;  1NX1 A;  2ZN8 A;  1NYA A;  3W1C A;  3OB2 B;  1OOJ A;  2H8Q A;  4W7C A;  1Z1Q A;  1SL9 A;  3LVD A;  2QLI A;  4GF6 B;  3NF0 A;  3CGL A;  5KTG A;  5BTT A;  1S6I A;  2M8U A;  2BKI B;  3B86 A;  1SR6 B;  3E5T A;  4L13 A;  2AAO A;  1MXE A;  1OOF A;  3DQ6 A;  3IQQ A;  1Q4B A;  4JKT A;  2KFH A;  4PE7 A;  1IGV A;  1GL4 A;  4LJC A;  2WHT A;  4UPG A;  2KDH A;  4EMQ A;  2CT9 A;  1PK0 D;  2WSN A;  4XVP A;  4OZD A;  2BBM A;  2CBL A;  4DXP A;  4JFG A;  3U0M A;  1XA5 A;  1NX0 A;  1A75 A;  2O60 A;  1QY3 A;  3E5V A;  1KP5 A;  1AVS A;  1OOG A;  4JF9 A;  3FE9 A;  3NXA A;  2AWK A;  3SS5 A;  2GW3 A;  1N65 A;  1YUS A;  1YUR A;  1V1F A;  2OTG C;  3MGF A;  5D7F A;  4AS8 A;  4J8A A;  2WCM A;  3DQI A;  4INX A;  3D74 A;  3TDU A;  1OOH A;  3NGV A;  3LSA A;  4AQI A;  2OJK A;  4ZF3 A;  3UNW A;  5FI6 A;  4ZCV A;  4ZIO A;  2F3Z A;  1CKK A;  2LUX A;  1QX2 A;  2L5Y A;  4JGE A;  5HLV A;  3I5H B;  1NP8 A;  1CFC A;  4TNC A;  1MOU A;  1N2D A;  1RMP A;  1KSO A;  3O78 A;  4RTC A;  5F9G A;  3NEZ A;  2FWQ A;  4JC2 A;  1S1E A;  2Q6P A;  1EMF A;  2OPO A;  4DXN A;  1GQM A;  3KEV A;  3BUM B;  1QX7 A; 
#chains in the Genus database with same CATH homology
 1LVC D;  1JUO A;  2Q91 A;  2R2I A;  4OY4 A;  4N1G A;  5LTP A;  1TOP A;  1SR6 C;  3EVU A;  4ORA B;  3OB1 B;  4OJ0 A;  2F3Y A;  1DJX A;  1DJY A;  3OHM B;  1DJI A;  3IR8 A;  4XL5 A;  1UP5 A;  4I5L B;  1H4B A;  1K9K A;  3CR4 X;  2AH8 A;  3H4S E;  1JWD A;  1LKJ A;  1TTX A;  1X02 A;  4YGB B;  4W7A A;  3WXA A;  4C0J A;  2ZN9 A;  3PSR A;  4HQC A;  1CLB A;  3AAK A;  4DXO A;  4H3L A;  3VHT A;  1M46 A;  3AKA A;  5I8N A;  2KI6 D;  1PSB A;  1EG3 A;  2QT2 A;  3GB3 A;  1NSH A;  4AQJ A;  3WLD A;  3I19 A;  5DQB A;  2MJW B;  3SVN A;  1F4Q A;  2LMT A;  2O24 A;  2CTN A;  3I5H C;  2LE9 B;  4YBH B;  5DQM A;  2LMV A;  5DRF A;  3SVC A;  1YX8 A;  3LVC A;  1AK8 A;  2ZMU A;  2MA2 A;  3SVS A;  2ZND A;  1XVJ A;  2LLT A;  1EMM A;  1JFJ A;  3CR5 X;  3ED8 A;  3SST A;  2LMU A;  2B3P A;  1AJ4 A;  3GEX A;  3WCK A;  2LP2 A;  4KF5 C;  4ICB A;  1Y1A A;  2NXQ A;  4W6R A;  5H89 A;  4W6F A;  3CFF A;  4AR7 A;  1KFX L;  5AXI A;  4I2Y A;  4HQ8 A;  2VAD A;  4EUL A;  1E8A A;  1YHG A;  4WQ2 A;  1XK4 C;  2D8N A;  1J7Q A;  3LF4 B;  3TMT A;  4CPV A;  3U0K A;  2JUL A;  2WND A;  2M49 B;  4LW5 A;  1A03 A;  1K94 A;  4I5K A;  3CR2 A;  3DQ3 A;  5HZT A;  1BLQ A;  5DKN A;  1BU3 A;  3LS3 A;  4JRB A;  4MZK A;  2M1U A;  2OGR A;  2WCE A;  3OX5 A;  3CD9 A;  1QIW A;  1TCO B;  4N3D A;  2V53 A;  2FCE A;  2Q57 A;  1YUU A;  5HKW A;  2AWJ A;  3EK8 A;  3SSP A;  3GK4 X;  4BY5 A;  1EMA A;  3ZTF A;  1OXF A;  1XFW O;  1RRX A;  3CTN A;  4W7E A;  1J7R A;  1YX7 A;  5H87 A;  4JWQ A;  5EJU A;  2NLN A;  1DT7 B;  1LIN A;  2POX A;  5HZO A;  3OSR A;  2A53 B;  2IE2 A;  2BKH B;  4NDC A;  4KEX A;  1H4U A;  1KQV A;  1JBY A;  2E6W A;  4L1I A;  3RWA A;  3IQO A;  4BY4 A;  1Y0V H;  2KYF A;  2FOT A;  3SG5 A;  2ZRS A;  1CNP A;  2G16 B;  5KSZ A;  5DPJ A;  4UTS A;  3BOW B;  4U8D A;  1ZUX A;  4W6K A;  2VZX A;  1XYD A;  4W6T A;  2PMY A;  2QLH A;  2KI4 B;  1GJY A;  4C0L A;  2JT0 A;  3O2P A;  1RJV A;  2QPT A;  1SW8 A;  1Z1P A;  2SAS A;  2V4E C;  1SCV A;  2LCP A;  4Q9X A;  2IOV A;  1WRK A;  1ZGO A;  1CM4 A;  1KYP A;  2Z6X A;  5HLO A;  1G7K A;  3JVT B;  3RM1 A;  4P5O E;  2HJO A;  3DQ5 A;  3DQN A;  2NCP A;  2I7A A;  4H47 A;  1J1D A;  2A48 A;  3EK4 A;  1TRF A;  4W6I A;  1SRA A;  1SL8 A;  4LJD A;  1LXF C;  2K61 A;  2HFC A;  1QJT A;  1EML A;  3TDZ A;  1YJ2 A;  1S26 D;  1IQ3 A;  4NDD A;  1ZOT B;  1UUS A;  1W7U A;  1B7T Z;  2CNP A;  2BTJ A;  1UHK A;  2H5O A;  1UHN A;  3EVP A;  1PAL A;  1BOC A;  3SVU A;  3ST0 A;  1F8H A;  2TN4 A;  1YRU B;  3A8R A;  1L2O B;  2VVI A;  3PJB A;  1K93 D;  3CZT X;  4QJ4 B;  3SG7 A;  4MZL A;  4OR9 B;  4CLN A;  4PE1 A;  2JNX A;  4NDB A;  3DQ7 A;  1B4C A;  2QU1 A;  1UIS A;  3TZ1 A;  2KI4 C;  1UWO A;  3SSY A;  1XA9 A;  2O2B A;  3KO0 A;  3VRN A;  4EN1 A;  2EMN A;  4IK8 A;  3JVT C;  1NCX A;  2WUR A;  4P2Y B;  4MZJ A;  1QAS A;  2JT8 A;  2QLG A;  2PVB A;  4H3M A;  5EXB A;  1QVI Z;  3SSK A;  1W7T A;  1DF0 A;  1IWQ A;  1CDP A;  1ZFS A;  2PAS A;  2PRU A;  4W6H A;  1YVL A;  3U8A A;  4ORN A;  1XAE A;  4GOB A;  4IL1 A;  1LA3 A;  1BFP A;  4ZF4 A;  2H5Q A;  4H48 A;  1MUX A;  1FF1 A;  3DQF A;  2KNE A;  3SVO A;  3LK1 A;  2LVK A;  5G08 A;  1IKU A;  4CFR A;  3BXC A;  3HCM A;  4A4B A;  2KGR A;  4GGF A;  4L9M A;  4DKN A;  2JNF A;  3CD1 A;  2FZU A;  2KAX A;  3UFZ A;  1PRW A;  1L2O C;  2JZI A;  4HRH A;  2G3O A;  2JOJ A;  3BUW B;  2OKY A;  2ZO7 A;  1YVH A;  1MOV A;  2OS8 B;  3E3R A;  5ER5 A;  3PLF B;  2H5P A;  3DPX A;  1S6Z A;  1TNP A;  3PFV A;  1S5G Y;  4MRY A;  1U5I A;  5F6T A;  4IZN A;  4YGE B;  5DTY A;  4FQO A;  4KGF A;  1HQV A;  1NUB A;  1ODB A;  2EMD A;  5T3I A;  2K8M B;  4QJ5 B;  2KAV A;  2HQZ A;  2DOQ A;  1JBZ A;  2ZO6 A;  1CMF A;  1W7S A;  1JFK A;  3U0N A;  1ZMZ A;  2JXC A;  1M63 B;  1FW4 A;  3ICB A;  5KTY A;  4GBA A;  3SG2 A;  1G4Y R;  1EL4 A;  5HKZ A;  1F4O A;  1TCF A;  4XYN A;  2HRS A;  5FHV A;  3ST4 A;  1FPW A;  2HF5 A;  3OSQ A;  4PE0 A;  4W7R A;  2Y1N A;  2IB6 A;  5EB6 A;  1SBJ A;  2JPT A;  5FVF A;  2M9G A;  5CSN A;  2LM5 A;  1W7I B;  2I2R E;  4M2O A;  3AKB A;  2MLE C;  5DPI A;  2KFG A;  2LVI A;  1CV7 A;  3DF0 B;  2DDD A;  2M29 A;  3SG4 A;  1Q80 A;  4USL A;  4W73 A;  1SL7 A;  1R6P A;  2DDC A;  1KK7 Y;  1N0Y A;  1OXE A;  2OS8 C;  1C7W A;  5ER4 X;  4XJK A;  2HPW A;  1PVA A;  1UHJ A;  2AHA A;  3ADF A;  2L98 A;  5GQQ C;  3A4U B;  2FCD A;  5FVG A;  3SS0 A;  4CID A;  4B30 A;  5BTT B;  4IK4 A;  4YGC B;  1NIW A;  1J7O A;  2BE6 A;  3CFH A;  4GPL B;  1JF0 A;  2DUI A;  4W6A A;  3FWC A;  2HGY A;  3LCP C;  2ZKM X;  1W7J B;  3KF9 A;  3DVM A;  3ZUF A;  5IBW A;  3DQH A;  1RRO A;  1QV1 A;  1A75 B;  1YFP A;  3BXA A;  3VK1 A;  1B9A A;  1B8L A;  4W6B A;  2WIS A;  4R6B A;  2WCF A;  2LLS A;  1OZO A;  4GUK A;  1AHR A;  3SIA A;  1ALW A;  2LHL A;  2ICR A;  3V3D A;  1GGZ A;  2P6B B;  1EMG A;  5EXC I;  1KFX S;  1Q4A A;  4DS7 A;  1QS7 A;  1KK8 B;  1GGX A;  4WRI A;  1RFJ A;  2KSP A;  4NWS A;  4ORC B;  2B3Q A;  2KYC A;  1QYQ A;  2G3D B;  1MF8 B;  3TUY B;  4E68 A;  5LTR A;  3BXK A;  1MR8 A;  3TDI A;  1Y1X A;  1OMD A;  2DUH A;  3NT9 A;  4W6G A;  4W77 A;  2KOT A;  5FVI A;  1S36 A;  2I18 A;  2V4E A;  3I5G B;  4FTG A;  5CSJ A;  3A8S A;  2QZ0 A;  4OGS A;  4BDU A;  2DUF A;  3GJ2 A;  2JU0 A;  1WRZ A;  2QRF A;  4ZIN A;  1F54 A;  2DD7 A;  5DRG A;  4Q9W A;  2LC5 A;  4HQ9 A;  4PCW A;  1WLM A;  2MHH A;  1OQP A;  3DQE A;  2Q4U A;  2BL0 B;  4W6N A;  3DQ9 A;  1FI5 A;  4TZA A;  2QLE A;  3I5F B;  3K21 A;  2K7D A;  3U8P A;  1B47 A;  3RLZ A;  2OTE A;  4YRU A;  1CFP A;  2LAP A;  4KGE A;  2RGI A;  3ST2 A;  2A52 B;  1G8I A;  3PAT A;  4MN0 A;  2A4J A;  1NX2 A;  2ZFD A;  2B1U A;  2M7L A;  2G2S B;  1B8R A;  4KW8 A;  1BOD A;  2K7O A;  4WQ3 A;  3S05 A;  1UHI A;  1B7T Y;  5DPH A;  1YTZ C;  3P28 A;  3G9A A;  1XFU O;  3VHT B;  1H8B A;  2WOS A;  1LA0 A;  5HZS A;  3TMR A;  2F8P A;  1NCZ A;  1KK8 C;  4YGD B;  2VVJ A;  3VIC A;  2JAD A;  3TUY C;  5JJG A;  2YE0 A;  3LF3 A;  4W6C A;  3PIB A;  4W74 A;  1H6R A;  2G6Y A;  1MHO A;  4PDZ A;  2Y5I A;  4I5N B;  4DXQ A;  4RYS A;  5LTQ A;  3I5G C;  3GOF A;  5K89 A;  4W6U A;  1JSA A;  1EG4 A;  1DJH A;  1EMB A;  4MRX A;  4LQT A;  1CFD A;  2PSR A;  1QIV A;  4R6D A;  3DQA A;  3SVE A;  2BL0 C;  1QVI Y;  3RWT A;  3I5F C;  2H61 C;  1BR4 B;  5EHU A;  1KFU L;  1IQ5 A;  1BF5 A;  4QJ3 B;  4PFE A;  2AUC A;  4C0K A;  2ISD A;  1MQ1 A;  1HT9 A;  1K96 A;  3C1V A;  3DQ4 A;  2KBM A;  3NSL A;  3M0W A;  1UUR A;  3PJ5 A;  4OKH A;  1A2X A;  1CLL A;  3SV5 A;  1CDL A;  2G5Z B;  2CCM A;  2Y0G A;  3DQO A;  4W6D A;  4GGN A;  4W6L A;  1CLM A;  3DQD A;  3SSV A;  2HCG A;  1YUT A;  1NPQ A;  1D1O A;  5AEQ A;  4PHJ A;  3MSE B;  1R2U A;  2H9W A;  1QYF A;  4DIR A;  2O5G A;  2WHU A;  1MXL C;  1IH0 A;  3KPX A;  1K9U A;  3NSO A;  1JF2 A;  4B5Y A;  2DUE A;  2NZ0 A;  1J1E A;  5BQL A;  2JXL A;  3ZUJ A;  3EK7 A;  5CSI A;  2G9B A;  3GK1 A;  2FJU B;  2K2A A;  5H88 A;  5EBJ A;  1NWD A;  1REC A;  4HRG A;  3DQC A;  2KHN A;  3PM8 A;  2A56 B;  2C9J A;  3NT3 A;  1K95 A;  1J55 A;  4OCI A;  3SRY A;  3GL4 A;  3VRO A;  3DPW A;  3DQU A;  1KQM B;  1B8C A;  2K7B A;  3LA1 A;  3CS1 A;  4XOV A;  5D69 A;  2GX0 A;  3DVE A;  2E30 A;  4HSZ A;  4NQG A;  2LNK A;  3PAL A;  1AP4 A;  2MLF C;  3BUO B;  4KW4 A;  2P4M A;  2HET A;  2GV5 A;  5I2L A;  3VRP A;  1SCM B;  3BX9 A;  2A46 A;  3AKO A;  3K1K A;  5DTZ A;  2A47 A;  3KCT A;  1YHI A;  1F70 A;  1XFY O;  2C9I A;  4L12 A;  3F45 A;  4OV2 A;  3AAJ A;  4GFT A;  1CMG A;  1IRJ A;  2BBN A;  2OTB A;  3SJS A;  4IK5 A;  1QV0 A;  1HCJ A;  1K8U A;  2Z6Z A;  3FIA A;  1HUY A;  1QXP A;  3DQ1 A;  3P8U A;  1C07 A;  4W6P A;  1TNX A;  3D0Y B;  3ZUL A;  2CXJ A;  4IK9 A;  4M2Q A;  3LVA A;  4Z4M A;  2JTT A;  5DPG A;  1GFL A;  4ANJ A;  5KU1 A;  3IP2 A;  1DGU A;  1A29 A;  1YR5 A;  1KQM C;  1QTX A;  2KAY A;  2WOR A;  3SVR A;  4DXM A;  4W76 A;  4Q7U A;  1RMM A;  2WC8 A;  1K2H A;  3SVD A;  1YJF A;  4KF4 A;  2ZRT A;  5HZU A;  2LAN A;  2IB5 A;  5BT0 A;  3W1D A;  5HYD A;  2HQW A;  2G6X A;  4Q7R A;  1C7V A;  3KCS A;  1S6C A;  3D10 A;  5HW9 A;  1WLZ A;  1M45 A;  2DD9 A;  3CLN A;  4HE4 A;  2M1K B;  5DKR A;  1GGW A;  3WNX B;  2EMO A;  2L5X B;  1KCY A;  3FS7 A;  2AWL A;  3M22 A;  3DQ8 A;  1ZGQ A;  5DU0 A;  2BE4 A;  1SYM A;  1EXR A;  2MRD A;  1OMV A;  2JTZ A;  3CBE A;  1OSA A;  2QLG B;  5AER A;  1S3P A;  4KF5 A;  1DF0 B;  4OHS A;  2Z1O A;  4KPI A;  2PXW A;  4YI8 A;  4MSP A;  4JPZ B;  2LHI A;  4LJD C;  1DVI A;  2K2F A;  1QYO A;  3NSI A;  1XSS A;  5I2Q A;  2L0P A;  1XK4 A;  4U2V A;  2LVJ A;  1V1G A;  4W6J A;  1RTP 1;  3EVV A;  2RH7 A;  5DY6 A;  1A4P A;  1B9C A;  3O4Y A;  1F71 A;  1EMK A;  3OP0 A;  2Y1M A;  3AI5 A;  2DUG A;  3DPZ A;  2COL B;  1C4F A;  4KW9 A;  3U8C A;  1Y1U A;  2LUC A;  2M97 A;  1TIZ A;  4PPK A;  4AOM A;  4HRE E;  5I2O A;  3NSK A;  2AMI A;  4H3N A;  1U5I B;  2HQK A;  1OXD A;  1PUL A;  3ST3 A;  1K9P A;  2WCB A;  2HQ8 A;  2ARL A;  2BCB A;  3ZWH A;  4RYW A;  1ZGP A;  1KSM A;  1DTL A;  1ZAC A;  1MYW A;  2JT3 A;  2H5R A;  4EDO A;  1CTR A;  2SCP A;  2A50 B;  4XOW A;  4F0Z B;  1JBA A;  1QAT A;  2H61 A;  4TZG A;  2ZMW A;  3O6B A;  3PN7 B;  4W6M A;  2NCO A;  5HGE A;  2YE1 A;  1UHH A;  3QRX A;  2BEC A;  1WRL A;  1RK9 A;  1RMO A;  4DKM A;  5DKQ A;  2WSO A;  1DJZ A;  4P1Q A;  2LP3 A;  4W7X A;  4GGF C;  1BG1 A;  2YDZ A;  3VGO A;  3DQJ A;  1QX5 B;  2K7C A;  1Q4D A;  3NED A;  1F09 A;  4GNK B;  4W72 A;  3TS5 B;  2G2B A;  2F33 A;  2H6V A;  1S5G Z;  3BQ3 A;  4MEW A;  4XJK B;  3CGA A;  3BYA A;  3DD4 A;  1F0B A;  4I5J A;  3SG6 A;  1M31 A;  4GES B;  4J89 A;  2VRG A;  2MAZ A;  1PSR A;  1JC0 A;  3AI4 A;  4B30 B;  5AQB B;  3DQK A;  1NCY A;  5HBD A;  1BMO A;  1M39 A;  4JEO A;  2WHS A;  2M7N A;  3CWG A;  4LJB A;  2PXS A;  1S6J A;  2KFF A;  4PAL A;  1CM1 A;  3FWB A;  5J2O A;  3PN7 C;  5HKY A;  1IG5 A;  5LK4 A;  1ZUZ A;  3E5W A;  4MVF A;  1YZW A;  4PE4 A;  1CFF A;  4YGA A;  2Z6Y A;  2EC6 B;  1KFU S;  5CPV A;  1SMG A;  4PHK A;  2AWM A;  1EME A;  4EDS A;  1TNW A;  4IK3 A;  3DVK A;  4OQW A;  4GAO A;  2M0R A;  1G33 A;  4ORB B;  3BOW A;  1KK7 Z;  5DTL A;  2PAL A;  4ZCU A;  4N5X A;  3JTD B;  1VRK A;  4KA9 A;  5AAN A;  3TS5 C;  3EKJ A;  2L4I A;  2G6E A;  5J3X A;  2LLU A;  5BPJ A;  3CB9 A;  2GGM A;  1BT6 A;  3O77 A;  2BCX A;  3H1O A;  1DGV A;  3EVR A;  2V4E B;  1OE9 B;  1XFZ O;  3LK0 A;  2F2O A;  2EGD A;  1CDN A;  3SIB A;  4ZFS A;  2IS9 A;  4N1F A;  4J88 A;  2L51 A;  2I94 A;  4ZB1 A;  3LLE A;  2VVH A;  3I5I B;  1NX3 A;  4LQU A;  1OZS A;  3CFA A;  1FI6 A;  3BXB A;  5B8I B;  2H2K A;  1SNL A;  4OVN F;  2WIQ A;  2L50 A;  5AFP A;  2K0J A;  4KAG A;  2LV7 A;  1EMC A;  3VRQ A;  3DQL A;  1KWO B;  4CFQ A;  2GW4 B;  1YRT B;  4PPL A;  5TNC A;  1WDC B;  1JC1 A;  4Z4K A;  3IF7 A;  4DRW A;  2EC6 C;  4P76 A;  1AJ5 A;  1L7Z A;  5JOL A;  3SG3 A;  5CSF A;  1SKT A;  1YHH A;  2M3W A;  2JC2 A;  2KQ6 A;  1IJ5 A;  1K90 D;  1Q4E A;  4ZBL A;  1QXT A;  2LVV A;  3BUN B;  3JTD C;  1EH2 A;  3WHT B;  2FL1 A;  1Y6W A;  1B1G A;  2A54 B;  3BUX B;  1TNQ A;  4MLW A;  4D1E A;  3U0L A;  1XMZ A;  4IK1 A;  2F2P A;  2KI6 C;  1SK6 D;  1XO5 A;  5EB7 A;  4MBE A;  3KHE A;  3GJ1 A;  3SSH A;  1F55 A;  5PAL A;  1FBV A;  1CB1 A;  5EXU A;  1SPY A;  3D0Y A;  3I5I C;  2EHB A;  1Q73 A;  3H1R A;  3ZNI A;  3UG0 A;  2YFP A;  3OGO A;  1OMR A;  4A4C A;  4M2P A;  1XFX O;  2L2E A;  4W7F A;  1DJW A;  5FYX A;  1ALV A;  2OKW A;  2BCA A;  2L4H A;  2JWW A;  4HVF A;  1KWO C;  2KQY A;  1RM9 A;  1WDC C;  4JQ0 D;  5DTX A;  4W7D A;  4DXI A;  2HPS A;  1QLK A;  2QAC A;  3SSL A;  3WHU B;  2O29 A;  4W75 A;  4PHM A;  2JQ6 A;  3VRR A;  3M24 A;  1QLS A;  2KGB C;  3HX4 A;  2GX2 A;  4ETO A;  4W69 A;  3OX6 A;  4R1E A;  4XGY A;  1KYS A;  4PPJ A;  2JRF A;  2ZNE A;  1CDM A;  1DMO A;  2VAE A;  3WLC A;  1TN4 A;  3DQM A;  1MWN A;  3LL8 B;  2KBI A;  2GGZ A;  1IJ6 A;  4DCK A;  3EKH A;  1KYR A;  1PVB A;  1WY9 A;  1DJG A;  1BJF A;  1BR1 B;  4ZF5 A;  1XFV O;  1SY9 A;  2OTG B;  1AUI B;  4YI9 A;  1EJ3 A;  4DUQ A;  4Q7T A;  2MBX A;  3SVB A;  1XQM A;  3DVJ A;  1SCM C;  2HGD A;  3DQ2 A;  1JC2 A;  4W6S A;  3DF0 A;  3GK2 A;  2Y4Q A;  3PJ7 A;  4PHN A;  1J7P A;  4Q04 A;  4W6O A;  1Q4C A;  1RWY A;  1NX1 A;  2ZN8 A;  1NYA A;  3W1C A;  3OB2 B;  1OOJ A;  2H8Q A;  4W7C A;  1Z1Q A;  1SL9 A;  3LVD A;  2QLI A;  4GF6 B;  3NF0 A;  3CGL A;  5KTG A;  5BTT A;  1S6I A;  2M8U A;  2BKI B;  1SR6 B;  3E5T A;  4L13 A;  2AAO A;  1MXE A;  3DQ6 A;  3IQQ A;  1Q4B A;  2KFH A;  4PE7 A;  1IGV A;  1GL4 A;  4LJC A;  2WHT A;  4UPG A;  2KDH A;  4EMQ A;  2CT9 A;  1PK0 D;  2WSN A;  4XVP A;  2BBM A;  2CBL A;  4DXP A;  4JFG A;  3U0M A;  1XA5 A;  1NX0 A;  1A75 A;  2O60 A;  1QY3 A;  3E5V A;  1KP5 A;  1AVS A;  4JF9 A;  3NXA A;  2AWK A;  1N65 A;  2GW3 A;  1YUS A;  1YUR A;  1V1F A;  2OTG C;  3MGF A;  5D7F A;  4AS8 A;  4J8A A;  3DQI A;  3TDU A;  3LSA A;  4AQI A;  2OJK A;  4ZF3 A;  4ZCV A;  4ZIO A;  2F3Z A;  1CKK A;  2LUX A;  1QX2 A;  4JGE A;  5HLV A;  3I5H B;  1NP8 A;  1CFC A;  4TNC A;  1MOU A;  1N2D A;  1RMP A;  1KSO A;  3O78 A;  4RTC A;  5F9G A;  3NEZ A;  2FWQ A;  4JC2 A;  1S1E A;  2Q6P A;  1EMF A;  2OPO A;  4DXN A;  1GQM A;  3KEV A;  3BUM B;  1QX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...