3EVUA

Crystal structure of calcium bound dimeric gcamp2
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
410
structure length
393
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 123
structure length 393
sequence length 410
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evuA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evuA01
5T3IA 4YGEB 3BQ3A 4W7RA 3O77A 1K9KA 1XVJA 1H6RA 4W6KA 3NF0A 4N1GA 5DKNA 3LCPC 2B3QA 2KQ6A 2JULA 4JC2A 2A53B 1OMRA 2GX0A 3CTNA 2OTBA 5KSZA 4ZF3A 5K89A 3CR2A 2G16B 4A4BA 5CSIA 4JGEA 2O29A 1FW4A 5CSFA 3SG2A 1TNPA 2EC6C 1LA0A 1RMPA 1M63B 1QX7A 2H5RA 2KAYA 3P8UA 4W6LA 4GF6B 1A75A 1ZUZA 1PALA 2BKHB 3TDUA 2M9GA 1WDCB 4F0ZB 2O24A 3DPWA 4BY5A 1SL7A 1SR6C 1UHKA 2K61A 4C0KA 1RWYA 4HRGA 4YI8A 1Q4AA 4W69A 1S36A 1ZUXA 1KK7Y 1DMOA 4KF5A 1YJFA 1AJ5A 1KSOA 1YX7A 2BKIB 1CDLA 3GL4A 3TUYC 2LUCA 2K2AA 2WURA 4GGFA 2JPTA 3VRPA 1DTLA 4Q04A 1F09A 2KDHA 4W6DA 2HQKA 4J89A 2GGZA 1R2UA 4W72A 2OS8B 5JOLA 1UISA 4DCKA 1IWQA 1UWOA 2OS8C 4P2YB 3K1KA 2EGDA 2QRFA 3PN7B 1QLKA 4ORAB 2BTJA 1XA9A 3AKAA 1ZACA 4LQUA 1MWNA 4HQCA 3GK2A 1KQVA 4GGNA 3KCSA 2AUCA 1DGUA 3FWCA 1D1OA 4B5YA 2QACA 2I18A 2KYCA 5FHVA 1RM9A 2M97A 3GJ1A 2G5ZB 1S26D 1QX5B 4R1EA 3EVVA 2JXCA 1B7TZ 3A8SA 2DDCA 1UHJA 1J7RA 2LVIA 4LJDC 2P6BB 2JNFA 1C7WA 2NXQA 4LQTA 4W74A 3E5WA 2FCDA 2ZMUA 1YRTB 5HZSA 3ZUFA 3DQUA 3LS3A 4W6AA 2LE9B 1JF0A 2ZO7A 2Y4QA 1YJ2A 3GOFA 1W7TA 2H5PA 3TDZA 3ZTFA 3LA1A 1WLZA 4PE4A 2QLEA 1BODA 1SKTA 2ICRA 1BOCA 3TS5C 2M3WA 2ZN9A 2QLIA 3VGOA 1K9UA 2H61A 4KPIA 1NUBA 1MUXA 2M7LA 4I5JA 2QU1A 2JT3A 1NX1A 5FVFA 3A4UB 3CR5X 3JVTB 5DPGA 2JADA 3DQ7A 2MBXA 1J7QA 3DQFA 2ZMWA 4DKMA 3WLCA 4ZBLA 3DQKA 4RTCA 1FF1A 3BUNB 2AMIA 1HT9A 3NSKA 1JFJA 3WCKA 2ZFDA 1YUTA 4W6CA 1JFKA 3ZUJA 2YE0A 4DXQA 4H47A 2FWQA 2LAPA 4BY4A 5DTZA 1F70A 1B7TY 3O6BA 1L7ZA 1BU3A 2AAOA 4GOBA 4W7CA 5JJGA 1IG5A 2KBIA 2F33A 3G9AA 3PJBA 2LLTA 3U0LA 4HVFA 1JBYA 3DF0B 3NT9A 3BYAA 2DOQA 2G2SB 1SCVA 2F8PA 1ZGPA 3SVCA 4DKNA 3KPXA 4C0JA 5HLOA 1BFPA 2F3YA 1KQMB 3CLNA 3SVRA 3EKHA 5HKZA 3I19A 2KI6D 1Y6WA 1CTRA 4ZF4A 5DKRA 2VVIA 2Q6PA 3ST0A 2RH7A 1K8UA 2LVJA 2JQ6A 5HZUA 2LVVA 2WHSA 4C0LA 1NCXA 4H48A 4W76A 4LJDA 1DGVA 3A8RA 3SS0A 5ER5A 1EL4A 3U0KA 3SSTA 2JZIA 4W6NA 4IK3A 1S6ZA 1WLMA 1EMBA 3BXKA 2SCPA 3TDIA 3OSQA 3EVUA 1IQ5A 1CDMA 1N65A 3PJ7A 2DUIA 3DQLA 2HJOA 4XJKB 1CDPA 1NIWA 2L0PA 1RK9A 3UFZA 5F6TA 4NQGA 2LMUA 2OTGB 4KAGA 4YGAA 2HCGA 4HQ8A 2AWJA 1QXPA 3FIAA 1SL8A 5BTTB 5LTPA 1TNWA 2OTGC 2KAXA 4RYSA 4OGSA 2L5XB 4ZCVA 4W6BA 1YVLA 1IKUA 4USLA 3S05A 3V3DA 4LJBA 2LV7A 3U0MA 5HKWA 4IK8A 3BXBA 3CWGA 5IBWA 1VRKA 2CBLA 4MN0A 3BUWB 3C1VA 3SIAA 4H3NA 1A4PA 4W7DA 3PIBA 1B9CA 3TMRA 4W6SA 1Q73A 3FWBA 1QVIY 2M8UA 5LTRA 1BMOA 1EG4A 2EMOA 1B8LA 2K2FA 4MZLA 1NYAA 1ALWA 5DTLA 2VRGA 5EJUA 3DQEA 4GGFC 3NSOA 2BBMA 3DD4A 3I5IB 1OMDA 4NWSA 3FS7A 3BOWB 4XL5A 2NCOA 1TNQA 3DF0A 3M22A 4KF4A 1OE9B 2IOVA 5DY6A 2F2OA 4PCWA 2BCXA 1W7IB 3DQ3A 3DVJA 5FVIA 3I5FC 4NDCA 4ETOA 2EMDA 2PASA 2GW3A 4MVFA 1K94A 2JU0A 1RECA 5I8NA 1YURA 2A48A 4OCIA 2K7BA 4MEWA 4HQ9A 2LM5A 3CFFA 4MSPA 4U8DA 5GQQC 3BXCA 2O5GA 1N2DA 3CR4X 3AAJA 5HLVA 3DQAA 2ZRTA 1Q4CA 4I5LB 5I2LA 2D8NA 1QIWA 1TIZA 4QJ4B 4XGYA 5AQBB 2JT0A 3BUXB 5H89A 4KGFA 4UPGA 1QXTA 2IE2A 3ZWHA 1DJHA 1QATA 2MA2A 1GFLA 3E3RA 4OR9B 1SY9A 1XFZO 5DU0A 1XFXO 4GUKA 1Z1QA 1LA3A 4XJKA 2MLFC 1EMGA 2JTZA 4CFRA 1S1EA 3VRNA 2G3DB 1M46A 2PALA 3LVCA 5BTTA 4D1EA 1IRJA 1C4FA 4CFQA 4PPJA 5I2OA 2A4JA 1LKJA 3DQHA 2NCPA 3ZNIA 2GV5A 1JF2A 2H61C 4P1QA 5D69A 2BE4A 1CMFA 3GK4X 2OKYA 5HBDA 2LCPA 1M45A 1NSHA 4B30B 1RMOA 1WDCC 5FYXA 3SG3A 4IZNA 1L2OB 1XSSA 1MQ1A 1G8IA 1SNLA 4FQOA 1ZMZA 3D0YB 5KTGA 1R6PA 2EHBA 1KWOB 1GGXA 1F4QA 1TN4A 2KQYA 3JTDB 1MF8B 1RROA 2QLGA 5J2OA 1K90D 1MOUA 3DQ2A 3SIBA 4I5KA 1H4UA 3LF3A 4DXMA 2PSRA 2DD9A 3BOWA 2Y1NA 1DVIA 4UTSA 4KW9A 2PRUA 1NX3A 1Q80A 2GGMA 4CIDA 5DQBA 1CM4A 3HCMA 3PN7C 1ALVA 4JF9A 1CLMA 1MXEA 5EXBA 1K9PA 4MRXA 1C07A 2VAEA 2H2KA 1DF0B 1UHNA 1QX2A 3TZ1A 2YFPA 2HQ8A 1Y1UA 5F9GA 2A46A 1Q4DA 1U5IB 1G33A 2A56B 2OPOA 1KK8B 4MRYA 4N3DA 1JWDA 2WIQA 1S6JA 2EMNA 1Z1PA 3DQ5A 2QZ0A 4W73A 3VRRA 1XYDA 2VADA 5DPJA 1KP5A 2LHLA 4I5NB 3VK1A 4J88A 2Y1MA 2E6WA 2G6EA 2LP2A 4MBEA 3SVBA 1DJIA 4OY4A 3U8CA 2HGDA 4WRIA 1HQVA 5PALA 1WRZA 1GL4A 1V1GA 2WCBA 3OGOA 1B47A 5AEQA 4ZF5A 2G6YA 2K7CA 3CFHA 1QYOA 4L13A 3K21A 2DUEA 1QV1A 4E68A 2AWKA 4EDOA 3RWAA 1PSBA 2G2BA 3CB9A 2L51A 4JFGA 4QJ3B 5HZOA 2KNEA 1CFFA 1KSMA 3DQDA 1KFUL 2V53A 3HX4A 4EULA 2G9BA 2M0RA 3QRXA 2Q4UA 3PALA 2BECA 3CD9A 3IR8A 1J55A 3BUMB 5I2QA 3JVTC 4W6IA 1NX0A 1OZOA 3I5GB 4OV2A 3RLZA 4B30A 1AUIB 5KTYA 4BDUA 3NT3A 3DQNA 1SBJA 3OX6A 2KHNA 4PFEA 3EK7A 4NDBA 1S5GY 2YE1A 4I2YA 2HETA 5BT0A 2O60A 3D0YA 1YHGA 1SL9A 4ZINA 3SSKA 2A47A 1DJGA 1CM1A 3OB2B 2K8MB 4DXNA 1DJYA 4DUQA 1EH2A 3ST2A 1CFDA 2MRDA 1QS7A 2CTNA 2JTTA 3W1DA 1IJ5A 1SYMA 3DVEA 1YUUA 4W6RA 2H5QA 5HKYA 4W6UA 4CLNA 1K93D 4TZAA 1OZSA 4GNKB 2GX2A 2OTEA 1C7VA 1MXLC 5HZTA 1EMAA 4ANJA 1XO5A 3VRQA 2ZKMX 4W6FA 1NWDA 4DS7A 2L4HA 1W7SA 2WISA 2I7AA 1YTZC 1F71A 1QVIZ 2I94A 4QJ5B 4Q9WA 1DF0A 3PATA 1KQMC 3SVEA 4PE0A 2KFFA 1PULA 1K2HA 1U5IA 2CCMA 1ZOTB 1Y0VH 2WCEA 4HSZA 4IK4A 1MR8A 3NXAA 1AVSA 4L12A 2Y5IA 1A2XA 5HYDA 3E5VA 3M24A 1F0BA 2DUFA 1JC0A 3NEDA 4PHMA 3EK4A 2ZRSA 1MHOA 2H6VA 3ED8A 1EMLA 2G6XA 3AI4A 4ZCUA 3SSYA 4ZB1A 2L4IA 2ZNDA 2NLNA 1JC1A 1FBVA 4PE1A 3O4YA 3KEVA 2V4EB 2PVBA 1IQ3A 2OGRA 4L9MA 4YBHB 2L2EA 4W75A 1B9AA 2OKWA 4GESB 1F54A 4R6BA 1EJ3A 1GGWA 3MGFA 2FL1A 2LANA 3WHTB 3I5HB 1XMZA 1DJXA 1YZWA 4M2OA 5DPIA 1XQMA 5BQLA 4JEOA 3I5HC 1B8CA 3CFAA 5DRGA 1BR4B 2WCFA 2Z6YA 3VICA 2QT2A 3DVMA 1PVAA 3IP2A 4OJ0A 2KOTA 4XVPA 2HFCA 2BL0B 4JPZB 2WC8A 1Y1AA 1WY9A 4DXPA 3DQ6A 4N5XA 5H88A 2JXLA 3BXAA 1YUSA 3KF9A 1TOPA 4WQ3A 3SVUA 1G7KA 2QLGB 1CMGA 1RJVA 3PLFB 4IL1A 4PHKA 2JRFA 1EG3A 1CV7A 4LW5A 4Q7TA 3TMTA 3SVOA 3I5IC 4MZKA 3ZULA 5G08A 1OXFA 1BF5A 2DUHA 3GJ2A 2BCBA 4Q9XA 1UUSA 4XOVA 5CSNA 3SSVA 2VVHA 2KI4B 5B8IB 1YHIA 5DQMA 2M29A 1PRWA 4AR7A 1CLBA 1UHHA 1TCFA 3DQJA 4GPLB 1RRXA 2WHTA 4TNCA 1NPQA 1CLLA 3F45A 3SVSA 3ICBA 3DQ8A 3PJ5A 4DIRA 1QIVA 2Z6ZA 1V1FA 4GFTA 1S3PA 1S6CA 3CD1A 2IB5A 1W7UA 2GW4B 5EXUA 1A03A 4OKHA 1KFUS 1XA5A 2BE6A 2LLUA 2FZUA 3IQQA 4A4CA 1SRAA 3D10A 1RTP1 4DRWA 2Y0GA 1WRLA 1ODBA 1SK6D 2K0JA 1Q4EA 3WHUB 4GAOA 1JBZA 2DD7A 2WORA 1NX2A 1DJWA 1YX8A 1SW8A 3PM8A 2JWWA 1J7PA 3IF7A 2LP3A 4MLWA 1TRFA 5EBJA 1HUYA 4OHSA 1XFVO 2V4EA 2KFGA 3BX9A 5EXCI 5DTXA 5DTYA 3LK0A 4YGBB 1K95A 2EC6B 1JC2A 3E5TA 1E8AA 1UURA 3DVKA 4JQ0D 4M2PA 2KSPA 3BUOB 1MOVA 5HW9A 1KFXL 1IJ6A 3OHMB 1RFJA 2TN4A 2JNXA 3SVDA 1OQPA 2CXJA 2BCAA 2B3PA 3KO0A 5D7FA 4FTGA 3RWTA 1SR6B 1L2OC 1DT7B 1KYRA 1K96A 2G3OA 4RYWA 4MZJA 1LVCD 3GEXA 2L50A 1KCYA 5LK4A 1PK0D 3VHTB 2M1UA 1OMVA 3TUYB 2FOTA 4KA9A 2PMYA 4W7EA 2JC2A 2ZO6A 2P4MA 3IQOA 3RM1A 1KWOC 3W1CA 4YGCB 1G4YR 4IK5A 4W77A 3JTDC 4NDDA 4W6PA 4PDZA 4AS8A 4Z4KA 3DQOA 3O78A 3CBEA 2WSOA 3O2PA 1B8RA 3SV5A 1GGZA 2BBNA 3SSPA 1AK8A 1MYWA 4ORCB 2Z1OA 3WXAA 5AANA 5HGEA 5TNCA 4JWQA 4AQIA 4YGDB 3PSRA 1X02A 3NSLA 2M7NA 3DPZA 1HCJA 1OOJA 3UG0A 3GB3A 4OQWA 4DXOA 3AI5A 4N1FA 3DQ9A 5CSJA 4AQJA 1S5GZ 3EKJA 3OB1B 3ST4A 1EMKA 2MLEC 1RMMA 2LC5A 2F2PA 2LUXA 3P28A 1TTXA 1KK8C 2WHUA 1XFUO 3H4SE 2KFHA 1XK4A 2HPWA 1H8BA 1QYQA 1F55A 1EMCA 4W7XA 4W7AA 2A52B 3LK1A 5BPJA 4W6JA 1ZFSA 1NCZA 4HREE 4XYNA 2F3ZA 1NP8A 3DQIA 2CNPA 1QTXA 1QV0A 5CPVA 3LF4B 3VROA 5FVGA 2MAZA 2AWMA 1J1EA 4ZIOA 2PXWA 3EK8A 2L98A 1JBAA 4PPKA 2WNDA 2COLB 1CFPA 2K7OA 4PE7A 1SPYA 1CKKA 1JUOA 3TS5B 1LXFC 2LHIA 4PHJA 2WOSA 2K7DA 4J8AA 2M1KB 2H8QA 2LLSA 5H87A 3CGLA 1EXRA 1M39A 3LL8B 3AAKA 4EN1A 5ER4X 3I5GC 2CT9A 3SG4A 3U8PA 1M31A 1KYSA 2C9JA 5LTQA 1ZGOA 3ST3A 3OP0A 1EMEA 3WLDA 1A29A 4ORBB 3EVRA 3WNXB 1JSAA 4AOMA 4KGEA 2O2BA 2LMTA 5DRFA 4LJCA 1TCOB 3VHTA 5EB7A 1KYPA 2MJWB 1BG1A 1PVBA 2AH8A 4P5OE 2OJKA 3OX5A 1F8HA 3DQ4A 3SRYA 5AFPA 1YVHA 2Q57A 3ADFA 4KW4A 5EHUA 1AJ4A 2QLHA 4EDSA 3LLEA 3EVPA 1Q4BA 2KI6C 4W6OA 2POXA 3CS1A 2AHAA 1CDNA 3DQMA 5AERA 1BT6A 2HQWA 1AHRA 2AWLA 4W6GA 2A54B 1FI5A 5KU1A 5EB6A 3SG5A 1YR5A 1B1GA 4Z4MA 2M49B 3LVAA 2LMVA 1AP4A 3M0WA 2RGIA 3CZTX 2IB6A 1UP5A 2ISDA 3DQ1A 1IGVA 5J3XA 4KEXA 3DPXA 1OXEA 1CFCA 4W7FA 3PFVA 2H9WA 1CNPA 4OVNF 1KFXS 1XAEA 2YDZA 2Q91A 4GBAA 4M2QA 2VVJA 5DPHA 4ICBA 4PHNA 1GJYA 3KCTA 2KGRA 2ZNEA 1YFPA 1J1DA 1CB1A 4ZFSA 1QASA 2MHHA 2E30A 4TZGA 1FPWA 1ZGQA 1B4CA 2V4EC 4HE4A 1XFWO 4H3MA 2DDDA 3U8AA 2NZ0A 2JOJA 2Z6XA 3U0NA 4L1IA 2LVKA 3GK1A 2HF5A 2KGBC 5AXIA 1W7JB 2HQZA 3CGAA 2I2RE 3KHEA 1GQMA 1A75B 1YHHA 4Q7UA 3H1RA 1F4OA 2KYFA 4XOWA 1N0YA 4W6TA 4YI9A 4DXIA 4EMQA 3SG7A 4IK9A 2H5OA 3SSLA 1QJTA 4IK1A 2KBMA 2HPSA 2BL0C 1TNXA 1EMMA 2C9IA 4PALA 2FJUB 3SSHA 3SVNA 1EMFA 4CPVA 1BJFA 1IH0A 2A50B 4KF5C 2ZN8A 1SCMB 1XFYO 1QLSA 2DUGA 1QYFA 3H1OA 4KW8A 1SCMC 2B1UA 4WQ2A 4U2VA 2JT8A 2PXSA 1NCYA 2LNKA 3NEZA 2IS9A 1H4BA 4W6HA 1WRKA 1BLQA 1S6IA 2KI4C 2KAVA 3I5FB 4JRBA 1OSAA 3OSRA 1FI6A 3MSEB 1YRUB 3AKBA 3DQCA 4HRHA 2VZXA 1DJZA 1BR1B 2R2IA 4W6MA 3NSIA 1LINA 4H3LA 1KK7Z 1Y1XA 2QPTA 2SASA 3SG6A 3AKOA 4PPLA 4R6DA 5DKQA 4Q7RA 2HRSA 1OXDA 1QY3A 4P76A 1J7OA 1XK4C 2WSNA 1SMGA 1UHIA 2ARLA 3SJSA 2HGYA 3LSAA 2FCEA 4ORNA 4YRUA 1PSRA 3LVDA
chains in the Genus database with same CATH superfamily
5T3IA 4YGEB 3BQ3A 4W7RA 3O77A 1K9KA 1XVJA 1H6RA 4W6KA 3FE6A 1C3ZA 2KLDA 3NF0A 4N1GA 5DKNA 3LCPC 2B3QA 2KQ6A 2JULA 4JC2A 2A53B 1OMRA 2GX0A 5I94A 3CTNA 2OTBA 5KSZA 4ZF3A 5K89A 3CR2A 2G16B 4A4BA 5CSIA 4JGEA 2O29A 1FW4A 5CSFA 3SG2A 1TNPA 1Z4HA 1LA0A 2EC6C 1RMPA 1M63B 1QX7A 2H5RA 2KAYA 3P8UA 4W6LA 4GF6B 1A75A 1ZUZA 1PALA 2BKHB 3TDUA 2M9GA 1WDCB 4F0ZB 2O24A 3DPWA 4BY5A 1SL7A 1SR6C 2P71A 1UHKA 2K61A 4C0KA 1RWYA 4HRGA 4YI8A 1Q4AA 4W69A 1S36A 1ZUXA 1KK7Y 1DMOA 4KF5A 1YJFA 3L47A 1AJ5A 1KSOA 1YX7A 2BKIB 1CDLA 3GL4A 3TUYC 2LUCA 2K2AA 2WURA 4GGFA 2JPTA 3VRPA 1DTLA 3S0FA 4Q04A 1F09A 2KDHA 4W6DA 2HQKA 4J89A 2GGZA 3PJIA 1R2UA 4W72A 2OS8B 5JOLA 1UISA 4DCKA 1IWQA 1UWOA 2OS8C 4P2YB 3K1KA 2EGDA 2QRFA 3PN7B 1QLKA 4ORAB 2BTJA 1XA9A 3AKAA 1ZACA 4LQUA 1MWNA 4HQCA 3GK2A 1KQVA 4GGNA 3KCSA 2AUCA 1DGUA 3FWCA 1D1OA 4B5YA 2QACA 2I18A 2KYCA 5FHVA 1RM9A 2M97A 3GJ1A 2G5ZB 1S26D 1QX5B 4R1EA 3EVVA 2JXCA 1B7TZ 3A8SA 2DDCA 1UHJA 3UNWA 1J7RA 2LVIA 4LJDC 2P6BB 2JNFA 5FI6A 1TUJA 1C7WA 2NXQA 4LQTA 4W74A 3E5WA 2FCDA 2ZMUA 1YRTB 1QWVA 2JPOA 5HZSA 3ZUFA 3DQUA 3LS3A 4W6AA 2LE9B 1JF0A 2ZO7A 2Y4QA 1YJ2A 3GOFA 1W7TA 2H5PA 3TDZA 3ZTFA 3LA1A 1WLZA 3NHIA 4PE4A 2QLEA 1BODA 1OW4A 1SKTA 2ICRA 1BOCA 3TS5C 2M3WA 2ZN9A 2QLIA 3VGOA 1K9UA 2H61A 4KPIA 1NUBA 1MUXA 2M7LA 4I5JA 2QU1A 2JT3A 1NX1A 2PQLA 5FVFA 3A4UB 3CR5X 3JVTB 5DPGA 2JADA 3DQ7A 1GM0A 2MBXA 1J7QA 1T14A 3DQFA 2ZMWA 4DKMA 3WLCA 4ZBLA 3DQKA 3BJHA 4RTCA 1FF1A 3BUNB 2AMIA 1HT9A 4KYNA 3NSKA 1JFJA 3WCKA 2ZFDA 1YUTA 4W6CA 1JFKA 3ZUJA 2YE0A 4DXQA 4H47A 4OZDA 2FWQA 2LAPA 4BY4A 5DTZA 1F70A 1B7TY 3O6BA 1L7ZA 1BU3A 2AAOA 4GOBA 4W7CA 5JJGA 1IG5A 2KBIA 2F33A 3G9AA 3PJBA 2ERBA 2K60A 2LLTA 3U0LA 4HVFA 1JBYA 3DF0B 3NT9A 3BYAA 2DOQA 2G2SB 1SCVA 2F8PA 1ZGPA 3SVCA 4DKNA 3KPXA 4C0JA 1ORGA 5HLOA 1BFPA 2F3YA 1KQMB 3CLNA 3SVRA 3EKHA 5HKZA 3I19A 2KI6D 1Y6WA 1CTRA 4ZF4A 5DKRA 2VVIA 2Q6PA 3ST0A 2RH7A 1K8UA 2LVJA 2JQ6A 5HZUA 2LVVA 2WHSA 2KLEA 4C0LA 1NCXA 4H48A 4W76A 4LJDA 1DGVA 3A8RA 3SS0A 5ER5A 1EL4A 3U0KA 3SSTA 2JZIA 4W6NA 4IK3A 1S6ZA 1WLMA 3OBVA 3S0AA 1EMBA 3BXKA 2SCPA 3TDIA 3OSQA 3EVUA 1IQ5A 1CDMA 1N65A 3PJ7A 2DUIA 3DQLA 2HJOA 4XJKB 1CDPA 1NIWA 2L0PA 1RK9A 3UFZA 5F6TA 4NQGA 2LMUA 2OTGB 3FE8A 4KAGA 4YGAA 2HCGA 4HQ8A 2AWJA 1QXPA 3FIAA 1SL8A 5BTTB 5LTPA 1TNWA 2OTGC 2KAXA 4RYSA 4OGSA 2L5XB 4ZCVA 4W6BA 1YVLA 1IKUA 4USLA 3S05A 3V3DA 4LJBA 2LV7A 3D75A 3U0MA 5HKWA 4IK8A 3BXBA 3CWGA 5IBWA 1VRKA 2CBLA 4MN0A 3BUWB 3C1VA 3SIAA 4H3NA 2PYQA 1A4PA 4W7DA 3PIBA 1B9CA 3TMRA 4W6SA 1Q73A 2FJYA 3FWBA 1QVIY 2M8UA 5LTRA 1BMOA 1EG4A 2EMOA 1TUZA 1B8LA 2K2FA 5DICA 4MZLA 4INXA 1NYAA 1ALWA 5DTLA 2VRGA 5EJUA 3DQEA 1OOGA 4GGFC 3QMEA 3NSOA 2BBMA 3DD4A 3I5IB 1OMDA 4NWSA 3CZ2A 3FS7A 2QEVA 3BOWB 4XL5A 2NCOA 1TNQA 3DF0A 3M22A 4KF4A 1OE9B 2IOVA 5DY6A 2F2OA 4PCWA 2BCXA 1W7IB 3DQ3A 3DVJA 5FVIA 3I5FC 4NDCA 4ETOA 2EMDA 2PASA 2GW3A 4MVFA 1K94A 2JU0A 1RECA 5I8NA 1YURA 2A48A 4OCIA 2K7BA 2WCJA 4MEWA 4HQ9A 2LM5A 3CFFA 4MSPA 4U8DA 5GQQC 3BXCA 2O5GA 3BFBA 1N2DA 3CR4X 3AAJA 5HLVA 4FQTA 3DQAA 2ZRTA 1Q4CA 4I5LB 5I2LA 2D8NA 1QIWA 1TIZA 4QJ4B 4XGYA 5AQBB 2JT0A 3BUXB 5H89A 4KGFA 4UPGA 3V2LA 1QXTA 2IE2A 3ZWHA 1DJHA 1QATA 2MA2A 3BFAA 1GFLA 3E3RA 4OR9B 1SY9A 1XFZO 5DU0A 1XFXO 4GUKA 3N7HA 1Z1QA 1LA3A 4XJKA 2MLFC 1EMGA 2JTZA 4CFRA 1S1EA 3VRNA 2G3DB 1M46A 2PALA 3LVCA 5BTTA 4D1EA 3SS3A 1IRJA 4INWA 1C4FA 4CFQA 4PPJA 5I2OA 2A4JA 1LKJA 3DQHA 2NCPA 3ZNIA 2GV5A 1JF2A 2H61C 4P1QA 5D69A 2BE4A 1CMFA 3GK4X 2OKYA 5HBDA 2LCPA 1M45A 1NSHA 4B30B 1RMOA 1WDCC 5FYXA 3SG3A 4IZNA 1L2OB 1XSSA 1MQ1A 3L4AA 1G8IA 1SNLA 4FQOA 1ZMZA 2WCMA 3D0YB 5KTGA 1R6PA 2EHBA 1KWOB 1GGXA 1F4QA 1TN4A 2KQYA 3JTDB 1MF8B 1RROA 2QLGA 5J2OA 1K90D 1MOUA 3DQ2A 3SIBA 4I5KA 1H4UA 3LF3A 4DXMA 2PSRA 2DD9A 3BOWA 2Y1NA 1DVIA 4UTSA 4KW9A 2PRUA 1NX3A 1Q80A 2GGMA 4CIDA 5DQBA 1CM4A 1OOIX 3HCMA 3PN7C 1ALVA 4JF9A 1CLMA 1MXEA 5EXBA 1K9PA 4MRXA 1C07A 2VAEA 2H2KA 1DF0B 1UHNA 3PM2A 1QX2A 3TZ1A 4PT1A 2YFPA 2HQ8A 1Y1UA 5F9GA 2A46A 1Q4DA 1U5IB 1G33A 2A56B 3O4XA 2OPOA 1KK8B 4MRYA 2H8VA 1JWDA 4N3DA 2WIQA 1S6JA 2EMNA 1Z1PA 3DQ5A 2QZ0A 4W73A 3VRRA 1XYDA 2VADA 1IIOA 5DPJA 1KP5A 2LHLA 4I5NB 3VK1A 4J88A 2Y1MA 2E6WA 2G6EA 2LP2A 4MBEA 3SVBA 1DJIA 3Q8IA 4OY4A 3U8CA 2HGDA 4WRIA 1HQVA 5PALA 1WRZA 1GL4A 1V1GA 2WCBA 3OGOA 1B47A 5AEQA 4ZF5A 2G6YA 2K7CA 3CFHA 1QYOA 4L13A 3K21A 2DUEA 1QV1A 4E68A 2AWKA 4EDOA 3RWAA 1PSBA 2G2BA 4F7FA 3CB9A 2L51A 4JFGA 4QJ3B 5HZOA 2KNEA 1CFFA 1KSMA 3DQDA 1KFUL 2V53A 3HX4A 4EULA 2G9BA 2M0RA 3QRXA 2Q4UA 3PALA 2QEBA 2BECA 3CD9A 3IR8A 1J55A 3BUMB 3IVTA 5I2QA 3JVTC 4W6IA 1NX0A 1OZOA 3I5GB 4OV2A 3RLZA 4B30A 3R1OA 1AUIB 5KTYA 4BDUA 3NT3A 3DQNA 1SBJA 3OX6A 2KHNA 4PFEA 3EK7A 4NDBA 1S5GY 3D73A 2YE1A 4I2YA 2HETA 5BT0A 2O60A 3D0YA 1YHGA 1SL9A 2WCHA 4ZINA 3SSKA 2A47A 1DJGA 1CM1A 3OB2B 2K8MB 4DXNA 1DJYA 4DUQA 1EH2A 3DY9A 3ST2A 1CFDA 2MRDA 1QS7A 2CTNA 3DXLA 3S0GA 2JTTA 3W1DA 1IJ5A 1SYMA 3OGNA 3DVEA 1YUUA 2WCKA 4W6RA 2H5QA 5HKYA 4W6UA 4CLNA 1K93D 4TZAA 1OZSA 4GNKB 2GX2A 2OTEA 1C7VA 1MXLC 5HZTA 1EMAA 4ANJA 1XO5A 3VRQA 2ZKMX 4W6FA 1NWDA 4DS7A 2L4HA 1W7SA 2WISA 2I7AA 2L2CA 1YTZC 1F71A 1QVIZ 2I94A 5D3OA 4QJ5B 3S0DA 4Q9WA 1DF0A 3PATA 1KQMC 3SVEA 4PE0A 2KFFA 1PULA 1XFRA 1K2HA 1U5IA 2CCMA 3VB1A 1ZOTB 1Y0VH 2WCEA 4HSZA 4IK4A 1MR8A 3NXAA 1AVSA 4L12A 2Y5IA 1A2XA 5HYDA 3E5VA 3M24A 1F0BA 2DUFA 1JC0A 3NEDA 4PHMA 3EK4A 2ZRSA 1MHOA 2H6VA 3D74A 3ED8A 1EMLA 2G6XA 3AI4A 4ZCUA 3SSYA 4ZB1A 2L4IA 2ZNDA 2NLNA 1JC1A 1FBVA 5HL1A 4PE1A 3O4YA 3KEVA 2V4EB 2PVBA 1IQ3A 2OGRA 4L9MA 4YBHB 2L2EA 4W75A 1B9AA 2OKWA 4GESB 1F54A 4R6BA 1EJ3A 1GGWA 3MGFA 2FL1A 2LANA 3WHTB 3I5HB 1XMZA 1DJXA 1YZWA 4M2OA 5DPIA 1XQMA 5BQLA 4JEOA 3I5HC 1B8CA 3CFAA 5DRGA 3K1EA 1BR4B 2WCFA 2Z6YA 3VICA 2QT2A 3DVMA 1PVAA 3IP2A 2YGUA 4OJ0A 2KOTA 4XVPA 2HFCA 2BL0B 4JPZB 2P70A 2WC8A 1Y1AA 1WY9A 3B87A 4DXPA 3DQ6A 4N5XA 5H88A 2JXLA 3BXAA 1YUSA 3KF9A 1TOPA 4WQ3A 3SVUA 1G7KA 2QLGB 1TWOA 1CMGA 1RJVA 3PLFB 4IL1A 4PHKA 2JRFA 1EG3A 1CV7A 4LW5A 4Q7TA 3TMTA 5FI7A 3SVOA 3I5IC 3NHTA 4MZKA 3ZULA 5G08A 1OXFA 1BF5A 2DUHA 3GJ2A 2BCBA 4Q9XA 1UUSA 4XOVA 5CSNA 3SSVA 2VVHA 2KI4B 5B8IB 1YHIA 3CYZA 5DQMA 2M29A 1PRWA 4AR7A 1CLBA 1UHHA 1TCFA 3DQJA 4GPLB 1RRXA 2WHTA 4TNCA 1NPQA 1CLLA 3F45A 3SVSA 3ICBA 3S0BA 3DQ8A 3PJ5A 4DIRA 1QIVA 2Z6ZA 3DYEA 2WC6A 1V1FA 4GFTA 1S3PA 1S6CA 3CD1A 2IB5A 1W7UA 2GW4B 3DZTA 5EXUA 1A03A 4OKHA 1KFUS 1XA5A 2BE6A 2LLUA 2FZUA 3IQQA 4A4CA 1SRAA 3D10A 1RTP1 4DRWA 2Y0GA 1WRLA 3B7AA 1ODBA 1SK6D 2K0JA 1Q4EA 3WHUB 4GAOA 1JBZA 2DD7A 2WORA 1NX2A 1DJWA 2L5YA 3EG5B 1YX8A 1SW8A 3PM8A 3CABA 2JWWA 1J7PA 3IF7A 2LP3A 4MLWA 1TRFA 5EBJA 1HUYA 1XFVO 2V4EA 4OHSA 2KFGA 3BX9A 5EXCI 5DTXA 5DTYA 3LK0A 4YGBB 1K95A 2EC6B 1JC2A 3E5TA 1E8AA 1UURA 3DVKA 3B88A 4JQ0D 4M2PA 2KSPA 3BUOB 1MOVA 5HW9A 1KFXL 1IJ6A 3OHMB 1RFJA 2TN4A 2JNXA 3SVDA 1OQPA 2CXJA 2BCAA 2WC5A 2B3PA 3KO0A 5D7FA 4FTGA 3RWTA 1SR6B 1L2OC 5FI2A 1DT7B 1KYRA 1K96A 2G3OA 4RYWA 2WCLA 4MZJA 1LVCD 1DC1A 3GEXA 2L50A 1KCYA 5LK4A 1PK0D 3VHTB 2M1UA 1OMVA 3TUYB 2FOTA 4KA9A 2PMYA 4W7EA 2JC2A 2ZO6A 2P4MA 1OOHA 3IQOA 3FE9A 3RM1A 1KWOC 3W1CA 4YGCB 3L4LA 1G4YR 4IK5A 4W77A 3JTDC 4NDDA 4W6PA 2GTEA 4PDZA 4AS8A 4Z4KA 3DQOA 3O78A 3CBEA 2WSOA 3O2PA 1B8RA 3SV5A 3R72A 1GGZA 2BBNA 3SSPA 1AK8A 1MYWA 4ORCB 2Z1OA 3WXAA 5AANA 5HGEA 5TNCA 3D77A 4JWQA 4AQIA 4YGDB 3PSRA 1X02A 3NSLA 1Z2CB 2M7NA 3D76A 3DPZA 1HCJA 1OOJA 3CZ0A 3UG0A 3GB3A 4OQWA 4DXOA 3AI5A 3S0EA 4N1FA 3DQ9A 5CSJA 1W9ZA 4AQJA 1S5GZ 3EKJA 3OB1B 3ST4A 1EMKA 2MLEC 1RMMA 2LC5A 2F2PA 2LUXA 3P28A 1TTXA 1KK8C 2WHUA 1XFUO 3H4SE 2KFHA 1XK4A 2HPWA 1H8BA 1QYQA 1F55A 1EMCA 4W7XA 4W7AA 5EL2A 2A52B 3LK1A 5BPJA 4W6JA 3SS4A 1ZFSA 1NCZA 4HREE 4XYNA 2F3ZA 1NP8A 3DQIA 2CNPA 1QTXA 1QV0A 5CPVA 3LF4B 3VROA 1DEKA 5FVGA 2MAZA 2AWMA 1J1EA 4ZIOA 2PXWA 3EK8A 2L98A 1JBAA 4PPKA 2QEHA 2WNDA 3CZ1A 2COLB 1CFPA 2K7OA 4PE7A 2KPHA 1SPYA 1CKKA 1JUOA 3TS5B 1LXFC 2LHIA 4PHJA 2WOSA 2K7DA 4J8AA 2M1KB 2QEOA 2H8QA 2LLSA 5H87A 3CGLA 1EXRA 1M39A 3LL8B 3AAKA 4EN1A 4JKTA 5ER4X 3I5GC 2CT9A 3SG4A 3U8PA 1M31A 1KYSA 2C9JA 5LTQA 1ZGOA 3ST3A 3OP0A 1EMEA 3WLDA 1A29A 3B6XA 4ORBB 3EVRA 3WNXB 1JSAA 4AOMA 4KGEA 2O2BA 2LMTA 5DRFA 4LJCA 1TCOB 3VHTA 5EB7A 1KYPA 2MJWB 3BFHA 1BG1A 1PVBA 2AH8A 4P5OE 2OJKA 3OX5A 1F8HA 3DQ4A 3SRYA 5AFPA 1YVHA 2Q57A 3ADFA 4KW4A 5EHUA 1AJ4A 2QLHA 4EDSA 3LLEA 3EVPA 1Q4BA 2KI6C 4W6OA 2POXA 3CS1A 2AHAA 1CDNA 3DQMA 5AERA 1BT6A 2HQWA 3R1PA 1AHRA 2AWLA 4W6GA 2A54B 1FI5A 5KU1A 5EB6A 3SG5A 1YR5A 1B1GA 4Z4MA 3NGVA 2M49B 3LVAA 2LMVA 1AP4A 4JD9A 3M0WA 2RGIA 3CZTX 2IB6A 1UP5A 2ISDA 3DQ1A 1IGVA 3D78A 1DQEA 5J3XA 4KEXA 3DPXA 1OXEA 1CFCA 4W7FA 3PFVA 2H9WA 1CNPA 1DELA 4OVNF 1KFXS 1XAEA 2QDIA 2YDZA 2Q91A 4GBAA 4M2QA 2VVJA 5DPHA 3CDNA 4ICBA 3SS5A 4PHNA 1GJYA 3KCTA 3R1VA 2KGRA 2ZNEA 3RZSA 1YFPA 1J1DA 1CB1A 4ZFSA 1QASA 2MHHA 2E30A 4TZGA 1FPWA 1ZGQA 2BNXA 1B4CA 2V4EC 4HE4A 1XFWO 4H3MA 2DDDA 3U8AA 2NZ0A 2JOJA 2Z6XA 3U0NA 4L1IA 2LVKA 3GK1A 2HF5A 2KGBC 5AXIA 1W7JB 1C3YA 2HQZA 3CGAA 2I2RE 3KHEA 1GQMA 1A75B 1YHHA 4Q7UA 3H1RA 1F4OA 2KYFA 4XOWA 1N0YA 4W6TA 4YI9A 4DXIA 4EMQA 3SG7A 4IK9A 2H5OA 3SSLA 1QJTA 4IK1A 2KBMA 2HPSA 2BL0C 1TNXA 1EMMA 2C9IA 4PALA 4IJ7A 2FJUB 3SSHA 3SVNA 1EMFA 4CPVA 1BJFA 1IH0A 2A50B 4KF5C 2ZN8A 1OOFA 1SCMB 1XFYO 1QLSA 2DUGA 1QYFA 3H1OA 4KW8A 1SCMC 2B1UA 4WQ2A 4U2VA 2JT8A 2PXSA 1NCYA 2LNKA 3NEZA 2IS9A 1H4BA 4W6HA 1WRKA 1BLQA 1S6IA 2KI4C 2KAVA 1LS8A 3I5FB 4JRBA 1OSAA 3OSRA 3UO9A 1FI6A 3MSEB 1YRUB 3AKBA 2BAPA 4HRHA 3DQCA 2VZXA 1DJZA 1BR1B 2R2IA 4W6MA 3NSIA 1LINA 4H3LA 1KK7Z 1Y1XA 2QPTA 2SASA 3SG6A 3AKOA 4PPLA 4R6DA 5DKQA 4Q7RA 2HRSA 1OXDA 1QY3A 4P76A 1J7OA 1XK4C 2WSNA 1P28A 1SMGA 1UHIA 3B86A 2ARLA 3SJSA 2HGYA 1SSEB 3LSAA 2FCEA 4ORNA 4YRUA 1PSRA 3LVDA
chains in the Genus database with same CATH topology
5T3IA 4YGEB 3BQ3A 4W7RA 3O77A 1K9KA 1XVJA 1H6RA 4W6KA 3NF0A 4N1GA 5DKNA 3LCPC 2B3QA 2KQ6A 2JULA 4JC2A 2A53B 1OMRA 2GX0A 3CTNA 2OTBA 5KSZA 4ZF3A 5K89A 3CR2A 2G16B 4A4BA 5CSIA 4JGEA 2O29A 1FW4A 5CSFA 3SG2A 1TNPA 2EC6C 1LA0A 1RMPA 1M63B 1QX7A 2H5RA 2KAYA 3P8UA 4W6LA 4GF6B 1A75A 1ZUZA 1PALA 2BKHB 3TDUA 2M9GA 1WDCB 4F0ZB 2O24A 3DPWA 4BY5A 1SL7A 1SR6C 1UHKA 2K61A 4C0KA 1RWYA 4HRGA 4YI8A 1Q4AA 4W69A 1S36A 1ZUXA 1KK7Y 1DMOA 4KF5A 1YJFA 1AJ5A 1KSOA 1YX7A 2BKIB 1CDLA 3GL4A 3TUYC 2LUCA 2K2AA 2WURA 4GGFA 2JPTA 3VRPA 1DTLA 4Q04A 1F09A 2KDHA 4W6DA 2HQKA 4J89A 2GGZA 1R2UA 4W72A 2OS8B 5JOLA 1UISA 4DCKA 1IWQA 1UWOA 2OS8C 4P2YB 3K1KA 2EGDA 2QRFA 3PN7B 1QLKA 4ORAB 2BTJA 1XA9A 3AKAA 1ZACA 4LQUA 1MWNA 4HQCA 3GK2A 1KQVA 4GGNA 3KCSA 2AUCA 1DGUA 3FWCA 1D1OA 4B5YA 2QACA 2I18A 2KYCA 5FHVA 1RM9A 2M97A 3GJ1A 2G5ZB 1S26D 1QX5B 4R1EA 3EVVA 2JXCA 1B7TZ 3A8SA 2DDCA 1UHJA 1J7RA 2LVIA 4LJDC 2P6BB 2JNFA 1C7WA 2NXQA 4LQTA 4W74A 3E5WA 2FCDA 2ZMUA 1YRTB 5HZSA 3ZUFA 3DQUA 3LS3A 4W6AA 2LE9B 1JF0A 2ZO7A 2Y4QA 1YJ2A 3GOFA 1W7TA 2H5PA 3TDZA 3ZTFA 3LA1A 1WLZA 4PE4A 2QLEA 1BODA 1SKTA 2ICRA 1BOCA 3TS5C 2M3WA 2ZN9A 2QLIA 3VGOA 1K9UA 2H61A 4KPIA 1NUBA 1MUXA 2M7LA 4I5JA 2QU1A 2JT3A 1NX1A 5FVFA 3A4UB 3CR5X 3JVTB 5DPGA 2JADA 3DQ7A 2MBXA 1J7QA 3DQFA 2ZMWA 4DKMA 3WLCA 4ZBLA 3DQKA 4RTCA 1FF1A 3BUNB 2AMIA 1HT9A 3NSKA 1JFJA 3WCKA 2ZFDA 1YUTA 4W6CA 1JFKA 3ZUJA 2YE0A 4DXQA 4H47A 2FWQA 2LAPA 4BY4A 5DTZA 1F70A 1B7TY 3O6BA 1L7ZA 1BU3A 2AAOA 4GOBA 4W7CA 5JJGA 1IG5A 2KBIA 2F33A 3G9AA 3PJBA 2LLTA 3U0LA 4HVFA 1JBYA 3DF0B 3NT9A 3BYAA 2DOQA 2G2SB 1SCVA 2F8PA 1ZGPA 3SVCA 4DKNA 3KPXA 4C0JA 5HLOA 1BFPA 2F3YA 1KQMB 3CLNA 3SVRA 3EKHA 5HKZA 3I19A 2KI6D 1Y6WA 1CTRA 4ZF4A 5DKRA 2VVIA 2Q6PA 3ST0A 2RH7A 1K8UA 2LVJA 2JQ6A 5HZUA 2LVVA 2WHSA 4C0LA 1NCXA 4H48A 4W76A 4LJDA 1DGVA 3A8RA 3SS0A 5ER5A 1EL4A 3U0KA 3SSTA 2JZIA 4W6NA 4IK3A 1S6ZA 1WLMA 1EMBA 3BXKA 2SCPA 3TDIA 3OSQA 3EVUA 1IQ5A 1CDMA 1N65A 3PJ7A 2DUIA 3DQLA 2HJOA 4XJKB 1CDPA 1NIWA 2L0PA 1RK9A 3UFZA 5F6TA 4NQGA 2LMUA 2OTGB 4KAGA 4YGAA 2HCGA 4HQ8A 2AWJA 1QXPA 3FIAA 1SL8A 5BTTB 5LTPA 1TNWA 2OTGC 2KAXA 4RYSA 4OGSA 2L5XB 4ZCVA 4W6BA 1YVLA 1IKUA 4USLA 3S05A 3V3DA 4LJBA 2LV7A 3U0MA 5HKWA 4IK8A 3BXBA 3CWGA 5IBWA 1VRKA 2CBLA 4MN0A 3BUWB 3C1VA 3SIAA 4H3NA 1A4PA 4W7DA 3PIBA 1B9CA 3TMRA 4W6SA 1Q73A 3FWBA 1QVIY 2M8UA 5LTRA 1BMOA 1EG4A 2EMOA 1B8LA 2K2FA 4MZLA 1NYAA 1ALWA 5DTLA 2VRGA 5EJUA 3DQEA 4GGFC 3NSOA 2BBMA 3DD4A 3I5IB 1OMDA 4NWSA 3FS7A 3BOWB 4XL5A 2NCOA 1TNQA 3DF0A 3M22A 4KF4A 1OE9B 2IOVA 5DY6A 2F2OA 4PCWA 2BCXA 1W7IB 3DQ3A 3DVJA 5FVIA 3I5FC 4NDCA 4ETOA 2EMDA 2PASA 2GW3A 4MVFA 1K94A 2JU0A 1RECA 5I8NA 1YURA 2A48A 4OCIA 2K7BA 4MEWA 4HQ9A 2LM5A 3CFFA 4MSPA 4U8DA 5GQQC 3BXCA 2O5GA 1N2DA 3CR4X 3AAJA 5HLVA 3DQAA 2ZRTA 1Q4CA 4I5LB 5I2LA 2D8NA 1QIWA 1TIZA 4QJ4B 4XGYA 5AQBB 2JT0A 3BUXB 5H89A 4KGFA 4UPGA 1QXTA 2IE2A 3ZWHA 1DJHA 1QATA 2MA2A 1GFLA 3E3RA 4OR9B 1SY9A 1XFZO 5DU0A 1XFXO 4GUKA 1Z1QA 1LA3A 4XJKA 2MLFC 1EMGA 2JTZA 4CFRA 1S1EA 3VRNA 2G3DB 1M46A 2PALA 3LVCA 5BTTA 4D1EA 1IRJA 1C4FA 4CFQA 4PPJA 5I2OA 2A4JA 1LKJA 3DQHA 2NCPA 3ZNIA 2GV5A 1JF2A 2H61C 4P1QA 5D69A 2BE4A 1CMFA 3GK4X 2OKYA 5HBDA 2LCPA 1M45A 1NSHA 4B30B 1RMOA 1WDCC 5FYXA 3SG3A 4IZNA 1L2OB 1XSSA 1MQ1A 1G8IA 1SNLA 4FQOA 1ZMZA 3D0YB 5KTGA 1R6PA 2EHBA 1KWOB 1GGXA 1F4QA 1TN4A 2KQYA 3JTDB 1MF8B 1RROA 2QLGA 5J2OA 1K90D 1MOUA 3DQ2A 3SIBA 4I5KA 1H4UA 3LF3A 4DXMA 2PSRA 2DD9A 3BOWA 2Y1NA 1DVIA 4UTSA 4KW9A 2PRUA 1NX3A 1Q80A 2GGMA 4CIDA 5DQBA 1CM4A 3HCMA 3PN7C 1ALVA 4JF9A 1CLMA 1MXEA 5EXBA 1K9PA 4MRXA 1C07A 2VAEA 2H2KA 1DF0B 1UHNA 1QX2A 3TZ1A 2YFPA 2HQ8A 1Y1UA 5F9GA 2A46A 1Q4DA 1U5IB 1G33A 2A56B 2OPOA 1KK8B 4MRYA 4N3DA 1JWDA 2WIQA 1S6JA 2EMNA 1Z1PA 3DQ5A 2QZ0A 4W73A 3VRRA 1XYDA 2VADA 5DPJA 1KP5A 2LHLA 4I5NB 3VK1A 4J88A 2Y1MA 2E6WA 2G6EA 2LP2A 4MBEA 3SVBA 1DJIA 4OY4A 3U8CA 2HGDA 4WRIA 1HQVA 5PALA 1WRZA 1GL4A 1V1GA 2WCBA 3OGOA 1B47A 5AEQA 4ZF5A 2G6YA 2K7CA 3CFHA 1QYOA 4L13A 3K21A 2DUEA 1QV1A 4E68A 2AWKA 4EDOA 3RWAA 1PSBA 2G2BA 3CB9A 2L51A 4JFGA 4QJ3B 5HZOA 2KNEA 1CFFA 1KSMA 3DQDA 1KFUL 2V53A 3HX4A 4EULA 2G9BA 2M0RA 3QRXA 2Q4UA 3PALA 2BECA 3CD9A 3IR8A 1J55A 3BUMB 5I2QA 3JVTC 4W6IA 1NX0A 1OZOA 3I5GB 4OV2A 3RLZA 4B30A 1AUIB 5KTYA 4BDUA 3NT3A 3DQNA 1SBJA 3OX6A 2KHNA 4PFEA 3EK7A 4NDBA 1S5GY 2YE1A 4I2YA 2HETA 5BT0A 2O60A 3D0YA 1YHGA 1SL9A 4ZINA 3SSKA 2A47A 1DJGA 1CM1A 3OB2B 2K8MB 4DXNA 1DJYA 4DUQA 1EH2A 3ST2A 1CFDA 2MRDA 1QS7A 2CTNA 2JTTA 3W1DA 1IJ5A 1SYMA 3DVEA 1YUUA 4W6RA 2H5QA 5HKYA 4W6UA 4CLNA 1K93D 4TZAA 1OZSA 4GNKB 2GX2A 2OTEA 1C7VA 1MXLC 5HZTA 1EMAA 4ANJA 1XO5A 3VRQA 2ZKMX 4W6FA 1NWDA 4DS7A 2L4HA 1W7SA 2WISA 2I7AA 1YTZC 1F71A 1QVIZ 2I94A 4QJ5B 4Q9WA 1DF0A 3PATA 1KQMC 3SVEA 4PE0A 2KFFA 1PULA 1K2HA 1U5IA 2CCMA 1ZOTB 1Y0VH 2WCEA 4HSZA 4IK4A 1MR8A 3NXAA 1AVSA 4L12A 2Y5IA 1A2XA 5HYDA 3E5VA 3M24A 1F0BA 2DUFA 1JC0A 3NEDA 4PHMA 3EK4A 2ZRSA 1MHOA 2H6VA 3ED8A 1EMLA 2G6XA 3AI4A 4ZCUA 3SSYA 4ZB1A 2L4IA 2ZNDA 2NLNA 1JC1A 1FBVA 4PE1A 3O4YA 3KEVA 2V4EB 2PVBA 1IQ3A 2OGRA 4L9MA 4YBHB 2L2EA 4W75A 1B9AA 2OKWA 4GESB 1F54A 4R6BA 1EJ3A 1GGWA 3MGFA 2FL1A 2LANA 3WHTB 3I5HB 1XMZA 1DJXA 1YZWA 4M2OA 5DPIA 1XQMA 5BQLA 4JEOA 3I5HC 1B8CA 3CFAA 5DRGA 1BR4B 2WCFA 2Z6YA 3VICA 2QT2A 3DVMA 1PVAA 3IP2A 4OJ0A 2KOTA 4XVPA 2HFCA 2BL0B 4JPZB 2WC8A 1Y1AA 1WY9A 4DXPA 3DQ6A 4N5XA 5H88A 2JXLA 3BXAA 1YUSA 3KF9A 1TOPA 4WQ3A 3SVUA 1G7KA 2QLGB 1CMGA 1RJVA 3PLFB 4IL1A 4PHKA 2JRFA 1EG3A 1CV7A 4LW5A 4Q7TA 3TMTA 3SVOA 3I5IC 4MZKA 3ZULA 5G08A 1OXFA 1BF5A 2DUHA 3GJ2A 2BCBA 4Q9XA 1UUSA 4XOVA 5CSNA 3SSVA 2VVHA 2KI4B 5B8IB 1YHIA 5DQMA 2M29A 1PRWA 4AR7A 1CLBA 1UHHA 1TCFA 3DQJA 4GPLB 1RRXA 2WHTA 4TNCA 1NPQA 1CLLA 3F45A 3SVSA 3ICBA 3DQ8A 3PJ5A 4DIRA 1QIVA 2Z6ZA 1V1FA 4GFTA 1S3PA 1S6CA 3CD1A 2IB5A 1W7UA 2GW4B 5EXUA 1A03A 4OKHA 1KFUS 1XA5A 2BE6A 2LLUA 2FZUA 3IQQA 4A4CA 1SRAA 3D10A 1RTP1 4DRWA 2Y0GA 1WRLA 1ODBA 1SK6D 2K0JA 1Q4EA 3WHUB 4GAOA 1JBZA 2DD7A 2WORA 1NX2A 1DJWA 1YX8A 1SW8A 3PM8A 2JWWA 1J7PA 3IF7A 2LP3A 4MLWA 1TRFA 5EBJA 1HUYA 4OHSA 1XFVO 2V4EA 2KFGA 3BX9A 5EXCI 5DTXA 5DTYA 3LK0A 4YGBB 1K95A 2EC6B 1JC2A 3E5TA 1E8AA 1UURA 3DVKA 4JQ0D 4M2PA 2KSPA 3BUOB 1MOVA 5HW9A 1KFXL 1IJ6A 3OHMB 1RFJA 2TN4A 2JNXA 3SVDA 1OQPA 2CXJA 2BCAA 2B3PA 3KO0A 5D7FA 4FTGA 3RWTA 1SR6B 1L2OC 1DT7B 1KYRA 1K96A 2G3OA 4RYWA 4MZJA 1LVCD 3GEXA 2L50A 1KCYA 5LK4A 1PK0D 3VHTB 2M1UA 1OMVA 3TUYB 2FOTA 4KA9A 2PMYA 4W7EA 2JC2A 2ZO6A 2P4MA 3IQOA 3RM1A 1KWOC 3W1CA 4YGCB 1G4YR 4IK5A 4W77A 3JTDC 4NDDA 4W6PA 4PDZA 4AS8A 4Z4KA 3DQOA 3O78A 3CBEA 2WSOA 3O2PA 1B8RA 3SV5A 1GGZA 2BBNA 3SSPA 1AK8A 1MYWA 4ORCB 2Z1OA 3WXAA 5AANA 5HGEA 5TNCA 4JWQA 4AQIA 4YGDB 3PSRA 1X02A 3NSLA 2M7NA 3DPZA 1HCJA 1OOJA 3UG0A 3GB3A 4OQWA 4DXOA 3AI5A 4N1FA 3DQ9A 5CSJA 4AQJA 1S5GZ 3EKJA 3OB1B 3ST4A 1EMKA 2MLEC 1RMMA 2LC5A 2F2PA 2LUXA 3P28A 1TTXA 1KK8C 2WHUA 1XFUO 3H4SE 2KFHA 1XK4A 2HPWA 1H8BA 1QYQA 1F55A 1EMCA 4W7XA 4W7AA 2A52B 3LK1A 5BPJA 4W6JA 1ZFSA 1NCZA 4HREE 4XYNA 2F3ZA 1NP8A 3DQIA 2CNPA 1QTXA 1QV0A 5CPVA 3LF4B 3VROA 5FVGA 2MAZA 2AWMA 1J1EA 4ZIOA 2PXWA 3EK8A 2L98A 1JBAA 4PPKA 2WNDA 2COLB 1CFPA 2K7OA 4PE7A 1SPYA 1CKKA 1JUOA 3TS5B 1LXFC 2LHIA 4PHJA 2WOSA 2K7DA 4J8AA 2M1KB 2H8QA 2LLSA 5H87A 3CGLA 1EXRA 1M39A 3LL8B 3AAKA 4EN1A 5ER4X 3I5GC 2CT9A 3SG4A 3U8PA 1M31A 1KYSA 2C9JA 5LTQA 1ZGOA 3ST3A 3OP0A 1EMEA 3WLDA 1A29A 4ORBB 3EVRA 3WNXB 1JSAA 4AOMA 4KGEA 2O2BA 2LMTA 5DRFA 4LJCA 1TCOB 3VHTA 5EB7A 1KYPA 2MJWB 1BG1A 1PVBA 2AH8A 4P5OE 2OJKA 3OX5A 1F8HA 3DQ4A 3SRYA 5AFPA 1YVHA 2Q57A 3ADFA 4KW4A 5EHUA 1AJ4A 2QLHA 4EDSA 3LLEA 3EVPA 1Q4BA 2KI6C 4W6OA 2POXA 3CS1A 2AHAA 1CDNA 3DQMA 5AERA 1BT6A 2HQWA 1AHRA 2AWLA 4W6GA 2A54B 1FI5A 5KU1A 5EB6A 3SG5A 1YR5A 1B1GA 4Z4MA 2M49B 3LVAA 2LMVA 1AP4A 3M0WA 2RGIA 3CZTX 2IB6A 1UP5A 2ISDA 3DQ1A 1IGVA 5J3XA 4KEXA 3DPXA 1OXEA 1CFCA 4W7FA 3PFVA 2H9WA 1CNPA 4OVNF 1KFXS 1XAEA 2YDZA 2Q91A 4GBAA 4M2QA 2VVJA 5DPHA 4ICBA 4PHNA 1GJYA 3KCTA 2KGRA 2ZNEA 1YFPA 1J1DA 1CB1A 4ZFSA 1QASA 2MHHA 2E30A 4TZGA 1FPWA 1ZGQA 1B4CA 2V4EC 4HE4A 1XFWO 4H3MA 2DDDA 3U8AA 2NZ0A 2JOJA 2Z6XA 3U0NA 4L1IA 2LVKA 3GK1A 2HF5A 2KGBC 5AXIA 1W7JB 2HQZA 3CGAA 2I2RE 3KHEA 1GQMA 1A75B 1YHHA 4Q7UA 3H1RA 1F4OA 2KYFA 4XOWA 1N0YA 4W6TA 4YI9A 4DXIA 4EMQA 3SG7A 4IK9A 2H5OA 3SSLA 1QJTA 4IK1A 2KBMA 2HPSA 2BL0C 1TNXA 1EMMA 2C9IA 4PALA 2FJUB 3SSHA 3SVNA 1EMFA 4CPVA 1BJFA 1IH0A 2A50B 4KF5C 2ZN8A 1SCMB 1XFYO 1QLSA 2DUGA 1QYFA 3H1OA 4KW8A 1SCMC 2B1UA 4WQ2A 4U2VA 2JT8A 2PXSA 1NCYA 2LNKA 3NEZA 2IS9A 1H4BA 4W6HA 1WRKA 1BLQA 1S6IA 2KI4C 2KAVA 3I5FB 4JRBA 1OSAA 3OSRA 1FI6A 3MSEB 1YRUB 3AKBA 3DQCA 4HRHA 2VZXA 1DJZA 1BR1B 2R2IA 4W6MA 3NSIA 1LINA 4H3LA 1KK7Z 1Y1XA 2QPTA 2SASA 3SG6A 3AKOA 4PPLA 4R6DA 5DKQA 4Q7RA 2HRSA 1OXDA 1QY3A 4P76A 1J7OA 1XK4C 2WSNA 1SMGA 1UHIA 2ARLA 3SJSA 2HGYA 3LSAA 2FCEA 4ORNA 4YRUA 1PSRA 3LVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T3I A;  4YGE B;  3BQ3 A;  4W7R A;  3O77 A;  1K9K A;  1XVJ A;  1H6R A;  4W6K A;  3NF0 A;  4N1G A;  5DKN A;  3LCP C;  2B3Q A;  2KQ6 A;  2JUL A;  4JC2 A;  2A53 B;  1OMR A;  2GX0 A;  3CTN A;  2OTB A;  5KSZ A;  4ZF3 A;  5K89 A;  3CR2 A;  2G16 B;  4A4B A;  5CSI A;  4JGE A;  2O29 A;  1FW4 A;  5CSF A;  3SG2 A;  1TNP A;  2EC6 C;  1LA0 A;  1RMP A;  1M63 B;  1QX7 A;  2H5R A;  2KAY A;  3P8U A;  4W6L A;  4GF6 B;  1A75 A;  1ZUZ A;  1PAL A;  2BKH B;  3TDU A;  2M9G A;  1WDC B;  4F0Z B;  2O24 A;  3DPW A;  4BY5 A;  1SL7 A;  1SR6 C;  1UHK A;  2K61 A;  4C0K A;  1RWY A;  4HRG A;  4YI8 A;  1Q4A A;  4W69 A;  1S36 A;  1ZUX A;  1KK7 Y;  1DMO A;  4KF5 A;  1YJF A;  1AJ5 A;  1KSO A;  1YX7 A;  2BKI B;  1CDL A;  3GL4 A;  3TUY C;  2LUC A;  2K2A A;  2WUR A;  4GGF A;  2JPT A;  3VRP A;  1DTL A;  4Q04 A;  1F09 A;  2KDH A;  4W6D A;  2HQK A;  4J89 A;  2GGZ A;  1R2U A;  4W72 A;  2OS8 B;  5JOL A;  1UIS A;  4DCK A;  1IWQ A;  1UWO A;  2OS8 C;  4P2Y B;  3K1K A;  2EGD A;  2QRF A;  3PN7 B;  1QLK A;  4ORA B;  2BTJ A;  1XA9 A;  3AKA A;  1ZAC A;  4LQU A;  1MWN A;  4HQC A;  3GK2 A;  1KQV A;  4GGN A;  3KCS A;  2AUC A;  1DGU A;  3FWC A;  1D1O A;  4B5Y A;  2QAC A;  2I18 A;  2KYC A;  5FHV A;  1RM9 A;  2M97 A;  3GJ1 A;  2G5Z B;  1S26 D;  1QX5 B;  4R1E A;  3EVV A;  2JXC A;  1B7T Z;  3A8S A;  2DDC A;  1UHJ A;  1J7R A;  2LVI A;  4LJD C;  2P6B B;  2JNF A;  1C7W A;  2NXQ A;  4LQT A;  4W74 A;  3E5W A;  2FCD A;  2ZMU A;  1YRT B;  5HZS A;  3ZUF A;  3DQU A;  3LS3 A;  4W6A A;  2LE9 B;  1JF0 A;  2ZO7 A;  2Y4Q A;  1YJ2 A;  3GOF A;  1W7T A;  2H5P A;  3TDZ A;  3ZTF A;  3LA1 A;  1WLZ A;  4PE4 A;  2QLE A;  1BOD A;  1SKT A;  2ICR A;  1BOC A;  3TS5 C;  2M3W A;  2ZN9 A;  2QLI A;  3VGO A;  1K9U A;  2H61 A;  4KPI A;  1NUB A;  1MUX A;  2M7L A;  4I5J A;  2QU1 A;  2JT3 A;  1NX1 A;  5FVF A;  3A4U B;  3CR5 X;  3JVT B;  5DPG A;  2JAD A;  3DQ7 A;  2MBX A;  1J7Q A;  3DQF A;  2ZMW A;  4DKM A;  3WLC A;  4ZBL A;  3DQK A;  4RTC A;  1FF1 A;  3BUN B;  2AMI A;  1HT9 A;  3NSK A;  1JFJ A;  3WCK A;  2ZFD A;  1YUT A;  4W6C A;  1JFK A;  3ZUJ A;  2YE0 A;  4DXQ A;  4H47 A;  2FWQ A;  2LAP A;  4BY4 A;  5DTZ A;  1F70 A;  1B7T Y;  3O6B A;  1L7Z A;  1BU3 A;  2AAO A;  4GOB A;  4W7C A;  5JJG A;  1IG5 A;  2KBI A;  2F33 A;  3G9A A;  3PJB A;  2LLT A;  3U0L A;  4HVF A;  1JBY A;  3DF0 B;  3NT9 A;  3BYA A;  2DOQ A;  2G2S B;  1SCV A;  2F8P A;  1ZGP A;  3SVC A;  4DKN A;  3KPX A;  4C0J A;  5HLO A;  1BFP A;  2F3Y A;  1KQM B;  3CLN A;  3SVR A;  3EKH A;  5HKZ A;  3I19 A;  2KI6 D;  1Y6W A;  1CTR A;  4ZF4 A;  5DKR A;  2VVI A;  2Q6P A;  3ST0 A;  2RH7 A;  1K8U A;  2LVJ A;  2JQ6 A;  5HZU A;  2LVV A;  2WHS A;  4C0L A;  1NCX A;  4H48 A;  4W76 A;  4LJD A;  1DGV A;  3A8R A;  3SS0 A;  5ER5 A;  1EL4 A;  3U0K A;  3SST A;  2JZI A;  4W6N A;  4IK3 A;  1S6Z A;  1WLM A;  1EMB A;  3BXK A;  2SCP A;  3TDI A;  3OSQ A;  3EVU A;  1IQ5 A;  1CDM A;  1N65 A;  3PJ7 A;  2DUI A;  3DQL A;  2HJO A;  4XJK B;  1CDP A;  1NIW A;  2L0P A;  1RK9 A;  3UFZ A;  5F6T A;  4NQG A;  2LMU A;  2OTG B;  4KAG A;  4YGA A;  2HCG A;  4HQ8 A;  2AWJ A;  1QXP A;  3FIA A;  1SL8 A;  5BTT B;  5LTP A;  1TNW A;  2OTG C;  2KAX A;  4RYS A;  4OGS A;  2L5X B;  4ZCV A;  4W6B A;  1YVL A;  1IKU A;  4USL A;  3S05 A;  3V3D A;  4LJB A;  2LV7 A;  3U0M A;  5HKW A;  4IK8 A;  3BXB A;  3CWG A;  5IBW A;  1VRK A;  2CBL A;  4MN0 A;  3BUW B;  3C1V A;  3SIA A;  4H3N A;  1A4P A;  4W7D A;  3PIB A;  1B9C A;  3TMR A;  4W6S A;  1Q73 A;  3FWB A;  1QVI Y;  2M8U A;  5LTR A;  1BMO A;  1EG4 A;  2EMO A;  1B8L A;  2K2F A;  4MZL A;  1NYA A;  1ALW A;  5DTL A;  2VRG A;  5EJU A;  3DQE A;  4GGF C;  3NSO A;  2BBM A;  3DD4 A;  3I5I B;  1OMD A;  4NWS A;  3FS7 A;  3BOW B;  4XL5 A;  2NCO A;  1TNQ A;  3DF0 A;  3M22 A;  4KF4 A;  1OE9 B;  2IOV A;  5DY6 A;  2F2O A;  4PCW A;  2BCX A;  1W7I B;  3DQ3 A;  3DVJ A;  5FVI A;  3I5F C;  4NDC A;  4ETO A;  2EMD A;  2PAS A;  2GW3 A;  4MVF A;  1K94 A;  2JU0 A;  1REC A;  5I8N A;  1YUR A;  2A48 A;  4OCI A;  2K7B A;  4MEW A;  4HQ9 A;  2LM5 A;  3CFF A;  4MSP A;  4U8D A;  5GQQ C;  3BXC A;  2O5G A;  1N2D A;  3CR4 X;  3AAJ A;  5HLV A;  3DQA A;  2ZRT A;  1Q4C A;  4I5L B;  5I2L A;  2D8N A;  1QIW A;  1TIZ A;  4QJ4 B;  4XGY A;  5AQB B;  2JT0 A;  3BUX B;  5H89 A;  4KGF A;  4UPG A;  1QXT A;  2IE2 A;  3ZWH A;  1DJH A;  1QAT A;  2MA2 A;  1GFL A;  3E3R A;  4OR9 B;  1SY9 A;  1XFZ O;  5DU0 A;  1XFX O;  4GUK A;  1Z1Q A;  1LA3 A;  4XJK A;  2MLF C;  1EMG A;  2JTZ A;  4CFR A;  1S1E A;  3VRN A;  2G3D B;  1M46 A;  2PAL A;  3LVC A;  5BTT A;  4D1E A;  1IRJ A;  1C4F A;  4CFQ A;  4PPJ A;  5I2O A;  2A4J A;  1LKJ A;  3DQH A;  2NCP A;  3ZNI A;  2GV5 A;  1JF2 A;  2H61 C;  4P1Q A;  5D69 A;  2BE4 A;  1CMF A;  3GK4 X;  2OKY A;  5HBD A;  2LCP A;  1M45 A;  1NSH A;  4B30 B;  1RMO A;  1WDC C;  5FYX A;  3SG3 A;  4IZN A;  1L2O B;  1XSS A;  1MQ1 A;  1G8I A;  1SNL A;  4FQO A;  1ZMZ A;  3D0Y B;  5KTG A;  1R6P A;  2EHB A;  1KWO B;  1GGX A;  1F4Q A;  1TN4 A;  2KQY A;  3JTD B;  1MF8 B;  1RRO A;  2QLG A;  5J2O A;  1K90 D;  1MOU A;  3DQ2 A;  3SIB A;  4I5K A;  1H4U A;  3LF3 A;  4DXM A;  2PSR A;  2DD9 A;  3BOW A;  2Y1N A;  1DVI A;  4UTS A;  4KW9 A;  2PRU A;  1NX3 A;  1Q80 A;  2GGM A;  4CID A;  5DQB A;  1CM4 A;  3HCM A;  3PN7 C;  1ALV A;  4JF9 A;  1CLM A;  1MXE A;  5EXB A;  1K9P A;  4MRX A;  1C07 A;  2VAE A;  2H2K A;  1DF0 B;  1UHN A;  1QX2 A;  3TZ1 A;  2YFP A;  2HQ8 A;  1Y1U A;  5F9G A;  2A46 A;  1Q4D A;  1U5I B;  1G33 A;  2A56 B;  2OPO A;  1KK8 B;  4MRY A;  4N3D A;  1JWD A;  2WIQ A;  1S6J A;  2EMN A;  1Z1P A;  3DQ5 A;  2QZ0 A;  4W73 A;  3VRR A;  1XYD A;  2VAD A;  5DPJ A;  1KP5 A;  2LHL A;  4I5N B;  3VK1 A;  4J88 A;  2Y1M A;  2E6W A;  2G6E A;  2LP2 A;  4MBE A;  3SVB A;  1DJI A;  4OY4 A;  3U8C A;  2HGD A;  4WRI A;  1HQV A;  5PAL A;  1WRZ A;  1GL4 A;  1V1G A;  2WCB A;  3OGO A;  1B47 A;  5AEQ A;  4ZF5 A;  2G6Y A;  2K7C A;  3CFH A;  1QYO A;  4L13 A;  3K21 A;  2DUE A;  1QV1 A;  4E68 A;  2AWK A;  4EDO A;  3RWA A;  1PSB A;  2G2B A;  3CB9 A;  2L51 A;  4JFG A;  4QJ3 B;  5HZO A;  2KNE A;  1CFF A;  1KSM A;  3DQD A;  1KFU L;  2V53 A;  3HX4 A;  4EUL A;  2G9B A;  2M0R A;  3QRX A;  2Q4U A;  3PAL A;  2BEC A;  3CD9 A;  3IR8 A;  1J55 A;  3BUM B;  5I2Q A;  3JVT C;  4W6I A;  1NX0 A;  1OZO A;  3I5G B;  4OV2 A;  3RLZ A;  4B30 A;  1AUI B;  5KTY A;  4BDU A;  3NT3 A;  3DQN A;  1SBJ A;  3OX6 A;  2KHN A;  4PFE A;  3EK7 A;  4NDB A;  1S5G Y;  2YE1 A;  4I2Y A;  2HET A;  5BT0 A;  2O60 A;  3D0Y A;  1YHG A;  1SL9 A;  4ZIN A;  3SSK A;  2A47 A;  1DJG A;  1CM1 A;  3OB2 B;  2K8M B;  4DXN A;  1DJY A;  4DUQ A;  1EH2 A;  3ST2 A;  1CFD A;  2MRD A;  1QS7 A;  2CTN A;  2JTT A;  3W1D A;  1IJ5 A;  1SYM A;  3DVE A;  1YUU A;  4W6R A;  2H5Q A;  5HKY A;  4W6U A;  4CLN A;  1K93 D;  4TZA A;  1OZS A;  4GNK B;  2GX2 A;  2OTE A;  1C7V A;  1MXL C;  5HZT A;  1EMA A;  4ANJ A;  1XO5 A;  3VRQ A;  2ZKM X;  4W6F A;  1NWD A;  4DS7 A;  2L4H A;  1W7S A;  2WIS A;  2I7A A;  1YTZ C;  1F71 A;  1QVI Z;  2I94 A;  4QJ5 B;  4Q9W A;  1DF0 A;  3PAT A;  1KQM C;  3SVE A;  4PE0 A;  2KFF A;  1PUL A;  1K2H A;  1U5I A;  2CCM A;  1ZOT B;  1Y0V H;  2WCE A;  4HSZ A;  4IK4 A;  1MR8 A;  3NXA A;  1AVS A;  4L12 A;  2Y5I A;  1A2X A;  5HYD A;  3E5V A;  3M24 A;  1F0B A;  2DUF A;  1JC0 A;  3NED A;  4PHM A;  3EK4 A;  2ZRS A;  1MHO A;  2H6V A;  3ED8 A;  1EML A;  2G6X A;  3AI4 A;  4ZCU A;  3SSY A;  4ZB1 A;  2L4I A;  2ZND A;  2NLN A;  1JC1 A;  1FBV A;  4PE1 A;  3O4Y A;  3KEV A;  2V4E B;  2PVB A;  1IQ3 A;  2OGR A;  4L9M A;  4YBH B;  2L2E A;  4W75 A;  1B9A A;  2OKW A;  4GES B;  1F54 A;  4R6B A;  1EJ3 A;  1GGW A;  3MGF A;  2FL1 A;  2LAN A;  3WHT B;  3I5H B;  1XMZ A;  1DJX A;  1YZW A;  4M2O A;  5DPI A;  1XQM A;  5BQL A;  4JEO A;  3I5H C;  1B8C A;  3CFA A;  5DRG A;  1BR4 B;  2WCF A;  2Z6Y A;  3VIC A;  2QT2 A;  3DVM A;  1PVA A;  3IP2 A;  4OJ0 A;  2KOT A;  4XVP A;  2HFC A;  2BL0 B;  4JPZ B;  2WC8 A;  1Y1A A;  1WY9 A;  4DXP A;  3DQ6 A;  4N5X A;  5H88 A;  2JXL A;  3BXA A;  1YUS A;  3KF9 A;  1TOP A;  4WQ3 A;  3SVU A;  1G7K A;  2QLG B;  1CMG A;  1RJV A;  3PLF B;  4IL1 A;  4PHK A;  2JRF A;  1EG3 A;  1CV7 A;  4LW5 A;  4Q7T A;  3TMT A;  3SVO A;  3I5I C;  4MZK A;  3ZUL A;  5G08 A;  1OXF A;  1BF5 A;  2DUH A;  3GJ2 A;  2BCB A;  4Q9X A;  1UUS A;  4XOV A;  5CSN A;  3SSV A;  2VVH A;  2KI4 B;  5B8I B;  1YHI A;  5DQM A;  2M29 A;  1PRW A;  4AR7 A;  1CLB A;  1UHH A;  1TCF A;  3DQJ A;  4GPL B;  1RRX A;  2WHT A;  4TNC A;  1NPQ A;  1CLL A;  3F45 A;  3SVS A;  3ICB A;  3DQ8 A;  3PJ5 A;  4DIR A;  1QIV A;  2Z6Z A;  1V1F A;  4GFT A;  1S3P A;  1S6C A;  3CD1 A;  2IB5 A;  1W7U A;  2GW4 B;  5EXU A;  1A03 A;  4OKH A;  1KFU S;  1XA5 A;  2BE6 A;  2LLU A;  2FZU A;  3IQQ A;  4A4C A;  1SRA A;  3D10 A;  1RTP 1;  4DRW A;  2Y0G A;  1WRL A;  1ODB A;  1SK6 D;  2K0J A;  1Q4E A;  3WHU B;  4GAO A;  1JBZ A;  2DD7 A;  2WOR A;  1NX2 A;  1DJW A;  1YX8 A;  1SW8 A;  3PM8 A;  2JWW A;  1J7P A;  3IF7 A;  2LP3 A;  4MLW A;  1TRF A;  5EBJ A;  1HUY A;  4OHS A;  1XFV O;  2V4E A;  2KFG A;  3BX9 A;  5EXC I;  5DTX A;  5DTY A;  3LK0 A;  4YGB B;  1K95 A;  2EC6 B;  1JC2 A;  3E5T A;  1E8A A;  1UUR A;  3DVK A;  4JQ0 D;  4M2P A;  2KSP A;  3BUO B;  1MOV A;  5HW9 A;  1KFX L;  1IJ6 A;  3OHM B;  1RFJ A;  2TN4 A;  2JNX A;  3SVD A;  1OQP A;  2CXJ A;  2BCA A;  2B3P A;  3KO0 A;  5D7F A;  4FTG A;  3RWT A;  1SR6 B;  1L2O C;  1DT7 B;  1KYR A;  1K96 A;  2G3O A;  4RYW A;  4MZJ A;  1LVC D;  3GEX A;  2L50 A;  1KCY A;  5LK4 A;  1PK0 D;  3VHT B;  2M1U A;  1OMV A;  3TUY B;  2FOT A;  4KA9 A;  2PMY A;  4W7E A;  2JC2 A;  2ZO6 A;  2P4M A;  3IQO A;  3RM1 A;  1KWO C;  3W1C A;  4YGC B;  1G4Y R;  4IK5 A;  4W77 A;  3JTD C;  4NDD A;  4W6P A;  4PDZ A;  4AS8 A;  4Z4K A;  3DQO A;  3O78 A;  3CBE A;  2WSO A;  3O2P A;  1B8R A;  3SV5 A;  1GGZ A;  2BBN A;  3SSP A;  1AK8 A;  1MYW A;  4ORC B;  2Z1O A;  3WXA A;  5AAN A;  5HGE A;  5TNC A;  4JWQ A;  4AQI A;  4YGD B;  3PSR A;  1X02 A;  3NSL A;  2M7N A;  3DPZ A;  1HCJ A;  1OOJ A;  3UG0 A;  3GB3 A;  4OQW A;  4DXO A;  3AI5 A;  4N1F A;  3DQ9 A;  5CSJ A;  4AQJ A;  1S5G Z;  3EKJ A;  3OB1 B;  3ST4 A;  1EMK A;  2MLE C;  1RMM A;  2LC5 A;  2F2P A;  2LUX A;  3P28 A;  1TTX A;  1KK8 C;  2WHU A;  1XFU O;  3H4S E;  2KFH A;  1XK4 A;  2HPW A;  1H8B A;  1QYQ A;  1F55 A;  1EMC A;  4W7X A;  4W7A A;  2A52 B;  3LK1 A;  5BPJ A;  4W6J A;  1ZFS A;  1NCZ A;  4HRE E;  4XYN A;  2F3Z A;  1NP8 A;  3DQI A;  2CNP A;  1QTX A;  1QV0 A;  5CPV A;  3LF4 B;  3VRO A;  5FVG A;  2MAZ A;  2AWM A;  1J1E A;  4ZIO A;  2PXW A;  3EK8 A;  2L98 A;  1JBA A;  4PPK A;  2WND A;  2COL B;  1CFP A;  2K7O A;  4PE7 A;  1SPY A;  1CKK A;  1JUO A;  3TS5 B;  1LXF C;  2LHI A;  4PHJ A;  2WOS A;  2K7D A;  4J8A A;  2M1K B;  2H8Q A;  2LLS A;  5H87 A;  3CGL A;  1EXR A;  1M39 A;  3LL8 B;  3AAK A;  4EN1 A;  5ER4 X;  3I5G C;  2CT9 A;  3SG4 A;  3U8P A;  1M31 A;  1KYS A;  2C9J A;  5LTQ A;  1ZGO A;  3ST3 A;  3OP0 A;  1EME A;  3WLD A;  1A29 A;  4ORB B;  3EVR A;  3WNX B;  1JSA A;  4AOM A;  4KGE A;  2O2B A;  2LMT A;  5DRF A;  4LJC A;  1TCO B;  3VHT A;  5EB7 A;  1KYP A;  2MJW B;  1BG1 A;  1PVB A;  2AH8 A;  4P5O E;  2OJK A;  3OX5 A;  1F8H A;  3DQ4 A;  3SRY A;  5AFP A;  1YVH A;  2Q57 A;  3ADF A;  4KW4 A;  5EHU A;  1AJ4 A;  2QLH A;  4EDS A;  3LLE A;  3EVP A;  1Q4B A;  2KI6 C;  4W6O A;  2POX A;  3CS1 A;  2AHA A;  1CDN A;  3DQM A;  5AER A;  1BT6 A;  2HQW A;  1AHR A;  2AWL A;  4W6G A;  2A54 B;  1FI5 A;  5KU1 A;  5EB6 A;  3SG5 A;  1YR5 A;  1B1G A;  4Z4M A;  2M49 B;  3LVA A;  2LMV A;  1AP4 A;  3M0W A;  2RGI A;  3CZT X;  2IB6 A;  1UP5 A;  2ISD A;  3DQ1 A;  1IGV A;  5J3X A;  4KEX A;  3DPX A;  1OXE A;  1CFC A;  4W7F A;  3PFV A;  2H9W A;  1CNP A;  4OVN F;  1KFX S;  1XAE A;  2YDZ A;  2Q91 A;  4GBA A;  4M2Q A;  2VVJ A;  5DPH A;  4ICB A;  4PHN A;  1GJY A;  3KCT A;  2KGR A;  2ZNE A;  1YFP A;  1J1D A;  1CB1 A;  4ZFS A;  1QAS A;  2MHH A;  2E30 A;  4TZG A;  1FPW A;  1ZGQ A;  1B4C A;  2V4E C;  4HE4 A;  1XFW O;  4H3M A;  2DDD A;  3U8A A;  2NZ0 A;  2JOJ A;  2Z6X A;  3U0N A;  4L1I A;  2LVK A;  3GK1 A;  2HF5 A;  2KGB C;  5AXI A;  1W7J B;  2HQZ A;  3CGA A;  2I2R E;  3KHE A;  1GQM A;  1A75 B;  1YHH A;  4Q7U A;  3H1R A;  1F4O A;  2KYF A;  4XOW A;  1N0Y A;  4W6T A;  4YI9 A;  4DXI A;  4EMQ A;  3SG7 A;  4IK9 A;  2H5O A;  3SSL A;  1QJT A;  4IK1 A;  2KBM A;  2HPS A;  2BL0 C;  1TNX A;  1EMM A;  2C9I A;  4PAL A;  2FJU B;  3SSH A;  3SVN A;  1EMF A;  4CPV A;  1BJF A;  1IH0 A;  2A50 B;  4KF5 C;  2ZN8 A;  1SCM B;  1XFY O;  1QLS A;  2DUG A;  1QYF A;  3H1O A;  4KW8 A;  1SCM C;  2B1U A;  4WQ2 A;  4U2V A;  2JT8 A;  2PXS A;  1NCY A;  2LNK A;  3NEZ A;  2IS9 A;  1H4B A;  4W6H A;  1WRK A;  1BLQ A;  1S6I A;  2KI4 C;  2KAV A;  3I5F B;  4JRB A;  1OSA A;  3OSR A;  1FI6 A;  3MSE B;  1YRU B;  3AKB A;  3DQC A;  4HRH A;  2VZX A;  1DJZ A;  1BR1 B;  2R2I A;  4W6M A;  3NSI A;  1LIN A;  4H3L A;  1KK7 Z;  1Y1X A;  2QPT A;  2SAS A;  3SG6 A;  3AKO A;  4PPL A;  4R6D A;  5DKQ A;  4Q7R A;  2HRS A;  1OXD A;  1QY3 A;  4P76 A;  1J7O A;  1XK4 C;  2WSN A;  1SMG A;  1UHI A;  2ARL A;  3SJS A;  2HGY A;  3LSA A;  2FCE A;  4ORN A;  4YRU A;  1PSR A;  3LVD A; 
#chains in the Genus database with same CATH topology
 5T3I A;  4YGE B;  3BQ3 A;  4W7R A;  3O77 A;  1K9K A;  1XVJ A;  1H6R A;  4W6K A;  3FE6 A;  1C3Z A;  2KLD A;  3NF0 A;  4N1G A;  5DKN A;  3LCP C;  2B3Q A;  2KQ6 A;  2JUL A;  4JC2 A;  2A53 B;  1OMR A;  2GX0 A;  5I94 A;  3CTN A;  2OTB A;  5KSZ A;  4ZF3 A;  5K89 A;  3CR2 A;  2G16 B;  4A4B A;  5CSI A;  4JGE A;  2O29 A;  1FW4 A;  5CSF A;  3SG2 A;  1TNP A;  1Z4H A;  1LA0 A;  2EC6 C;  1RMP A;  1M63 B;  1QX7 A;  2H5R A;  2KAY A;  3P8U A;  4W6L A;  4GF6 B;  1A75 A;  1ZUZ A;  1PAL A;  2BKH B;  3TDU A;  2M9G A;  1WDC B;  4F0Z B;  2O24 A;  3DPW A;  4BY5 A;  1SL7 A;  1SR6 C;  2P71 A;  1UHK A;  2K61 A;  4C0K A;  1RWY A;  4HRG A;  4YI8 A;  1Q4A A;  4W69 A;  1S36 A;  1ZUX A;  1KK7 Y;  1DMO A;  4KF5 A;  1YJF A;  3L47 A;  1AJ5 A;  1KSO A;  1YX7 A;  2BKI B;  1CDL A;  3GL4 A;  3TUY C;  2LUC A;  2K2A A;  2WUR A;  4GGF A;  2JPT A;  3VRP A;  1DTL A;  3S0F A;  4Q04 A;  1F09 A;  2KDH A;  4W6D A;  2HQK A;  4J89 A;  2GGZ A;  3PJI A;  1R2U A;  4W72 A;  2OS8 B;  5JOL A;  1UIS A;  4DCK A;  1IWQ A;  1UWO A;  2OS8 C;  4P2Y B;  3K1K A;  2EGD A;  2QRF A;  3PN7 B;  1QLK A;  4ORA B;  2BTJ A;  1XA9 A;  3AKA A;  1ZAC A;  4LQU A;  1MWN A;  4HQC A;  3GK2 A;  1KQV A;  4GGN A;  3KCS A;  2AUC A;  1DGU A;  3FWC A;  1D1O A;  4B5Y A;  2QAC A;  2I18 A;  2KYC A;  5FHV A;  1RM9 A;  2M97 A;  3GJ1 A;  2G5Z B;  1S26 D;  1QX5 B;  4R1E A;  3EVV A;  2JXC A;  1B7T Z;  3A8S A;  2DDC A;  1UHJ A;  3UNW A;  1J7R A;  2LVI A;  4LJD C;  2P6B B;  2JNF A;  5FI6 A;  1TUJ A;  1C7W A;  2NXQ A;  4LQT A;  4W74 A;  3E5W A;  2FCD A;  2ZMU A;  1YRT B;  1QWV A;  2JPO A;  5HZS A;  3ZUF A;  3DQU A;  3LS3 A;  4W6A A;  2LE9 B;  1JF0 A;  2ZO7 A;  2Y4Q A;  1YJ2 A;  3GOF A;  1W7T A;  2H5P A;  3TDZ A;  3ZTF A;  3LA1 A;  1WLZ A;  3NHI A;  4PE4 A;  2QLE A;  1BOD A;  1OW4 A;  1SKT A;  2ICR A;  1BOC A;  3TS5 C;  2M3W A;  2ZN9 A;  2QLI A;  3VGO A;  1K9U A;  2H61 A;  4KPI A;  1NUB A;  1MUX A;  2M7L A;  4I5J A;  2QU1 A;  2JT3 A;  1NX1 A;  2PQL A;  5FVF A;  3A4U B;  3CR5 X;  3JVT B;  5DPG A;  2JAD A;  3DQ7 A;  1GM0 A;  2MBX A;  1J7Q A;  1T14 A;  3DQF A;  2ZMW A;  4DKM A;  3WLC A;  4ZBL A;  3DQK A;  3BJH A;  4RTC A;  1FF1 A;  3BUN B;  2AMI A;  1HT9 A;  4KYN A;  3NSK A;  1JFJ A;  3WCK A;  2ZFD A;  1YUT A;  4W6C A;  1JFK A;  3ZUJ A;  2YE0 A;  4DXQ A;  4H47 A;  4OZD A;  2FWQ A;  2LAP A;  4BY4 A;  5DTZ A;  1F70 A;  1B7T Y;  3O6B A;  1L7Z A;  1BU3 A;  2AAO A;  4GOB A;  4W7C A;  5JJG A;  1IG5 A;  2KBI A;  2F33 A;  3G9A A;  3PJB A;  2ERB A;  2K60 A;  2LLT A;  3U0L A;  4HVF A;  1JBY A;  3DF0 B;  3NT9 A;  3BYA A;  2DOQ A;  2G2S B;  1SCV A;  2F8P A;  1ZGP A;  3SVC A;  4DKN A;  3KPX A;  4C0J A;  1ORG A;  5HLO A;  1BFP A;  2F3Y A;  1KQM B;  3CLN A;  3SVR A;  3EKH A;  5HKZ A;  3I19 A;  2KI6 D;  1Y6W A;  1CTR A;  4ZF4 A;  5DKR A;  2VVI A;  2Q6P A;  3ST0 A;  2RH7 A;  1K8U A;  2LVJ A;  2JQ6 A;  5HZU A;  2LVV A;  2WHS A;  2KLE A;  4C0L A;  1NCX A;  4H48 A;  4W76 A;  4LJD A;  1DGV A;  3A8R A;  3SS0 A;  5ER5 A;  1EL4 A;  3U0K A;  3SST A;  2JZI A;  4W6N A;  4IK3 A;  1S6Z A;  1WLM A;  3OBV A;  3S0A A;  1EMB A;  3BXK A;  2SCP A;  3TDI A;  3OSQ A;  3EVU A;  1IQ5 A;  1CDM A;  1N65 A;  3PJ7 A;  2DUI A;  3DQL A;  2HJO A;  4XJK B;  1CDP A;  1NIW A;  2L0P A;  1RK9 A;  3UFZ A;  5F6T A;  4NQG A;  2LMU A;  2OTG B;  3FE8 A;  4KAG A;  4YGA A;  2HCG A;  4HQ8 A;  2AWJ A;  1QXP A;  3FIA A;  1SL8 A;  5BTT B;  5LTP A;  1TNW A;  2OTG C;  2KAX A;  4RYS A;  4OGS A;  2L5X B;  4ZCV A;  4W6B A;  1YVL A;  1IKU A;  4USL A;  3S05 A;  3V3D A;  4LJB A;  2LV7 A;  3D75 A;  3U0M A;  5HKW A;  4IK8 A;  3BXB A;  3CWG A;  5IBW A;  1VRK A;  2CBL A;  4MN0 A;  3BUW B;  3C1V A;  3SIA A;  4H3N A;  2PYQ A;  1A4P A;  4W7D A;  3PIB A;  1B9C A;  3TMR A;  4W6S A;  1Q73 A;  2FJY A;  3FWB A;  1QVI Y;  2M8U A;  5LTR A;  1BMO A;  1EG4 A;  2EMO A;  1TUZ A;  1B8L A;  2K2F A;  5DIC A;  4MZL A;  4INX A;  1NYA A;  1ALW A;  5DTL A;  2VRG A;  5EJU A;  3DQE A;  1OOG A;  4GGF C;  3QME A;  3NSO A;  2BBM A;  3DD4 A;  3I5I B;  1OMD A;  4NWS A;  3CZ2 A;  3FS7 A;  2QEV A;  3BOW B;  4XL5 A;  2NCO A;  1TNQ A;  3DF0 A;  3M22 A;  4KF4 A;  1OE9 B;  2IOV A;  5DY6 A;  2F2O A;  4PCW A;  2BCX A;  1W7I B;  3DQ3 A;  3DVJ A;  5FVI A;  3I5F C;  4NDC A;  4ETO A;  2EMD A;  2PAS A;  2GW3 A;  4MVF A;  1K94 A;  2JU0 A;  1REC A;  5I8N A;  1YUR A;  2A48 A;  4OCI A;  2K7B A;  2WCJ A;  4MEW A;  4HQ9 A;  2LM5 A;  3CFF A;  4MSP A;  4U8D A;  5GQQ C;  3BXC A;  2O5G A;  3BFB A;  1N2D A;  3CR4 X;  3AAJ A;  5HLV A;  4FQT A;  3DQA A;  2ZRT A;  1Q4C A;  4I5L B;  5I2L A;  2D8N A;  1QIW A;  1TIZ A;  4QJ4 B;  4XGY A;  5AQB B;  2JT0 A;  3BUX B;  5H89 A;  4KGF A;  4UPG A;  3V2L A;  1QXT A;  2IE2 A;  3ZWH A;  1DJH A;  1QAT A;  2MA2 A;  3BFA A;  1GFL A;  3E3R A;  4OR9 B;  1SY9 A;  1XFZ O;  5DU0 A;  1XFX O;  4GUK A;  3N7H A;  1Z1Q A;  1LA3 A;  4XJK A;  2MLF C;  1EMG A;  2JTZ A;  4CFR A;  1S1E A;  3VRN A;  2G3D B;  1M46 A;  2PAL A;  3LVC A;  5BTT A;  4D1E A;  3SS3 A;  1IRJ A;  4INW A;  1C4F A;  4CFQ A;  4PPJ A;  5I2O A;  2A4J A;  1LKJ A;  3DQH A;  2NCP A;  3ZNI A;  2GV5 A;  1JF2 A;  2H61 C;  4P1Q A;  5D69 A;  2BE4 A;  1CMF A;  3GK4 X;  2OKY A;  5HBD A;  2LCP A;  1M45 A;  1NSH A;  4B30 B;  1RMO A;  1WDC C;  5FYX A;  3SG3 A;  4IZN A;  1L2O B;  1XSS A;  1MQ1 A;  3L4A A;  1G8I A;  1SNL A;  4FQO A;  1ZMZ A;  2WCM A;  3D0Y B;  5KTG A;  1R6P A;  2EHB A;  1KWO B;  1GGX A;  1F4Q A;  1TN4 A;  2KQY A;  3JTD B;  1MF8 B;  1RRO A;  2QLG A;  5J2O A;  1K90 D;  1MOU A;  3DQ2 A;  3SIB A;  4I5K A;  1H4U A;  3LF3 A;  4DXM A;  2PSR A;  2DD9 A;  3BOW A;  2Y1N A;  1DVI A;  4UTS A;  4KW9 A;  2PRU A;  1NX3 A;  1Q80 A;  2GGM A;  4CID A;  5DQB A;  1CM4 A;  1OOI X;  3HCM A;  3PN7 C;  1ALV A;  4JF9 A;  1CLM A;  1MXE A;  5EXB A;  1K9P A;  4MRX A;  1C07 A;  2VAE A;  2H2K A;  1DF0 B;  1UHN A;  3PM2 A;  1QX2 A;  3TZ1 A;  4PT1 A;  2YFP A;  2HQ8 A;  1Y1U A;  5F9G A;  2A46 A;  1Q4D A;  1U5I B;  1G33 A;  2A56 B;  3O4X A;  2OPO A;  1KK8 B;  4MRY A;  2H8V A;  1JWD A;  4N3D A;  2WIQ A;  1S6J A;  2EMN A;  1Z1P A;  3DQ5 A;  2QZ0 A;  4W73 A;  3VRR A;  1XYD A;  2VAD A;  1IIO A;  5DPJ A;  1KP5 A;  2LHL A;  4I5N B;  3VK1 A;  4J88 A;  2Y1M A;  2E6W A;  2G6E A;  2LP2 A;  4MBE A;  3SVB A;  1DJI A;  3Q8I A;  4OY4 A;  3U8C A;  2HGD A;  4WRI A;  1HQV A;  5PAL A;  1WRZ A;  1GL4 A;  1V1G A;  2WCB A;  3OGO A;  1B47 A;  5AEQ A;  4ZF5 A;  2G6Y A;  2K7C A;  3CFH A;  1QYO A;  4L13 A;  3K21 A;  2DUE A;  1QV1 A;  4E68 A;  2AWK A;  4EDO A;  3RWA A;  1PSB A;  2G2B A;  4F7F A;  3CB9 A;  2L51 A;  4JFG A;  4QJ3 B;  5HZO A;  2KNE A;  1CFF A;  1KSM A;  3DQD A;  1KFU L;  2V53 A;  3HX4 A;  4EUL A;  2G9B A;  2M0R A;  3QRX A;  2Q4U A;  3PAL A;  2QEB A;  2BEC A;  3CD9 A;  3IR8 A;  1J55 A;  3BUM B;  3IVT A;  5I2Q A;  3JVT C;  4W6I A;  1NX0 A;  1OZO A;  3I5G B;  4OV2 A;  3RLZ A;  4B30 A;  3R1O A;  1AUI B;  5KTY A;  4BDU A;  3NT3 A;  3DQN A;  1SBJ A;  3OX6 A;  2KHN A;  4PFE A;  3EK7 A;  4NDB A;  1S5G Y;  3D73 A;  2YE1 A;  4I2Y A;  2HET A;  5BT0 A;  2O60 A;  3D0Y A;  1YHG A;  1SL9 A;  2WCH A;  4ZIN A;  3SSK A;  2A47 A;  1DJG A;  1CM1 A;  3OB2 B;  2K8M B;  4DXN A;  1DJY A;  4DUQ A;  1EH2 A;  3DY9 A;  3ST2 A;  1CFD A;  2MRD A;  1QS7 A;  2CTN A;  3DXL A;  3S0G A;  2JTT A;  3W1D A;  1IJ5 A;  1SYM A;  3OGN A;  3DVE A;  1YUU A;  2WCK A;  4W6R A;  2H5Q A;  5HKY A;  4W6U A;  4CLN A;  1K93 D;  4TZA A;  1OZS A;  4GNK B;  2GX2 A;  2OTE A;  1C7V A;  1MXL C;  5HZT A;  1EMA A;  4ANJ A;  1XO5 A;  3VRQ A;  2ZKM X;  4W6F A;  1NWD A;  4DS7 A;  2L4H A;  1W7S A;  2WIS A;  2I7A A;  2L2C A;  1YTZ C;  1F71 A;  1QVI Z;  2I94 A;  5D3O A;  4QJ5 B;  3S0D A;  4Q9W A;  1DF0 A;  3PAT A;  1KQM C;  3SVE A;  4PE0 A;  2KFF A;  1PUL A;  1XFR A;  1K2H A;  1U5I A;  2CCM A;  3VB1 A;  1ZOT B;  1Y0V H;  2WCE A;  4HSZ A;  4IK4 A;  1MR8 A;  3NXA A;  1AVS A;  4L12 A;  2Y5I A;  1A2X A;  5HYD A;  3E5V A;  3M24 A;  1F0B A;  2DUF A;  1JC0 A;  3NED A;  4PHM A;  3EK4 A;  2ZRS A;  1MHO A;  2H6V A;  3D74 A;  3ED8 A;  1EML A;  2G6X A;  3AI4 A;  4ZCU A;  3SSY A;  4ZB1 A;  2L4I A;  2ZND A;  2NLN A;  1JC1 A;  1FBV A;  5HL1 A;  4PE1 A;  3O4Y A;  3KEV A;  2V4E B;  2PVB A;  1IQ3 A;  2OGR A;  4L9M A;  4YBH B;  2L2E A;  4W75 A;  1B9A A;  2OKW A;  4GES B;  1F54 A;  4R6B A;  1EJ3 A;  1GGW A;  3MGF A;  2FL1 A;  2LAN A;  3WHT B;  3I5H B;  1XMZ A;  1DJX A;  1YZW A;  4M2O A;  5DPI A;  1XQM A;  5BQL A;  4JEO A;  3I5H C;  1B8C A;  3CFA A;  5DRG A;  3K1E A;  1BR4 B;  2WCF A;  2Z6Y A;  3VIC A;  2QT2 A;  3DVM A;  1PVA A;  3IP2 A;  2YGU A;  4OJ0 A;  2KOT A;  4XVP A;  2HFC A;  2BL0 B;  4JPZ B;  2P70 A;  2WC8 A;  1Y1A A;  1WY9 A;  3B87 A;  4DXP A;  3DQ6 A;  4N5X A;  5H88 A;  2JXL A;  3BXA A;  1YUS A;  3KF9 A;  1TOP A;  4WQ3 A;  3SVU A;  1G7K A;  2QLG B;  1TWO A;  1CMG A;  1RJV A;  3PLF B;  4IL1 A;  4PHK A;  2JRF A;  1EG3 A;  1CV7 A;  4LW5 A;  4Q7T A;  3TMT A;  5FI7 A;  3SVO A;  3I5I C;  3NHT A;  4MZK A;  3ZUL A;  5G08 A;  1OXF A;  1BF5 A;  2DUH A;  3GJ2 A;  2BCB A;  4Q9X A;  1UUS A;  4XOV A;  5CSN A;  3SSV A;  2VVH A;  2KI4 B;  5B8I B;  1YHI A;  3CYZ A;  5DQM A;  2M29 A;  1PRW A;  4AR7 A;  1CLB A;  1UHH A;  1TCF A;  3DQJ A;  4GPL B;  1RRX A;  2WHT A;  4TNC A;  1NPQ A;  1CLL A;  3F45 A;  3SVS A;  3ICB A;  3S0B A;  3DQ8 A;  3PJ5 A;  4DIR A;  1QIV A;  2Z6Z A;  3DYE A;  2WC6 A;  1V1F A;  4GFT A;  1S3P A;  1S6C A;  3CD1 A;  2IB5 A;  1W7U A;  2GW4 B;  3DZT A;  5EXU A;  1A03 A;  4OKH A;  1KFU S;  1XA5 A;  2BE6 A;  2LLU A;  2FZU A;  3IQQ A;  4A4C A;  1SRA A;  3D10 A;  1RTP 1;  4DRW A;  2Y0G A;  1WRL A;  3B7A A;  1ODB A;  1SK6 D;  2K0J A;  1Q4E A;  3WHU B;  4GAO A;  1JBZ A;  2DD7 A;  2WOR A;  1NX2 A;  1DJW A;  2L5Y A;  3EG5 B;  1YX8 A;  1SW8 A;  3PM8 A;  3CAB A;  2JWW A;  1J7P A;  3IF7 A;  2LP3 A;  4MLW A;  1TRF A;  5EBJ A;  1HUY A;  1XFV O;  2V4E A;  4OHS A;  2KFG A;  3BX9 A;  5EXC I;  5DTX A;  5DTY A;  3LK0 A;  4YGB B;  1K95 A;  2EC6 B;  1JC2 A;  3E5T A;  1E8A A;  1UUR A;  3DVK A;  3B88 A;  4JQ0 D;  4M2P A;  2KSP A;  3BUO B;  1MOV A;  5HW9 A;  1KFX L;  1IJ6 A;  3OHM B;  1RFJ A;  2TN4 A;  2JNX A;  3SVD A;  1OQP A;  2CXJ A;  2BCA A;  2WC5 A;  2B3P A;  3KO0 A;  5D7F A;  4FTG A;  3RWT A;  1SR6 B;  1L2O C;  5FI2 A;  1DT7 B;  1KYR A;  1K96 A;  2G3O A;  4RYW A;  2WCL A;  4MZJ A;  1LVC D;  1DC1 A;  3GEX A;  2L50 A;  1KCY A;  5LK4 A;  1PK0 D;  3VHT B;  2M1U A;  1OMV A;  3TUY B;  2FOT A;  4KA9 A;  2PMY A;  4W7E A;  2JC2 A;  2ZO6 A;  2P4M A;  1OOH A;  3IQO A;  3FE9 A;  3RM1 A;  1KWO C;  3W1C A;  4YGC B;  3L4L A;  1G4Y R;  4IK5 A;  4W77 A;  3JTD C;  4NDD A;  4W6P A;  2GTE A;  4PDZ A;  4AS8 A;  4Z4K A;  3DQO A;  3O78 A;  3CBE A;  2WSO A;  3O2P A;  1B8R A;  3SV5 A;  3R72 A;  1GGZ A;  2BBN A;  3SSP A;  1AK8 A;  1MYW A;  4ORC B;  2Z1O A;  3WXA A;  5AAN A;  5HGE A;  5TNC A;  3D77 A;  4JWQ A;  4AQI A;  4YGD B;  3PSR A;  1X02 A;  3NSL A;  1Z2C B;  2M7N A;  3D76 A;  3DPZ A;  1HCJ A;  1OOJ A;  3CZ0 A;  3UG0 A;  3GB3 A;  4OQW A;  4DXO A;  3AI5 A;  3S0E A;  4N1F A;  3DQ9 A;  5CSJ A;  1W9Z A;  4AQJ A;  1S5G Z;  3EKJ A;  3OB1 B;  3ST4 A;  1EMK A;  2MLE C;  1RMM A;  2LC5 A;  2F2P A;  2LUX A;  3P28 A;  1TTX A;  1KK8 C;  2WHU A;  1XFU O;  3H4S E;  2KFH A;  1XK4 A;  2HPW A;  1H8B A;  1QYQ A;  1F55 A;  1EMC A;  4W7X A;  4W7A A;  5EL2 A;  2A52 B;  3LK1 A;  5BPJ A;  4W6J A;  3SS4 A;  1ZFS A;  1NCZ A;  4HRE E;  4XYN A;  2F3Z A;  1NP8 A;  3DQI A;  2CNP A;  1QTX A;  1QV0 A;  5CPV A;  3LF4 B;  3VRO A;  1DEK A;  5FVG A;  2MAZ A;  2AWM A;  1J1E A;  4ZIO A;  2PXW A;  3EK8 A;  2L98 A;  1JBA A;  4PPK A;  2QEH A;  2WND A;  3CZ1 A;  2COL B;  1CFP A;  2K7O A;  4PE7 A;  2KPH A;  1SPY A;  1CKK A;  1JUO A;  3TS5 B;  1LXF C;  2LHI A;  4PHJ A;  2WOS A;  2K7D A;  4J8A A;  2M1K B;  2QEO A;  2H8Q A;  2LLS A;  5H87 A;  3CGL A;  1EXR A;  1M39 A;  3LL8 B;  3AAK A;  4EN1 A;  4JKT A;  5ER4 X;  3I5G C;  2CT9 A;  3SG4 A;  3U8P A;  1M31 A;  1KYS A;  2C9J A;  5LTQ A;  1ZGO A;  3ST3 A;  3OP0 A;  1EME A;  3WLD A;  1A29 A;  3B6X A;  4ORB B;  3EVR A;  3WNX B;  1JSA A;  4AOM A;  4KGE A;  2O2B A;  2LMT A;  5DRF A;  4LJC A;  1TCO B;  3VHT A;  5EB7 A;  1KYP A;  2MJW B;  3BFH A;  1BG1 A;  1PVB A;  2AH8 A;  4P5O E;  2OJK A;  3OX5 A;  1F8H A;  3DQ4 A;  3SRY A;  5AFP A;  1YVH A;  2Q57 A;  3ADF A;  4KW4 A;  5EHU A;  1AJ4 A;  2QLH A;  4EDS A;  3LLE A;  3EVP A;  1Q4B A;  2KI6 C;  4W6O A;  2POX A;  3CS1 A;  2AHA A;  1CDN A;  3DQM A;  5AER A;  1BT6 A;  2HQW A;  3R1P A;  1AHR A;  2AWL A;  4W6G A;  2A54 B;  1FI5 A;  5KU1 A;  5EB6 A;  3SG5 A;  1YR5 A;  1B1G A;  4Z4M A;  3NGV A;  2M49 B;  3LVA A;  2LMV A;  1AP4 A;  4JD9 A;  3M0W A;  2RGI A;  3CZT X;  2IB6 A;  1UP5 A;  2ISD A;  3DQ1 A;  1IGV A;  3D78 A;  1DQE A;  5J3X A;  4KEX A;  3DPX A;  1OXE A;  1CFC A;  4W7F A;  3PFV A;  2H9W A;  1CNP A;  1DEL A;  4OVN F;  1KFX S;  1XAE A;  2QDI A;  2YDZ A;  2Q91 A;  4GBA A;  4M2Q A;  2VVJ A;  5DPH A;  3CDN A;  4ICB A;  3SS5 A;  4PHN A;  1GJY A;  3KCT A;  3R1V A;  2KGR A;  2ZNE A;  3RZS A;  1YFP A;  1J1D A;  1CB1 A;  4ZFS A;  1QAS A;  2MHH A;  2E30 A;  4TZG A;  1FPW A;  1ZGQ A;  2BNX A;  1B4C A;  2V4E C;  4HE4 A;  1XFW O;  4H3M A;  2DDD A;  3U8A A;  2NZ0 A;  2JOJ A;  2Z6X A;  3U0N A;  4L1I A;  2LVK A;  3GK1 A;  2HF5 A;  2KGB C;  5AXI A;  1W7J B;  1C3Y A;  2HQZ A;  3CGA A;  2I2R E;  3KHE A;  1GQM A;  1A75 B;  1YHH A;  4Q7U A;  3H1R A;  1F4O A;  2KYF A;  4XOW A;  1N0Y A;  4W6T A;  4YI9 A;  4DXI A;  4EMQ A;  3SG7 A;  4IK9 A;  2H5O A;  3SSL A;  1QJT A;  4IK1 A;  2KBM A;  2HPS A;  2BL0 C;  1TNX A;  1EMM A;  2C9I A;  4PAL A;  4IJ7 A;  2FJU B;  3SSH A;  3SVN A;  1EMF A;  4CPV A;  1BJF A;  1IH0 A;  2A50 B;  4KF5 C;  2ZN8 A;  1OOF A;  1SCM B;  1XFY O;  1QLS A;  2DUG A;  1QYF A;  3H1O A;  4KW8 A;  1SCM C;  2B1U A;  4WQ2 A;  4U2V A;  2JT8 A;  2PXS A;  1NCY A;  2LNK A;  3NEZ A;  2IS9 A;  1H4B A;  4W6H A;  1WRK A;  1BLQ A;  1S6I A;  2KI4 C;  2KAV A;  1LS8 A;  3I5F B;  4JRB A;  1OSA A;  3OSR A;  3UO9 A;  1FI6 A;  3MSE B;  1YRU B;  3AKB A;  2BAP A;  4HRH A;  3DQC A;  2VZX A;  1DJZ A;  1BR1 B;  2R2I A;  4W6M A;  3NSI A;  1LIN A;  4H3L A;  1KK7 Z;  1Y1X A;  2QPT A;  2SAS A;  3SG6 A;  3AKO A;  4PPL A;  4R6D A;  5DKQ A;  4Q7R A;  2HRS A;  1OXD A;  1QY3 A;  4P76 A;  1J7O A;  1XK4 C;  2WSN A;  1P28 A;  1SMG A;  1UHI A;  3B86 A;  2ARL A;  3SJS A;  2HGY A;  1SSE B;  3LSA A;  2FCE A;  4ORN A;  4YRU A;  1PSR A;  3LVD A; 
#chains in the Genus database with same CATH homology
 5T3I A;  4YGE B;  3BQ3 A;  4W7R A;  3O77 A;  1K9K A;  1XVJ A;  1H6R A;  4W6K A;  3NF0 A;  4N1G A;  5DKN A;  3LCP C;  2B3Q A;  2KQ6 A;  2JUL A;  4JC2 A;  2A53 B;  1OMR A;  2GX0 A;  3CTN A;  2OTB A;  5KSZ A;  4ZF3 A;  5K89 A;  3CR2 A;  2G16 B;  4A4B A;  5CSI A;  4JGE A;  2O29 A;  1FW4 A;  5CSF A;  3SG2 A;  1TNP A;  2EC6 C;  1LA0 A;  1RMP A;  1M63 B;  1QX7 A;  2H5R A;  2KAY A;  3P8U A;  4W6L A;  4GF6 B;  1A75 A;  1ZUZ A;  1PAL A;  2BKH B;  3TDU A;  2M9G A;  1WDC B;  4F0Z B;  2O24 A;  3DPW A;  4BY5 A;  1SL7 A;  1SR6 C;  1UHK A;  2K61 A;  4C0K A;  1RWY A;  4HRG A;  4YI8 A;  1Q4A A;  4W69 A;  1S36 A;  1ZUX A;  1KK7 Y;  1DMO A;  4KF5 A;  1YJF A;  1AJ5 A;  1KSO A;  1YX7 A;  2BKI B;  1CDL A;  3GL4 A;  3TUY C;  2LUC A;  2K2A A;  2WUR A;  4GGF A;  2JPT A;  3VRP A;  1DTL A;  4Q04 A;  1F09 A;  2KDH A;  4W6D A;  2HQK A;  4J89 A;  2GGZ A;  1R2U A;  4W72 A;  2OS8 B;  5JOL A;  1UIS A;  4DCK A;  1IWQ A;  1UWO A;  2OS8 C;  4P2Y B;  3K1K A;  2EGD A;  2QRF A;  3PN7 B;  1QLK A;  4ORA B;  2BTJ A;  1XA9 A;  3AKA A;  1ZAC A;  4LQU A;  1MWN A;  4HQC A;  3GK2 A;  1KQV A;  4GGN A;  3KCS A;  2AUC A;  1DGU A;  3FWC A;  1D1O A;  4B5Y A;  2QAC A;  2I18 A;  2KYC A;  5FHV A;  1RM9 A;  2M97 A;  3GJ1 A;  2G5Z B;  1S26 D;  1QX5 B;  4R1E A;  3EVV A;  2JXC A;  1B7T Z;  3A8S A;  2DDC A;  1UHJ A;  1J7R A;  2LVI A;  4LJD C;  2P6B B;  2JNF A;  1C7W A;  2NXQ A;  4LQT A;  4W74 A;  3E5W A;  2FCD A;  2ZMU A;  1YRT B;  5HZS A;  3ZUF A;  3DQU A;  3LS3 A;  4W6A A;  2LE9 B;  1JF0 A;  2ZO7 A;  2Y4Q A;  1YJ2 A;  3GOF A;  1W7T A;  2H5P A;  3TDZ A;  3ZTF A;  3LA1 A;  1WLZ A;  4PE4 A;  2QLE A;  1BOD A;  1SKT A;  2ICR A;  1BOC A;  3TS5 C;  2M3W A;  2ZN9 A;  2QLI A;  3VGO A;  1K9U A;  2H61 A;  4KPI A;  1NUB A;  1MUX A;  2M7L A;  4I5J A;  2QU1 A;  2JT3 A;  1NX1 A;  5FVF A;  3A4U B;  3CR5 X;  3JVT B;  5DPG A;  2JAD A;  3DQ7 A;  2MBX A;  1J7Q A;  3DQF A;  2ZMW A;  4DKM A;  3WLC A;  4ZBL A;  3DQK A;  4RTC A;  1FF1 A;  3BUN B;  2AMI A;  1HT9 A;  3NSK A;  1JFJ A;  3WCK A;  2ZFD A;  1YUT A;  4W6C A;  1JFK A;  3ZUJ A;  2YE0 A;  4DXQ A;  4H47 A;  2FWQ A;  2LAP A;  4BY4 A;  5DTZ A;  1F70 A;  1B7T Y;  3O6B A;  1L7Z A;  1BU3 A;  2AAO A;  4GOB A;  4W7C A;  5JJG A;  1IG5 A;  2KBI A;  2F33 A;  3G9A A;  3PJB A;  2LLT A;  3U0L A;  4HVF A;  1JBY A;  3DF0 B;  3NT9 A;  3BYA A;  2DOQ A;  2G2S B;  1SCV A;  2F8P A;  1ZGP A;  3SVC A;  4DKN A;  3KPX A;  4C0J A;  5HLO A;  1BFP A;  2F3Y A;  1KQM B;  3CLN A;  3SVR A;  3EKH A;  5HKZ A;  3I19 A;  2KI6 D;  1Y6W A;  1CTR A;  4ZF4 A;  5DKR A;  2VVI A;  2Q6P A;  3ST0 A;  2RH7 A;  1K8U A;  2LVJ A;  2JQ6 A;  5HZU A;  2LVV A;  2WHS A;  4C0L A;  1NCX A;  4H48 A;  4W76 A;  4LJD A;  1DGV A;  3A8R A;  3SS0 A;  5ER5 A;  1EL4 A;  3U0K A;  3SST A;  2JZI A;  4W6N A;  4IK3 A;  1S6Z A;  1WLM A;  1EMB A;  3BXK A;  2SCP A;  3TDI A;  3OSQ A;  3EVU A;  1IQ5 A;  1CDM A;  1N65 A;  3PJ7 A;  2DUI A;  3DQL A;  2HJO A;  4XJK B;  1CDP A;  1NIW A;  2L0P A;  1RK9 A;  3UFZ A;  5F6T A;  4NQG A;  2LMU A;  2OTG B;  4KAG A;  4YGA A;  2HCG A;  4HQ8 A;  2AWJ A;  1QXP A;  3FIA A;  1SL8 A;  5BTT B;  5LTP A;  1TNW A;  2OTG C;  2KAX A;  4RYS A;  4OGS A;  2L5X B;  4ZCV A;  4W6B A;  1YVL A;  1IKU A;  4USL A;  3S05 A;  3V3D A;  4LJB A;  2LV7 A;  3U0M A;  5HKW A;  4IK8 A;  3BXB A;  3CWG A;  5IBW A;  1VRK A;  2CBL A;  4MN0 A;  3BUW B;  3C1V A;  3SIA A;  4H3N A;  1A4P A;  4W7D A;  3PIB A;  1B9C A;  3TMR A;  4W6S A;  1Q73 A;  3FWB A;  1QVI Y;  2M8U A;  5LTR A;  1BMO A;  1EG4 A;  2EMO A;  1B8L A;  2K2F A;  4MZL A;  1NYA A;  1ALW A;  5DTL A;  2VRG A;  5EJU A;  3DQE A;  4GGF C;  3NSO A;  2BBM A;  3DD4 A;  3I5I B;  1OMD A;  4NWS A;  3FS7 A;  3BOW B;  4XL5 A;  2NCO A;  1TNQ A;  3DF0 A;  3M22 A;  4KF4 A;  1OE9 B;  2IOV A;  5DY6 A;  2F2O A;  4PCW A;  2BCX A;  1W7I B;  3DQ3 A;  3DVJ A;  5FVI A;  3I5F C;  4NDC A;  4ETO A;  2EMD A;  2PAS A;  2GW3 A;  4MVF A;  1K94 A;  2JU0 A;  1REC A;  5I8N A;  1YUR A;  2A48 A;  4OCI A;  2K7B A;  4MEW A;  4HQ9 A;  2LM5 A;  3CFF A;  4MSP A;  4U8D A;  5GQQ C;  3BXC A;  2O5G A;  1N2D A;  3CR4 X;  3AAJ A;  5HLV A;  3DQA A;  2ZRT A;  1Q4C A;  4I5L B;  5I2L A;  2D8N A;  1QIW A;  1TIZ A;  4QJ4 B;  4XGY A;  5AQB B;  2JT0 A;  3BUX B;  5H89 A;  4KGF A;  4UPG A;  1QXT A;  2IE2 A;  3ZWH A;  1DJH A;  1QAT A;  2MA2 A;  1GFL A;  3E3R A;  4OR9 B;  1SY9 A;  1XFZ O;  5DU0 A;  1XFX O;  4GUK A;  1Z1Q A;  1LA3 A;  4XJK A;  2MLF C;  1EMG A;  2JTZ A;  4CFR A;  1S1E A;  3VRN A;  2G3D B;  1M46 A;  2PAL A;  3LVC A;  5BTT A;  4D1E A;  1IRJ A;  1C4F A;  4CFQ A;  4PPJ A;  5I2O A;  2A4J A;  1LKJ A;  3DQH A;  2NCP A;  3ZNI A;  2GV5 A;  1JF2 A;  2H61 C;  4P1Q A;  5D69 A;  2BE4 A;  1CMF A;  3GK4 X;  2OKY A;  5HBD A;  2LCP A;  1M45 A;  1NSH A;  4B30 B;  1RMO A;  1WDC C;  5FYX A;  3SG3 A;  4IZN A;  1L2O B;  1XSS A;  1MQ1 A;  1G8I A;  1SNL A;  4FQO A;  1ZMZ A;  3D0Y B;  5KTG A;  1R6P A;  2EHB A;  1KWO B;  1GGX A;  1F4Q A;  1TN4 A;  2KQY A;  3JTD B;  1MF8 B;  1RRO A;  2QLG A;  5J2O A;  1K90 D;  1MOU A;  3DQ2 A;  3SIB A;  4I5K A;  1H4U A;  3LF3 A;  4DXM A;  2PSR A;  2DD9 A;  3BOW A;  2Y1N A;  1DVI A;  4UTS A;  4KW9 A;  2PRU A;  1NX3 A;  1Q80 A;  2GGM A;  4CID A;  5DQB A;  1CM4 A;  3HCM A;  3PN7 C;  1ALV A;  4JF9 A;  1CLM A;  1MXE A;  5EXB A;  1K9P A;  4MRX A;  1C07 A;  2VAE A;  2H2K A;  1DF0 B;  1UHN A;  1QX2 A;  3TZ1 A;  2YFP A;  2HQ8 A;  1Y1U A;  5F9G A;  2A46 A;  1Q4D A;  1U5I B;  1G33 A;  2A56 B;  2OPO A;  1KK8 B;  4MRY A;  4N3D A;  1JWD A;  2WIQ A;  1S6J A;  2EMN A;  1Z1P A;  3DQ5 A;  2QZ0 A;  4W73 A;  3VRR A;  1XYD A;  2VAD A;  5DPJ A;  1KP5 A;  2LHL A;  4I5N B;  3VK1 A;  4J88 A;  2Y1M A;  2E6W A;  2G6E A;  2LP2 A;  4MBE A;  3SVB A;  1DJI A;  4OY4 A;  3U8C A;  2HGD A;  4WRI A;  1HQV A;  5PAL A;  1WRZ A;  1GL4 A;  1V1G A;  2WCB A;  3OGO A;  1B47 A;  5AEQ A;  4ZF5 A;  2G6Y A;  2K7C A;  3CFH A;  1QYO A;  4L13 A;  3K21 A;  2DUE A;  1QV1 A;  4E68 A;  2AWK A;  4EDO A;  3RWA A;  1PSB A;  2G2B A;  3CB9 A;  2L51 A;  4JFG A;  4QJ3 B;  5HZO A;  2KNE A;  1CFF A;  1KSM A;  3DQD A;  1KFU L;  2V53 A;  3HX4 A;  4EUL A;  2G9B A;  2M0R A;  3QRX A;  2Q4U A;  3PAL A;  2BEC A;  3CD9 A;  3IR8 A;  1J55 A;  3BUM B;  5I2Q A;  3JVT C;  4W6I A;  1NX0 A;  1OZO A;  3I5G B;  4OV2 A;  3RLZ A;  4B30 A;  1AUI B;  5KTY A;  4BDU A;  3NT3 A;  3DQN A;  1SBJ A;  3OX6 A;  2KHN A;  4PFE A;  3EK7 A;  4NDB A;  1S5G Y;  2YE1 A;  4I2Y A;  2HET A;  5BT0 A;  2O60 A;  3D0Y A;  1YHG A;  1SL9 A;  4ZIN A;  3SSK A;  2A47 A;  1DJG A;  1CM1 A;  3OB2 B;  2K8M B;  4DXN A;  1DJY A;  4DUQ A;  1EH2 A;  3ST2 A;  1CFD A;  2MRD A;  1QS7 A;  2CTN A;  2JTT A;  3W1D A;  1IJ5 A;  1SYM A;  3DVE A;  1YUU A;  4W6R A;  2H5Q A;  5HKY A;  4W6U A;  4CLN A;  1K93 D;  4TZA A;  1OZS A;  4GNK B;  2GX2 A;  2OTE A;  1C7V A;  1MXL C;  5HZT A;  1EMA A;  4ANJ A;  1XO5 A;  3VRQ A;  2ZKM X;  4W6F A;  1NWD A;  4DS7 A;  2L4H A;  1W7S A;  2WIS A;  2I7A A;  1YTZ C;  1F71 A;  1QVI Z;  2I94 A;  4QJ5 B;  4Q9W A;  1DF0 A;  3PAT A;  1KQM C;  3SVE A;  4PE0 A;  2KFF A;  1PUL A;  1K2H A;  1U5I A;  2CCM A;  1ZOT B;  1Y0V H;  2WCE A;  4HSZ A;  4IK4 A;  1MR8 A;  3NXA A;  1AVS A;  4L12 A;  2Y5I A;  1A2X A;  5HYD A;  3E5V A;  3M24 A;  1F0B A;  2DUF A;  1JC0 A;  3NED A;  4PHM A;  3EK4 A;  2ZRS A;  1MHO A;  2H6V A;  3ED8 A;  1EML A;  2G6X A;  3AI4 A;  4ZCU A;  3SSY A;  4ZB1 A;  2L4I A;  2ZND A;  2NLN A;  1JC1 A;  1FBV A;  4PE1 A;  3O4Y A;  3KEV A;  2V4E B;  2PVB A;  1IQ3 A;  2OGR A;  4L9M A;  4YBH B;  2L2E A;  4W75 A;  1B9A A;  2OKW A;  4GES B;  1F54 A;  4R6B A;  1EJ3 A;  1GGW A;  3MGF A;  2FL1 A;  2LAN A;  3WHT B;  3I5H B;  1XMZ A;  1DJX A;  1YZW A;  4M2O A;  5DPI A;  1XQM A;  5BQL A;  4JEO A;  3I5H C;  1B8C A;  3CFA A;  5DRG A;  1BR4 B;  2WCF A;  2Z6Y A;  3VIC A;  2QT2 A;  3DVM A;  1PVA A;  3IP2 A;  4OJ0 A;  2KOT A;  4XVP A;  2HFC A;  2BL0 B;  4JPZ B;  2WC8 A;  1Y1A A;  1WY9 A;  4DXP A;  3DQ6 A;  4N5X A;  5H88 A;  2JXL A;  3BXA A;  1YUS A;  3KF9 A;  1TOP A;  4WQ3 A;  3SVU A;  1G7K A;  2QLG B;  1CMG A;  1RJV A;  3PLF B;  4IL1 A;  4PHK A;  2JRF A;  1EG3 A;  1CV7 A;  4LW5 A;  4Q7T A;  3TMT A;  3SVO A;  3I5I C;  4MZK A;  3ZUL A;  5G08 A;  1OXF A;  1BF5 A;  2DUH A;  3GJ2 A;  2BCB A;  4Q9X A;  1UUS A;  4XOV A;  5CSN A;  3SSV A;  2VVH A;  2KI4 B;  5B8I B;  1YHI A;  5DQM A;  2M29 A;  1PRW A;  4AR7 A;  1CLB A;  1UHH A;  1TCF A;  3DQJ A;  4GPL B;  1RRX A;  2WHT A;  4TNC A;  1NPQ A;  1CLL A;  3F45 A;  3SVS A;  3ICB A;  3DQ8 A;  3PJ5 A;  4DIR A;  1QIV A;  2Z6Z A;  1V1F A;  4GFT A;  1S3P A;  1S6C A;  3CD1 A;  2IB5 A;  1W7U A;  2GW4 B;  5EXU A;  1A03 A;  4OKH A;  1KFU S;  1XA5 A;  2BE6 A;  2LLU A;  2FZU A;  3IQQ A;  4A4C A;  1SRA A;  3D10 A;  1RTP 1;  4DRW A;  2Y0G A;  1WRL A;  1ODB A;  1SK6 D;  2K0J A;  1Q4E A;  3WHU B;  4GAO A;  1JBZ A;  2DD7 A;  2WOR A;  1NX2 A;  1DJW A;  1YX8 A;  1SW8 A;  3PM8 A;  2JWW A;  1J7P A;  3IF7 A;  2LP3 A;  4MLW A;  1TRF A;  5EBJ A;  1HUY A;  4OHS A;  1XFV O;  2V4E A;  2KFG A;  3BX9 A;  5EXC I;  5DTX A;  5DTY A;  3LK0 A;  4YGB B;  1K95 A;  2EC6 B;  1JC2 A;  3E5T A;  1E8A A;  1UUR A;  3DVK A;  4JQ0 D;  4M2P A;  2KSP A;  3BUO B;  1MOV A;  5HW9 A;  1KFX L;  1IJ6 A;  3OHM B;  1RFJ A;  2TN4 A;  2JNX A;  3SVD A;  1OQP A;  2CXJ A;  2BCA A;  2B3P A;  3KO0 A;  5D7F A;  4FTG A;  3RWT A;  1SR6 B;  1L2O C;  1DT7 B;  1KYR A;  1K96 A;  2G3O A;  4RYW A;  4MZJ A;  1LVC D;  3GEX A;  2L50 A;  1KCY A;  5LK4 A;  1PK0 D;  3VHT B;  2M1U A;  1OMV A;  3TUY B;  2FOT A;  4KA9 A;  2PMY A;  4W7E A;  2JC2 A;  2ZO6 A;  2P4M A;  3IQO A;  3RM1 A;  1KWO C;  3W1C A;  4YGC B;  1G4Y R;  4IK5 A;  4W77 A;  3JTD C;  4NDD A;  4W6P A;  4PDZ A;  4AS8 A;  4Z4K A;  3DQO A;  3O78 A;  3CBE A;  2WSO A;  3O2P A;  1B8R A;  3SV5 A;  1GGZ A;  2BBN A;  3SSP A;  1AK8 A;  1MYW A;  4ORC B;  2Z1O A;  3WXA A;  5AAN A;  5HGE A;  5TNC A;  4JWQ A;  4AQI A;  4YGD B;  3PSR A;  1X02 A;  3NSL A;  2M7N A;  3DPZ A;  1HCJ A;  1OOJ A;  3UG0 A;  3GB3 A;  4OQW A;  4DXO A;  3AI5 A;  4N1F A;  3DQ9 A;  5CSJ A;  4AQJ A;  1S5G Z;  3EKJ A;  3OB1 B;  3ST4 A;  1EMK A;  2MLE C;  1RMM A;  2LC5 A;  2F2P A;  2LUX A;  3P28 A;  1TTX A;  1KK8 C;  2WHU A;  1XFU O;  3H4S E;  2KFH A;  1XK4 A;  2HPW A;  1H8B A;  1QYQ A;  1F55 A;  1EMC A;  4W7X A;  4W7A A;  2A52 B;  3LK1 A;  5BPJ A;  4W6J A;  1ZFS A;  1NCZ A;  4HRE E;  4XYN A;  2F3Z A;  1NP8 A;  3DQI A;  2CNP A;  1QTX A;  1QV0 A;  5CPV A;  3LF4 B;  3VRO A;  5FVG A;  2MAZ A;  2AWM A;  1J1E A;  4ZIO A;  2PXW A;  3EK8 A;  2L98 A;  1JBA A;  4PPK A;  2WND A;  2COL B;  1CFP A;  2K7O A;  4PE7 A;  1SPY A;  1CKK A;  1JUO A;  3TS5 B;  1LXF C;  2LHI A;  4PHJ A;  2WOS A;  2K7D A;  4J8A A;  2M1K B;  2H8Q A;  2LLS A;  5H87 A;  3CGL A;  1EXR A;  1M39 A;  3LL8 B;  3AAK A;  4EN1 A;  5ER4 X;  3I5G C;  2CT9 A;  3SG4 A;  3U8P A;  1M31 A;  1KYS A;  2C9J A;  5LTQ A;  1ZGO A;  3ST3 A;  3OP0 A;  1EME A;  3WLD A;  1A29 A;  4ORB B;  3EVR A;  3WNX B;  1JSA A;  4AOM A;  4KGE A;  2O2B A;  2LMT A;  5DRF A;  4LJC A;  1TCO B;  3VHT A;  5EB7 A;  1KYP A;  2MJW B;  1BG1 A;  1PVB A;  2AH8 A;  4P5O E;  2OJK A;  3OX5 A;  1F8H A;  3DQ4 A;  3SRY A;  5AFP A;  1YVH A;  2Q57 A;  3ADF A;  4KW4 A;  5EHU A;  1AJ4 A;  2QLH A;  4EDS A;  3LLE A;  3EVP A;  1Q4B A;  2KI6 C;  4W6O A;  2POX A;  3CS1 A;  2AHA A;  1CDN A;  3DQM A;  5AER A;  1BT6 A;  2HQW A;  1AHR A;  2AWL A;  4W6G A;  2A54 B;  1FI5 A;  5KU1 A;  5EB6 A;  3SG5 A;  1YR5 A;  1B1G A;  4Z4M A;  2M49 B;  3LVA A;  2LMV A;  1AP4 A;  3M0W A;  2RGI A;  3CZT X;  2IB6 A;  1UP5 A;  2ISD A;  3DQ1 A;  1IGV A;  5J3X A;  4KEX A;  3DPX A;  1OXE A;  1CFC A;  4W7F A;  3PFV A;  2H9W A;  1CNP A;  4OVN F;  1KFX S;  1XAE A;  2YDZ A;  2Q91 A;  4GBA A;  4M2Q A;  2VVJ A;  5DPH A;  4ICB A;  4PHN A;  1GJY A;  3KCT A;  2KGR A;  2ZNE A;  1YFP A;  1J1D A;  1CB1 A;  4ZFS A;  1QAS A;  2MHH A;  2E30 A;  4TZG A;  1FPW A;  1ZGQ A;  1B4C A;  2V4E C;  4HE4 A;  1XFW O;  4H3M A;  2DDD A;  3U8A A;  2NZ0 A;  2JOJ A;  2Z6X A;  3U0N A;  4L1I A;  2LVK A;  3GK1 A;  2HF5 A;  2KGB C;  5AXI A;  1W7J B;  2HQZ A;  3CGA A;  2I2R E;  3KHE A;  1GQM A;  1A75 B;  1YHH A;  4Q7U A;  3H1R A;  1F4O A;  2KYF A;  4XOW A;  1N0Y A;  4W6T A;  4YI9 A;  4DXI A;  4EMQ A;  3SG7 A;  4IK9 A;  2H5O A;  3SSL A;  1QJT A;  4IK1 A;  2KBM A;  2HPS A;  2BL0 C;  1TNX A;  1EMM A;  2C9I A;  4PAL A;  2FJU B;  3SSH A;  3SVN A;  1EMF A;  4CPV A;  1BJF A;  1IH0 A;  2A50 B;  4KF5 C;  2ZN8 A;  1SCM B;  1XFY O;  1QLS A;  2DUG A;  1QYF A;  3H1O A;  4KW8 A;  1SCM C;  2B1U A;  4WQ2 A;  4U2V A;  2JT8 A;  2PXS A;  1NCY A;  2LNK A;  3NEZ A;  2IS9 A;  1H4B A;  4W6H A;  1WRK A;  1BLQ A;  1S6I A;  2KI4 C;  2KAV A;  3I5F B;  4JRB A;  1OSA A;  3OSR A;  1FI6 A;  3MSE B;  1YRU B;  3AKB A;  3DQC A;  4HRH A;  2VZX A;  1DJZ A;  1BR1 B;  2R2I A;  4W6M A;  3NSI A;  1LIN A;  4H3L A;  1KK7 Z;  1Y1X A;  2QPT A;  2SAS A;  3SG6 A;  3AKO A;  4PPL A;  4R6D A;  5DKQ A;  4Q7R A;  2HRS A;  1OXD A;  1QY3 A;  4P76 A;  1J7O A;  1XK4 C;  2WSN A;  1SMG A;  1UHI A;  2ARL A;  3SJS A;  2HGY A;  3LSA A;  2FCE A;  4ORN A;  4YRU A;  1PSR A;  3LVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...