3EVUA

Crystal structure of calcium bound dimeric gcamp2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
410
structure length
393
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
total genus 123
structure length 393
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evuA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evuA01
3DQ2A 1A4PA 1Q4CA 3VHTA 4MVFA 4WQ2A 1CMGA 3BUMB 4HREE 2JPTA 5HGEA 4EMQA 3CGAA 1NUBA 1KCYA 3SSPA 1F55A 5CSFA 1TRFA 1WLMA 2I94A 4CFQA 1QX7A 5KSZA 1RK9A 3DPXA 4ZF3A 3GOFA 4PPLA 3P8UA 5K89A 4B5YA 1IH0A 1KYSA 2G6XA 1IWQA 2RH7A 4HQ8A 2JT8A 4XOWA 4DUQA 2K61A 2NCOA 2MBXA 4LW5A 2A47A 1BJFA 3VRQA 1JWDA 2G3DB 1NPQA 4W73A 3SRYA 4W7EA 2F8PA 2HJOA 2DUFA 4KAGA 1YVLA 4NDBA 1OOJA 1IJ6A 1Q4AA 2WHUA 2IB5A 4N1FA 1XQMA 2HQKA 4W6UA 1EXRA 2A4JA 5HZOA 3SG6A 3TS5B 4XJKA 4W6JA 2AMIA 3LK1A 1RWYA 3SVEA 4NDDA 3I5GC 1EMMA 1WRZA 2V4EA 2K0JA 2ZMWA 1S26D 4W6KA 1QATA 1YRTB 1FPWA 2DDCA 2AHAA 1ALVA 1K93D 5DRFA 1HUYA 1RECA 4OQWA 2SCPA 4N3DA 4LJDC 3SSHA 3KF9A 4FQOA 3DQ5A 1CM4A 1NX0A 1SR6B 1FI6A 4PPKA 1DGVA 2EMNA 4GESB 1AJ5A 4DKNA 4ORNA 2C9IA 1YX8A 2CBLA 2O29A 2LMTA 5DRGA 4GNKB 1BT6A 4DS7A 1MXEA 2JNFA 4W77A 1U5IB 3BOWA 2GW4B 2JQ6A 2F2OA 2EHBA 3DQ8A 4KF5A 1B8CA 2B1UA 1A03A 2KFHA 3NEZA 3BUXB 2QZ0A 2I7AA 1S6CA 3LLEA 1PSBA 4YGCB 2H61A 1H4UA 1SY9A 2DUIA 1N65A 4HQ9A 2PXSA 4GFTA 2QLGA 3DPWA 1OQPA 4MZKA 3CFFA 1TCOB 3TDZA 3SG5A 3DF0A 3ZWHA 1CKKA 1EMBA 4NQGA 1RTP1 5DKRA 1YFPA 4W69A 3PATA 5DTXA 2QU1A 3FS7A 3DVJA 4YBHB 2O24A 3LF3A 1DGUA 2O2BA 3U8CA 4Q7UA 1QLKA 1TNXA 3ST4A 2G9BA 2ZRSA 3GJ1A 1QV0A 4MRXA 2VVHA 4Q04A 1RJVA 4KA9A 2JT3A 2OS8C 1ODBA 4HQCA 4DXNA 1OMVA 1FI5A 5LTPA 2MLFC 1QVIZ 5BT0A 3RWTA 2JXLA 1DJGA 1VRKA 3IR8A 1W7UA 2I18A 3SVOA 1Q80A 2KGBC 1MXLC 5H88A 2Q91A 1DF0A 2F33A 2FL1A 2HPSA 2L98A 3AKBA 1EH2A 1QYOA 5FVFA 4EN1A 2KHNA 2DOQA 1IGVA 1ZUZA 1DJHA 1TOPA 1PSRA 3U8PA 1UHIA 3CFHA 1XMZA 1S5GY 1YVHA 2OTGB 1GGWA 1KWOB 2Y5IA 4CPVA 1F4OA 2M1KB 3NSOA 4Q9XA 2LUCA 3SG7A 5AFPA 2YE1A 2PXWA 3WLDA 4H3LA 5DQMA 3SSVA 2IB6A 3CD9A 5LTRA 1YURA 1IQ3A 2ZN9A 4ORCB 2A53B 4JWQA 3CBEA 1ZMZA 3EKHA 3DQ1A 3SSYA 1LA0A 2HQ8A 3IQOA 4P5OE 3M22A 1BFPA 1KFUL 1QIWA 1CLLA 3DQ6A 1EMFA 3EVPA 1KFXS 2HQWA 5D7FA 3DQMA 1SMGA 1M45A 4L12A 4J89A 4DXOA 1YJFA 5I2QA 3TS5C 1K90D 1OMRA 4IK1A 2JU0A 1KK7Y 2IE2A 3CB9A 2ZKMX 4IK9A 2A46A 2M3WA 1WDCB 2GX2A 3W1CA 2SASA 1R2UA 2QPTA 4P2YB 3SIAA 2VADA 4W72A 1ZGOA 2Z6XA 3PJBA 1HT9A 2OGRA 1G4YR 2OJKA 3G9AA 5DTYA 1XAEA 4L9MA 1SR6C 2H5RA 2K2AA 3OB1B 3CR5X 4JEOA 4IL1A 1H8BA 2LNKA 2JTTA 2K8MB 4UTSA 3M24A 1A75B 4J8AA 5DPGA 2JXCA 3CZTX 3WHUB 4BY4A 4I5JA 4LJDA 2Y4QA 1RMOA 3NSKA 2Y0GA 4U8DA 3LS3A 4WRIA 1UHNA 1EMGA 1Z1QA 2KGRA 3O2PA 5FYXA 4W75A 2OPOA 3GK1A 2DUEA 3V3DA 1CFFA 3IP2A 2C9JA 5ER4X 2GV5A 4RTCA 2K7BA 3GK2A 2HPWA 2BECA 3TUYB 1YX7A 2CT9A 4W6TA 2TN4A 2G16B 3EKJA 2M97A 1SW8A 1B47A 3K21A 2KSPA 3MGFA 1S6ZA 3ZULA 1RMPA 2KI4B 4OY4A 2BL0B 4YI9A 2H6VA 3U8AA 1TNWA 1K8UA 4W7AA 4DIRA 1M63B 1DJYA 2AWKA 3SSKA 3DQ3A 3LA1A 2KDHA 2YDZA 1ALWA 1BMOA 1XFXO 2WSOA 5FVGA 3U0LA 2G3OA 4DXMA 1JUOA 4H47A 2QRFA 4L1IA 2VVJA 1KSOA 4J88A 1QTXA 3E5TA 1OXDA 2OTBA 3AI5A 1EG4A 5AERA 1M46A 2CCMA 2JNXA 3SG3A 4DXQA 5EBJA 2BKHB 2AUCA 3EVUA 2M7NA 3TMTA 1JBYA 1AUIB 2KBMA 5FVIA 2JULA 1L2OC 2LHLA 4W7CA 1KSMA 4E68A 1K9UA 1EL4A 1IRJA 1G8IA 3O4YA 1XFZO 2LP3A 2OKYA 2LAPA 5JOLA 2WORA 1NCZA 3D0YA 4JF9A 1YZWA 5EB6A 3BUNB 3DQUA 2OTGC 2Q57A 1KWOC 4PHJA 4R6DA 1KK8B 3LVCA 5DU0A 1S3PA 3ED8A 2OTEA 2VZXA 3CS1A 1K2HA 4H3NA 4ZBLA 1Y0VH 2M9GA 4KW4A 1HQVA 5DTZA 1XFWO 4DXIA 3DD4A 4I5LB 3RWAA 2FZUA 3ICBA 3AI4A 2KFGA 1XFYO 4KW9A 1Y1AA 1YHHA 5EB7A 4W6OA 4PHKA 1B7TZ 3DQAA 2LHIA 2R2IA 4ETOA 2GW3A 1S1EA 4W6CA 3DQFA 3ST2A 5ER5A 1PRWA 1EMKA 1FBVA 3LL8B 4JRBA 1F71A 4P76A 2POXA 1WDCC 2BCBA 1SNLA 3WXAA 1Q73A 4PALA 1CLBA 3VICA 4ZF4A 1MWNA 3I5HB 4KEXA 1CFDA 2KYFA 3O77A 4AR7A 2ZMUA 1ZGPA 1CFPA 4Q7TA 3VGOA 1BODA 1OZOA 5CSNA 1S36A 1XK4A 1J7QA 2Z1OA 4N5XA 4XYNA 1QXTA 1XA9A 2QLHA 1LINA 3DVEA 1WY9A 1LVCD 3SS0A 5AQBB 1JF2A 4ZB1A 1J1DA 3UG0A 1NCXA 1Y6WA 2JOJA 1W7TA 2AWJA 2LV7A 2LCPA 1J1EA 1YUUA 3RLZA 3VRRA 4YI8A 1Q4DA 1XO5A 1SYMA 4W7DA 2BCXA 1BR4B 2PRUA 1G7KA 1BOCA 5GQQC 1QIVA 4ZINA 2D8NA 1TNQA 3CR2A 5BQLA 2K2FA 2EMOA 5IBWA 5HKYA 3WLCA 4JFGA 5CPVA 3TUYC 1U5IA 5CSJA 3A4UB 1F09A 1UHKA 2QLGB 4B30A 1OMDA 1ZFSA 2JRFA 2CXJA 1SCVA 3H1RA 2MAZA 3SVDA 2KI4C 2BL0C 3S05A 2HGDA 4YRUA 4W7XA 2WIQA 2P4MA 4BDUA 1N0YA 3OX5A 4OHSA 4ZF5A 5BTTB 2JZIA 2HF5A 1GJYA 1DJZA 2B3PA 4W74A 2ZN8A 5DPIA 1IQ5A 3VROA 1CDNA 3PN7B 4DRWA 3DQNA 2K7CA 3CFAA 4USLA 4M2QA 1RROA 4A4CA 4RYWA 3SJSA 1D1OA 2KQ6A 3PALA 3VRNA 3NXAA 1DVIA 4RYSA 3NF0A 1CB1A 3PLFB 4OVNF 1NYAA 3SVCA 3CR4X 1UISA 1LKJA 4MZJA 1PK0D 2L50A 5PALA 4D1EA 4I5KA 4PHNA 2BBNA 2G6YA 1DF0B 1WLZA 1KYRA 1EMLA 4PFEA 2BCAA 1L2OB 3EVRA 4LQTA 1W7SA 1K9PA 3JVTB 1KQVA 4LQUA 4MLWA 1XVJA 2ZNEA 3OSRA 3AKAA 5DPHA 1KK8C 2ISDA 4ZFSA 2F3ZA 1V1FA 2I2RE 1KYPA 4H48A 1IJ5A 1LA3A 4Q7RA 2ZO6A 2KYCA 3D10A 1JC1A 1ZGQA 3KHEA 2FOTA 4MZLA 3E3RA 5HZUA 4GOBA 3E5WA 1EJ3A 4FTGA 1PVAA 1PULA 2LC5A 3SVUA 3WCKA 3A8RA 2KAVA 2WCFA 3W1DA 1AJ4A 2O60A 1QV1A 1G33A 1SRAA 5CSIA 2LE9B 4PHMA 1A2XA 2MA2A 4GGFC 2NLNA 2ZRTA 3GL4A 3DQDA 2LVIA 2PMYA 1NP8A 3C1VA 1QYFA 1JSAA 2HFCA 2VVIA 1SPYA 4YGAA 3I5HC 1K94A 1TTXA 1NIWA 3DQLA 2FCEA 1AVSA 1RM9A 3DQ9A 3BXBA 4C0LA 3OX6A 4TZGA 1B8RA 1UP5A 2H5PA 3DQJA 3SVBA 3F45A 1Y1UA 3DQ7A 1NWDA 1UHHA 3BX9A 4OGSA 2YFPA 2MLEC 3SVSA 1OE9B 3P28A 3EK8A 2H5QA 2KNEA 2AAOA 4PE1A 1GL4A 3OP0A 1C07A 4W6SA 5HZSA 3IQQA 4DCKA 1KQMB 3GEXA 1EMCA 2M29A 2GGMA 1SL8A 1XFUO 3IF7A 4HVFA 5EXBA 1MYWA 3FIAA 3VRPA 3SVRA 1JC2A 3I19A 5J3XA 4MSPA 1JF0A 2FCDA 4QJ5B 5KTGA 5HLOA 4BY5A 2QT2A 2COLB 4IK8A 1DTLA 2ZO7A 2BBMA 3OB2B 2LVKA 1PVBA 2HETA 1XYDA 5HLVA 4H3MA 3DQEA 1JFJA 3GB3A 4AQJA 2LM5A 3I5IB 1HCJA 4MEWA 1YRUB 5EXCI 2KI6D 2OKWA 1AK8A 1K96A 3EVVA 3PN7C 1WRKA 4U2VA 3M0WA 1JC0A 4KF4A 2GX0A 3DQCA 1B8LA 1NCYA 3PFVA 2EGDA 4ZCVA 2Y1NA 3TZ1A 4NWSA 4XOVA 1CM1A 1UUSA 1SCMB 2A54B 3I5FB 4OR9B 2F2PA 2EC6B 4IK5A 1SL9A 4WQ3A 4W6LA 2P6BB 1K95A 3PM8A 5AEQA 4Z4MA 1B9AA 3H1OA 2KFFA 5DKQA 1OSAA 3VHTB 3JVTC 3BXAA 3MSEB 1KK7Z 2HCGA 1TCFA 3JTDB 1R6PA 5EJUA 3D0YB 4JGEA 2G6EA 1N2DA 5DKNA 4ZIOA 3SSLA 1KFXL 1MQ1A 3WNXB 4HRGA 2ICRA 2CTNA 1QYQA 4KW8A 5AANA 4W6RA 3EK4A 4LJCA 4KGEA 4DXPA 5F9GA 3ZUJA 4W6NA 5HZTA 1FF1A 1QX5B 5HYDA 1KP5A 1A29A 4PCWA 1RFJA 2KBIA 5AXIA 5DQBA 4HE4A 1MR8A 5DY6A 1ZOTB 1C4FA 2L2EA 2F3YA 5F6TA 2E6WA 1TNPA 2YE0A 1NX1A 4JQ0D 2L4HA 5BPJA 1MOUA 3NSLA 4XJKB 3KPXA 2M49B 3DPZA 2M1UA 4N1GA 3DQOA 3KCTA 1IKUA 2HRSA 4GBAA 2V4EB 4PE0A 1DJXA 2LMVA 1YJ2A 2L0PA 1YUTA 1J7PA 2JWWA 1B1GA 4ICBA 1QVIY 3CWGA 1W7JB 4PE7A 4LJBA 3FWCA 3CTNA 3EK7A 4OJ0A 3AAJA 2WURA 5LK4A 2VAEA 4GGFA 1SKTA 5T3IA 3BYAA 1CDLA 2L51A 1LXFC 1K9KA 2A52B 1CLMA 1BF5A 2NZ0A 3SV5A 1KFUS 3TDUA 3DQ4A 4W6PA 1NSHA 2AH8A 3BUWB 5HBDA 4EDSA 4KGFA 4W6HA 3BOWB 3HX4A 2LP2A 1CDPA 1J55A 1QASA 2JT0A 2GGZA 2WSNA 4I2YA 5JJGA 1KQMC 4W6AA 1BR1B 1J7OA 3KO0A 2PVBA 1S6IA 5KTYA 4GAOA 2JADA 2Z6ZA 1C7VA 1DMOA 3TMRA 1YHGA 1F70A 2PALA 4B30B 1WRLA 2VRGA 3OSQA 1M31A 4F0ZB 4W6GA 3DF0B 3OGOA 1DJWA 2WC8A 1JBAA 3CGLA 1FW4A 5H87A 3FWBA 1BG1A 4EDOA 3I5IC 1AP4A 4EULA 2KQYA 2CNPA 2H9WA 1XSSA 1ZACA 2BE4A 1MF8B 4CLNA 3U0NA 1XFVO 2G5ZB 3LK0A 2IS9A 2ARLA 2IOVA 1OXEA 3LVAA 3PSRA 1IG5A 3E5VA 4MN0A 1GFLA 1QX2A 5H89A 1CNPA 3ZUFA 1SCMC 4TNCA 5BTTA 3I5FC 2MHHA 1YHIA 4W6DA 4ORBB 2L4IA 3O6BA 1QLSA 2EC6C 3BXCA 4CIDA 1Q4BA 3AAKA 2LLTA 3SG2A 4W7FA 2LMUA 4W6BA 2A50B 3JTDC 2M8UA 1F4QA 1GGXA 4C0JA 1RRXA 3KEVA 3LCPC 2Q6PA 5HKZA 2DD9A 1W7IB 4OV2A 2K7OA 5I2OA 1CDMA 4GGNA 1TN4A 1EG3A 2NXQA 2QLEA 2ZNDA 2HQZA 3GK4X 4W6IA 3RM1A 5J2OA 1NX3A 3CLNA 1YR5A 4R6BA 2M0RA 2H2KA 4W6MA 1OXFA 3NEDA 5HW9A 2Z6YA 4XL5A 2Q4UA 4PDZA 4AS8A 2BTJA 3DVMA 2A48A 5EXUA 4HRHA 2L5XB 2EMDA 4ANJA 1S6JA 4IK3A 1SBJA 2LLSA 3ZTFA 3SIBA 3U0KA 1QXPA 4R1EA 2BKIB 3BUOB 2H8QA 3H4SE 4M2PA 1E8AA 4YGEB 2DD7A 1XA5A 4YGDB 4DKMA 1V1GA 1MHOA 1B9CA 4ORAB 1AHRA 2HGYA 1M39A 4QJ3B 2V4EC 1QS7A 4YGBB 2PASA 5LTQA 1EMAA 1YUSA 4IK4A 1H4BA 3A8SA 2G2BA 3DVKA 4AOMA 2WHTA 1H6RA 2LANA 2FJUB 1DJIA 4MRYA 2MRDA 4CFRA 1XK4C 2QLIA 1B4CA 4I5NB 1SK6D 3OHMB 2WCEA 4A4BA 4XGYA 1OZSA 3ADFA 3I5GB 3LVDA 5G08A 2PSRA 3BXKA 4Z4KA 1C7WA 3AKOA 5HKWA 3KCSA 3K1KA 4OKHA 2E30A 3PJ5A 2Y1MA 1X02A 3ST3A 2WCBA 4KF5C 3GJ2A 2AWLA 1UURA 3SSTA 4HSZA 2WISA 2H5OA 4QJ4B 4OCIA 2LVJA 4ZCUA 1DT7B 3U0MA 2G2SB 3CD1A 4JC2A 4TZAA 3LSAA 1MOVA 2H61C 4W7RA 3QRXA 1A75A 1CV7A 2BE6A 1B7TY 3TDIA 3LF4B 3WHTB 4W76A 3UFZA 3NT3A 2LLUA 4W6FA 4C0KA 5KU1A 1ZUXA 2JC2A 4L13A 3HCMA 1MUXA 4GUKA 1Q4EA 5DPJA 3DQKA 1RMMA 2LVVA 1Z1PA 3BQ3A 4XVPA 1BU3A 4P1QA 1NX2A 5B8IB 1EMEA 1CFCA 1GGZA 4GPLB 4Q9WA 2O5GA 2JTZA 1S5GZ 1BLQA 4KPIA 1GQMA 1JFKA 5D69A 4AQIA 4PE4A 1UHJA 1J7RA 1QY3A 1CTRA 2MJWB 3DQHA 5I2LA 1QJTA 2WHSA 3NSIA 2LUXA 5I8NA 2KOTA 4PPJA 3VK1A 2ZFDA 5DTLA 3ST0A 1Y1XA 2WNDA 3PIBA 1F8HA 1L7ZA 2KAXA 2RGIA 1YTZC 2KAYA 1F54A 4JPZB 2DUHA 2V53A 1PALA 2K7DA 1SL7A 4M2OA 3SVNA 3NT9A 3ZNIA 3O78A 2WOSA 2NCPA 4GF6B 2QACA 2DDDA 2AWMA 1TIZA 1JBZA 2B3QA 2DUGA 2FWQA 2KI6C 5FHVA 2M7LA 5TNCA 2OS8B 1CMFA 4MBEA 3DQIA 3PJ7A 1UWOA 4NDCA 1F0BA 4IZNA 4UPGA 3SG4A 5EHUA 2A56B
chains in the Genus database with same CATH superfamily
3DQ2A 1A4PA 1Q4CA 3VHTA 2WCMA 4MVFA 4WQ2A 1CMGA 3BUMB 4HREE 2JPTA 5HGEA 4EMQA 3CGAA 1NUBA 1KCYA 1Z2CB 3SSPA 3RZSA 1F55A 5CSFA 1TRFA 1WLMA 2I94A 4CFQA 1QX7A 5KSZA 1TWOA 1RK9A 3DPXA 4ZF3A 3GOFA 4PPLA 3P8UA 5K89A 4B5YA 1IH0A 1KYSA 2G6XA 1IWQA 2RH7A 4HQ8A 2JT8A 4XOWA 4DUQA 2K61A 2NCOA 2MBXA 4LW5A 2A47A 1BJFA 3VRQA 1JWDA 2G3DB 1NPQA 4W73A 3SRYA 4W7EA 2F8PA 2HJOA 2DUFA 4KAGA 1YVLA 4NDBA 1OOJA 1IJ6A 1Q4AA 2WHUA 2IB5A 4N1FA 1XQMA 2HQKA 4W6UA 1EXRA 2A4JA 5HZOA 3SG6A 3OGNA 3D77A 3TS5B 4XJKA 4W6JA 1OOHA 2PYQA 2AMIA 3LK1A 1RWYA 3SVEA 4NDDA 3I5GC 1EMMA 1WRZA 2V4EA 2K0JA 2ZMWA 1S26D 4W6KA 1QATA 3CABA 1YRTB 2H8VA 1FPWA 2DDCA 2AHAA 1ALVA 1K93D 5DRFA 1HUYA 1RECA 4OQWA 2SCPA 4N3DA 4LJDC 3SSHA 3KF9A 4FQOA 3DQ5A 1CM4A 1NX0A 1SR6B 1FI6A 4PPKA 1DGVA 3SS4A 2EMNA 4GESB 1AJ5A 4DKNA 4ORNA 2C9IA 1YX8A 2CBLA 2O29A 2LMTA 5DRGA 4GNKB 1BT6A 4DS7A 1MXEA 2JNFA 4W77A 1U5IB 3BOWA 2GW4B 2JQ6A 2F2OA 2EHBA 3DQ8A 4KF5A 1B8CA 3O4XA 2B1UA 1A03A 2KFHA 3NEZA 3BUXB 2QZ0A 2I7AA 1S6CA 3LLEA 1PSBA 3BFHA 4YGCB 2H61A 1H4UA 1SY9A 2DUIA 1N65A 4HQ9A 2BNXA 2PXSA 4GFTA 3N7HA 5I94A 2QLGA 3DPWA 5FI7A 3BFBA 1OQPA 4MZKA 3CFFA 1TCOB 3TDZA 3SG5A 3DF0A 3ZWHA 1CKKA 1EMBA 1TUZA 4NQGA 1RTP1 5DKRA 2QEOA 1YFPA 4W69A 3PATA 5DTXA 3SS3A 2QU1A 3FS7A 3DVJA 4YBHB 2O24A 3LF3A 1DGUA 2O2BA 3U8CA 4Q7UA 1QLKA 1TNXA 3ST4A 2G9BA 2ZRSA 3GJ1A 1QV0A 4MRXA 2VVHA 4Q04A 1RJVA 4KA9A 2JT3A 2OS8C 1ODBA 4HQCA 4DXNA 1DQEA 1OMVA 2WC5A 1FI5A 5LTPA 2MLFC 1QVIZ 4PT1A 5BT0A 3RWTA 3BFAA 2JXLA 3Q8IA 1DJGA 1VRKA 3IR8A 5D3OA 1W7UA 2I18A 3SVOA 1Q80A 2KGBC 1MXLC 5H88A 2Q91A 1DF0A 2F33A 2FL1A 2HPSA 2L98A 3AKBA 2L2CA 1EH2A 1QYOA 5FVFA 4EN1A 2KHNA 2DOQA 1IGVA 1ZUZA 1DJHA 1TOPA 1PSRA 3U8PA 1UHIA 3CFHA 1XMZA 1S5GY 1YVHA 2OTGB 1GGWA 1KWOB 2Y5IA 4CPVA 1F4OA 2M1KB 3NSOA 4Q9XA 2LUCA 3SG7A 5AFPA 4OZDA 2YE1A 1SSEB 2PXWA 3WLDA 3FE9A 2K60A 4H3LA 5DQMA 1C3ZA 3SSVA 2IB6A 3CD9A 5LTRA 1YURA 1IQ3A 2ZN9A 4ORCB 2A53B 4JWQA 3DYEA 3CBEA 1ZMZA 3EKHA 3DQ1A 3SSYA 1LA0A 2HQ8A 3IQOA 4P5OE 3M22A 1BFPA 1KFUL 2P70A 1QIWA 1CLLA 3DQ6A 1EMFA 3EVPA 1KFXS 2HQWA 5D7FA 3DQMA 1SMGA 1M45A 4L12A 4J89A 4DXOA 1YJFA 5I2QA 3TS5C 1K90D 1OMRA 4IK1A 2JU0A 1KK7Y 2IE2A 3CB9A 2ZKMX 4IK9A 2A46A 2M3WA 1WDCB 2GX2A 3W1CA 2SASA 1R2UA 2QPTA 4P2YB 3SIAA 2L5YA 2VADA 4W72A 3CZ1A 1ZGOA 2Z6XA 3PJBA 1HT9A 2OGRA 1G4YR 3CYZA 2OJKA 2WCJA 3G9AA 5DTYA 1XAEA 4L9MA 1SR6C 4FQTA 2H5RA 2K2AA 3OB1B 3CR5X 4JEOA 4IL1A 1OW4A 1H8BA 2LNKA 2JTTA 1OOFA 2K8MB 4UTSA 3M24A 1A75B 4J8AA 5DPGA 2JXCA 3CZTX 3WHUB 4BY4A 4I5JA 4LJDA 2Y4QA 1RMOA 3NSKA 2Y0GA 4U8DA 3LS3A 4WRIA 1UHNA 1OOIX 1EMGA 1C3YA 1Z1QA 2KGRA 3O2PA 5FYXA 4W75A 2OPOA 3GK1A 2DUEA 3V3DA 1CFFA 3IP2A 2C9JA 5ER4X 2GV5A 4RTCA 2K7BA 3GK2A 2HPWA 2BECA 3TUYB 1YX7A 2CT9A 3NHIA 4W6TA 2TN4A 2G16B 3EKJA 2M97A 1SW8A 1B47A 3K21A 2KSPA 3MGFA 1S6ZA 3ZULA 1RMPA 2KI4B 4OY4A 2BL0B 4YI9A 2H6VA 3U8AA 1TNWA 1K8UA 4W7AA 4DIRA 1M63B 1DJYA 2AWKA 3SSKA 1P28A 3DZTA 3DQ3A 2KDHA 2YDZA 3LA1A 1ALWA 1BMOA 1XFXO 2WSOA 5FVGA 3U0LA 2G3OA 4DXMA 1JUOA 4H47A 2QRFA 4L1IA 2VVJA 1KSOA 4J88A 1QTXA 3E5TA 1OXDA 5DICA 2OTBA 3AI5A 1EG4A 5AERA 1M46A 2CCMA 2JNXA 3SG3A 4DXQA 5EBJA 2BKHB 2AUCA 3EVUA 2M7NA 3TMTA 1JBYA 1AUIB 2KBMA 5FVIA 2BAPA 2JULA 1L2OC 2LHLA 5HL1A 4W7CA 1KSMA 2QEHA 1K9UA 4E68A 1EL4A 1IRJA 1G8IA 3O4YA 1XFZO 2LP3A 2OKYA 2LAPA 5JOLA 2WORA 1NCZA 3D0YA 4JF9A 1YZWA 5EB6A 3BUNB 3DQUA 2OTGC 2Q57A 1KWOC 4PHJA 4R6DA 1KK8B 3S0EA 3LVCA 5DU0A 1S3PA 3ED8A 2OTEA 2VZXA 3CS1A 1K2HA 4H3NA 4ZBLA 1Y0VH 4INWA 2M9GA 4KW4A 1HQVA 5DTZA 1XFWO 4DXIA 3DD4A 4I5LB 3RWAA 2FZUA 3ICBA 3AI4A 2KFGA 1XFYO 4KW9A 1Y1AA 1YHHA 5EB7A 4W6OA 4PHKA 1B7TZ 3DQAA 2LHIA 5FI2A 2R2IA 4ETOA 2GW3A 1S1EA 4W6CA 3DQFA 3ST2A 5ER5A 1PRWA 1EMKA 1FBVA 3LL8B 4JRBA 1F71A 3R1VA 4P76A 2POXA 1WDCC 2BCBA 1SNLA 3WXAA 1Q73A 3D78A 4PALA 1CLBA 3VICA 4ZF4A 1MWNA 3I5HB 4KEXA 1CFDA 3CZ2A 2KYFA 3O77A 4AR7A 2ZMUA 1ZGPA 1CFPA 4Q7TA 3VGOA 1BODA 1OZOA 5CSNA 1S36A 1XK4A 3QMEA 1J7QA 2Z1OA 3R72A 4N5XA 4XYNA 1QXTA 1XA9A 2KPHA 2QLHA 1LINA 3DVEA 1WY9A 1LVCD 3SS0A 5AQBB 1JF2A 4ZB1A 1J1DA 3UG0A 1NCXA 1Y6WA 2JOJA 1W7TA 2AWJA 2LV7A 2LCPA 1IIOA 1J1EA 1YUUA 3RLZA 3VRRA 3K1EA 4YI8A 1Q4DA 1XO5A 1SYMA 4W7DA 2BCXA 1BR4B 2PRUA 1DEKA 3L4LA 1G7KA 1BOCA 5GQQC 1QIVA 4ZINA 2D8NA 1TNQA 3CR2A 5BQLA 2K2FA 2EMOA 5IBWA 5HKYA 3WLCA 4JFGA 5CPVA 3TUYC 1U5IA 5CSJA 3A4UB 1F09A 1UHKA 2QLGB 4B30A 1DC1A 1OMDA 1ZFSA 2JRFA 2CXJA 1SCVA 3H1RA 2MAZA 3SVDA 2KI4C 2BL0C 3S05A 2HGDA 4YRUA 4W7XA 2WIQA 2P4MA 4BDUA 1N0YA 3OX5A 1ORGA 4OHSA 4ZF5A 5BTTB 2JZIA 2HF5A 1GJYA 1DJZA 2B3PA 4W74A 2ZN8A 5DPIA 1IQ5A 3VROA 1CDNA 3PN7B 4DRWA 3DQNA 2K7CA 3CFAA 4USLA 4M2QA 1RROA 4A4CA 4RYWA 3SJSA 1D1OA 2KQ6A 3PALA 3VRNA 3NXAA 1DVIA 4RYSA 3NF0A 1CB1A 3PLFB 3S0FA 4OVNF 1NYAA 3SVCA 3CR4X 1UISA 1LKJA 3EG5B 3V2LA 4MZJA 1PK0D 2L50A 5PALA 4D1EA 4I5KA 4PHNA 2BBNA 4INXA 2G6YA 1DF0B 1WLZA 1KYRA 1EMLA 4PFEA 2BCAA 3L4AA 1L2OB 3EVRA 4LQTA 1W7SA 1K9PA 3JVTB 1KQVA 4LQUA 4MLWA 2WCLA 1XVJA 2ZNEA 3OSRA 3AKAA 5DPHA 1KK8C 3R1OA 2ISDA 4ZFSA 2F3ZA 1V1FA 2I2RE 1KYPA 4H48A 1IJ5A 1LA3A 4Q7RA 2ZO6A 1W9ZA 2KLDA 2KYCA 3D10A 1JC1A 1ZGQA 2KLEA 3KHEA 2FOTA 4MZLA 3S0BA 3E3RA 5HZUA 4GOBA 3E5WA 1EJ3A 4FTGA 1PVAA 1PULA 2LC5A 3SVUA 3WCKA 3A8RA 2KAVA 2WCFA 3W1DA 1AJ4A 2O60A 1QV1A 1G33A 1SRAA 5CSIA 2LE9B 4PHMA 1A2XA 2MA2A 4GGFC 2NLNA 2ZRTA 3GL4A 3DQDA 2LVIA 2PMYA 1NP8A 3C1VA 1QYFA 1JSAA 2HFCA 2P71A 2VVIA 1SPYA 4YGAA 3I5HC 1K94A 1TTXA 1NIWA 3DQLA 2FCEA 1AVSA 1RM9A 3DQ9A 3BXBA 4C0LA 3OX6A 3SS5A 4TZGA 1B8RA 1UP5A 2H5PA 3DQJA 3SVBA 3F45A 1Y1UA 3IVTA 3DQ7A 1NWDA 1UHHA 3BX9A 4JKTA 4OGSA 2YFPA 2MLEC 3SVSA 1OE9B 2WC6A 3P28A 3EK8A 2H5QA 2KNEA 2AAOA 4PE1A 1GL4A 3OP0A 1C07A 4W6SA 5HZSA 3IQQA 4DCKA 1KQMB 3GEXA 1EMCA 2M29A 2GGMA 1SL8A 1XFUO 3IF7A 4HVFA 5EXBA 1MYWA 3FIAA 3VRPA 3SVRA 1JC2A 3I19A 5J3XA 4MSPA 1JF0A 2FCDA 4QJ5B 5KTGA 5HLOA 4BY5A 2QT2A 2COLB 4IK8A 2PQLA 3B87A 1DTLA 1OOGA 3FE8A 3FE6A 1Z4HA 2ZO7A 2BBMA 3OB2B 2LVKA 1PVBA 2HETA 1XYDA 5HLVA 3S0AA 2QEVA 4H3MA 3DQEA 1JFJA 3GB3A 4AQJA 2LM5A 3I5IB 1HCJA 4MEWA 1YRUB 5EXCI 2KI6D 2OKWA 2YGUA 1K96A 3EVVA 3PN7C 1WRKA 1AK8A 3UNWA 4U2VA 3M0WA 1JC0A 4KF4A 2GX0A 3DQCA 1B8LA 1NCYA 3PFVA 2EGDA 3BJHA 4ZCVA 2Y1NA 3TZ1A 4NWSA 4XOVA 1CM1A 1UUSA 1SCMB 2A54B 3I5FB 4OR9B 2F2PA 2EC6B 4IK5A 1SL9A 4WQ3A 4W6LA 2P6BB 1K95A 3PM8A 5AEQA 3D76A 4Z4MA 1B9AA 3H1OA 2KFFA 5DKQA 1OSAA 3VHTB 3JVTC 3BXAA 3MSEB 1KK7Z 2HCGA 1TCFA 3JTDB 1R6PA 5EJUA 3D0YB 4JGEA 2G6EA 1N2DA 5DKNA 4ZIOA 3SSLA 1KFXL 1MQ1A 3WNXB 4HRGA 2ICRA 2CTNA 3B86A 1QYQA 4KW8A 5AANA 4W6RA 3EK4A 4LJCA 4KGEA 4DXPA 2FJYA 5F9GA 3ZUJA 3B88A 4W6NA 5HZTA 1FF1A 1QX5B 5HYDA 1KP5A 3D75A 1A29A 4PCWA 4KYNA 1RFJA 2KBIA 5AXIA 5DQBA 3PJIA 4HE4A 1MR8A 5DY6A 1ZOTB 1C4FA 2L2EA 2F3YA 5F6TA 2E6WA 4IJ7A 1TNPA 2YE0A 1NX1A 4JQ0D 2L4HA 5BPJA 1MOUA 3NSLA 4XJKB 3KPXA 2M49B 3DPZA 2M1UA 4N1GA 3DQOA 3KCTA 3D74A 1IKUA 2HRSA 4GBAA 2V4EB 4PE0A 1DJXA 2LMVA 1YJ2A 2L0PA 1YUTA 3D73A 1J7PA 2JWWA 2WCKA 1B1GA 3DY9A 4ICBA 1QVIY 3CWGA 1W7JB 4PE7A 4LJBA 3FWCA 3CTNA 3EK7A 3CZ0A 4OJ0A 3AAJA 2WURA 5LK4A 2VAEA 4GGFA 3S0GA 1SKTA 5T3IA 3BYAA 1CDLA 3L47A 2L51A 1LXFC 1K9KA 2A52B 1CLMA 1BF5A 2NZ0A 3SV5A 1KFUS 3TDUA 3DQ4A 4W6PA 1NSHA 2AH8A 3BUWB 5HBDA 4EDSA 4KGFA 3OBVA 4W6HA 3BOWB 3HX4A 2LP2A 1CDPA 1J55A 1QASA 2JT0A 2GGZA 2WSNA 4I2YA 5JJGA 1LS8A 1KQMC 4W6AA 1BR1B 1J7OA 3KO0A 2PVBA 1S6IA 5KTYA 4GAOA 2JADA 2Z6ZA 1C7VA 1DMOA 3TMRA 1YHGA 1F70A 2PALA 4B30B 1WRLA 2VRGA 3OSQA 1M31A 4F0ZB 4W6GA 3DF0B 3UO9A 3OGOA 1DJWA 2WC8A 1JBAA 3CGLA 1FW4A 2QDIA 5H87A 3FWBA 1BG1A 4EDOA 3I5IC 1AP4A 5FI6A 2GTEA 4EULA 2KQYA 2CNPA 2H9WA 1XSSA 1ZACA 2BE4A 1MF8B 4CLNA 3U0NA 1XFVO 2G5ZB 3LK0A 2IS9A 2ARLA 2IOVA 1OXEA 3LVAA 3PSRA 3NGVA 1IG5A 3E5VA 1QWVA 4MN0A 1GFLA 1QX2A 5H89A 1CNPA 3ZUFA 1SCMC 4TNCA 3PM2A 5BTTA 3I5FC 2MHHA 1YHIA 4W6DA 4ORBB 2L4IA 3O6BA 1TUJA 1QLSA 2EC6C 3BXCA 4CIDA 1Q4BA 3AAKA 2LLTA 3SG2A 4W7FA 3B6XA 2LMUA 4W6BA 2A50B 3JTDC 2M8UA 1F4QA 1GGXA 3B7AA 4C0JA 1RRXA 3KEVA 3LCPC 2Q6PA 5HKZA 2DD9A 1W7IB 4OV2A 2K7OA 5I2OA 1CDMA 4GGNA 1TN4A 1EG3A 2NXQA 2QLEA 2ZNDA 2HQZA 3GK4X 4W6IA 3RM1A 5J2OA 2ERBA 1NX3A 3CLNA 1YR5A 4R6BA 2M0RA 2H2KA 4W6MA 1OXFA 5EL2A 3NEDA 5HW9A 2Z6YA 4XL5A 2Q4UA 4PDZA 4AS8A 2BTJA 3DVMA 2A48A 5EXUA 4HRHA 2L5XB 2EMDA 4ANJA 1S6JA 4IK3A 1SBJA 2LLSA 3ZTFA 3SIBA 3U0KA 1QXPA 3CDNA 4R1EA 2BKIB 3BUOB 2H8QA 3H4SE 4M2PA 1E8AA 4YGEB 2DD7A 1XA5A 4YGDB 4DKMA 1V1GA 1MHOA 1B9CA 4ORAB 1AHRA 2HGYA 1M39A 4QJ3B 2V4EC 1QS7A 4YGBB 2PASA 5LTQA 1EMAA 1YUSA 4IK4A 1H4BA 3A8SA 2G2BA 3DVKA 4AOMA 2WHTA 1H6RA 2LANA 2FJUB 1DJIA 2WCHA 4MRYA 2MRDA 4CFRA 1XK4C 2QLIA 1B4CA 4I5NB 1SK6D 3OHMB 3R1PA 2WCEA 4F7FA 4A4BA 4XGYA 1OZSA 3ADFA 3I5GB 3LVDA 4JD9A 5G08A 2PSRA 3BXKA 1XFRA 4Z4KA 1C7WA 3AKOA 5HKWA 3KCSA 3K1KA 2JPOA 4OKHA 2E30A 3PJ5A 2Y1MA 1X02A 3ST3A 2WCBA 4KF5C 3NHTA 3GJ2A 2AWLA 1UURA 3SSTA 4HSZA 2WISA 2H5OA 4QJ4B 4OCIA 2LVJA 4ZCUA 1DT7B 1DELA 3U0MA 3DXLA 2G2SB 3CD1A 4JC2A 4TZAA 3LSAA 1MOVA 2H61C 4W7RA 3QRXA 1A75A 1CV7A 1B7TY 2BE6A 3TDIA 3LF4B 3WHTB 4W76A 3UFZA 3NT3A 2LLUA 4W6FA 4C0KA 5KU1A 1ZUXA 2JC2A 4L13A 3HCMA 1MUXA 4GUKA 1Q4EA 5DPJA 3DQKA 1RMMA 2LVVA 1Z1PA 3BQ3A 4XVPA 1BU3A 3VB1A 4P1QA 1NX2A 5B8IB 1EMEA 1CFCA 1GGZA 4GPLB 4Q9WA 2O5GA 2JTZA 1S5GZ 1BLQA 4KPIA 1GQMA 1JFKA 5D69A 4AQIA 4PE4A 1UHJA 1J7RA 1QY3A 1CTRA 2MJWB 3DQHA 5I2LA 1QJTA 2WHSA 3NSIA 2LUXA 5I8NA 2KOTA 2QEBA 3S0DA 4PPJA 3VK1A 2ZFDA 5DTLA 3ST0A 1Y1XA 2WNDA 3PIBA 1F8HA 1L7ZA 2KAXA 2RGIA 1YTZC 2KAYA 1F54A 4JPZB 2DUHA 1T14A 1PALA 2K7DA 1SL7A 2V53A 4M2OA 3SVNA 3NT9A 3ZNIA 3O78A 2WOSA 2NCPA 4GF6B 2QACA 2DDDA 2AWMA 1TIZA 1JBZA 2B3QA 2DUGA 2FWQA 2KI6C 5FHVA 2M7LA 5TNCA 2OS8B 1CMFA 1GM0A 4MBEA 3DQIA 3PJ7A 1UWOA 4NDCA 1F0BA 4UPGA 4IZNA 3SG4A 5EHUA 2A56B
chains in the Genus database with same CATH topology
3DQ2A 1A4PA 1Q4CA 3VHTA 4MVFA 4WQ2A 1CMGA 3BUMB 4HREE 2JPTA 5HGEA 4EMQA 3CGAA 1NUBA 1KCYA 3SSPA 1F55A 5CSFA 1TRFA 1WLMA 2I94A 4CFQA 1QX7A 5KSZA 1RK9A 3DPXA 4ZF3A 3GOFA 4PPLA 3P8UA 5K89A 4B5YA 1IH0A 1KYSA 2G6XA 1IWQA 2RH7A 4HQ8A 2JT8A 4XOWA 4DUQA 2K61A 2NCOA 2MBXA 4LW5A 2A47A 1BJFA 3VRQA 1JWDA 2G3DB 1NPQA 4W73A 3SRYA 4W7EA 2F8PA 2HJOA 2DUFA 4KAGA 1YVLA 4NDBA 1OOJA 1IJ6A 1Q4AA 2WHUA 2IB5A 4N1FA 1XQMA 2HQKA 4W6UA 1EXRA 2A4JA 5HZOA 3SG6A 3TS5B 4XJKA 4W6JA 2AMIA 3LK1A 1RWYA 3SVEA 4NDDA 3I5GC 1EMMA 1WRZA 2V4EA 2K0JA 2ZMWA 1S26D 4W6KA 1QATA 1YRTB 1FPWA 2DDCA 2AHAA 1ALVA 1K93D 5DRFA 1HUYA 1RECA 4OQWA 2SCPA 4N3DA 4LJDC 3SSHA 3KF9A 4FQOA 3DQ5A 1CM4A 1NX0A 1SR6B 1FI6A 4PPKA 1DGVA 2EMNA 4GESB 1AJ5A 4DKNA 4ORNA 2C9IA 1YX8A 2CBLA 2O29A 2LMTA 5DRGA 4GNKB 1BT6A 4DS7A 1MXEA 2JNFA 4W77A 1U5IB 3BOWA 2GW4B 2JQ6A 2F2OA 2EHBA 3DQ8A 4KF5A 1B8CA 2B1UA 1A03A 2KFHA 3NEZA 3BUXB 2QZ0A 2I7AA 1S6CA 3LLEA 1PSBA 4YGCB 2H61A 1H4UA 1SY9A 2DUIA 1N65A 4HQ9A 2PXSA 4GFTA 2QLGA 3DPWA 1OQPA 4MZKA 3CFFA 1TCOB 3TDZA 3SG5A 3DF0A 3ZWHA 1CKKA 1EMBA 4NQGA 1RTP1 5DKRA 1YFPA 4W69A 3PATA 5DTXA 2QU1A 3FS7A 3DVJA 4YBHB 2O24A 3LF3A 1DGUA 2O2BA 3U8CA 4Q7UA 1QLKA 1TNXA 3ST4A 2G9BA 2ZRSA 3GJ1A 1QV0A 4MRXA 2VVHA 4Q04A 1RJVA 4KA9A 2JT3A 2OS8C 1ODBA 4HQCA 4DXNA 1OMVA 1FI5A 5LTPA 2MLFC 1QVIZ 5BT0A 3RWTA 2JXLA 1DJGA 1VRKA 3IR8A 1W7UA 2I18A 3SVOA 1Q80A 2KGBC 1MXLC 5H88A 2Q91A 1DF0A 2F33A 2FL1A 2HPSA 2L98A 3AKBA 1EH2A 1QYOA 5FVFA 4EN1A 2KHNA 2DOQA 1IGVA 1ZUZA 1DJHA 1TOPA 1PSRA 3U8PA 1UHIA 3CFHA 1XMZA 1S5GY 1YVHA 2OTGB 1GGWA 1KWOB 2Y5IA 4CPVA 1F4OA 2M1KB 3NSOA 4Q9XA 2LUCA 3SG7A 5AFPA 2YE1A 2PXWA 3WLDA 4H3LA 5DQMA 3SSVA 2IB6A 3CD9A 5LTRA 1YURA 1IQ3A 2ZN9A 4ORCB 2A53B 4JWQA 3CBEA 1ZMZA 3EKHA 3DQ1A 3SSYA 1LA0A 2HQ8A 3IQOA 4P5OE 3M22A 1BFPA 1KFUL 1QIWA 1CLLA 3DQ6A 1EMFA 3EVPA 1KFXS 2HQWA 5D7FA 3DQMA 1SMGA 1M45A 4L12A 4J89A 4DXOA 1YJFA 5I2QA 3TS5C 1K90D 1OMRA 4IK1A 2JU0A 1KK7Y 2IE2A 3CB9A 2ZKMX 4IK9A 2A46A 2M3WA 1WDCB 2GX2A 3W1CA 2SASA 1R2UA 2QPTA 4P2YB 3SIAA 2VADA 4W72A 1ZGOA 2Z6XA 3PJBA 1HT9A 2OGRA 1G4YR 2OJKA 3G9AA 5DTYA 1XAEA 4L9MA 1SR6C 2H5RA 2K2AA 3OB1B 3CR5X 4JEOA 4IL1A 1H8BA 2LNKA 2JTTA 2K8MB 4UTSA 3M24A 1A75B 4J8AA 5DPGA 2JXCA 3CZTX 3WHUB 4BY4A 4I5JA 4LJDA 2Y4QA 1RMOA 3NSKA 2Y0GA 4U8DA 3LS3A 4WRIA 1UHNA 1EMGA 1Z1QA 2KGRA 3O2PA 5FYXA 4W75A 2OPOA 3GK1A 2DUEA 3V3DA 1CFFA 3IP2A 2C9JA 5ER4X 2GV5A 4RTCA 2K7BA 3GK2A 2HPWA 2BECA 3TUYB 1YX7A 2CT9A 4W6TA 2TN4A 2G16B 3EKJA 2M97A 1SW8A 1B47A 3K21A 2KSPA 3MGFA 1S6ZA 3ZULA 1RMPA 2KI4B 4OY4A 2BL0B 4YI9A 2H6VA 3U8AA 1TNWA 1K8UA 4W7AA 4DIRA 1M63B 1DJYA 2AWKA 3SSKA 3DQ3A 3LA1A 2KDHA 2YDZA 1ALWA 1BMOA 1XFXO 2WSOA 5FVGA 3U0LA 2G3OA 4DXMA 1JUOA 4H47A 2QRFA 4L1IA 2VVJA 1KSOA 4J88A 1QTXA 3E5TA 1OXDA 2OTBA 3AI5A 1EG4A 5AERA 1M46A 2CCMA 2JNXA 3SG3A 4DXQA 5EBJA 2BKHB 2AUCA 3EVUA 2M7NA 3TMTA 1JBYA 1AUIB 2KBMA 5FVIA 2JULA 1L2OC 2LHLA 4W7CA 1KSMA 4E68A 1K9UA 1EL4A 1IRJA 1G8IA 3O4YA 1XFZO 2LP3A 2OKYA 2LAPA 5JOLA 2WORA 1NCZA 3D0YA 4JF9A 1YZWA 5EB6A 3BUNB 3DQUA 2OTGC 2Q57A 1KWOC 4PHJA 4R6DA 1KK8B 3LVCA 5DU0A 1S3PA 3ED8A 2OTEA 2VZXA 3CS1A 1K2HA 4H3NA 4ZBLA 1Y0VH 2M9GA 4KW4A 1HQVA 5DTZA 1XFWO 4DXIA 3DD4A 4I5LB 3RWAA 2FZUA 3ICBA 3AI4A 2KFGA 1XFYO 4KW9A 1Y1AA 1YHHA 5EB7A 4W6OA 4PHKA 1B7TZ 3DQAA 2LHIA 2R2IA 4ETOA 2GW3A 1S1EA 4W6CA 3DQFA 3ST2A 5ER5A 1PRWA 1EMKA 1FBVA 3LL8B 4JRBA 1F71A 4P76A 2POXA 1WDCC 2BCBA 1SNLA 3WXAA 1Q73A 4PALA 1CLBA 3VICA 4ZF4A 1MWNA 3I5HB 4KEXA 1CFDA 2KYFA 3O77A 4AR7A 2ZMUA 1ZGPA 1CFPA 4Q7TA 3VGOA 1BODA 1OZOA 5CSNA 1S36A 1XK4A 1J7QA 2Z1OA 4N5XA 4XYNA 1QXTA 1XA9A 2QLHA 1LINA 3DVEA 1WY9A 1LVCD 3SS0A 5AQBB 1JF2A 4ZB1A 1J1DA 3UG0A 1NCXA 1Y6WA 2JOJA 1W7TA 2AWJA 2LV7A 2LCPA 1J1EA 1YUUA 3RLZA 3VRRA 4YI8A 1Q4DA 1XO5A 1SYMA 4W7DA 2BCXA 1BR4B 2PRUA 1G7KA 1BOCA 5GQQC 1QIVA 4ZINA 2D8NA 1TNQA 3CR2A 5BQLA 2K2FA 2EMOA 5IBWA 5HKYA 3WLCA 4JFGA 5CPVA 3TUYC 1U5IA 5CSJA 3A4UB 1F09A 1UHKA 2QLGB 4B30A 1OMDA 1ZFSA 2JRFA 2CXJA 1SCVA 3H1RA 2MAZA 3SVDA 2KI4C 2BL0C 3S05A 2HGDA 4YRUA 4W7XA 2WIQA 2P4MA 4BDUA 1N0YA 3OX5A 4OHSA 4ZF5A 5BTTB 2JZIA 2HF5A 1GJYA 1DJZA 2B3PA 4W74A 2ZN8A 5DPIA 1IQ5A 3VROA 1CDNA 3PN7B 4DRWA 3DQNA 2K7CA 3CFAA 4USLA 4M2QA 1RROA 4A4CA 4RYWA 3SJSA 1D1OA 2KQ6A 3PALA 3VRNA 3NXAA 1DVIA 4RYSA 3NF0A 1CB1A 3PLFB 4OVNF 1NYAA 3SVCA 3CR4X 1UISA 1LKJA 4MZJA 1PK0D 2L50A 5PALA 4D1EA 4I5KA 4PHNA 2BBNA 2G6YA 1DF0B 1WLZA 1KYRA 1EMLA 4PFEA 2BCAA 1L2OB 3EVRA 4LQTA 1W7SA 1K9PA 3JVTB 1KQVA 4LQUA 4MLWA 1XVJA 2ZNEA 3OSRA 3AKAA 5DPHA 1KK8C 2ISDA 4ZFSA 2F3ZA 1V1FA 2I2RE 1KYPA 4H48A 1IJ5A 1LA3A 4Q7RA 2ZO6A 2KYCA 3D10A 1JC1A 1ZGQA 3KHEA 2FOTA 4MZLA 3E3RA 5HZUA 4GOBA 3E5WA 1EJ3A 4FTGA 1PVAA 1PULA 2LC5A 3SVUA 3WCKA 3A8RA 2KAVA 2WCFA 3W1DA 1AJ4A 2O60A 1QV1A 1G33A 1SRAA 5CSIA 2LE9B 4PHMA 1A2XA 2MA2A 4GGFC 2NLNA 2ZRTA 3GL4A 3DQDA 2LVIA 2PMYA 1NP8A 3C1VA 1QYFA 1JSAA 2HFCA 2VVIA 1SPYA 4YGAA 3I5HC 1K94A 1TTXA 1NIWA 3DQLA 2FCEA 1AVSA 1RM9A 3DQ9A 3BXBA 4C0LA 3OX6A 4TZGA 1B8RA 1UP5A 2H5PA 3DQJA 3SVBA 3F45A 1Y1UA 3DQ7A 1NWDA 1UHHA 3BX9A 4OGSA 2YFPA 2MLEC 3SVSA 1OE9B 3P28A 3EK8A 2H5QA 2KNEA 2AAOA 4PE1A 1GL4A 3OP0A 1C07A 4W6SA 5HZSA 3IQQA 4DCKA 1KQMB 3GEXA 1EMCA 2M29A 2GGMA 1SL8A 1XFUO 3IF7A 4HVFA 5EXBA 1MYWA 3FIAA 3VRPA 3SVRA 1JC2A 3I19A 5J3XA 4MSPA 1JF0A 2FCDA 4QJ5B 5KTGA 5HLOA 4BY5A 2QT2A 2COLB 4IK8A 1DTLA 2ZO7A 2BBMA 3OB2B 2LVKA 1PVBA 2HETA 1XYDA 5HLVA 4H3MA 3DQEA 1JFJA 3GB3A 4AQJA 2LM5A 3I5IB 1HCJA 4MEWA 1YRUB 5EXCI 2KI6D 2OKWA 1AK8A 1K96A 3EVVA 3PN7C 1WRKA 4U2VA 3M0WA 1JC0A 4KF4A 2GX0A 3DQCA 1B8LA 1NCYA 3PFVA 2EGDA 4ZCVA 2Y1NA 3TZ1A 4NWSA 4XOVA 1CM1A 1UUSA 1SCMB 2A54B 3I5FB 4OR9B 2F2PA 2EC6B 4IK5A 1SL9A 4WQ3A 4W6LA 2P6BB 1K95A 3PM8A 5AEQA 4Z4MA 1B9AA 3H1OA 2KFFA 5DKQA 1OSAA 3VHTB 3JVTC 3BXAA 3MSEB 1KK7Z 2HCGA 1TCFA 3JTDB 1R6PA 5EJUA 3D0YB 4JGEA 2G6EA 1N2DA 5DKNA 4ZIOA 3SSLA 1KFXL 1MQ1A 3WNXB 4HRGA 2ICRA 2CTNA 1QYQA 4KW8A 5AANA 4W6RA 3EK4A 4LJCA 4KGEA 4DXPA 5F9GA 3ZUJA 4W6NA 5HZTA 1FF1A 1QX5B 5HYDA 1KP5A 1A29A 4PCWA 1RFJA 2KBIA 5AXIA 5DQBA 4HE4A 1MR8A 5DY6A 1ZOTB 1C4FA 2L2EA 2F3YA 5F6TA 2E6WA 1TNPA 2YE0A 1NX1A 4JQ0D 2L4HA 5BPJA 1MOUA 3NSLA 4XJKB 3KPXA 2M49B 3DPZA 2M1UA 4N1GA 3DQOA 3KCTA 1IKUA 2HRSA 4GBAA 2V4EB 4PE0A 1DJXA 2LMVA 1YJ2A 2L0PA 1YUTA 1J7PA 2JWWA 1B1GA 4ICBA 1QVIY 3CWGA 1W7JB 4PE7A 4LJBA 3FWCA 3CTNA 3EK7A 4OJ0A 3AAJA 2WURA 5LK4A 2VAEA 4GGFA 1SKTA 5T3IA 3BYAA 1CDLA 2L51A 1LXFC 1K9KA 2A52B 1CLMA 1BF5A 2NZ0A 3SV5A 1KFUS 3TDUA 3DQ4A 4W6PA 1NSHA 2AH8A 3BUWB 5HBDA 4EDSA 4KGFA 4W6HA 3BOWB 3HX4A 2LP2A 1CDPA 1J55A 1QASA 2JT0A 2GGZA 2WSNA 4I2YA 5JJGA 1KQMC 4W6AA 1BR1B 1J7OA 3KO0A 2PVBA 1S6IA 5KTYA 4GAOA 2JADA 2Z6ZA 1C7VA 1DMOA 3TMRA 1YHGA 1F70A 2PALA 4B30B 1WRLA 2VRGA 3OSQA 1M31A 4F0ZB 4W6GA 3DF0B 3OGOA 1DJWA 2WC8A 1JBAA 3CGLA 1FW4A 5H87A 3FWBA 1BG1A 4EDOA 3I5IC 1AP4A 4EULA 2KQYA 2CNPA 2H9WA 1XSSA 1ZACA 2BE4A 1MF8B 4CLNA 3U0NA 1XFVO 2G5ZB 3LK0A 2IS9A 2ARLA 2IOVA 1OXEA 3LVAA 3PSRA 1IG5A 3E5VA 4MN0A 1GFLA 1QX2A 5H89A 1CNPA 3ZUFA 1SCMC 4TNCA 5BTTA 3I5FC 2MHHA 1YHIA 4W6DA 4ORBB 2L4IA 3O6BA 1QLSA 2EC6C 3BXCA 4CIDA 1Q4BA 3AAKA 2LLTA 3SG2A 4W7FA 2LMUA 4W6BA 2A50B 3JTDC 2M8UA 1F4QA 1GGXA 4C0JA 1RRXA 3KEVA 3LCPC 2Q6PA 5HKZA 2DD9A 1W7IB 4OV2A 2K7OA 5I2OA 1CDMA 4GGNA 1TN4A 1EG3A 2NXQA 2QLEA 2ZNDA 2HQZA 3GK4X 4W6IA 3RM1A 5J2OA 1NX3A 3CLNA 1YR5A 4R6BA 2M0RA 2H2KA 4W6MA 1OXFA 3NEDA 5HW9A 2Z6YA 4XL5A 2Q4UA 4PDZA 4AS8A 2BTJA 3DVMA 2A48A 5EXUA 4HRHA 2L5XB 2EMDA 4ANJA 1S6JA 4IK3A 1SBJA 2LLSA 3ZTFA 3SIBA 3U0KA 1QXPA 4R1EA 2BKIB 3BUOB 2H8QA 3H4SE 4M2PA 1E8AA 4YGEB 2DD7A 1XA5A 4YGDB 4DKMA 1V1GA 1MHOA 1B9CA 4ORAB 1AHRA 2HGYA 1M39A 4QJ3B 2V4EC 1QS7A 4YGBB 2PASA 5LTQA 1EMAA 1YUSA 4IK4A 1H4BA 3A8SA 2G2BA 3DVKA 4AOMA 2WHTA 1H6RA 2LANA 2FJUB 1DJIA 4MRYA 2MRDA 4CFRA 1XK4C 2QLIA 1B4CA 4I5NB 1SK6D 3OHMB 2WCEA 4A4BA 4XGYA 1OZSA 3ADFA 3I5GB 3LVDA 5G08A 2PSRA 3BXKA 4Z4KA 1C7WA 3AKOA 5HKWA 3KCSA 3K1KA 4OKHA 2E30A 3PJ5A 2Y1MA 1X02A 3ST3A 2WCBA 4KF5C 3GJ2A 2AWLA 1UURA 3SSTA 4HSZA 2WISA 2H5OA 4QJ4B 4OCIA 2LVJA 4ZCUA 1DT7B 3U0MA 2G2SB 3CD1A 4JC2A 4TZAA 3LSAA 1MOVA 2H61C 4W7RA 3QRXA 1A75A 1CV7A 2BE6A 1B7TY 3TDIA 3LF4B 3WHTB 4W76A 3UFZA 3NT3A 2LLUA 4W6FA 4C0KA 5KU1A 1ZUXA 2JC2A 4L13A 3HCMA 1MUXA 4GUKA 1Q4EA 5DPJA 3DQKA 1RMMA 2LVVA 1Z1PA 3BQ3A 4XVPA 1BU3A 4P1QA 1NX2A 5B8IB 1EMEA 1CFCA 1GGZA 4GPLB 4Q9WA 2O5GA 2JTZA 1S5GZ 1BLQA 4KPIA 1GQMA 1JFKA 5D69A 4AQIA 4PE4A 1UHJA 1J7RA 1QY3A 1CTRA 2MJWB 3DQHA 5I2LA 1QJTA 2WHSA 3NSIA 2LUXA 5I8NA 2KOTA 4PPJA 3VK1A 2ZFDA 5DTLA 3ST0A 1Y1XA 2WNDA 3PIBA 1F8HA 1L7ZA 2KAXA 2RGIA 1YTZC 2KAYA 1F54A 4JPZB 2DUHA 2V53A 1PALA 2K7DA 1SL7A 4M2OA 3SVNA 3NT9A 3ZNIA 3O78A 2WOSA 2NCPA 4GF6B 2QACA 2DDDA 2AWMA 1TIZA 1JBZA 2B3QA 2DUGA 2FWQA 2KI6C 5FHVA 2M7LA 5TNCA 2OS8B 1CMFA 4MBEA 3DQIA 3PJ7A 1UWOA 4NDCA 1F0BA 4IZNA 4UPGA 3SG4A 5EHUA 2A56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ2 A;  1A4P A;  1Q4C A;  3VHT A;  4MVF A;  4WQ2 A;  1CMG A;  3BUM B;  4HRE E;  2JPT A;  5HGE A;  4EMQ A;  3CGA A;  1NUB A;  1KCY A;  3SSP A;  1F55 A;  5CSF A;  1TRF A;  1WLM A;  2I94 A;  4CFQ A;  1QX7 A;  5KSZ A;  1RK9 A;  3DPX A;  4ZF3 A;  3GOF A;  4PPL A;  3P8U A;  5K89 A;  4B5Y A;  1IH0 A;  1KYS A;  2G6X A;  1IWQ A;  2RH7 A;  4HQ8 A;  2JT8 A;  4XOW A;  4DUQ A;  2K61 A;  2NCO A;  2MBX A;  4LW5 A;  2A47 A;  1BJF A;  3VRQ A;  1JWD A;  2G3D B;  1NPQ A;  4W73 A;  3SRY A;  4W7E A;  2F8P A;  2HJO A;  2DUF A;  4KAG A;  1YVL A;  4NDB A;  1OOJ A;  1IJ6 A;  1Q4A A;  2WHU A;  2IB5 A;  4N1F A;  1XQM A;  2HQK A;  4W6U A;  1EXR A;  2A4J A;  5HZO A;  3SG6 A;  3TS5 B;  4XJK A;  4W6J A;  2AMI A;  3LK1 A;  1RWY A;  3SVE A;  4NDD A;  3I5G C;  1EMM A;  1WRZ A;  2V4E A;  2K0J A;  2ZMW A;  1S26 D;  4W6K A;  1QAT A;  1YRT B;  1FPW A;  2DDC A;  2AHA A;  1ALV A;  1K93 D;  5DRF A;  1HUY A;  1REC A;  4OQW A;  2SCP A;  4N3D A;  4LJD C;  3SSH A;  3KF9 A;  4FQO A;  3DQ5 A;  1CM4 A;  1NX0 A;  1SR6 B;  1FI6 A;  4PPK A;  1DGV A;  2EMN A;  4GES B;  1AJ5 A;  4DKN A;  4ORN A;  2C9I A;  1YX8 A;  2CBL A;  2O29 A;  2LMT A;  5DRG A;  4GNK B;  1BT6 A;  4DS7 A;  1MXE A;  2JNF A;  4W77 A;  1U5I B;  3BOW A;  2GW4 B;  2JQ6 A;  2F2O A;  2EHB A;  3DQ8 A;  4KF5 A;  1B8C A;  2B1U A;  1A03 A;  2KFH A;  3NEZ A;  3BUX B;  2QZ0 A;  2I7A A;  1S6C A;  3LLE A;  1PSB A;  4YGC B;  2H61 A;  1H4U A;  1SY9 A;  2DUI A;  1N65 A;  4HQ9 A;  2PXS A;  4GFT A;  2QLG A;  3DPW A;  1OQP A;  4MZK A;  3CFF A;  1TCO B;  3TDZ A;  3SG5 A;  3DF0 A;  3ZWH A;  1CKK A;  1EMB A;  4NQG A;  1RTP 1;  5DKR A;  1YFP A;  4W69 A;  3PAT A;  5DTX A;  2QU1 A;  3FS7 A;  3DVJ A;  4YBH B;  2O24 A;  3LF3 A;  1DGU A;  2O2B A;  3U8C A;  4Q7U A;  1QLK A;  1TNX A;  3ST4 A;  2G9B A;  2ZRS A;  3GJ1 A;  1QV0 A;  4MRX A;  2VVH A;  4Q04 A;  1RJV A;  4KA9 A;  2JT3 A;  2OS8 C;  1ODB A;  4HQC A;  4DXN A;  1OMV A;  1FI5 A;  5LTP A;  2MLF C;  1QVI Z;  5BT0 A;  3RWT A;  2JXL A;  1DJG A;  1VRK A;  3IR8 A;  1W7U A;  2I18 A;  3SVO A;  1Q80 A;  2KGB C;  1MXL C;  5H88 A;  2Q91 A;  1DF0 A;  2F33 A;  2FL1 A;  2HPS A;  2L98 A;  3AKB A;  1EH2 A;  1QYO A;  5FVF A;  4EN1 A;  2KHN A;  2DOQ A;  1IGV A;  1ZUZ A;  1DJH A;  1TOP A;  1PSR A;  3U8P A;  1UHI A;  3CFH A;  1XMZ A;  1S5G Y;  1YVH A;  2OTG B;  1GGW A;  1KWO B;  2Y5I A;  4CPV A;  1F4O A;  2M1K B;  3NSO A;  4Q9X A;  2LUC A;  3SG7 A;  5AFP A;  2YE1 A;  2PXW A;  3WLD A;  4H3L A;  5DQM A;  3SSV A;  2IB6 A;  3CD9 A;  5LTR A;  1YUR A;  1IQ3 A;  2ZN9 A;  4ORC B;  2A53 B;  4JWQ A;  3CBE A;  1ZMZ A;  3EKH A;  3DQ1 A;  3SSY A;  1LA0 A;  2HQ8 A;  3IQO A;  4P5O E;  3M22 A;  1BFP A;  1KFU L;  1QIW A;  1CLL A;  3DQ6 A;  1EMF A;  3EVP A;  1KFX S;  2HQW A;  5D7F A;  3DQM A;  1SMG A;  1M45 A;  4L12 A;  4J89 A;  4DXO A;  1YJF A;  5I2Q A;  3TS5 C;  1K90 D;  1OMR A;  4IK1 A;  2JU0 A;  1KK7 Y;  2IE2 A;  3CB9 A;  2ZKM X;  4IK9 A;  2A46 A;  2M3W A;  1WDC B;  2GX2 A;  3W1C A;  2SAS A;  1R2U A;  2QPT A;  4P2Y B;  3SIA A;  2VAD A;  4W72 A;  1ZGO A;  2Z6X A;  3PJB A;  1HT9 A;  2OGR A;  1G4Y R;  2OJK A;  3G9A A;  5DTY A;  1XAE A;  4L9M A;  1SR6 C;  2H5R A;  2K2A A;  3OB1 B;  3CR5 X;  4JEO A;  4IL1 A;  1H8B A;  2LNK A;  2JTT A;  2K8M B;  4UTS A;  3M24 A;  1A75 B;  4J8A A;  5DPG A;  2JXC A;  3CZT X;  3WHU B;  4BY4 A;  4I5J A;  4LJD A;  2Y4Q A;  1RMO A;  3NSK A;  2Y0G A;  4U8D A;  3LS3 A;  4WRI A;  1UHN A;  1EMG A;  1Z1Q A;  2KGR A;  3O2P A;  5FYX A;  4W75 A;  2OPO A;  3GK1 A;  2DUE A;  3V3D A;  1CFF A;  3IP2 A;  2C9J A;  5ER4 X;  2GV5 A;  4RTC A;  2K7B A;  3GK2 A;  2HPW A;  2BEC A;  3TUY B;  1YX7 A;  2CT9 A;  4W6T A;  2TN4 A;  2G16 B;  3EKJ A;  2M97 A;  1SW8 A;  1B47 A;  3K21 A;  2KSP A;  3MGF A;  1S6Z A;  3ZUL A;  1RMP A;  2KI4 B;  4OY4 A;  2BL0 B;  4YI9 A;  2H6V A;  3U8A A;  1TNW A;  1K8U A;  4W7A A;  4DIR A;  1M63 B;  1DJY A;  2AWK A;  3SSK A;  3DQ3 A;  3LA1 A;  2KDH A;  2YDZ A;  1ALW A;  1BMO A;  1XFX O;  2WSO A;  5FVG A;  3U0L A;  2G3O A;  4DXM A;  1JUO A;  4H47 A;  2QRF A;  4L1I A;  2VVJ A;  1KSO A;  4J88 A;  1QTX A;  3E5T A;  1OXD A;  2OTB A;  3AI5 A;  1EG4 A;  5AER A;  1M46 A;  2CCM A;  2JNX A;  3SG3 A;  4DXQ A;  5EBJ A;  2BKH B;  2AUC A;  3EVU A;  2M7N A;  3TMT A;  1JBY A;  1AUI B;  2KBM A;  5FVI A;  2JUL A;  1L2O C;  2LHL A;  4W7C A;  1KSM A;  4E68 A;  1K9U A;  1EL4 A;  1IRJ A;  1G8I A;  3O4Y A;  1XFZ O;  2LP3 A;  2OKY A;  2LAP A;  5JOL A;  2WOR A;  1NCZ A;  3D0Y A;  4JF9 A;  1YZW A;  5EB6 A;  3BUN B;  3DQU A;  2OTG C;  2Q57 A;  1KWO C;  4PHJ A;  4R6D A;  1KK8 B;  3LVC A;  5DU0 A;  1S3P A;  3ED8 A;  2OTE A;  2VZX A;  3CS1 A;  1K2H A;  4H3N A;  4ZBL A;  1Y0V H;  2M9G A;  4KW4 A;  1HQV A;  5DTZ A;  1XFW O;  4DXI A;  3DD4 A;  4I5L B;  3RWA A;  2FZU A;  3ICB A;  3AI4 A;  2KFG A;  1XFY O;  4KW9 A;  1Y1A A;  1YHH A;  5EB7 A;  4W6O A;  4PHK A;  1B7T Z;  3DQA A;  2LHI A;  2R2I A;  4ETO A;  2GW3 A;  1S1E A;  4W6C A;  3DQF A;  3ST2 A;  5ER5 A;  1PRW A;  1EMK A;  1FBV A;  3LL8 B;  4JRB A;  1F71 A;  4P76 A;  2POX A;  1WDC C;  2BCB A;  1SNL A;  3WXA A;  1Q73 A;  4PAL A;  1CLB A;  3VIC A;  4ZF4 A;  1MWN A;  3I5H B;  4KEX A;  1CFD A;  2KYF A;  3O77 A;  4AR7 A;  2ZMU A;  1ZGP A;  1CFP A;  4Q7T A;  3VGO A;  1BOD A;  1OZO A;  5CSN A;  1S36 A;  1XK4 A;  1J7Q A;  2Z1O A;  4N5X A;  4XYN A;  1QXT A;  1XA9 A;  2QLH A;  1LIN A;  3DVE A;  1WY9 A;  1LVC D;  3SS0 A;  5AQB B;  1JF2 A;  4ZB1 A;  1J1D A;  3UG0 A;  1NCX A;  1Y6W A;  2JOJ A;  1W7T A;  2AWJ A;  2LV7 A;  2LCP A;  1J1E A;  1YUU A;  3RLZ A;  3VRR A;  4YI8 A;  1Q4D A;  1XO5 A;  1SYM A;  4W7D A;  2BCX A;  1BR4 B;  2PRU A;  1G7K A;  1BOC A;  5GQQ C;  1QIV A;  4ZIN A;  2D8N A;  1TNQ A;  3CR2 A;  5BQL A;  2K2F A;  2EMO A;  5IBW A;  5HKY A;  3WLC A;  4JFG A;  5CPV A;  3TUY C;  1U5I A;  5CSJ A;  3A4U B;  1F09 A;  1UHK A;  2QLG B;  4B30 A;  1OMD A;  1ZFS A;  2JRF A;  2CXJ A;  1SCV A;  3H1R A;  2MAZ A;  3SVD A;  2KI4 C;  2BL0 C;  3S05 A;  2HGD A;  4YRU A;  4W7X A;  2WIQ A;  2P4M A;  4BDU A;  1N0Y A;  3OX5 A;  4OHS A;  4ZF5 A;  5BTT B;  2JZI A;  2HF5 A;  1GJY A;  1DJZ A;  2B3P A;  4W74 A;  2ZN8 A;  5DPI A;  1IQ5 A;  3VRO A;  1CDN A;  3PN7 B;  4DRW A;  3DQN A;  2K7C A;  3CFA A;  4USL A;  4M2Q A;  1RRO A;  4A4C A;  4RYW A;  3SJS A;  1D1O A;  2KQ6 A;  3PAL A;  3VRN A;  3NXA A;  1DVI A;  4RYS A;  3NF0 A;  1CB1 A;  3PLF B;  4OVN F;  1NYA A;  3SVC A;  3CR4 X;  1UIS A;  1LKJ A;  4MZJ A;  1PK0 D;  2L50 A;  5PAL A;  4D1E A;  4I5K A;  4PHN A;  2BBN A;  2G6Y A;  1DF0 B;  1WLZ A;  1KYR A;  1EML A;  4PFE A;  2BCA A;  1L2O B;  3EVR A;  4LQT A;  1W7S A;  1K9P A;  3JVT B;  1KQV A;  4LQU A;  4MLW A;  1XVJ A;  2ZNE A;  3OSR A;  3AKA A;  5DPH A;  1KK8 C;  2ISD A;  4ZFS A;  2F3Z A;  1V1F A;  2I2R E;  1KYP A;  4H48 A;  1IJ5 A;  1LA3 A;  4Q7R A;  2ZO6 A;  2KYC A;  3D10 A;  1JC1 A;  1ZGQ A;  3KHE A;  2FOT A;  4MZL A;  3E3R A;  5HZU A;  4GOB A;  3E5W A;  1EJ3 A;  4FTG A;  1PVA A;  1PUL A;  2LC5 A;  3SVU A;  3WCK A;  3A8R A;  2KAV A;  2WCF A;  3W1D A;  1AJ4 A;  2O60 A;  1QV1 A;  1G33 A;  1SRA A;  5CSI A;  2LE9 B;  4PHM A;  1A2X A;  2MA2 A;  4GGF C;  2NLN A;  2ZRT A;  3GL4 A;  3DQD A;  2LVI A;  2PMY A;  1NP8 A;  3C1V A;  1QYF A;  1JSA A;  2HFC A;  2VVI A;  1SPY A;  4YGA A;  3I5H C;  1K94 A;  1TTX A;  1NIW A;  3DQL A;  2FCE A;  1AVS A;  1RM9 A;  3DQ9 A;  3BXB A;  4C0L A;  3OX6 A;  4TZG A;  1B8R A;  1UP5 A;  2H5P A;  3DQJ A;  3SVB A;  3F45 A;  1Y1U A;  3DQ7 A;  1NWD A;  1UHH A;  3BX9 A;  4OGS A;  2YFP A;  2MLE C;  3SVS A;  1OE9 B;  3P28 A;  3EK8 A;  2H5Q A;  2KNE A;  2AAO A;  4PE1 A;  1GL4 A;  3OP0 A;  1C07 A;  4W6S A;  5HZS A;  3IQQ A;  4DCK A;  1KQM B;  3GEX A;  1EMC A;  2M29 A;  2GGM A;  1SL8 A;  1XFU O;  3IF7 A;  4HVF A;  5EXB A;  1MYW A;  3FIA A;  3VRP A;  3SVR A;  1JC2 A;  3I19 A;  5J3X A;  4MSP A;  1JF0 A;  2FCD A;  4QJ5 B;  5KTG A;  5HLO A;  4BY5 A;  2QT2 A;  2COL B;  4IK8 A;  1DTL A;  2ZO7 A;  2BBM A;  3OB2 B;  2LVK A;  1PVB A;  2HET A;  1XYD A;  5HLV A;  4H3M A;  3DQE A;  1JFJ A;  3GB3 A;  4AQJ A;  2LM5 A;  3I5I B;  1HCJ A;  4MEW A;  1YRU B;  5EXC I;  2KI6 D;  2OKW A;  1AK8 A;  1K96 A;  3EVV A;  3PN7 C;  1WRK A;  4U2V A;  3M0W A;  1JC0 A;  4KF4 A;  2GX0 A;  3DQC A;  1B8L A;  1NCY A;  3PFV A;  2EGD A;  4ZCV A;  2Y1N A;  3TZ1 A;  4NWS A;  4XOV A;  1CM1 A;  1UUS A;  1SCM B;  2A54 B;  3I5F B;  4OR9 B;  2F2P A;  2EC6 B;  4IK5 A;  1SL9 A;  4WQ3 A;  4W6L A;  2P6B B;  1K95 A;  3PM8 A;  5AEQ A;  4Z4M A;  1B9A A;  3H1O A;  2KFF A;  5DKQ A;  1OSA A;  3VHT B;  3JVT C;  3BXA A;  3MSE B;  1KK7 Z;  2HCG A;  1TCF A;  3JTD B;  1R6P A;  5EJU A;  3D0Y B;  4JGE A;  2G6E A;  1N2D A;  5DKN A;  4ZIO A;  3SSL A;  1KFX L;  1MQ1 A;  3WNX B;  4HRG A;  2ICR A;  2CTN A;  1QYQ A;  4KW8 A;  5AAN A;  4W6R A;  3EK4 A;  4LJC A;  4KGE A;  4DXP A;  5F9G A;  3ZUJ A;  4W6N A;  5HZT A;  1FF1 A;  1QX5 B;  5HYD A;  1KP5 A;  1A29 A;  4PCW A;  1RFJ A;  2KBI A;  5AXI A;  5DQB A;  4HE4 A;  1MR8 A;  5DY6 A;  1ZOT B;  1C4F A;  2L2E A;  2F3Y A;  5F6T A;  2E6W A;  1TNP A;  2YE0 A;  1NX1 A;  4JQ0 D;  2L4H A;  5BPJ A;  1MOU A;  3NSL A;  4XJK B;  3KPX A;  2M49 B;  3DPZ A;  2M1U A;  4N1G A;  3DQO A;  3KCT A;  1IKU A;  2HRS A;  4GBA A;  2V4E B;  4PE0 A;  1DJX A;  2LMV A;  1YJ2 A;  2L0P A;  1YUT A;  1J7P A;  2JWW A;  1B1G A;  4ICB A;  1QVI Y;  3CWG A;  1W7J B;  4PE7 A;  4LJB A;  3FWC A;  3CTN A;  3EK7 A;  4OJ0 A;  3AAJ A;  2WUR A;  5LK4 A;  2VAE A;  4GGF A;  1SKT A;  5T3I A;  3BYA A;  1CDL A;  2L51 A;  1LXF C;  1K9K A;  2A52 B;  1CLM A;  1BF5 A;  2NZ0 A;  3SV5 A;  1KFU S;  3TDU A;  3DQ4 A;  4W6P A;  1NSH A;  2AH8 A;  3BUW B;  5HBD A;  4EDS A;  4KGF A;  4W6H A;  3BOW B;  3HX4 A;  2LP2 A;  1CDP A;  1J55 A;  1QAS A;  2JT0 A;  2GGZ A;  2WSN A;  4I2Y A;  5JJG A;  1KQM C;  4W6A A;  1BR1 B;  1J7O A;  3KO0 A;  2PVB A;  1S6I A;  5KTY A;  4GAO A;  2JAD A;  2Z6Z A;  1C7V A;  1DMO A;  3TMR A;  1YHG A;  1F70 A;  2PAL A;  4B30 B;  1WRL A;  2VRG A;  3OSQ A;  1M31 A;  4F0Z B;  4W6G A;  3DF0 B;  3OGO A;  1DJW A;  2WC8 A;  1JBA A;  3CGL A;  1FW4 A;  5H87 A;  3FWB A;  1BG1 A;  4EDO A;  3I5I C;  1AP4 A;  4EUL A;  2KQY A;  2CNP A;  2H9W A;  1XSS A;  1ZAC A;  2BE4 A;  1MF8 B;  4CLN A;  3U0N A;  1XFV O;  2G5Z B;  3LK0 A;  2IS9 A;  2ARL A;  2IOV A;  1OXE A;  3LVA A;  3PSR A;  1IG5 A;  3E5V A;  4MN0 A;  1GFL A;  1QX2 A;  5H89 A;  1CNP A;  3ZUF A;  1SCM C;  4TNC A;  5BTT A;  3I5F C;  2MHH A;  1YHI A;  4W6D A;  4ORB B;  2L4I A;  3O6B A;  1QLS A;  2EC6 C;  3BXC A;  4CID A;  1Q4B A;  3AAK A;  2LLT A;  3SG2 A;  4W7F A;  2LMU A;  4W6B A;  2A50 B;  3JTD C;  2M8U A;  1F4Q A;  1GGX A;  4C0J A;  1RRX A;  3KEV A;  3LCP C;  2Q6P A;  5HKZ A;  2DD9 A;  1W7I B;  4OV2 A;  2K7O A;  5I2O A;  1CDM A;  4GGN A;  1TN4 A;  1EG3 A;  2NXQ A;  2QLE A;  2ZND A;  2HQZ A;  3GK4 X;  4W6I A;  3RM1 A;  5J2O A;  1NX3 A;  3CLN A;  1YR5 A;  4R6B A;  2M0R A;  2H2K A;  4W6M A;  1OXF A;  3NED A;  5HW9 A;  2Z6Y A;  4XL5 A;  2Q4U A;  4PDZ A;  4AS8 A;  2BTJ A;  3DVM A;  2A48 A;  5EXU A;  4HRH A;  2L5X B;  2EMD A;  4ANJ A;  1S6J A;  4IK3 A;  1SBJ A;  2LLS A;  3ZTF A;  3SIB A;  3U0K A;  1QXP A;  4R1E A;  2BKI B;  3BUO B;  2H8Q A;  3H4S E;  4M2P A;  1E8A A;  4YGE B;  2DD7 A;  1XA5 A;  4YGD B;  4DKM A;  1V1G A;  1MHO A;  1B9C A;  4ORA B;  1AHR A;  2HGY A;  1M39 A;  4QJ3 B;  2V4E C;  1QS7 A;  4YGB B;  2PAS A;  5LTQ A;  1EMA A;  1YUS A;  4IK4 A;  1H4B A;  3A8S A;  2G2B A;  3DVK A;  4AOM A;  2WHT A;  1H6R A;  2LAN A;  2FJU B;  1DJI A;  4MRY A;  2MRD A;  4CFR A;  1XK4 C;  2QLI A;  1B4C A;  4I5N B;  1SK6 D;  3OHM B;  2WCE A;  4A4B A;  4XGY A;  1OZS A;  3ADF A;  3I5G B;  3LVD A;  5G08 A;  2PSR A;  3BXK A;  4Z4K A;  1C7W A;  3AKO A;  5HKW A;  3KCS A;  3K1K A;  4OKH A;  2E30 A;  3PJ5 A;  2Y1M A;  1X02 A;  3ST3 A;  2WCB A;  4KF5 C;  3GJ2 A;  2AWL A;  1UUR A;  3SST A;  4HSZ A;  2WIS A;  2H5O A;  4QJ4 B;  4OCI A;  2LVJ A;  4ZCU A;  1DT7 B;  3U0M A;  2G2S B;  3CD1 A;  4JC2 A;  4TZA A;  3LSA A;  1MOV A;  2H61 C;  4W7R A;  3QRX A;  1A75 A;  1CV7 A;  2BE6 A;  1B7T Y;  3TDI A;  3LF4 B;  3WHT B;  4W76 A;  3UFZ A;  3NT3 A;  2LLU A;  4W6F A;  4C0K A;  5KU1 A;  1ZUX A;  2JC2 A;  4L13 A;  3HCM A;  1MUX A;  4GUK A;  1Q4E A;  5DPJ A;  3DQK A;  1RMM A;  2LVV A;  1Z1P A;  3BQ3 A;  4XVP A;  1BU3 A;  4P1Q A;  1NX2 A;  5B8I B;  1EME A;  1CFC A;  1GGZ A;  4GPL B;  4Q9W A;  2O5G A;  2JTZ A;  1S5G Z;  1BLQ A;  4KPI A;  1GQM A;  1JFK A;  5D69 A;  4AQI A;  4PE4 A;  1UHJ A;  1J7R A;  1QY3 A;  1CTR A;  2MJW B;  3DQH A;  5I2L A;  1QJT A;  2WHS A;  3NSI A;  2LUX A;  5I8N A;  2KOT A;  4PPJ A;  3VK1 A;  2ZFD A;  5DTL A;  3ST0 A;  1Y1X A;  2WND A;  3PIB A;  1F8H A;  1L7Z A;  2KAX A;  2RGI A;  1YTZ C;  2KAY A;  1F54 A;  4JPZ B;  2DUH A;  2V53 A;  1PAL A;  2K7D A;  1SL7 A;  4M2O A;  3SVN A;  3NT9 A;  3ZNI A;  3O78 A;  2WOS A;  2NCP A;  4GF6 B;  2QAC A;  2DDD A;  2AWM A;  1TIZ A;  1JBZ A;  2B3Q A;  2DUG A;  2FWQ A;  2KI6 C;  5FHV A;  2M7L A;  5TNC A;  2OS8 B;  1CMF A;  4MBE A;  3DQI A;  3PJ7 A;  1UWO A;  4NDC A;  1F0B A;  4IZN A;  4UPG A;  3SG4 A;  5EHU A;  2A56 B; 
#chains in the Genus database with same CATH topology
 3DQ2 A;  1A4P A;  1Q4C A;  3VHT A;  2WCM A;  4MVF A;  4WQ2 A;  1CMG A;  3BUM B;  4HRE E;  2JPT A;  5HGE A;  4EMQ A;  3CGA A;  1NUB A;  1KCY A;  1Z2C B;  3SSP A;  3RZS A;  1F55 A;  5CSF A;  1TRF A;  1WLM A;  2I94 A;  4CFQ A;  1QX7 A;  5KSZ A;  1TWO A;  1RK9 A;  3DPX A;  4ZF3 A;  3GOF A;  4PPL A;  3P8U A;  5K89 A;  4B5Y A;  1IH0 A;  1KYS A;  2G6X A;  1IWQ A;  2RH7 A;  4HQ8 A;  2JT8 A;  4XOW A;  4DUQ A;  2K61 A;  2NCO A;  2MBX A;  4LW5 A;  2A47 A;  1BJF A;  3VRQ A;  1JWD A;  2G3D B;  1NPQ A;  4W73 A;  3SRY A;  4W7E A;  2F8P A;  2HJO A;  2DUF A;  4KAG A;  1YVL A;  4NDB A;  1OOJ A;  1IJ6 A;  1Q4A A;  2WHU A;  2IB5 A;  4N1F A;  1XQM A;  2HQK A;  4W6U A;  1EXR A;  2A4J A;  5HZO A;  3SG6 A;  3OGN A;  3D77 A;  3TS5 B;  4XJK A;  4W6J A;  1OOH A;  2PYQ A;  2AMI A;  3LK1 A;  1RWY A;  3SVE A;  4NDD A;  3I5G C;  1EMM A;  1WRZ A;  2V4E A;  2K0J A;  2ZMW A;  1S26 D;  4W6K A;  1QAT A;  3CAB A;  1YRT B;  2H8V A;  1FPW A;  2DDC A;  2AHA A;  1ALV A;  1K93 D;  5DRF A;  1HUY A;  1REC A;  4OQW A;  2SCP A;  4N3D A;  4LJD C;  3SSH A;  3KF9 A;  4FQO A;  3DQ5 A;  1CM4 A;  1NX0 A;  1SR6 B;  1FI6 A;  4PPK A;  1DGV A;  3SS4 A;  2EMN A;  4GES B;  1AJ5 A;  4DKN A;  4ORN A;  2C9I A;  1YX8 A;  2CBL A;  2O29 A;  2LMT A;  5DRG A;  4GNK B;  1BT6 A;  4DS7 A;  1MXE A;  2JNF A;  4W77 A;  1U5I B;  3BOW A;  2GW4 B;  2JQ6 A;  2F2O A;  2EHB A;  3DQ8 A;  4KF5 A;  1B8C A;  3O4X A;  2B1U A;  1A03 A;  2KFH A;  3NEZ A;  3BUX B;  2QZ0 A;  2I7A A;  1S6C A;  3LLE A;  1PSB A;  3BFH A;  4YGC B;  2H61 A;  1H4U A;  1SY9 A;  2DUI A;  1N65 A;  4HQ9 A;  2BNX A;  2PXS A;  4GFT A;  3N7H A;  5I94 A;  2QLG A;  3DPW A;  5FI7 A;  3BFB A;  1OQP A;  4MZK A;  3CFF A;  1TCO B;  3TDZ A;  3SG5 A;  3DF0 A;  3ZWH A;  1CKK A;  1EMB A;  1TUZ A;  4NQG A;  1RTP 1;  5DKR A;  2QEO A;  1YFP A;  4W69 A;  3PAT A;  5DTX A;  3SS3 A;  2QU1 A;  3FS7 A;  3DVJ A;  4YBH B;  2O24 A;  3LF3 A;  1DGU A;  2O2B A;  3U8C A;  4Q7U A;  1QLK A;  1TNX A;  3ST4 A;  2G9B A;  2ZRS A;  3GJ1 A;  1QV0 A;  4MRX A;  2VVH A;  4Q04 A;  1RJV A;  4KA9 A;  2JT3 A;  2OS8 C;  1ODB A;  4HQC A;  4DXN A;  1DQE A;  1OMV A;  2WC5 A;  1FI5 A;  5LTP A;  2MLF C;  1QVI Z;  4PT1 A;  5BT0 A;  3RWT A;  3BFA A;  2JXL A;  3Q8I A;  1DJG A;  1VRK A;  3IR8 A;  5D3O A;  1W7U A;  2I18 A;  3SVO A;  1Q80 A;  2KGB C;  1MXL C;  5H88 A;  2Q91 A;  1DF0 A;  2F33 A;  2FL1 A;  2HPS A;  2L98 A;  3AKB A;  2L2C A;  1EH2 A;  1QYO A;  5FVF A;  4EN1 A;  2KHN A;  2DOQ A;  1IGV A;  1ZUZ A;  1DJH A;  1TOP A;  1PSR A;  3U8P A;  1UHI A;  3CFH A;  1XMZ A;  1S5G Y;  1YVH A;  2OTG B;  1GGW A;  1KWO B;  2Y5I A;  4CPV A;  1F4O A;  2M1K B;  3NSO A;  4Q9X A;  2LUC A;  3SG7 A;  5AFP A;  4OZD A;  2YE1 A;  1SSE B;  2PXW A;  3WLD A;  3FE9 A;  2K60 A;  4H3L A;  5DQM A;  1C3Z A;  3SSV A;  2IB6 A;  3CD9 A;  5LTR A;  1YUR A;  1IQ3 A;  2ZN9 A;  4ORC B;  2A53 B;  4JWQ A;  3DYE A;  3CBE A;  1ZMZ A;  3EKH A;  3DQ1 A;  3SSY A;  1LA0 A;  2HQ8 A;  3IQO A;  4P5O E;  3M22 A;  1BFP A;  1KFU L;  2P70 A;  1QIW A;  1CLL A;  3DQ6 A;  1EMF A;  3EVP A;  1KFX S;  2HQW A;  5D7F A;  3DQM A;  1SMG A;  1M45 A;  4L12 A;  4J89 A;  4DXO A;  1YJF A;  5I2Q A;  3TS5 C;  1K90 D;  1OMR A;  4IK1 A;  2JU0 A;  1KK7 Y;  2IE2 A;  3CB9 A;  2ZKM X;  4IK9 A;  2A46 A;  2M3W A;  1WDC B;  2GX2 A;  3W1C A;  2SAS A;  1R2U A;  2QPT A;  4P2Y B;  3SIA A;  2L5Y A;  2VAD A;  4W72 A;  3CZ1 A;  1ZGO A;  2Z6X A;  3PJB A;  1HT9 A;  2OGR A;  1G4Y R;  3CYZ A;  2OJK A;  2WCJ A;  3G9A A;  5DTY A;  1XAE A;  4L9M A;  1SR6 C;  4FQT A;  2H5R A;  2K2A A;  3OB1 B;  3CR5 X;  4JEO A;  4IL1 A;  1OW4 A;  1H8B A;  2LNK A;  2JTT A;  1OOF A;  2K8M B;  4UTS A;  3M24 A;  1A75 B;  4J8A A;  5DPG A;  2JXC A;  3CZT X;  3WHU B;  4BY4 A;  4I5J A;  4LJD A;  2Y4Q A;  1RMO A;  3NSK A;  2Y0G A;  4U8D A;  3LS3 A;  4WRI A;  1UHN A;  1OOI X;  1EMG A;  1C3Y A;  1Z1Q A;  2KGR A;  3O2P A;  5FYX A;  4W75 A;  2OPO A;  3GK1 A;  2DUE A;  3V3D A;  1CFF A;  3IP2 A;  2C9J A;  5ER4 X;  2GV5 A;  4RTC A;  2K7B A;  3GK2 A;  2HPW A;  2BEC A;  3TUY B;  1YX7 A;  2CT9 A;  3NHI A;  4W6T A;  2TN4 A;  2G16 B;  3EKJ A;  2M97 A;  1SW8 A;  1B47 A;  3K21 A;  2KSP A;  3MGF A;  1S6Z A;  3ZUL A;  1RMP A;  2KI4 B;  4OY4 A;  2BL0 B;  4YI9 A;  2H6V A;  3U8A A;  1TNW A;  1K8U A;  4W7A A;  4DIR A;  1M63 B;  1DJY A;  2AWK A;  3SSK A;  1P28 A;  3DZT A;  3DQ3 A;  2KDH A;  2YDZ A;  3LA1 A;  1ALW A;  1BMO A;  1XFX O;  2WSO A;  5FVG A;  3U0L A;  2G3O A;  4DXM A;  1JUO A;  4H47 A;  2QRF A;  4L1I A;  2VVJ A;  1KSO A;  4J88 A;  1QTX A;  3E5T A;  1OXD A;  5DIC A;  2OTB A;  3AI5 A;  1EG4 A;  5AER A;  1M46 A;  2CCM A;  2JNX A;  3SG3 A;  4DXQ A;  5EBJ A;  2BKH B;  2AUC A;  3EVU A;  2M7N A;  3TMT A;  1JBY A;  1AUI B;  2KBM A;  5FVI A;  2BAP A;  2JUL A;  1L2O C;  2LHL A;  5HL1 A;  4W7C A;  1KSM A;  2QEH A;  1K9U A;  4E68 A;  1EL4 A;  1IRJ A;  1G8I A;  3O4Y A;  1XFZ O;  2LP3 A;  2OKY A;  2LAP A;  5JOL A;  2WOR A;  1NCZ A;  3D0Y A;  4JF9 A;  1YZW A;  5EB6 A;  3BUN B;  3DQU A;  2OTG C;  2Q57 A;  1KWO C;  4PHJ A;  4R6D A;  1KK8 B;  3S0E A;  3LVC A;  5DU0 A;  1S3P A;  3ED8 A;  2OTE A;  2VZX A;  3CS1 A;  1K2H A;  4H3N A;  4ZBL A;  1Y0V H;  4INW A;  2M9G A;  4KW4 A;  1HQV A;  5DTZ A;  1XFW O;  4DXI A;  3DD4 A;  4I5L B;  3RWA A;  2FZU A;  3ICB A;  3AI4 A;  2KFG A;  1XFY O;  4KW9 A;  1Y1A A;  1YHH A;  5EB7 A;  4W6O A;  4PHK A;  1B7T Z;  3DQA A;  2LHI A;  5FI2 A;  2R2I A;  4ETO A;  2GW3 A;  1S1E A;  4W6C A;  3DQF A;  3ST2 A;  5ER5 A;  1PRW A;  1EMK A;  1FBV A;  3LL8 B;  4JRB A;  1F71 A;  3R1V A;  4P76 A;  2POX A;  1WDC C;  2BCB A;  1SNL A;  3WXA A;  1Q73 A;  3D78 A;  4PAL A;  1CLB A;  3VIC A;  4ZF4 A;  1MWN A;  3I5H B;  4KEX A;  1CFD A;  3CZ2 A;  2KYF A;  3O77 A;  4AR7 A;  2ZMU A;  1ZGP A;  1CFP A;  4Q7T A;  3VGO A;  1BOD A;  1OZO A;  5CSN A;  1S36 A;  1XK4 A;  3QME A;  1J7Q A;  2Z1O A;  3R72 A;  4N5X A;  4XYN A;  1QXT A;  1XA9 A;  2KPH A;  2QLH A;  1LIN A;  3DVE A;  1WY9 A;  1LVC D;  3SS0 A;  5AQB B;  1JF2 A;  4ZB1 A;  1J1D A;  3UG0 A;  1NCX A;  1Y6W A;  2JOJ A;  1W7T A;  2AWJ A;  2LV7 A;  2LCP A;  1IIO A;  1J1E A;  1YUU A;  3RLZ A;  3VRR A;  3K1E A;  4YI8 A;  1Q4D A;  1XO5 A;  1SYM A;  4W7D A;  2BCX A;  1BR4 B;  2PRU A;  1DEK A;  3L4L A;  1G7K A;  1BOC A;  5GQQ C;  1QIV A;  4ZIN A;  2D8N A;  1TNQ A;  3CR2 A;  5BQL A;  2K2F A;  2EMO A;  5IBW A;  5HKY A;  3WLC A;  4JFG A;  5CPV A;  3TUY C;  1U5I A;  5CSJ A;  3A4U B;  1F09 A;  1UHK A;  2QLG B;  4B30 A;  1DC1 A;  1OMD A;  1ZFS A;  2JRF A;  2CXJ A;  1SCV A;  3H1R A;  2MAZ A;  3SVD A;  2KI4 C;  2BL0 C;  3S05 A;  2HGD A;  4YRU A;  4W7X A;  2WIQ A;  2P4M A;  4BDU A;  1N0Y A;  3OX5 A;  1ORG A;  4OHS A;  4ZF5 A;  5BTT B;  2JZI A;  2HF5 A;  1GJY A;  1DJZ A;  2B3P A;  4W74 A;  2ZN8 A;  5DPI A;  1IQ5 A;  3VRO A;  1CDN A;  3PN7 B;  4DRW A;  3DQN A;  2K7C A;  3CFA A;  4USL A;  4M2Q A;  1RRO A;  4A4C A;  4RYW A;  3SJS A;  1D1O A;  2KQ6 A;  3PAL A;  3VRN A;  3NXA A;  1DVI A;  4RYS A;  3NF0 A;  1CB1 A;  3PLF B;  3S0F A;  4OVN F;  1NYA A;  3SVC A;  3CR4 X;  1UIS A;  1LKJ A;  3EG5 B;  3V2L A;  4MZJ A;  1PK0 D;  2L50 A;  5PAL A;  4D1E A;  4I5K A;  4PHN A;  2BBN A;  4INX A;  2G6Y A;  1DF0 B;  1WLZ A;  1KYR A;  1EML A;  4PFE A;  2BCA A;  3L4A A;  1L2O B;  3EVR A;  4LQT A;  1W7S A;  1K9P A;  3JVT B;  1KQV A;  4LQU A;  4MLW A;  2WCL A;  1XVJ A;  2ZNE A;  3OSR A;  3AKA A;  5DPH A;  1KK8 C;  3R1O A;  2ISD A;  4ZFS A;  2F3Z A;  1V1F A;  2I2R E;  1KYP A;  4H48 A;  1IJ5 A;  1LA3 A;  4Q7R A;  2ZO6 A;  1W9Z A;  2KLD A;  2KYC A;  3D10 A;  1JC1 A;  1ZGQ A;  2KLE A;  3KHE A;  2FOT A;  4MZL A;  3S0B A;  3E3R A;  5HZU A;  4GOB A;  3E5W A;  1EJ3 A;  4FTG A;  1PVA A;  1PUL A;  2LC5 A;  3SVU A;  3WCK A;  3A8R A;  2KAV A;  2WCF A;  3W1D A;  1AJ4 A;  2O60 A;  1QV1 A;  1G33 A;  1SRA A;  5CSI A;  2LE9 B;  4PHM A;  1A2X A;  2MA2 A;  4GGF C;  2NLN A;  2ZRT A;  3GL4 A;  3DQD A;  2LVI A;  2PMY A;  1NP8 A;  3C1V A;  1QYF A;  1JSA A;  2HFC A;  2P71 A;  2VVI A;  1SPY A;  4YGA A;  3I5H C;  1K94 A;  1TTX A;  1NIW A;  3DQL A;  2FCE A;  1AVS A;  1RM9 A;  3DQ9 A;  3BXB A;  4C0L A;  3OX6 A;  3SS5 A;  4TZG A;  1B8R A;  1UP5 A;  2H5P A;  3DQJ A;  3SVB A;  3F45 A;  1Y1U A;  3IVT A;  3DQ7 A;  1NWD A;  1UHH A;  3BX9 A;  4JKT A;  4OGS A;  2YFP A;  2MLE C;  3SVS A;  1OE9 B;  2WC6 A;  3P28 A;  3EK8 A;  2H5Q A;  2KNE A;  2AAO A;  4PE1 A;  1GL4 A;  3OP0 A;  1C07 A;  4W6S A;  5HZS A;  3IQQ A;  4DCK A;  1KQM B;  3GEX A;  1EMC A;  2M29 A;  2GGM A;  1SL8 A;  1XFU O;  3IF7 A;  4HVF A;  5EXB A;  1MYW A;  3FIA A;  3VRP A;  3SVR A;  1JC2 A;  3I19 A;  5J3X A;  4MSP A;  1JF0 A;  2FCD A;  4QJ5 B;  5KTG A;  5HLO A;  4BY5 A;  2QT2 A;  2COL B;  4IK8 A;  2PQL A;  3B87 A;  1DTL A;  1OOG A;  3FE8 A;  3FE6 A;  1Z4H A;  2ZO7 A;  2BBM A;  3OB2 B;  2LVK A;  1PVB A;  2HET A;  1XYD A;  5HLV A;  3S0A A;  2QEV A;  4H3M A;  3DQE A;  1JFJ A;  3GB3 A;  4AQJ A;  2LM5 A;  3I5I B;  1HCJ A;  4MEW A;  1YRU B;  5EXC I;  2KI6 D;  2OKW A;  2YGU A;  1K96 A;  3EVV A;  3PN7 C;  1WRK A;  1AK8 A;  3UNW A;  4U2V A;  3M0W A;  1JC0 A;  4KF4 A;  2GX0 A;  3DQC A;  1B8L A;  1NCY A;  3PFV A;  2EGD A;  3BJH A;  4ZCV A;  2Y1N A;  3TZ1 A;  4NWS A;  4XOV A;  1CM1 A;  1UUS A;  1SCM B;  2A54 B;  3I5F B;  4OR9 B;  2F2P A;  2EC6 B;  4IK5 A;  1SL9 A;  4WQ3 A;  4W6L A;  2P6B B;  1K95 A;  3PM8 A;  5AEQ A;  3D76 A;  4Z4M A;  1B9A A;  3H1O A;  2KFF A;  5DKQ A;  1OSA A;  3VHT B;  3JVT C;  3BXA A;  3MSE B;  1KK7 Z;  2HCG A;  1TCF A;  3JTD B;  1R6P A;  5EJU A;  3D0Y B;  4JGE A;  2G6E A;  1N2D A;  5DKN A;  4ZIO A;  3SSL A;  1KFX L;  1MQ1 A;  3WNX B;  4HRG A;  2ICR A;  2CTN A;  3B86 A;  1QYQ A;  4KW8 A;  5AAN A;  4W6R A;  3EK4 A;  4LJC A;  4KGE A;  4DXP A;  2FJY A;  5F9G A;  3ZUJ A;  3B88 A;  4W6N A;  5HZT A;  1FF1 A;  1QX5 B;  5HYD A;  1KP5 A;  3D75 A;  1A29 A;  4PCW A;  4KYN A;  1RFJ A;  2KBI A;  5AXI A;  5DQB A;  3PJI A;  4HE4 A;  1MR8 A;  5DY6 A;  1ZOT B;  1C4F A;  2L2E A;  2F3Y A;  5F6T A;  2E6W A;  4IJ7 A;  1TNP A;  2YE0 A;  1NX1 A;  4JQ0 D;  2L4H A;  5BPJ A;  1MOU A;  3NSL A;  4XJK B;  3KPX A;  2M49 B;  3DPZ A;  2M1U A;  4N1G A;  3DQO A;  3KCT A;  3D74 A;  1IKU A;  2HRS A;  4GBA A;  2V4E B;  4PE0 A;  1DJX A;  2LMV A;  1YJ2 A;  2L0P A;  1YUT A;  3D73 A;  1J7P A;  2JWW A;  2WCK A;  1B1G A;  3DY9 A;  4ICB A;  1QVI Y;  3CWG A;  1W7J B;  4PE7 A;  4LJB A;  3FWC A;  3CTN A;  3EK7 A;  3CZ0 A;  4OJ0 A;  3AAJ A;  2WUR A;  5LK4 A;  2VAE A;  4GGF A;  3S0G A;  1SKT A;  5T3I A;  3BYA A;  1CDL A;  3L47 A;  2L51 A;  1LXF C;  1K9K A;  2A52 B;  1CLM A;  1BF5 A;  2NZ0 A;  3SV5 A;  1KFU S;  3TDU A;  3DQ4 A;  4W6P A;  1NSH A;  2AH8 A;  3BUW B;  5HBD A;  4EDS A;  4KGF A;  3OBV A;  4W6H A;  3BOW B;  3HX4 A;  2LP2 A;  1CDP A;  1J55 A;  1QAS A;  2JT0 A;  2GGZ A;  2WSN A;  4I2Y A;  5JJG A;  1LS8 A;  1KQM C;  4W6A A;  1BR1 B;  1J7O A;  3KO0 A;  2PVB A;  1S6I A;  5KTY A;  4GAO A;  2JAD A;  2Z6Z A;  1C7V A;  1DMO A;  3TMR A;  1YHG A;  1F70 A;  2PAL A;  4B30 B;  1WRL A;  2VRG A;  3OSQ A;  1M31 A;  4F0Z B;  4W6G A;  3DF0 B;  3UO9 A;  3OGO A;  1DJW A;  2WC8 A;  1JBA A;  3CGL A;  1FW4 A;  2QDI A;  5H87 A;  3FWB A;  1BG1 A;  4EDO A;  3I5I C;  1AP4 A;  5FI6 A;  2GTE A;  4EUL A;  2KQY A;  2CNP A;  2H9W A;  1XSS A;  1ZAC A;  2BE4 A;  1MF8 B;  4CLN A;  3U0N A;  1XFV O;  2G5Z B;  3LK0 A;  2IS9 A;  2ARL A;  2IOV A;  1OXE A;  3LVA A;  3PSR A;  3NGV A;  1IG5 A;  3E5V A;  1QWV A;  4MN0 A;  1GFL A;  1QX2 A;  5H89 A;  1CNP A;  3ZUF A;  1SCM C;  4TNC A;  3PM2 A;  5BTT A;  3I5F C;  2MHH A;  1YHI A;  4W6D A;  4ORB B;  2L4I A;  3O6B A;  1TUJ A;  1QLS A;  2EC6 C;  3BXC A;  4CID A;  1Q4B A;  3AAK A;  2LLT A;  3SG2 A;  4W7F A;  3B6X A;  2LMU A;  4W6B A;  2A50 B;  3JTD C;  2M8U A;  1F4Q A;  1GGX A;  3B7A A;  4C0J A;  1RRX A;  3KEV A;  3LCP C;  2Q6P A;  5HKZ A;  2DD9 A;  1W7I B;  4OV2 A;  2K7O A;  5I2O A;  1CDM A;  4GGN A;  1TN4 A;  1EG3 A;  2NXQ A;  2QLE A;  2ZND A;  2HQZ A;  3GK4 X;  4W6I A;  3RM1 A;  5J2O A;  2ERB A;  1NX3 A;  3CLN A;  1YR5 A;  4R6B A;  2M0R A;  2H2K A;  4W6M A;  1OXF A;  5EL2 A;  3NED A;  5HW9 A;  2Z6Y A;  4XL5 A;  2Q4U A;  4PDZ A;  4AS8 A;  2BTJ A;  3DVM A;  2A48 A;  5EXU A;  4HRH A;  2L5X B;  2EMD A;  4ANJ A;  1S6J A;  4IK3 A;  1SBJ A;  2LLS A;  3ZTF A;  3SIB A;  3U0K A;  1QXP A;  3CDN A;  4R1E A;  2BKI B;  3BUO B;  2H8Q A;  3H4S E;  4M2P A;  1E8A A;  4YGE B;  2DD7 A;  1XA5 A;  4YGD B;  4DKM A;  1V1G A;  1MHO A;  1B9C A;  4ORA B;  1AHR A;  2HGY A;  1M39 A;  4QJ3 B;  2V4E C;  1QS7 A;  4YGB B;  2PAS A;  5LTQ A;  1EMA A;  1YUS A;  4IK4 A;  1H4B A;  3A8S A;  2G2B A;  3DVK A;  4AOM A;  2WHT A;  1H6R A;  2LAN A;  2FJU B;  1DJI A;  2WCH A;  4MRY A;  2MRD A;  4CFR A;  1XK4 C;  2QLI A;  1B4C A;  4I5N B;  1SK6 D;  3OHM B;  3R1P A;  2WCE A;  4F7F A;  4A4B A;  4XGY A;  1OZS A;  3ADF A;  3I5G B;  3LVD A;  4JD9 A;  5G08 A;  2PSR A;  3BXK A;  1XFR A;  4Z4K A;  1C7W A;  3AKO A;  5HKW A;  3KCS A;  3K1K A;  2JPO A;  4OKH A;  2E30 A;  3PJ5 A;  2Y1M A;  1X02 A;  3ST3 A;  2WCB A;  4KF5 C;  3NHT A;  3GJ2 A;  2AWL A;  1UUR A;  3SST A;  4HSZ A;  2WIS A;  2H5O A;  4QJ4 B;  4OCI A;  2LVJ A;  4ZCU A;  1DT7 B;  1DEL A;  3U0M A;  3DXL A;  2G2S B;  3CD1 A;  4JC2 A;  4TZA A;  3LSA A;  1MOV A;  2H61 C;  4W7R A;  3QRX A;  1A75 A;  1CV7 A;  1B7T Y;  2BE6 A;  3TDI A;  3LF4 B;  3WHT B;  4W76 A;  3UFZ A;  3NT3 A;  2LLU A;  4W6F A;  4C0K A;  5KU1 A;  1ZUX A;  2JC2 A;  4L13 A;  3HCM A;  1MUX A;  4GUK A;  1Q4E A;  5DPJ A;  3DQK A;  1RMM A;  2LVV A;  1Z1P A;  3BQ3 A;  4XVP A;  1BU3 A;  3VB1 A;  4P1Q A;  1NX2 A;  5B8I B;  1EME A;  1CFC A;  1GGZ A;  4GPL B;  4Q9W A;  2O5G A;  2JTZ A;  1S5G Z;  1BLQ A;  4KPI A;  1GQM A;  1JFK A;  5D69 A;  4AQI A;  4PE4 A;  1UHJ A;  1J7R A;  1QY3 A;  1CTR A;  2MJW B;  3DQH A;  5I2L A;  1QJT A;  2WHS A;  3NSI A;  2LUX A;  5I8N A;  2KOT A;  2QEB A;  3S0D A;  4PPJ A;  3VK1 A;  2ZFD A;  5DTL A;  3ST0 A;  1Y1X A;  2WND A;  3PIB A;  1F8H A;  1L7Z A;  2KAX A;  2RGI A;  1YTZ C;  2KAY A;  1F54 A;  4JPZ B;  2DUH A;  1T14 A;  1PAL A;  2K7D A;  1SL7 A;  2V53 A;  4M2O A;  3SVN A;  3NT9 A;  3ZNI A;  3O78 A;  2WOS A;  2NCP A;  4GF6 B;  2QAC A;  2DDD A;  2AWM A;  1TIZ A;  1JBZ A;  2B3Q A;  2DUG A;  2FWQ A;  2KI6 C;  5FHV A;  2M7L A;  5TNC A;  2OS8 B;  1CMF A;  1GM0 A;  4MBE A;  3DQI A;  3PJ7 A;  1UWO A;  4NDC A;  1F0B A;  4UPG A;  4IZN A;  3SG4 A;  5EHU A;  2A56 B; 
#chains in the Genus database with same CATH homology
 3DQ2 A;  1A4P A;  1Q4C A;  3VHT A;  4MVF A;  4WQ2 A;  1CMG A;  3BUM B;  4HRE E;  2JPT A;  5HGE A;  4EMQ A;  3CGA A;  1NUB A;  1KCY A;  3SSP A;  1F55 A;  5CSF A;  1TRF A;  1WLM A;  2I94 A;  4CFQ A;  1QX7 A;  5KSZ A;  1RK9 A;  3DPX A;  4ZF3 A;  3GOF A;  4PPL A;  3P8U A;  5K89 A;  4B5Y A;  1IH0 A;  1KYS A;  2G6X A;  1IWQ A;  2RH7 A;  4HQ8 A;  2JT8 A;  4XOW A;  4DUQ A;  2K61 A;  2NCO A;  2MBX A;  4LW5 A;  2A47 A;  1BJF A;  3VRQ A;  1JWD A;  2G3D B;  1NPQ A;  4W73 A;  3SRY A;  4W7E A;  2F8P A;  2HJO A;  2DUF A;  4KAG A;  1YVL A;  4NDB A;  1OOJ A;  1IJ6 A;  1Q4A A;  2WHU A;  2IB5 A;  4N1F A;  1XQM A;  2HQK A;  4W6U A;  1EXR A;  2A4J A;  5HZO A;  3SG6 A;  3TS5 B;  4XJK A;  4W6J A;  2AMI A;  3LK1 A;  1RWY A;  3SVE A;  4NDD A;  3I5G C;  1EMM A;  1WRZ A;  2V4E A;  2K0J A;  2ZMW A;  1S26 D;  4W6K A;  1QAT A;  1YRT B;  1FPW A;  2DDC A;  2AHA A;  1ALV A;  1K93 D;  5DRF A;  1HUY A;  1REC A;  4OQW A;  2SCP A;  4N3D A;  4LJD C;  3SSH A;  3KF9 A;  4FQO A;  3DQ5 A;  1CM4 A;  1NX0 A;  1SR6 B;  1FI6 A;  4PPK A;  1DGV A;  2EMN A;  4GES B;  1AJ5 A;  4DKN A;  4ORN A;  2C9I A;  1YX8 A;  2CBL A;  2O29 A;  2LMT A;  5DRG A;  4GNK B;  1BT6 A;  4DS7 A;  1MXE A;  2JNF A;  4W77 A;  1U5I B;  3BOW A;  2GW4 B;  2JQ6 A;  2F2O A;  2EHB A;  3DQ8 A;  4KF5 A;  1B8C A;  2B1U A;  1A03 A;  2KFH A;  3NEZ A;  3BUX B;  2QZ0 A;  2I7A A;  1S6C A;  3LLE A;  1PSB A;  4YGC B;  2H61 A;  1H4U A;  1SY9 A;  2DUI A;  1N65 A;  4HQ9 A;  2PXS A;  4GFT A;  2QLG A;  3DPW A;  1OQP A;  4MZK A;  3CFF A;  1TCO B;  3TDZ A;  3SG5 A;  3DF0 A;  3ZWH A;  1CKK A;  1EMB A;  4NQG A;  1RTP 1;  5DKR A;  1YFP A;  4W69 A;  3PAT A;  5DTX A;  2QU1 A;  3FS7 A;  3DVJ A;  4YBH B;  2O24 A;  3LF3 A;  1DGU A;  2O2B A;  3U8C A;  4Q7U A;  1QLK A;  1TNX A;  3ST4 A;  2G9B A;  2ZRS A;  3GJ1 A;  1QV0 A;  4MRX A;  2VVH A;  4Q04 A;  1RJV A;  4KA9 A;  2JT3 A;  2OS8 C;  1ODB A;  4HQC A;  4DXN A;  1OMV A;  1FI5 A;  5LTP A;  2MLF C;  1QVI Z;  5BT0 A;  3RWT A;  2JXL A;  1DJG A;  1VRK A;  3IR8 A;  1W7U A;  2I18 A;  3SVO A;  1Q80 A;  2KGB C;  1MXL C;  5H88 A;  2Q91 A;  1DF0 A;  2F33 A;  2FL1 A;  2HPS A;  2L98 A;  3AKB A;  1EH2 A;  1QYO A;  5FVF A;  4EN1 A;  2KHN A;  2DOQ A;  1IGV A;  1ZUZ A;  1DJH A;  1TOP A;  1PSR A;  3U8P A;  1UHI A;  3CFH A;  1XMZ A;  1S5G Y;  1YVH A;  2OTG B;  1GGW A;  1KWO B;  2Y5I A;  4CPV A;  1F4O A;  2M1K B;  3NSO A;  4Q9X A;  2LUC A;  3SG7 A;  5AFP A;  2YE1 A;  2PXW A;  3WLD A;  4H3L A;  5DQM A;  3SSV A;  2IB6 A;  3CD9 A;  5LTR A;  1YUR A;  1IQ3 A;  2ZN9 A;  4ORC B;  2A53 B;  4JWQ A;  3CBE A;  1ZMZ A;  3EKH A;  3DQ1 A;  3SSY A;  1LA0 A;  2HQ8 A;  3IQO A;  4P5O E;  3M22 A;  1BFP A;  1KFU L;  1QIW A;  1CLL A;  3DQ6 A;  1EMF A;  3EVP A;  1KFX S;  2HQW A;  5D7F A;  3DQM A;  1SMG A;  1M45 A;  4L12 A;  4J89 A;  4DXO A;  1YJF A;  5I2Q A;  3TS5 C;  1K90 D;  1OMR A;  4IK1 A;  2JU0 A;  1KK7 Y;  2IE2 A;  3CB9 A;  2ZKM X;  4IK9 A;  2A46 A;  2M3W A;  1WDC B;  2GX2 A;  3W1C A;  2SAS A;  1R2U A;  2QPT A;  4P2Y B;  3SIA A;  2VAD A;  4W72 A;  1ZGO A;  2Z6X A;  3PJB A;  1HT9 A;  2OGR A;  1G4Y R;  2OJK A;  3G9A A;  5DTY A;  1XAE A;  4L9M A;  1SR6 C;  2H5R A;  2K2A A;  3OB1 B;  3CR5 X;  4JEO A;  4IL1 A;  1H8B A;  2LNK A;  2JTT A;  2K8M B;  4UTS A;  3M24 A;  1A75 B;  4J8A A;  5DPG A;  2JXC A;  3CZT X;  3WHU B;  4BY4 A;  4I5J A;  4LJD A;  2Y4Q A;  1RMO A;  3NSK A;  2Y0G A;  4U8D A;  3LS3 A;  4WRI A;  1UHN A;  1EMG A;  1Z1Q A;  2KGR A;  3O2P A;  5FYX A;  4W75 A;  2OPO A;  3GK1 A;  2DUE A;  3V3D A;  1CFF A;  3IP2 A;  2C9J A;  5ER4 X;  2GV5 A;  4RTC A;  2K7B A;  3GK2 A;  2HPW A;  2BEC A;  3TUY B;  1YX7 A;  2CT9 A;  4W6T A;  2TN4 A;  2G16 B;  3EKJ A;  2M97 A;  1SW8 A;  1B47 A;  3K21 A;  2KSP A;  3MGF A;  1S6Z A;  3ZUL A;  1RMP A;  2KI4 B;  4OY4 A;  2BL0 B;  4YI9 A;  2H6V A;  3U8A A;  1TNW A;  1K8U A;  4W7A A;  4DIR A;  1M63 B;  1DJY A;  2AWK A;  3SSK A;  3DQ3 A;  3LA1 A;  2KDH A;  2YDZ A;  1ALW A;  1BMO A;  1XFX O;  2WSO A;  5FVG A;  3U0L A;  2G3O A;  4DXM A;  1JUO A;  4H47 A;  2QRF A;  4L1I A;  2VVJ A;  1KSO A;  4J88 A;  1QTX A;  3E5T A;  1OXD A;  2OTB A;  3AI5 A;  1EG4 A;  5AER A;  1M46 A;  2CCM A;  2JNX A;  3SG3 A;  4DXQ A;  5EBJ A;  2BKH B;  2AUC A;  3EVU A;  2M7N A;  3TMT A;  1JBY A;  1AUI B;  2KBM A;  5FVI A;  2JUL A;  1L2O C;  2LHL A;  4W7C A;  1KSM A;  4E68 A;  1K9U A;  1EL4 A;  1IRJ A;  1G8I A;  3O4Y A;  1XFZ O;  2LP3 A;  2OKY A;  2LAP A;  5JOL A;  2WOR A;  1NCZ A;  3D0Y A;  4JF9 A;  1YZW A;  5EB6 A;  3BUN B;  3DQU A;  2OTG C;  2Q57 A;  1KWO C;  4PHJ A;  4R6D A;  1KK8 B;  3LVC A;  5DU0 A;  1S3P A;  3ED8 A;  2OTE A;  2VZX A;  3CS1 A;  1K2H A;  4H3N A;  4ZBL A;  1Y0V H;  2M9G A;  4KW4 A;  1HQV A;  5DTZ A;  1XFW O;  4DXI A;  3DD4 A;  4I5L B;  3RWA A;  2FZU A;  3ICB A;  3AI4 A;  2KFG A;  1XFY O;  4KW9 A;  1Y1A A;  1YHH A;  5EB7 A;  4W6O A;  4PHK A;  1B7T Z;  3DQA A;  2LHI A;  2R2I A;  4ETO A;  2GW3 A;  1S1E A;  4W6C A;  3DQF A;  3ST2 A;  5ER5 A;  1PRW A;  1EMK A;  1FBV A;  3LL8 B;  4JRB A;  1F71 A;  4P76 A;  2POX A;  1WDC C;  2BCB A;  1SNL A;  3WXA A;  1Q73 A;  4PAL A;  1CLB A;  3VIC A;  4ZF4 A;  1MWN A;  3I5H B;  4KEX A;  1CFD A;  2KYF A;  3O77 A;  4AR7 A;  2ZMU A;  1ZGP A;  1CFP A;  4Q7T A;  3VGO A;  1BOD A;  1OZO A;  5CSN A;  1S36 A;  1XK4 A;  1J7Q A;  2Z1O A;  4N5X A;  4XYN A;  1QXT A;  1XA9 A;  2QLH A;  1LIN A;  3DVE A;  1WY9 A;  1LVC D;  3SS0 A;  5AQB B;  1JF2 A;  4ZB1 A;  1J1D A;  3UG0 A;  1NCX A;  1Y6W A;  2JOJ A;  1W7T A;  2AWJ A;  2LV7 A;  2LCP A;  1J1E A;  1YUU A;  3RLZ A;  3VRR A;  4YI8 A;  1Q4D A;  1XO5 A;  1SYM A;  4W7D A;  2BCX A;  1BR4 B;  2PRU A;  1G7K A;  1BOC A;  5GQQ C;  1QIV A;  4ZIN A;  2D8N A;  1TNQ A;  3CR2 A;  5BQL A;  2K2F A;  2EMO A;  5IBW A;  5HKY A;  3WLC A;  4JFG A;  5CPV A;  3TUY C;  1U5I A;  5CSJ A;  3A4U B;  1F09 A;  1UHK A;  2QLG B;  4B30 A;  1OMD A;  1ZFS A;  2JRF A;  2CXJ A;  1SCV A;  3H1R A;  2MAZ A;  3SVD A;  2KI4 C;  2BL0 C;  3S05 A;  2HGD A;  4YRU A;  4W7X A;  2WIQ A;  2P4M A;  4BDU A;  1N0Y A;  3OX5 A;  4OHS A;  4ZF5 A;  5BTT B;  2JZI A;  2HF5 A;  1GJY A;  1DJZ A;  2B3P A;  4W74 A;  2ZN8 A;  5DPI A;  1IQ5 A;  3VRO A;  1CDN A;  3PN7 B;  4DRW A;  3DQN A;  2K7C A;  3CFA A;  4USL A;  4M2Q A;  1RRO A;  4A4C A;  4RYW A;  3SJS A;  1D1O A;  2KQ6 A;  3PAL A;  3VRN A;  3NXA A;  1DVI A;  4RYS A;  3NF0 A;  1CB1 A;  3PLF B;  4OVN F;  1NYA A;  3SVC A;  3CR4 X;  1UIS A;  1LKJ A;  4MZJ A;  1PK0 D;  2L50 A;  5PAL A;  4D1E A;  4I5K A;  4PHN A;  2BBN A;  2G6Y A;  1DF0 B;  1WLZ A;  1KYR A;  1EML A;  4PFE A;  2BCA A;  1L2O B;  3EVR A;  4LQT A;  1W7S A;  1K9P A;  3JVT B;  1KQV A;  4LQU A;  4MLW A;  1XVJ A;  2ZNE A;  3OSR A;  3AKA A;  5DPH A;  1KK8 C;  2ISD A;  4ZFS A;  2F3Z A;  1V1F A;  2I2R E;  1KYP A;  4H48 A;  1IJ5 A;  1LA3 A;  4Q7R A;  2ZO6 A;  2KYC A;  3D10 A;  1JC1 A;  1ZGQ A;  3KHE A;  2FOT A;  4MZL A;  3E3R A;  5HZU A;  4GOB A;  3E5W A;  1EJ3 A;  4FTG A;  1PVA A;  1PUL A;  2LC5 A;  3SVU A;  3WCK A;  3A8R A;  2KAV A;  2WCF A;  3W1D A;  1AJ4 A;  2O60 A;  1QV1 A;  1G33 A;  1SRA A;  5CSI A;  2LE9 B;  4PHM A;  1A2X A;  2MA2 A;  4GGF C;  2NLN A;  2ZRT A;  3GL4 A;  3DQD A;  2LVI A;  2PMY A;  1NP8 A;  3C1V A;  1QYF A;  1JSA A;  2HFC A;  2VVI A;  1SPY A;  4YGA A;  3I5H C;  1K94 A;  1TTX A;  1NIW A;  3DQL A;  2FCE A;  1AVS A;  1RM9 A;  3DQ9 A;  3BXB A;  4C0L A;  3OX6 A;  4TZG A;  1B8R A;  1UP5 A;  2H5P A;  3DQJ A;  3SVB A;  3F45 A;  1Y1U A;  3DQ7 A;  1NWD A;  1UHH A;  3BX9 A;  4OGS A;  2YFP A;  2MLE C;  3SVS A;  1OE9 B;  3P28 A;  3EK8 A;  2H5Q A;  2KNE A;  2AAO A;  4PE1 A;  1GL4 A;  3OP0 A;  1C07 A;  4W6S A;  5HZS A;  3IQQ A;  4DCK A;  1KQM B;  3GEX A;  1EMC A;  2M29 A;  2GGM A;  1SL8 A;  1XFU O;  3IF7 A;  4HVF A;  5EXB A;  1MYW A;  3FIA A;  3VRP A;  3SVR A;  1JC2 A;  3I19 A;  5J3X A;  4MSP A;  1JF0 A;  2FCD A;  4QJ5 B;  5KTG A;  5HLO A;  4BY5 A;  2QT2 A;  2COL B;  4IK8 A;  1DTL A;  2ZO7 A;  2BBM A;  3OB2 B;  2LVK A;  1PVB A;  2HET A;  1XYD A;  5HLV A;  4H3M A;  3DQE A;  1JFJ A;  3GB3 A;  4AQJ A;  2LM5 A;  3I5I B;  1HCJ A;  4MEW A;  1YRU B;  5EXC I;  2KI6 D;  2OKW A;  1AK8 A;  1K96 A;  3EVV A;  3PN7 C;  1WRK A;  4U2V A;  3M0W A;  1JC0 A;  4KF4 A;  2GX0 A;  3DQC A;  1B8L A;  1NCY A;  3PFV A;  2EGD A;  4ZCV A;  2Y1N A;  3TZ1 A;  4NWS A;  4XOV A;  1CM1 A;  1UUS A;  1SCM B;  2A54 B;  3I5F B;  4OR9 B;  2F2P A;  2EC6 B;  4IK5 A;  1SL9 A;  4WQ3 A;  4W6L A;  2P6B B;  1K95 A;  3PM8 A;  5AEQ A;  4Z4M A;  1B9A A;  3H1O A;  2KFF A;  5DKQ A;  1OSA A;  3VHT B;  3JVT C;  3BXA A;  3MSE B;  1KK7 Z;  2HCG A;  1TCF A;  3JTD B;  1R6P A;  5EJU A;  3D0Y B;  4JGE A;  2G6E A;  1N2D A;  5DKN A;  4ZIO A;  3SSL A;  1KFX L;  1MQ1 A;  3WNX B;  4HRG A;  2ICR A;  2CTN A;  1QYQ A;  4KW8 A;  5AAN A;  4W6R A;  3EK4 A;  4LJC A;  4KGE A;  4DXP A;  5F9G A;  3ZUJ A;  4W6N A;  5HZT A;  1FF1 A;  1QX5 B;  5HYD A;  1KP5 A;  1A29 A;  4PCW A;  1RFJ A;  2KBI A;  5AXI A;  5DQB A;  4HE4 A;  1MR8 A;  5DY6 A;  1ZOT B;  1C4F A;  2L2E A;  2F3Y A;  5F6T A;  2E6W A;  1TNP A;  2YE0 A;  1NX1 A;  4JQ0 D;  2L4H A;  5BPJ A;  1MOU A;  3NSL A;  4XJK B;  3KPX A;  2M49 B;  3DPZ A;  2M1U A;  4N1G A;  3DQO A;  3KCT A;  1IKU A;  2HRS A;  4GBA A;  2V4E B;  4PE0 A;  1DJX A;  2LMV A;  1YJ2 A;  2L0P A;  1YUT A;  1J7P A;  2JWW A;  1B1G A;  4ICB A;  1QVI Y;  3CWG A;  1W7J B;  4PE7 A;  4LJB A;  3FWC A;  3CTN A;  3EK7 A;  4OJ0 A;  3AAJ A;  2WUR A;  5LK4 A;  2VAE A;  4GGF A;  1SKT A;  5T3I A;  3BYA A;  1CDL A;  2L51 A;  1LXF C;  1K9K A;  2A52 B;  1CLM A;  1BF5 A;  2NZ0 A;  3SV5 A;  1KFU S;  3TDU A;  3DQ4 A;  4W6P A;  1NSH A;  2AH8 A;  3BUW B;  5HBD A;  4EDS A;  4KGF A;  4W6H A;  3BOW B;  3HX4 A;  2LP2 A;  1CDP A;  1J55 A;  1QAS A;  2JT0 A;  2GGZ A;  2WSN A;  4I2Y A;  5JJG A;  1KQM C;  4W6A A;  1BR1 B;  1J7O A;  3KO0 A;  2PVB A;  1S6I A;  5KTY A;  4GAO A;  2JAD A;  2Z6Z A;  1C7V A;  1DMO A;  3TMR A;  1YHG A;  1F70 A;  2PAL A;  4B30 B;  1WRL A;  2VRG A;  3OSQ A;  1M31 A;  4F0Z B;  4W6G A;  3DF0 B;  3OGO A;  1DJW A;  2WC8 A;  1JBA A;  3CGL A;  1FW4 A;  5H87 A;  3FWB A;  1BG1 A;  4EDO A;  3I5I C;  1AP4 A;  4EUL A;  2KQY A;  2CNP A;  2H9W A;  1XSS A;  1ZAC A;  2BE4 A;  1MF8 B;  4CLN A;  3U0N A;  1XFV O;  2G5Z B;  3LK0 A;  2IS9 A;  2ARL A;  2IOV A;  1OXE A;  3LVA A;  3PSR A;  1IG5 A;  3E5V A;  4MN0 A;  1GFL A;  1QX2 A;  5H89 A;  1CNP A;  3ZUF A;  1SCM C;  4TNC A;  5BTT A;  3I5F C;  2MHH A;  1YHI A;  4W6D A;  4ORB B;  2L4I A;  3O6B A;  1QLS A;  2EC6 C;  3BXC A;  4CID A;  1Q4B A;  3AAK A;  2LLT A;  3SG2 A;  4W7F A;  2LMU A;  4W6B A;  2A50 B;  3JTD C;  2M8U A;  1F4Q A;  1GGX A;  4C0J A;  1RRX A;  3KEV A;  3LCP C;  2Q6P A;  5HKZ A;  2DD9 A;  1W7I B;  4OV2 A;  2K7O A;  5I2O A;  1CDM A;  4GGN A;  1TN4 A;  1EG3 A;  2NXQ A;  2QLE A;  2ZND A;  2HQZ A;  3GK4 X;  4W6I A;  3RM1 A;  5J2O A;  1NX3 A;  3CLN A;  1YR5 A;  4R6B A;  2M0R A;  2H2K A;  4W6M A;  1OXF A;  3NED A;  5HW9 A;  2Z6Y A;  4XL5 A;  2Q4U A;  4PDZ A;  4AS8 A;  2BTJ A;  3DVM A;  2A48 A;  5EXU A;  4HRH A;  2L5X B;  2EMD A;  4ANJ A;  1S6J A;  4IK3 A;  1SBJ A;  2LLS A;  3ZTF A;  3SIB A;  3U0K A;  1QXP A;  4R1E A;  2BKI B;  3BUO B;  2H8Q A;  3H4S E;  4M2P A;  1E8A A;  4YGE B;  2DD7 A;  1XA5 A;  4YGD B;  4DKM A;  1V1G A;  1MHO A;  1B9C A;  4ORA B;  1AHR A;  2HGY A;  1M39 A;  4QJ3 B;  2V4E C;  1QS7 A;  4YGB B;  2PAS A;  5LTQ A;  1EMA A;  1YUS A;  4IK4 A;  1H4B A;  3A8S A;  2G2B A;  3DVK A;  4AOM A;  2WHT A;  1H6R A;  2LAN A;  2FJU B;  1DJI A;  4MRY A;  2MRD A;  4CFR A;  1XK4 C;  2QLI A;  1B4C A;  4I5N B;  1SK6 D;  3OHM B;  2WCE A;  4A4B A;  4XGY A;  1OZS A;  3ADF A;  3I5G B;  3LVD A;  5G08 A;  2PSR A;  3BXK A;  4Z4K A;  1C7W A;  3AKO A;  5HKW A;  3KCS A;  3K1K A;  4OKH A;  2E30 A;  3PJ5 A;  2Y1M A;  1X02 A;  3ST3 A;  2WCB A;  4KF5 C;  3GJ2 A;  2AWL A;  1UUR A;  3SST A;  4HSZ A;  2WIS A;  2H5O A;  4QJ4 B;  4OCI A;  2LVJ A;  4ZCU A;  1DT7 B;  3U0M A;  2G2S B;  3CD1 A;  4JC2 A;  4TZA A;  3LSA A;  1MOV A;  2H61 C;  4W7R A;  3QRX A;  1A75 A;  1CV7 A;  2BE6 A;  1B7T Y;  3TDI A;  3LF4 B;  3WHT B;  4W76 A;  3UFZ A;  3NT3 A;  2LLU A;  4W6F A;  4C0K A;  5KU1 A;  1ZUX A;  2JC2 A;  4L13 A;  3HCM A;  1MUX A;  4GUK A;  1Q4E A;  5DPJ A;  3DQK A;  1RMM A;  2LVV A;  1Z1P A;  3BQ3 A;  4XVP A;  1BU3 A;  4P1Q A;  1NX2 A;  5B8I B;  1EME A;  1CFC A;  1GGZ A;  4GPL B;  4Q9W A;  2O5G A;  2JTZ A;  1S5G Z;  1BLQ A;  4KPI A;  1GQM A;  1JFK A;  5D69 A;  4AQI A;  4PE4 A;  1UHJ A;  1J7R A;  1QY3 A;  1CTR A;  2MJW B;  3DQH A;  5I2L A;  1QJT A;  2WHS A;  3NSI A;  2LUX A;  5I8N A;  2KOT A;  4PPJ A;  3VK1 A;  2ZFD A;  5DTL A;  3ST0 A;  1Y1X A;  2WND A;  3PIB A;  1F8H A;  1L7Z A;  2KAX A;  2RGI A;  1YTZ C;  2KAY A;  1F54 A;  4JPZ B;  2DUH A;  2V53 A;  1PAL A;  2K7D A;  1SL7 A;  4M2O A;  3SVN A;  3NT9 A;  3ZNI A;  3O78 A;  2WOS A;  2NCP A;  4GF6 B;  2QAC A;  2DDD A;  2AWM A;  1TIZ A;  1JBZ A;  2B3Q A;  2DUG A;  2FWQ A;  2KI6 C;  5FHV A;  2M7L A;  5TNC A;  2OS8 B;  1CMF A;  4MBE A;  3DQI A;  3PJ7 A;  1UWO A;  4NDC A;  1F0B A;  4IZN A;  4UPG A;  3SG4 A;  5EHU A;  2A56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...