3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, transcription
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
2CKHB 4Z4MA 5T3IA 4KW9A 2H5PA 3VDZA 3B0AA 4GB9A 5EXCI 3VFKA 4WAAA 3U0KA 4IC7B 4H48A 2KNBA 2RPQA 3HK0A 1P98A 5DPHA 3NHEB 3SSKA 3SSTA 2HFCA 1P3QU 1WMHA 4HVBA 3ONSA 1S3SG 2BKFA 5DPGA 3AKOA 3TL5A 3SVRA 2L05A 3ZTFA 1RLFA 3CSTA 1NI2A 4W6FA 4KZ0A 1Q4DA 2V1YA 1OQYA 4HJKA 5EBJA 1E90A 2L00B 2V4EC 2A52B 4K1RB 3DDCB 4MGKE 3SVEA 1Y8RC 3ENEA 4I6LB 2QU1A 4N9F4 5L83A 2ZCCA 4ZIOA 2KMCA 1UH6A 4J8AA 2H8QA 4F1SA 2IY0B 1WGYA 3E5VA 4EOYA 3I19A 1ZGQA 4PFEA 4ANUA 2HJOA 5KHOA 2WWZA 3PJBA 3WLDA 4GDLB 4ZB1A 3DQJA 4W6KA 5AQBB 2I1KA 4PPLA 1YHIA 4KGFA 1QZEA 1YX6B 4ANXA 3DQ3A 4IM0A 4HE4A 4DKMA 2QHOA 3GL4A 3SV5A 4OY4A 4GIVA 1OGWA 4W7AA 2GX0A 1KP5A 3QARA 2I1JA 1WX8A 5DPRA 2M4NA 2PE9A 2N7EA 3RD2A 1Q4EA 3NY5A 3V62A 3H1RA 4EN1A 2C9IA 2N7DA 2PXWA 5HGEA 4ANWA 4AJYB 5DPJA 2DZKA 4W6JA 4Q7UA 3QC8B 2MRPA 3RCZA 2DAJA 1ZGPA 3PLVA 4WJNA 4ZYNA 3DOWA 4W9HA 1E8YA 4FJVB 1WE6A 1EMKA 1XD3B 2PJHA 3OLMD 4W72A 3B1LX 1XQQA 2EMDA 2LXCA 1E5WA 2ICRA 4WWNA 3LVAA 3KYCD 3PJ7A 2JPHA 3DBHI 3L16A 1UBIA 2FL1A 5HBDA 1XSSA 3I3TB 5FR6A 5J2OA 3RULA 3DQ8A 4B5YA 3ZRFA 3TJPA 3HM6X 4DXAB 2IBIB 1EMEA 4DXNA 4GOBA 2H5OA 3EK7A 3KUZA 4Q9WA 1WYWB 4Q9XA 4KV2A 1WY8A 4TUUA 3QAQA 2ZMWA 2J7QB 4XL5A 4LJDA 3IG3A 3A1QA 5H89A 2KWCA 4IM2A 2DAFA 3PHWB 2CR5A 2K8BA 4LDTD 3A9JB 1XQMA 4Q7RA 2OGRA 3WANA 2LXAA 4IUMB 4G0NB 2GBJA 3DPDA 3KUDB 2KDIA 3PTFC 1L2NA 4KZCA 4MSQB 4HCPB 1E7UA 3T9LA 2B3PA 1E7VA 4IG7B 1WGRA 2EKEC 5BO4B 1V81A 2M8SA 4CO7A 2FZUA 4KA9A 2N9XA 2GBKA 3N30A 2KFKB 1NDDA 4IK5A 2B3QA 2UWQA 1UZXB 3U30A 3SG6A 3KCTA 4HDOA 1EMAA 4L12A 3JSVA 1OXDA 4TQ1A 1RMPA 2G2SB 3VUXA 3UG0A 1RFAA 3N32A 5CTRC 2C9JA 1WR1A 4IWOA 5EXUA 1KYRA 1EO6A 2KD0A 3M24A 3ZKJC 4W6UA 1MG8A 2GX2A 2J0MA 3ZNZB 3ADFA 1WMHB 3VXWA 2V4LA 4W6DA 1X1MA 3WCKA 3AI4A 3R7RA 4CYEA 4DXMA 2NPTA 1YHGA 2KDEB 2Z0DB 1V80A 1UISA 2NCNA 2REXA 2QRFA 2JRHA 4PS7A 4W6HA 2FNJB 4NAWA 2PEAA 2AH8A 1QY3A 3DPWA 5LLIA 1BT0A 4ZRJA 4AS8A 4W77A 2LGXA 2JVCA 4ZFSA 3VVWB 3QQ8B 2J0JA 3CMMB 4ASWC 2LVOA 2DUEA 4NY0A 4MELA 4JEOA 3BINA 1KM7A 1UGMA 3CFAA 1HE8A 1OEYJ 2D07B 3LSAA 3ZNHB 4W9IA 4B95A 4W74A 2RD0A 3ST3A 3DQOA 4FHKA 2D2QA 3EVPA 5HW9A 2OTBA 2V3SA 5DQBA 2IYDB 1WJUA 5HZUA 2G6YA 1JBZA 2ZPNA 1UBQA 2GBRA 3V3DA 2N1WA 3ST4A 2WHTA 3V61A 2K8HA 2Q57A 1HCJA 4DKNA 5KTGA 1YX5B 3SD5A 4LJBA 2MBBB 2DYOA 4TKNA 4X57B 1YZWA 2DENB 2WX1A 2H5RA 3JYUA 3PJ5A 3EKJA 4NQKE 2KO3A 2AWTA 2AWLA 3JW0X 3AULA 3DQFA 4ZRIA 1V49A 5IA7A 4L13A 4TQ0A 2FIFA 1CMXB 3CSFA 4LCDE 4L1IA 2WISA 4W7RA 2G5ZB 4IK1A 2LVQA 2K6DB 1RMOA 2L0TA 4KW4A 2ZCBA 3KH0A 2DUFA 2DX5B 2JT4B 1WH3A 3DBRI 1W7TA 1WIAA 4E3CA 3U0NA 4BKSA 4FJYA 4R6BA 2WIQA 5E6OA 2KDBA 3JVZX 1VCBA 4LDTB 1WX9A 4PS3A 4A3OA 1Z2MA 2OJKA 2KTFA 2GMIC 5DRGA 4WWPA 2VAEA 1WZ3A 3UINB 4BDUA 3KUCB 2KJRA 1IYFA 3OJ3A 3PS6A 5C1ZA 2N4FA 4W6CA 4MGYE 1YJFA 5AZHA 2O6VA 4BKSD 3U7DA 3V6CB 3A1QB 3WALA 5HZOA 4W9DA 5LTRA 3MHSD 3U0LA 4LW5A 2L0FA 2KLCA 3DQ9A 2KX3A 1J0GA 3DBSA 1XA9A 2CHWA 3RZFA 3VTUA 1WM2A 2WYQA 4WJPA 1GG3A 1F9JA 2KX0A 4ZBLA 4JGEA 3PRMB 4RM8A 3U0MA 2BKRB 2FCSA 4II3B 3L13A 3V60A 3ZTDA 4FBJB 3PIBA 4OHSA 5DTLA 2BPSA 4HQ9A 1RRXA 2DD7A 1GC7A 4BBNC 2G45B 3JSVB 3G9AA 2IO0B 2NBWB 5E6NA 1YQBA 3IBEA 2HPWA 3RWAA 4W6OA 1JC0A 4J89A 2IZVB 4XX5A 4W6MA 5EJUA 3KCSA 2DZMA 1C1YB 2A46A 2A50B 1KYPA 3GJ1A 3SVUA 2HQZA 2MBHA 2OKYA 3SVCA 3K9OB 1V5TA 4KF5C 2QZ0A 3SVBA 1WGGA 3EK4A 2HE7A 4W76A 5BTTA 1LXDA 3PVLA 1H8CA 4DHJB 1GL4A 2KXJA 2NPTB 3UGBB 3EC8A 2JZZA 5G55A 2YLMA 2K8CA 3AU4A 2HGYA 4BVUC 3BX9A 5KHQA 4NAWB 1EF5A 3SDLC 3IP2A 2G16B 2K39A 3IHPC 5BT0A 3M3JA 1KYSA 3SSVA 5HZTA 1L7YA 4FLHA 5EHUA 3PRPB 4B30A 5G2NA 3GOEA 3QK0A 4EZLA 2AHAA 1QYOA 3ALBA 2RGFA 1IP9A 5FVFA 1R4NI 4AWJA 1ZW7A 3D32A 1V5OA 1WXAA 1E8ZA 1E8XA 2EMNA 4M8MA 2M1MA 3PREA 3UF8A 3W1SC 1KLVA 2KKCA 3SU8X 4M8NA 1IPGA 4HPMB 3A4RA 2DUIA 3WLCA 2BYFA 4EDSA 2YE0A 2FAZA 1WRDB 3W1CA 2IY1B 3DQUA 2B3AA 3X0WA 2KQ7A 1P0RA 1J8CA 3SG2A 3H7SA 4ZF4A 3U8PA 2HD5B 1RM9A 4AUQC 2KMAA 4IK9A 1UD7A 2BGFA 5EXBA 5EB6A 1I42A 1WR6E 3IVFA 3ZNID 3SS0A 2H5QA 1H4UA 3NZUA 2QLGA 3QWZB 1TZ1A 4XGYA 2Z6ZA 4W6BA 2G6EA 5DPWA 4EKUA 1H6RA 4PYUA 1EUVB 2RR9A 2A4ZA 4KDIC 4YL8A 4EFOA 1FXTB 3ECIA 2QT2A 2L8JA 2MWSB 2KANA 3ZUJA 4URKA 3SG7A 4AR7A 3GB3A 1EMBA 4HLEA 4PS8A 1A5RA 3EFUA 1P9DU 2MCNB 2MX2A 3H1UA 3VQIA 5EDSA 5TR5A 2P4MA 4W9KA 2G3DB 3QIJA 4JL9A 2G4DB 4XC2A 4AP4C 3LVCA 4ANJA 3H7PA 2DZIA 3DCGA 2KLGA 4IZNA 3TIXA 1P1AA 4KW8A 3ZULA 1WM3A 4DDID 2AWJA 2MLBA 1WE7A 2JY6A 3A33B 3VICA 2BTJA 2IB6A 3VHTA 2N9PC 2Z0EB 2O6VB 3VH3B 3L10B 3BXCA 4W9CA 4JF9A 4MJSA 3ML9A 4BKTA 1B9CA 3U8ZA 1GJZA 4DXQA 3CFHA 2KN5A 1D3ZA 5HKHA 5IAAC 2KK8A 4NNJB 2MBQA 4W6PA 1ZKHA 1TTNA 1Q4BA 4EULA 4KDLB 3PV1A 3A9KA 1MOVA 2CHZA 4JGHB 4RYWA 1SGHA 4WJQA 3O65B 3A8SA 3DQ4A 1GUAB 3SG4A 3LF3A 3LVDA 3CFFA 4DXOA 2A5UA 3NZSA 1TBEA 3SVSA 4W9LA 2PPHA 1Q5WB 1RAXA 2UYZB 1OTRB 2EMTA 4W69A 2FCMA 4F8CB 3BY4B 2KTRA 2IO3B 3VAWA 3VUYA 3L0WB 5D6JB 4FJZA 5BTTB 2L7RA 4G11A 4DK5A 3NOBA 3RZWC 4JFGA 3EHVA 4IWPA 3PPAA 2V4EA 4Z4KA 3W1YA 3DBLI 4KF5A 3VTWA 4ZRKA 5DCNA 2FCQA 4IW0A 4DHJD 2HTHA 3PHXB 4OQWA 2JZ3B 3QCAA 5L95C 5J2RA 2KOXA 1EMLA 3K9PB 3S05A 2A54B 5D2MB 4KVGB 4NQLB 5JHAA 4PPKA 3E5TA 3MTNB 4B30B 3A4SC 4B9KA 3QA8A 4HQCA 4LJOB 2MBOA 2WHUA 2YVCA 2ZO6A 3OJ4B 2Y5BB 3Q3JA 2Z1OA 4W6GA 4MSMB 4A3PA 2WSNA 4H3NA 1QYFA 1SE9A 3TBLD 2C9WB 4ZF3A 4AOFA 1QYQA 2HJ8A 4BKGA 5CX3A 3UIOB 2OOBB 1AARA 4GDKA 3TMTA 2HRSA 4II2B 3CBEA 5AEKB 2DDDA 2LI5A 2JWZA 2ZJDA 2CU1A 2VVJA 2WHSA 4KPIA 2A47A 1ISNA 2LRUA 3R3MA 4DXIA 2KQSA 3SRYA 4W7XA 2J0KA 3R7QA 2MQJA 3ZLZA 3NT9A 1JRUA 4J88A 3DVGY 3PSEB 1GGXA 2XK5A 1WZ0A 3WAMA 2ZNVC 4OVUA 1XAEA 3TCAA 3T8MA 4HK2A 3M95A 4I6NB 2GOWA 4KIKA 2ZZPB 2FIDA 2EMOA 2QLGB 3L08A 2KWVB 3V6EB 4FADA 4GMVA 5DPSA 2Z59B 3VK1A 2OTEA 4H3MA 3P2BA 1PQSA 3KW5B 3DPZA 4DXPA 2NBUA 4I2YA 3L17A 2FCNA 2PE6B 2MP2A 4MDKE 1W7SA 5D94A 5E6PA 3PGEA 2VRRB 5F9GA 1XT9B 4LJDC 2L76A 3ST0A 2DUHA 2N9EB 2ZVOA 4R6DA 1RMMA 3RYTA 3OGOA 2PXSA 3ZVVA 2D11A 5H87A 3LDZE 3CF6E 2DYBA 2O29A 1YJ1A 2VZXA 3KVFB 2AEHA 2K6QA 3RWTA 4W6RA 5DY6A 4KSKC 2GBMA 4K7UA 3VTVA 3H6NA 5DTYA 3GEXA 1EMGA 3H7PB 3DQ5A 1R4MI 5AZGA 4GSWA 3DQCA 3LS3A 4DHZE 1GC6A 4KAGA 4EMQA 3VHTB 1MYWA 2LWPA 4GESB 1WXVA 2KWUB 3ZUNA 4MJSB 2R2OA 3LJ3A 2WDTB 3DQ6A 2YE1A 3IR8A 1W7UA 3MJWA 5CHVC 2M17A 4H47A 2MSED 2O6VD 1EF1A 1V6EA 1GFLA 3BXAA 2IO2B 1C4FA 2DZJA 2ZO7A 3LF4B 2N1VA 1NBFC 2D10A 4F7ZA 1Z1QA 3SVOA 1WF9A 4CHKA 2A48A 2C5LC 3DQMA 4NWSA 1UELA 3A9KB 3X23A 2IO1B 1G7KA 3NT3A 3HHMA 2DYMA 1F09A 4W6IA 2KDFB 3TMRA 4RMAA 2MA9B 4B6WA 2D3GA 4OJ0A 3AXCA 2RH7A 2VVIA 2O24A 1EMMA 1BFPA 4W73A 3QX1A 3SSHA 2A53B 1Q0WB 4ZDVA 1XMZA 3H1OA 2LRWA 3MGFA 1ZGUB 1WX7A 2ARLA 1OXFA 3PZDA 4DBGA 2VADA 2KTRB 4GN1A 2JUOA 2AWMA 1HUYA 4MGIE 2KZRA 2V4EB 2LASA 3WIMA 2XEWA 5LXIB 4RM9A 4JRBA 1EMCA 3QHTA 3CGLA 1F0BA 2POXA 3U8AA 3L54A 3QJZA 3H9DA 2LZ6A 3CD1A 4MH0E 2ZVNA 1YHHA 4W7CA 3WA0A 4I6PA 3DPXA 4K7SA 1LQBA 1WGHA 1YD8U 5CHFA 4EZJA 2Y0GA 3B08A 3PRZA 2O2VA 4LQUA 2OJRA 4HQ8A 3EK8A 1V9JA 2Z6YA 2BWES 3SVDA 2K25A 3M62B 3DQNA 2YFPA 2OKWA 1U4AA 1YFPA 3Q3FA 2LJ5A 2KHWB 2FWQA 3DVNV 2AL3A 4U2VA 2KC2A 1JBYA 3ZUFA 3APDA 5JH5C 2DDCA 5J18A 4IK8A 2WSOA 4GDKB 2DHZA 4A20A 3OAWA 1G6JA 2HGDA 4LJPB 2C7MB 3KYDD 1I35A 3AU5A 3ED8A 4E71A 3P28A 5DQMA 1Q1OA 3SVNA 3DQ2A 1WXMA 3VH4B 3UQAA 4MM3A 2EMSA 2KC1A 4BBNF 2WURA 4IM3A 3DQHA 5D7GA 5HZSA 2XK5B 4W6AA 4OGSA 4K7WA 2G4SA 4DDGD 3ZDTA 4KIKB 4RTCA 5CHWA 2L3ZA 2DUGA 2XBBC 1KOTA 3C0RB 2QLHA 2QLEA 3APFA 3UFZA 4IK3A 2H6VA 2AWKA 1H4RA 2AL6A 3SG3A 3DVGX 4XZ4A 4BFRA 4DWFA 2MP2B 4NPNA 3DQDA 3APCA 4ORNA 1V86A 4JQWC 4P7IA 1SIFA 1WI0A 1WXSA 4GXBA 4IWQA 1CV7A 1Q73A 2LUEA 2RSUA 3SSPA 5FHVA 2C7NB 3GJ2A 4E74A 3HIZA 4EZKA 3M22A 1V2YA 2ZPYA 2JADA 2A56B 3DQ7A 3IFWB 5JHBA 5GMVA 2LD9A 1ZGOA 4K81A 4WQOB 4PYZA 2G6XA 1K8RB 4MGZE 5DTZA 4TZAA 4Q7TA 2HCGA 2KVRA 2LVPA 1WGDA 2Q6PA 4GGQA 4KSLC 2G3QB 1YIWA 4TV3A 5DU0A 3NS8A 4HPLB 1OXEA 1JC1A 3DQKA 4W7DA 1EMFA 1Q4AA 5DTXA 4ICUA 2BYEA 4LQTA 5J17A 4W75A 3PT2B 4KF4A 3DQ1A 3ML8A 5C23A 5LTQA 3ZNGC 1WJ6A 3EKHA 3EECA 3K1KA 2FUHB 2BF8B 4W7EA 3RUIB 2C7HA 4HWIB 1KJTA 2JRIB 1T0YA 2NVUI 1MOUA 4H3LA 5LTPA 4TZGA 4FULA 2W9NA 5FVIA 3DQAA 2CS4A 3TMPB 4WWOA 4ICVA 2R2QA 2WX0A 4G3XB 3UIPB 3SHQA 4OVVA 4IK4A 4KGEA 4PPJA 2ZEQA 3VUWA 4NJ7A 4W7FA 3SSYA 4HXDA 3CB9A 3O77A 3NEZA 3UQBA 4KEXA 3EVVA 1GNUA 4W9FA 3EVUA 4XOWA 1RRBA 5AZFA 3ST2A 1OEYA 1E8WA 3U8CA 4HVFA 4JC2A 2NBVB 4GDLA 4RYSA 1ZUXA 1Q4CA 4JLCA 3ZIMA 2MW5A 1TGZB 4ZINA 3ZTCA 5H88A 4XVPA 3E5WA 2KJHB 3ZDMC 2ZMUA 4BOZB 3DQLA 5DPTA 2LGDA 2MBEA 3DQEA 5LXHA 1WJNA 2GBNA 3RT3B 2IOVA 1S6ZA 1QXTA 2GW3A 3O78A 3NF0A 3LA1A 1VD2A 2O2VB 4FN2A 4W9JA 2JF5A 4ZF5A 3W1SA 2JXXA 2K1FA 1M94A 4N3DA 4GOCA 3DQVA 2Z6XA 2VVHA 4EEWA 3P8UA 2YDZA 4UTSA 2KFJA 4HCNB 4FA6A 3EVRA 3WAPA 3HM3A 3SSLA 2O2BA 3OSQA 3GZNI 5DRFA 3BXBA 2DD9A 2NS5A 2GW4B 4G50A 1LFDA 4P1QA 2AYOB 3ZW3A 4W6SA 4GF6B 2M0XA 1C3TA 3DQIA 2BYVE 1WFYA 3PLUA 3CD9A 2G3OA 4W9EA 1J19A 5BQLA 4W9GA 3S2AA 3OSRA 4ANVA 2QLIA 2BWFA 4FHJA 3ZO5B 4WJOA 2KJ6A 2ZNVB 5FVGA 1Z1PA 4XOVA 4M0WB 5LK4A 1Z5SB 2CHXA 5EB7A 3SG5A 4EDOA 3VHTC 3A9JA 4LJCA 3W1DA 2LGYA 5JZEB 4EUTA 4HDQA 4DHZB 4JIOU 2C60A 1YJ2A 1WJ4A 4W6NA 3DVNU 4P76A 1S1QB 2NR2A 3AI5A 4BOSC 1LM8B 3M63B 4AJWA 2IE2A 5DPIA 4W6TA 2KFKA 4NJ6A 2H9WA 3N3KB 4MEMA 3ZRCA 2IB5A 2ASQA 3NEDA 2HQKA 4GU2A 3R66C 3WAOA 4J6IA 4W6LA
chains in the Genus database with same CATH superfamily
4P16A 1VRAB 2CKHB 4Z4MA 5T3IA 4KW9A 2H5PA 3VDZA 1UF0A 3B0AA 4GB9A 5EXCI 3VFKA 4WAAA 3U0KA 4IC7B 4H48A 2KNBA 4PT5A 2RPQA 3HK0A 1P98A 2G1EA 5DPHA 4C4VA 3NHEB 3SSKA 3SSTA 2HFCA 1P3QU 1NI3A 1WMHA 4HVBA 4DXFA 3ONSA 1S3SG 2BKFA 3AEDB 5DPGA 2JZPA 3AKOA 3TL5A 3SVRA 2L05A 1L4DB 3ZTFA 1RLFA 2GRIA 3CSTA 1NI2A 4W6FA 3NVYA 4KZ0A 2ON8A 4L2YA 1V8CA 1Q4DA 3I5JC 2V1YA 1OQYA 4HJKA 5EBJA 3NZ3A 1E90A 1L0XB 3C19A 2L00B 2V4EC 2A52B 1OQQA 4K1RB 3RNAC 3DDCB 4MGKE 3SVEA 4O1NA 1YMHE 1Y8RC 4YTPB 1XF5L 3ENEA 4I6LB 2QU1A 4OZCA 3BYYB 4N9F4 5L83A 2PIAA 2ZCCA 3Q6BA 4ZIOA 4UDUC 2KMCA 1UH6A 1N5WA 4J8AA 1BXTA 2H8QA 4F1SA 2IY0B 1WGYA 2OJWA 3E5VA 4EOYA 3I19A 1ZGQA 1RWSA 4PFEA 4ANUA 2HJOA 5KHOA 2WWZA 3PJBA 3WLDA 1I4HA 1CJEA 4GDLB 2EELA 1D6EC 4ZB1A 2WDVB 3DQJA 2D5GA 1QLBB 4LNKA 4W6KA 5AQBB 2I1KA 4PPLA 3E56A 2OHFA 1YHIA 4KGFA 1QZEA 1YX6B 4ANXA 1HZ5A 3HVDA 1D5ZC 3DQ3A 1FFVA 2D3BA 1JMLA 4TMAB 3PO0A 4IM0A 4HE4A 4DKMA 2WP9B 3BYTB 2QHOA 2V4IB 3GL4A 3SV5A 4OY4A 4GIVA 1ET9A 1OGWA 4RGOS 4W7AA 3U7ZA 2GX0A 1KP5A 1K50A 4XDDA 3EA6A 3QARA 2I1JA 1WX8A 5DPRA 2M4NA 2PE9A 2D3CA 5BMGA 2N7EA 2LMCA 3RD2A 1Q4EA 2J42A 1E6EB 1UUPA 3NY5A 3V62A 3H1RA 4EN1A 2QC8A 2C9IA 2N7DA 2PXWA 1I4RA 5HGEA 3AEGB 4ANWA 1UWMA 4AJYB 1TYGB 1YJJA 5DPJA 1F0ZA 2DZKA 4W6JA 4Q7UA 3QC8B 2MRPA 2Z8LA 1PGAA 3RCZA 1GPXA 1SE3A 2DAJA 3ZJTA 1ZGPA 1LGRA 3PLVA 4WJNA 4ZYNA 3DOWA 4KKIA 4W9HA 2GLSA 2INNE 1E8YA 3GB1A 4FJVB 1WE6A 1ZP0B 1B1ZA 1EMKA 1XD3B 2PJHA 3OLMD 4W72A 3B1LX 1XQQA 2EMDA 3AH7A 2LXCA 4DQOC 1E5WA 4YSYB 1A70A 2ICRA 4WWNA 3LVAA 3KYCD 3PJ7A 1KLUD 2JPHA 2RDBC 3DBHI 3L16A 3HRDD 1AW7A 1UBIA 3N1XC 2FL1A 5HBDA 1XSSA 3I3TB 5FR6A 1JW9D 5J2OA 3RULA 3DQ8A 4B5YA 3ZRFA 3TJPA 2WXNA 4JWUC 2IGHA 3HM6X 4DXAB 2IBIB 1EMEA 4DXNA 4GOBA 2H5OA 3EK7A 3KUZA 4Q9WA 1R4NB 4Q9XA 1WYWB 4KV2A 1WY8A 1L6VA 4TUUA 3QAQA 2ZMWA 2J7QB 5EE0A 4XL5A 4LJDA 3IG3A 3A1QA 5H89A 2KWCA 4IM2A 2DAFA 3PHWB 2CR5A 2K8BA 4LDTD 3A9JB 1XQMA 4Q7RA 2OGRA 2HTME 2WXRA 3WANA 2LXAA 3RNBC 4IUMB 4G0NB 2GBJA 3DPDA 3OG5A 3KUDB 2KDIA 3PTFC 4L1BA 1L2NA 4KZCA 4MSQB 3V05A 4HCPB 1E7UA 3T9LA 4HRSA 2B3PA 1E7VA 4IG7B 5H92C 1WGRA 2EKEC 1D5MC 1VDVA 5BO4B 2NTSA 1V81A 2M8SA 4CO7A 3RNFC 3BZDB 4B0EA 2FZUA 4KA9A 2N9XA 2GBKA 3N30A 4C80A 2KFKB 1NDDA 2KN4A 4IK5A 3I57A 2B3QA 1HEZE 2UWQA 1UZXB 3U30A 3SG6A 3KCTA 4HDOA 2H89B 2WDQB 1EMAA 4L12A 3JSVA 1OXDA 3TUOA 4TQ1A 1RMPA 2G2SB 3VUXA 3UG0A 4MH8A 1RFAA 3N32A 5GXGB 5CTRC 3B2FA 2C9JA 1FEHA 1K53A 1WR1A 4IWOA 5EXUA 1KYRA 1XLQA 1EO6A 4M02A 2K5PA 2KD0A 2X38A 3M24A 1FRDA 3ZKJC 4W6UA 1MG8A 2GX2A 2WXQA 2J0MA 4C4VB 1PGXA 2QEJC 3ZNZB 4A9AA 3ADFA 1WMHB 1SJHD 3VXWA 1FM0D 2V4LA 4W6DA 2LEKA 1X1MA 3PZ8A 3WCKA 3AI4A 1XCTL 4KGRA 4DXGA 3R7RA 4CYEA 4A8XC 4DXMA 2NPTA 1YHGA 2KDEB 3DHHC 3VR8B 2Z0DB 1V80A 1UISA 2NCNA 2REXA 2QRFA 2JRHA 4PS7A 1SSNA 1YN4A 4W6HA 2BBCA 2FNJB 4NAWA 2DLBA 2PEAA 2AH8A 1QY3A 3DPWA 5LLIA 1BT0A 4ZRJA 4AS8A 2D3AA 4W77A 1HXYD 2LGXA 2JVCA 4RCOA 4ZFSA 3VVWB 1ESFA 3QQ8B 2ICIA 1T0SC 2WXMA 2J0JA 3CMMB 3SR6A 4ASWC 2BVCA 2LVOA 2DUEA 5HI1A 4NY0A 1ZXIA 4MELA 1JWUD 4JEOA 4P1CC 1V1PA 2LUMA 3N20C 1YN3A 3BINA 1KM7A 1RFKA 3OWEB 1UGMA 3CFAA 1WGKA 1HE8A 1OEYJ 5IP4D 5T8IA 2BW2A 2D07B 3LSAA 3ZNHB 4W9IA 4B95A 3N1YC 4W74A 2RD0A 2V9HA 3ST3A 2DNFA 3DQOA 4FHKA 4WAFA 2D2QA 1XLNA 3EVPA 5HW9A 2OTBA 4C7ZA 2V3SA 5DQBA 2IYDB 1WJUA 5HZUA 2G6YA 1JBZA 4OHJA 5C2TB 2ZPNA 1DOYA 1UBQA 2GBRA 3V3DA 2N1WA 4KKJA 3ST4A 1KLGD 3AEEB 2WHTA 3V61A 2K8HA 2Q57A 1HCJA 2RDHA 1NENB 4DKNA 1ROEA 1SF0A 1FD6A 5KTGA 3N1ZC 1YX5B 3P4PB 3SD5A 4LJBA 2MBBB 2DYOA 1C4PA 4TKNA 1FPYA 4X57B 1YZWA 2DENB 2WX1A 2H5RA 3JYUA 3PJ5A 3EKJA 4NQKE 2KO3A 3H8HA 3IAM1 3W9CB 3FKYA 2AWTA 2AWLA 3JW0X 3AULA 4RGNA 2GB1A 3DQFA 1HZ6A 1GB1A 4ZRIA 1V49A 5IA7A 4L13A 1D5XC 2K9XA 2FIFA 2QCZA 4TQ0A 4KGTA 1CMXB 2WU5B 3CSFA 4LCDE 4YSXB 4L1IA 2WISA 2TSSA 4W7RA 2G5ZB 4IK1A 2LVQA 1UWXA 2K6DB 1RMOA 2L0TA 1I7HA 4KW4A 2ZCBA 3KH0A 2DUFA 2DX5B 1V1OA 2JT4B 1WH3A 3DBRI 1W7TA 1WIAA 4YTNB 4E3CA 3U0NA 4BKSA 4FJYA 4R6BA 2WIQA 5E6OA 2KDBA 3JVZX 1HTQA 2RDGA 1VCBA 4LDTB 3DBLB 2WXPA 4NZLB 3SFDB 1JWBD 3T3NA 1WX9A 4PS3A 3AE6B 4A3OA 1E10A 1YNTE 2N7JA 1Z2MA 1XCQL 2OJKA 4M00A 2KTFA 2GMIC 1MHXA 4S17A 5DRGA 4WWPA 2VAEA 1WZ3A 3UINB 4BDUA 3KUCB 2KJRA 1WRIA 4ITKA 1IYFA 3OJ3A 3PS6A 2HDEA 4ZHPA 5C1ZA 1DOIA 2N4FA 4W6CA 4MGYE 1YJFA 1CZPA 2BTEA 5D3IB 5AZHA 2O6VA 4BKSD 2QMTA 1MVKA 3U7DA 2B76B 3V6CB 3A1QB 1L5PA 3WALA 5HZOA 4W9DA 2W54A 3Q3OC 5LTRA 1RYJA 3MHSD 3U0LA 4LW5A 2L0FA 4KX6B 2KLCA 3DQ9A 2Y5CA 4ZOHC 2KX3A 1J0GA 3DBSA 1Y56A 1XA9A 2CHWA 3RZFA 3VTUA 1WM2A 2WYQA 1GAQB 1P7EA 4WJPA 1GG3A 1F9JA 5H8YE 2KX0A 4ZBLA 4JGEA 3BK2A 4RFBA 5BYQA 2WXKA 3PRMB 1L0YB 5EE9A 4RM8A 3U0MA 2BKRB 2FCSA 4II3B 2J53A 1JWAD 3L13A 3V60A 3ZTDA 4FBJB 3PIBA 4OHSA 5DTLA 2BPSA 4LTUA 4HQ9A 2CJNA 3P4QB 4ZYSA 3KWVA 1RRXA 2DD7A 1GC7A 4BBNC 1MJDA 2G45B 3JSVB 2IGDA 2IJ0A 3G9AA 2IO0B 4BAXA 1PYWD 4RF1A 2NBWB 5E6NA 1YQBA 2H88B 3IBEA 3WCQA 2HPWA 3RWAA 1Q10A 2R61A 4W6OA 3NUHB 1JC0A 4J89A 2IZVB 4XX5A 4W6MA 5EJUA 3KCSA 1M4VA 2DZMA 3AV8A 1C1YB 2A46A 1ET6A 4US9A 2A50B 5FR3A 1KYPA 3GJ1A 3SVUA 2HQZA 2INCC 2MBHA 3AE1B 4C7YA 2OKYA 3E9SA 1EU4A 3BVMA 3SVCA 3K9OB 1V5TA 4KF5C 2QZ0A 4L23A 3SVBA 1WGGA 3EK4A 2HE7A 4W76A 1ZDXA 5BTTA 1LXDA 3PVLA 1H8CA 4DHJB 5I4DA 1GL4A 1NEKB 2KXJA 2NPTB 3UGBB 3EC8A 1T3QA 2JZZA 5G55A 2YLMA 2K8CA 4NJCA 3P63A 2L32A 1C76A 3AU4A 2HGYA 4BVUC 1E0ZA 3BX9A 5KHQA 4NAWB 1WXQA 1EF5A 3SDLC 3IP2A 1YOVB 2G16B 2K39A 2M0AA 3IHPC 5BT0A 1R4MB 1KH0A 3M3JA 3BWUD 1KYSA 3SSVA 5HZTA 1L4ZB 1L7YA 3L4PA 5EHUA 4FLHA 3PRPB 4GLSC 4B30A 5G2NA 3GOEA 3QK0A 1FNWA 4EZLA 2AHAA 1QYOA 3ALBA 2RGFA 1IP9A 5FVFA 1R4NI 2WS3B 2INPE 2PVGC 4AWJA 1JCKB 1ZW7A 3D32A 1V5OA 1WXAA 1V1PB 3C8YA 5BYSA 1E8ZA 1E8XA 2LHEA 4WIPA 2EMNA 3AM9A 2VH1A 4M8MA 2N9LA 4LK0M 2M1MA 3PREA 3UF8A 3W1SC 1KLVA 2KKCA 1JALA 3SU8X 4RNAA 4M8NA 1IPGA 4HPMB 4YXDB 3A4RA 5IO9A 3AECB 2DUIA 3WLCA 2BYFA 4EDSA 3IAS1 2YE0A 2FAZA 1WRDB 3W1CA 2FUG1 2IY1B 3DQUA 5AUKA 2B3AA 3X0WA 2YEPB 2KQ7A 2INDC 1P0RA 2EKIA 3ETRA 4ARIA 1J8CA 3SG2A 3H7SA 4ZF4A 3U8PA 2HD5B 1RM9A 4AUQC 2LGSA 2KMAA 4IK9A 1UD7A 1EM7A 2BGFA 2FE8A 5EXBA 5EB6A 1I42A 1VJKA 1FMAD 3AE2B 5IN7A 1QILA 2NMQA 1WR6E 3IVFA 3ZNID 3Q8FA 3ZQ4A 1GOZA 3SS0A 2H5QA 1H4UA 4HPPA 4ZRPA 3NZUA 2QLGA 3QWZB 1TZ1A 4XGYA 2Z6ZA 4W6BA 2G6EA 1C9FA 3Q8EA 5DPWA 3URYA 4EKUA 1H6RA 4PYUA 1EUVB 2RR9A 4LNNA 2A4ZA 4KDIC 2XN9C 4YL8A 3TEZA 1T5XD 4EFOA 1FXTB 3ECIA 4HROA 2QT2A 5LNK1 2L8JA 3BVZA 2MWSB 4AS1A 2KANA 3ZUJA 3GE8C 4URKA 3SG7A 2WXJA 4AR7A 3GB3A 1XEEA 4OZAA 2QJLA 3NS1A 1EMBA 4HLEA 4PS8A 1A5RA 3EFUA 1P9DU 2JYTA 2MCNB 2PVOD 2MX2A 3H1UA 3VQIA 5EDSA 5IKCM 4K3BA 5TR5A 2P4MA 4W9KA 3W5VB 2G3DB 3MFGA 1TS4A 1I4QA 3QIJA 4JL9A 3RNEC 2G4DB 3ZYYX 4XC2A 4AP4C 3LVCA 4ANJA 3H7PA 1TY0A 2DZIA 3DCGA 2KLGA 4IZNA 3TIXA 1P1AA 1F2RI 4KW8A 3ZULA 1WM3A 4RGTA 2AWJA 4DDID 3P4RB 2WU2B 2MLBA 1WE7A 2JY6A 3A33B 3VICA 2BTJA 2HJ1A 5HG2A 2IB6A 1QOAA 3VHTA 3B9JA 3RI7C 2N9PC 2Z0EB 1K52A 2BT6A 2O6VB 3VH3B 2W82A 3L10B 5HFYA 4XE0A 3BXCA 4W9CA 4JF9A 1I4GA 1TY2A 4MJSA 3ML9A 4BKTA 1B9CA 3U8ZA 1GJZA 3LB8C 1FFUA 4DXQA 3CFHA 4HKQA 2KN5A 2KWDA 2YEPF 1AN8A 3R2TA 1D3ZA 5HKHA 2BB6A 5IAAC 2IDYA 3GE3C 2KK8A 4NNJB 4C00A 2MBQA 2WXLA 1TS3A 4W6PA 1ZKHA 1TTNA 2QILA 1Q4BA 2PW9A 4EULA 4KDLB 3PV1A 3A9KA 5AUIA 1MOVA 2CHZA 4JGHB 1F77A 4RYWA 1SGHA 4WJQA 3O65B 1IBXA 3A8SA 3DQ4A 1GUAB 2IGGA 4LNFA 3SG4A 3LF3A 3LVDA 3CFFA 2X8XX 4DXOA 1J7CA 2A5UA 2LHDA 5G5HA 3VRAB 1NYQA 3NZSA 1TBEA 3SVSA 1L6UA 1IGCA 1F2RC 1ZDVA 3DBHB 4W9LA 2BS3B 2JX5A 2PPHA 1Q5WB 1RAXA 3FILA 2NTTA 2UYZB 1OTRB 1PUTA 2EMTA 4W69A 3AEAB 1YQ4B 2FCMA 4F8CB 4ZHOA 3NVVA 3BY4B 2KTRA 1QOBA 2IO3B 3VAWA 3VUYA 3L0WB 1N62A 5D6JB 4FJZA 1T0RC 5BTTB 1AYFA 2L7RA 4G11A 4DK5A 3NOBA 2E3TA 3RZWC 2JSVX 2JYEA 4JFGA 3EHVA 4IWPA 1JROA 2AQ2B 3PPAA 2V4EA 4Z4KA 3W1YA 3KWLA 3DBLI 4KF5A 1PDXA 3VTWA 2KVZA 1WSPA 3MC9A 4ZRKA 5DCNA 2FCQA 4IW0A 4DHJD 2HTHA 1OFFA 3PHXB 4OQWA 2JZ3B 3QCAA 1ENFA 5L95C 5J2RA 2KOXA 5EE1A 1SIJA 1EMLA 3K9PB 3S05A 1TZOA 2A54B 2SAKA 5D2MB 3RFZB 4KVGB 4NQLB 5JHAA 2BYTA 4PPKA 3LYYA 3E5TA 2M19A 3MTNB 3ABVB 3AE4B 3ZXRA 4EE2A 2WXHA 4B30B 3A4SC 4B9KA 3QA8A 4HQCA 4LJOB 2MBOA 2WHUA 2RPVA 2YVCA 2ZO6A 3OJ4B 2Y5BB 1STEA 2MH7A 3Q3JA 2Z1OA 1ZPSA 4W6GA 4MSMB 4A3PA 1CK1A 4A90A 2WSNA 4LNOA 4H3NA 1QYFA 1RM6C 1SE9A 3TBLD 2WLBA 2C9WB 4ZF3A 4AOFA 1QYQA 3EGRA 2HJ8A 4BKGA 5CX3A 3UIOB 2ONQA 2OOBB 1ZOYB 3DWGC 1WYGA 1AARA 4GDKA 3TMTA 2HRSA 4II2B 3CBEA 5AEKB 2DDDA 2KAJA 2LI5A 2JWZA 4YWGG 2ZJDA 2CU1A 2VVJA 2WHSA 4KPIA 3O13A 2A47A 1ISNA 2ZW1A 2LRUA 3R3MA 4DXIA 5E6JA 2KQSA 3SRYA 4W7XA 2J0KA 3R7QA 2MQJA 4LLGM 3NT9A 3ZLZA 1JRUA 2WXOA 1VZ8A 4J88A 3DVGY 3PSEB 1D4BA 2WDRB 4YT0B 1GGXA 2XK5A 2AX5A 1WZ0A 3WAMA 1N61A 2ZNVC 4OVUA 1XAEA 3TCAA 3T8MA 4HK2A 3M95A 1FCLA 4OVZA 4I6NB 3W2DA 2GOWA 4KIKA 4JE3B 2ZZPB 2FIDA 2EMOA 2QLGB 4HKZE 3L08A 1IGDA 2KWVB 3V6EB 3V3XA 4N58A 4FADA 4GMVA 1EWYC 4JWSC 5DPSA 2Z59B 3VK1A 2OTEA 4H3MA 3P2BA 1PQSA 3KW5B 3DPZA 4DXPA 2NBUA 1AWDA 4I2YA 1FNUA 3L17A 2FCNA 2PE6B 3BK1A 3R2IA 2MP2A 4MDKE 1W7SA 1QKZA 4WURA 5D94A 5E6PA 3PGEA 2VRRB 5F9GA 1XT9B 4LJDC 2L76A 4AQ7A 3ST0A 2DUHA 2N9EB 3Q14C 1C4AA 2ZVOA 4R6DA 1JWMD 1RMMA 3RYTA 3OGOA 2PXSA 3ZVVA 2D11A 5H87A 3LDZE 3CF6E 2DYBA 4N59A 2O29A 1YJ1A 2VZXA 3KVFB 1N5XA 2AEHA 2K6QA 3RWTA 4W6RA 2L83A 5DY6A 3U52E 2W55A 4KSKC 2GBMA 4K7UA 3VTVA 3H6NA 4IKGA 4RF0A 5DTYA 3GEXA 1EMGA 3H7PB 3B2GA 1MPEA 3DQ5A 3FAHA 1L0VB 1R4MI 5AZGA 1JQ4A 4GSWA 3DQCA 3LS3A 5FK9C 4DHZE 3ZJUA 2LJIA 2WNMA 3P1MA 1GC6A 4KAGA 2WXGA 4EMQA 3VHTB 1SJED 3DWMA 1MYWA 2LWPA 1N6ZA 4GESB 1WXVA 2SEBD 2KWUB 3ZUNA 2MEKA 4MJSB 2CJOA 4YTMB 2R2OA 3LJ3A 2WDTB 3DQ6A 2YE1A 4WH4A 3IR8A 3ZXVA 1W7UA 3MJWA 5CHVC 3SFEB 2M17A 4H47A 2MSED 2JWUA 2O6VD 1C78A 4H2AA 1EF1A 1J7AA 1TJEA 1V6EA 1GFLA 3BXAA 2IO2B 1C4FA 2DZJA 2ZO7A 3LF4B 2N1VA 1ACCA 1NBFC 2D10A 3TEXA 4F7ZA 1Z1QA 3SVOA 1WF9A 2QIEB 4CHKA 3J9CA 2C5LC 2A48A 3DQMA 4NWSA 1I4PA 1UELA 3GZNB 3A9KB 3X23A 2IO1B 1G7KA 3R8BA 3AE7B 3NT3A 3HHMA 2JXTA 3CIRB 2DYMA 1F09A 1IBXB 4W6IA 1T0QC 2KDFB 3TMRA 3RPFC 1QT9A 4RMAA 2MA9B 4B6WA 2D3GA 1PGBA 2KYWA 4OJ0A 1P7FA 2KQ4X 3DBRB 3AXCA 4N6EB 4CQNA 2RH7A 2VVIA 2O24A 1EMMA 1BFPA 4W73A 3QX1A 5C3JB 3SSHA 2A53B 4S0RA 1Q0WB 4ZDVA 1FXAA 3FILB 1XMZA 3GP7A 3H1OA 2LRWA 3NVZA 3MGFA 3EUB2 2JQRB 1ZGUB 1WX7A 2ARLA 3NRZA 1OXFA 3PZDA 4DBGA 2VADA 2KTRB 4LNIA 4QAYA 1XLPA 4GN1A 2JUOA 4K3CA 2AWMA 1HUYA 4A6QA 2LGIA 4MGIE 2W3RA 2KZRA 5G5GA 5MPOA 2V4EB 3I63C 3RN9C 2LASA 3WIMA 2XEWA 5LXIB 4B0MA 4RM9A 4JRBA 3AEBB 1EMCA 3AN1A 1KRHA 3IT6B 3QHTA 3CGLA 2N9KA 1F0BA 2POXA 3Q8AA 4ZRQA 4YSZB 2K22A 3MC8A 3U8AA 3L54A 1C77A 3H9DA 3QJZA 2LZ6A 3CD1A 4MH0E 2ZVNA 1YHHA 4W7CA 1NYRA 3BIID 2K0PA 4I6PA 3WA0A 1FRRA 3DPXA 2XNAC 4K7SA 1LQBA 4OZBA 3MHZA 1WGHA 1YD8U 5CHFA 4EZJA 4BZAA 2Y0GA 3B08A 2E6XA 3PRZA 2O2VA 4LQUA 2OJRA 1E9MA 3HUIA 4HQ8A 3EK8A 1XO3A 1V9JA 4IOIE 2Z6YA 2BWES 1JRPA 3SVDA 1N63A 2K25A 3M62B 4XWWA 3DQNA 1SEBD 2YFPA 1E7PB 3Q3NC 2OKWA 1U4AA 1YFPA 3Q3FA 2LJ5A 2KHWB 2FWQA 3DVNV 2AL3A 4RGMA 4U2VA 3TSSA 2KC2A 2WGSA 4P6VF 1JBYA 3GS2A 3ZUFA 3APDA 5JH5C 2DDCA 5J18A 4IK8A 1EU3A 2PTLA 3EFCA 2WSOA 4GDKB 4J3OD 2DHZA 4A20A 3OAWA 1G6JA 2HGDA 4LJPB 2C7MB 3KYDD 1I35A 3AU5A 3U2SC 3ED8A 4E71A 3P28A 2I2YA 5DQMA 1Q1OA 2VZKB 3SVNA 3DQ2A 2JU6X 3NG0A 4P1BC 1WXMA 1VLBA 3VH4B 3ZJVA 3UQAA 4MM3A 3BVGA 2WHIA 2EMSA 2KC1A 4BBNF 1FO4A 2WURA 4IM3A 4XDCA 3DQHA 5D7GA 3RNGC 5HZSA 2XK5B 3Q8CA 4W6AA 4OGSA 5BYRA 2BQQA 4K7WA 2G4SA 4DDGD 3RNCC 3ZDTA 4KIKB 4RTCA 5CHWA 3MP9A 2L3ZA 3SEBA 1SBBB 1WWTA 2DUGA 2XBBC 1KOTA 2G9HD 3C0RB 2QLHA 2QLEA 3APFA 3UFZA 4IK3A 2H6VA 2AWKA 1H4RA 3UI3A 2AL6A 4XGAB 3SG3A 4M0WA 3DVGX 4HJGE 4XZ4A 4BFRA 4DWFA 2MP2B 4NPNA 3DQDA 3AE5B 3APCA 1YN5A 3VRBB 4ORNA 1V86A 4JQWC 5EE3A 4P7IA 4HEA1 1SIFA 3AE9B 3IXSA 5JXVA 1WI0A 3NVWA 1WXSA 4GXBA 4IWQA 1CV7A 1Q73A 2LUEA 2RSUA 3SSPA 5FHVA 2C7NB 3GJ2A 4E74A 3HIZA 4EZKA 3M22A 2Y3AA 1V2YA 2WXFA 2ZPYA 3AE8B 3LXFA 2JADA 2A56B 3DQ7A 3IFWB 5JHBA 5GMVA 3AE3B 2OEDA 2LD9A 1ZGOA 4K81A 4WWMA 4WQOB 2V3PA 4PYZA 2IPKD 4NAMA 2UU7A 1FCCC 2G6XA 1K8RB 4XWTA 4MGZE 2VH2A 5DTZA 4TZAA 1SB3C 4Q7TA 2HCGA 2KVRA 2LVPA 1XLOA 4TSSA 1K51A 1WGDA 2Q6PA 4GGQA 4REZA 5IOIA 4KSLC 2G3QB 1YIWA 3PZ7A 3CWIA 4TV3A 5DU0A 3I9V1 3NS8A 4USAA 4ARCA 4R3DA 4HPLB 1OXEA 4A55A 1JC1A 1TKEA 3DQKA 4W7DA 2L52A 1EMFA 1Q4AA 5DTXA 1F1HA 2Y5PA 4ICUA 2BYEA 4LQTA 4XYCA 5J17A 4W75A 3PT2B 4KF4A 3DQ1A 3N9YC 3ML8A 5C23A 5LTQA 1KFYB 3ZNGC 1WJ6A 3EKHA 3EECA 2MJDA 1SE2A 4JX1C 3K1KA 1DGJA 2ACZB 2FUHB 4MACA 2BF8B 4W7EA 3RUIB 2C7HA 4HWIB 1KJTA 1DYQA 2JRIB 2N0SB 1T0YA 2NVUI 1OQRA 1TS5A 1MOUA 4H3LA 5LTPA 1CQVA 4TZGA 1EWCA 4FULA 2W9NA 1SE4A 1TKYA 4Q2JA 2KDMA 5FVIA 3DQAA 2ZW0A 2CS4A 3RMKC 3TMPB 4WWOA 4US8A 4ICVA 2R2QA 2WX0A 4G3XB 3MJ5A 4IDIA 2QSDA 3UIPB 3SHQA 4OVVA 2PLPA 4IK4A 4KGEA 4M01A 4PPJA 2ZEQA 3VUWA 4NJ7A 5D3DA 4W7FA 3SSYA 4HXDA 3CB9A 3MC0B 1BMLC 3O77A 3NEZA 3UQBA 4RH6A 4KEXA 2MHJA 3EVVA 2RMMA 1GNUA 4W9FA 3EVUA 2MJ3A 4XOWA 1RRBA 2AQ3B 4PK1A 5AZFA 3ST2A 1J7BA 1OEYA 1E8WA 3U8CA 2BS4B 4HVFA 5TSSA 4JC2A 2NBVB 4GDLA 4RYSA 4C56C 1ZUXA 2V0GA 1Q4CA 4JLCA 3ZIMA 3TEYA 1TKGA 2CU3A 3VR9B 2MW5A 1TGZB 2I38A 2WXIA 3HVZA 5HHDG 4ZINA 3ZTCA 5H88A 1IUEA 3P4SB 4XVPA 2DBYA 3E5WA 4FXCA 2KJHB 1KTKA 2FBWB 1DOXA 3ZDMC 1QOFA 1HTOA 2ZMUA 4MT5A 4BOZB 3Q8BA 2KMMA 3AEFB 3DQLA 5DPTA 2K3UA 1HA5A 2LGDA 3DQEA 2MBEA 4JPSA 2M56B 5LXHA 4KGSA 1WJNA 2GBNA 3RT3B 2IOVA 1S6ZA 1QXTA 2GW3A 3Q2AC 3O78A 4OW0A 3NF0A 1FIQA 1FNVA 3NJTA 3KLSX 3LA1A 1VD2A 2O2VB 4FN2A 4W9JA 2JF5A 4ZF5A 2LFIA 3U4EG 3W1SA 1F52A 2JXXA 2K1FA 1LO5D 1M94A 3FC4A 3AB5A 4N3DA 4GOCA 3DQVA 2Z6XA 2VVHA 4EEWA 3Q3MC 3P8UA 2YDZA 4UTSA 1TT5B 1YQ3B 2KFJA 1MFWA 4HCNB 3W5UB 4FA6A 3KQ4A 5BMHA 2BB5A 3EVRA 3WAPA 1XXGA 3HM3A 3ZGZA 3SSLA 2O2BA 3OSQA 3GZNI 5DRFA 2DWQA 3BXBA 1MHHE 2DD9A 2NS5A 2GW4B 4G50A 1LFDA 4P1QA 2AYOB 2PKOA 3ZW3A 4MM3B 1VZ7A 2KACA 4W6SA 3T3OA 1I4XA 1NVID 4GF6B 1TS2A 2M0XA 1C3TA 2KT7A 1C79A 3DQIA 2BYVE 1WFYA 4ACFA 2VZKD 3PLUA 3CD9A 1MG4A 2BS2B 2QDFA 2G3OA 1VR9A 2MJEA 4WQMA 4W9EA 1J19A 5BQLA 4W9GA 3S2AA 1QF6A 3OSRA 4ANVA 2QLIA 2BWFA 4FHJA 3ZO5B 1B9RA 3TEWA 4WJOA 2KJ6A 2ZNVB 1T6BX 1UNSA 5FVGA 2J4XA 2L1AA 3IT4B 2WQYB 1Z1PA 4XOVA 4M0WB 5LK4A 1Z5SB 2CHXA 5EB7A 3SG5A 1C4CA 3Q69A 4EDOA 1UGJA 3VHTC 3A9JA 1MI0A 2AQ1B 4LJCA 3W1DA 1ZUD2 2LGYA 5JZEB 4EUTA 1YJIA 4HDQA 3P42A 4DHZB 2GI9A 2Q5WD 4JIOU 2C60A 1YJ2A 1QOGA 1WJ4A 4W6NA 3DVNU 4P76A 1S1QB 1GB4A 1PFDA 2NR2A 3AI5A 1V97A 1HQRD 3DHIC 4BOSC 1ZE3D 1LM8B 1JWSD 1N60A 3M63B 4AJWA 1BUIC 2IE2A 5DPIA 1TIFA 4W6TA 1R7SA 2J52A 2KFKA 1SXTA 4D2KA 2PMVA 2V3NA 2W3SA 4NJ6A 2H9WA 3N3KB 5BMIA 4MEMA 1ZXHA 2IB5A 3ZRCA 2ASQA 1VZ6A 1KF6B 3NEDA 2HQKA 4GU2A 5FKAC 1QQRA 3DHGC 3AMZA 3R66C 3WAOA 1FXIA 4J6IA 4W6LA
chains in the Genus database with same CATH topology
2CKHB 4Z4MA 5T3IA 4KW9A 2H5PA 3VDZA 3B0AA 4GB9A 5EXCI 3VFKA 4WAAA 3U0KA 4IC7B 4H48A 2KNBA 2RPQA 3HK0A 1P98A 5DPHA 3NHEB 3SSKA 3SSTA 2HFCA 1P3QU 1WMHA 4HVBA 3ONSA 1S3SG 2BKFA 5DPGA 3AKOA 3TL5A 3SVRA 2L05A 3ZTFA 1RLFA 3CSTA 1NI2A 4W6FA 4KZ0A 1Q4DA 2V1YA 1OQYA 4HJKA 5EBJA 1E90A 2L00B 2V4EC 2A52B 4K1RB 3DDCB 4MGKE 3SVEA 1Y8RC 3ENEA 4I6LB 2QU1A 4N9F4 5L83A 2ZCCA 4ZIOA 2KMCA 1UH6A 4J8AA 2H8QA 4F1SA 2IY0B 1WGYA 3E5VA 4EOYA 3I19A 1ZGQA 4PFEA 4ANUA 2HJOA 5KHOA 2WWZA 3PJBA 3WLDA 4GDLB 4ZB1A 3DQJA 4W6KA 5AQBB 2I1KA 4PPLA 1YHIA 4KGFA 1QZEA 1YX6B 4ANXA 3DQ3A 4IM0A 4HE4A 4DKMA 2QHOA 3GL4A 3SV5A 4OY4A 4GIVA 1OGWA 4W7AA 2GX0A 1KP5A 3QARA 2I1JA 1WX8A 5DPRA 2M4NA 2PE9A 2N7EA 3RD2A 1Q4EA 3NY5A 3V62A 3H1RA 4EN1A 2C9IA 2N7DA 2PXWA 5HGEA 4ANWA 4AJYB 5DPJA 2DZKA 4W6JA 4Q7UA 3QC8B 2MRPA 3RCZA 2DAJA 1ZGPA 3PLVA 4WJNA 4ZYNA 3DOWA 4W9HA 1E8YA 4FJVB 1WE6A 1EMKA 1XD3B 2PJHA 3OLMD 4W72A 3B1LX 1XQQA 2EMDA 2LXCA 1E5WA 2ICRA 4WWNA 3LVAA 3KYCD 3PJ7A 2JPHA 3DBHI 3L16A 1UBIA 2FL1A 5HBDA 1XSSA 3I3TB 5FR6A 5J2OA 3RULA 3DQ8A 4B5YA 3ZRFA 3TJPA 3HM6X 4DXAB 2IBIB 1EMEA 4DXNA 4GOBA 2H5OA 3EK7A 3KUZA 4Q9WA 1WYWB 4Q9XA 4KV2A 1WY8A 4TUUA 3QAQA 2ZMWA 2J7QB 4XL5A 4LJDA 3IG3A 3A1QA 5H89A 2KWCA 4IM2A 2DAFA 3PHWB 2CR5A 2K8BA 4LDTD 3A9JB 1XQMA 4Q7RA 2OGRA 3WANA 2LXAA 4IUMB 4G0NB 2GBJA 3DPDA 3KUDB 2KDIA 3PTFC 1L2NA 4KZCA 4MSQB 4HCPB 1E7UA 3T9LA 2B3PA 1E7VA 4IG7B 1WGRA 2EKEC 5BO4B 1V81A 2M8SA 4CO7A 2FZUA 4KA9A 2N9XA 2GBKA 3N30A 2KFKB 1NDDA 4IK5A 2B3QA 2UWQA 1UZXB 3U30A 3SG6A 3KCTA 4HDOA 1EMAA 4L12A 3JSVA 1OXDA 4TQ1A 1RMPA 2G2SB 3VUXA 3UG0A 1RFAA 3N32A 5CTRC 2C9JA 1WR1A 4IWOA 5EXUA 1KYRA 1EO6A 2KD0A 3M24A 3ZKJC 4W6UA 1MG8A 2GX2A 2J0MA 3ZNZB 3ADFA 1WMHB 3VXWA 2V4LA 4W6DA 1X1MA 3WCKA 3AI4A 3R7RA 4CYEA 4DXMA 2NPTA 1YHGA 2KDEB 2Z0DB 1V80A 1UISA 2NCNA 2REXA 2QRFA 2JRHA 4PS7A 4W6HA 2FNJB 4NAWA 2PEAA 2AH8A 1QY3A 3DPWA 5LLIA 1BT0A 4ZRJA 4AS8A 4W77A 2LGXA 2JVCA 4ZFSA 3VVWB 3QQ8B 2J0JA 3CMMB 4ASWC 2LVOA 2DUEA 4NY0A 4MELA 4JEOA 3BINA 1KM7A 1UGMA 3CFAA 1HE8A 1OEYJ 2D07B 3LSAA 3ZNHB 4W9IA 4B95A 4W74A 2RD0A 3ST3A 3DQOA 4FHKA 2D2QA 3EVPA 5HW9A 2OTBA 2V3SA 5DQBA 2IYDB 1WJUA 5HZUA 2G6YA 1JBZA 2ZPNA 1UBQA 2GBRA 3V3DA 2N1WA 3ST4A 2WHTA 3V61A 2K8HA 2Q57A 1HCJA 4DKNA 5KTGA 1YX5B 3SD5A 4LJBA 2MBBB 2DYOA 4TKNA 4X57B 1YZWA 2DENB 2WX1A 2H5RA 3JYUA 3PJ5A 3EKJA 4NQKE 2KO3A 2AWTA 2AWLA 3JW0X 3AULA 3DQFA 4ZRIA 1V49A 5IA7A 4L13A 4TQ0A 2FIFA 1CMXB 3CSFA 4LCDE 4L1IA 2WISA 4W7RA 2G5ZB 4IK1A 2LVQA 2K6DB 1RMOA 2L0TA 4KW4A 2ZCBA 3KH0A 2DUFA 2DX5B 2JT4B 1WH3A 3DBRI 1W7TA 1WIAA 4E3CA 3U0NA 4BKSA 4FJYA 4R6BA 2WIQA 5E6OA 2KDBA 3JVZX 1VCBA 4LDTB 1WX9A 4PS3A 4A3OA 1Z2MA 2OJKA 2KTFA 2GMIC 5DRGA 4WWPA 2VAEA 1WZ3A 3UINB 4BDUA 3KUCB 2KJRA 1IYFA 3OJ3A 3PS6A 5C1ZA 2N4FA 4W6CA 4MGYE 1YJFA 5AZHA 2O6VA 4BKSD 3U7DA 3V6CB 3A1QB 3WALA 5HZOA 4W9DA 5LTRA 3MHSD 3U0LA 4LW5A 2L0FA 2KLCA 3DQ9A 2KX3A 1J0GA 3DBSA 1XA9A 2CHWA 3RZFA 3VTUA 1WM2A 2WYQA 4WJPA 1GG3A 1F9JA 2KX0A 4ZBLA 4JGEA 3PRMB 4RM8A 3U0MA 2BKRB 2FCSA 4II3B 3L13A 3V60A 3ZTDA 4FBJB 3PIBA 4OHSA 5DTLA 2BPSA 4HQ9A 1RRXA 2DD7A 1GC7A 4BBNC 2G45B 3JSVB 3G9AA 2IO0B 2NBWB 5E6NA 1YQBA 3IBEA 2HPWA 3RWAA 4W6OA 1JC0A 4J89A 2IZVB 4XX5A 4W6MA 5EJUA 3KCSA 2DZMA 1C1YB 2A46A 2A50B 1KYPA 3GJ1A 3SVUA 2HQZA 2MBHA 2OKYA 3SVCA 3K9OB 1V5TA 4KF5C 2QZ0A 3SVBA 1WGGA 3EK4A 2HE7A 4W76A 5BTTA 1LXDA 3PVLA 1H8CA 4DHJB 1GL4A 2KXJA 2NPTB 3UGBB 3EC8A 2JZZA 5G55A 2YLMA 2K8CA 3AU4A 2HGYA 4BVUC 3BX9A 5KHQA 4NAWB 1EF5A 3SDLC 3IP2A 2G16B 2K39A 3IHPC 5BT0A 3M3JA 1KYSA 3SSVA 5HZTA 1L7YA 4FLHA 5EHUA 3PRPB 4B30A 5G2NA 3GOEA 3QK0A 4EZLA 2AHAA 1QYOA 3ALBA 2RGFA 1IP9A 5FVFA 1R4NI 4AWJA 1ZW7A 3D32A 1V5OA 1WXAA 1E8ZA 1E8XA 2EMNA 4M8MA 2M1MA 3PREA 3UF8A 3W1SC 1KLVA 2KKCA 3SU8X 4M8NA 1IPGA 4HPMB 3A4RA 2DUIA 3WLCA 2BYFA 4EDSA 2YE0A 2FAZA 1WRDB 3W1CA 2IY1B 3DQUA 2B3AA 3X0WA 2KQ7A 1P0RA 1J8CA 3SG2A 3H7SA 4ZF4A 3U8PA 2HD5B 1RM9A 4AUQC 2KMAA 4IK9A 1UD7A 2BGFA 5EXBA 5EB6A 1I42A 1WR6E 3IVFA 3ZNID 3SS0A 2H5QA 1H4UA 3NZUA 2QLGA 3QWZB 1TZ1A 4XGYA 2Z6ZA 4W6BA 2G6EA 5DPWA 4EKUA 1H6RA 4PYUA 1EUVB 2RR9A 2A4ZA 4KDIC 4YL8A 4EFOA 1FXTB 3ECIA 2QT2A 2L8JA 2MWSB 2KANA 3ZUJA 4URKA 3SG7A 4AR7A 3GB3A 1EMBA 4HLEA 4PS8A 1A5RA 3EFUA 1P9DU 2MCNB 2MX2A 3H1UA 3VQIA 5EDSA 5TR5A 2P4MA 4W9KA 2G3DB 3QIJA 4JL9A 2G4DB 4XC2A 4AP4C 3LVCA 4ANJA 3H7PA 2DZIA 3DCGA 2KLGA 4IZNA 3TIXA 1P1AA 4KW8A 3ZULA 1WM3A 4DDID 2AWJA 2MLBA 1WE7A 2JY6A 3A33B 3VICA 2BTJA 2IB6A 3VHTA 2N9PC 2Z0EB 2O6VB 3VH3B 3L10B 3BXCA 4W9CA 4JF9A 4MJSA 3ML9A 4BKTA 1B9CA 3U8ZA 1GJZA 4DXQA 3CFHA 2KN5A 1D3ZA 5HKHA 5IAAC 2KK8A 4NNJB 2MBQA 4W6PA 1ZKHA 1TTNA 1Q4BA 4EULA 4KDLB 3PV1A 3A9KA 1MOVA 2CHZA 4JGHB 4RYWA 1SGHA 4WJQA 3O65B 3A8SA 3DQ4A 1GUAB 3SG4A 3LF3A 3LVDA 3CFFA 4DXOA 2A5UA 3NZSA 1TBEA 3SVSA 4W9LA 2PPHA 1Q5WB 1RAXA 2UYZB 1OTRB 2EMTA 4W69A 2FCMA 4F8CB 3BY4B 2KTRA 2IO3B 3VAWA 3VUYA 3L0WB 5D6JB 4FJZA 5BTTB 2L7RA 4G11A 4DK5A 3NOBA 3RZWC 4JFGA 3EHVA 4IWPA 3PPAA 2V4EA 4Z4KA 3W1YA 3DBLI 4KF5A 3VTWA 4ZRKA 5DCNA 2FCQA 4IW0A 4DHJD 2HTHA 3PHXB 4OQWA 2JZ3B 3QCAA 5L95C 5J2RA 2KOXA 1EMLA 3K9PB 3S05A 2A54B 5D2MB 4KVGB 4NQLB 5JHAA 4PPKA 3E5TA 3MTNB 4B30B 3A4SC 4B9KA 3QA8A 4HQCA 4LJOB 2MBOA 2WHUA 2YVCA 2ZO6A 3OJ4B 2Y5BB 3Q3JA 2Z1OA 4W6GA 4MSMB 4A3PA 2WSNA 4H3NA 1QYFA 1SE9A 3TBLD 2C9WB 4ZF3A 4AOFA 1QYQA 2HJ8A 4BKGA 5CX3A 3UIOB 2OOBB 1AARA 4GDKA 3TMTA 2HRSA 4II2B 3CBEA 5AEKB 2DDDA 2LI5A 2JWZA 2ZJDA 2CU1A 2VVJA 2WHSA 4KPIA 2A47A 1ISNA 2LRUA 3R3MA 4DXIA 2KQSA 3SRYA 4W7XA 2J0KA 3R7QA 2MQJA 3ZLZA 3NT9A 1JRUA 4J88A 3DVGY 3PSEB 1GGXA 2XK5A 1WZ0A 3WAMA 2ZNVC 4OVUA 1XAEA 3TCAA 3T8MA 4HK2A 3M95A 4I6NB 2GOWA 4KIKA 2ZZPB 2FIDA 2EMOA 2QLGB 3L08A 2KWVB 3V6EB 4FADA 4GMVA 5DPSA 2Z59B 3VK1A 2OTEA 4H3MA 3P2BA 1PQSA 3KW5B 3DPZA 4DXPA 2NBUA 4I2YA 3L17A 2FCNA 2PE6B 2MP2A 4MDKE 1W7SA 5D94A 5E6PA 3PGEA 2VRRB 5F9GA 1XT9B 4LJDC 2L76A 3ST0A 2DUHA 2N9EB 2ZVOA 4R6DA 1RMMA 3RYTA 3OGOA 2PXSA 3ZVVA 2D11A 5H87A 3LDZE 3CF6E 2DYBA 2O29A 1YJ1A 2VZXA 3KVFB 2AEHA 2K6QA 3RWTA 4W6RA 5DY6A 4KSKC 2GBMA 4K7UA 3VTVA 3H6NA 5DTYA 3GEXA 1EMGA 3H7PB 3DQ5A 1R4MI 5AZGA 4GSWA 3DQCA 3LS3A 4DHZE 1GC6A 4KAGA 4EMQA 3VHTB 1MYWA 2LWPA 4GESB 1WXVA 2KWUB 3ZUNA 4MJSB 2R2OA 3LJ3A 2WDTB 3DQ6A 2YE1A 3IR8A 1W7UA 3MJWA 5CHVC 2M17A 4H47A 2MSED 2O6VD 1EF1A 1V6EA 1GFLA 3BXAA 2IO2B 1C4FA 2DZJA 2ZO7A 3LF4B 2N1VA 1NBFC 2D10A 4F7ZA 1Z1QA 3SVOA 1WF9A 4CHKA 2A48A 2C5LC 3DQMA 4NWSA 1UELA 3A9KB 3X23A 2IO1B 1G7KA 3NT3A 3HHMA 2DYMA 1F09A 4W6IA 2KDFB 3TMRA 4RMAA 2MA9B 4B6WA 2D3GA 4OJ0A 3AXCA 2RH7A 2VVIA 2O24A 1EMMA 1BFPA 4W73A 3QX1A 3SSHA 2A53B 1Q0WB 4ZDVA 1XMZA 3H1OA 2LRWA 3MGFA 1ZGUB 1WX7A 2ARLA 1OXFA 3PZDA 4DBGA 2VADA 2KTRB 4GN1A 2JUOA 2AWMA 1HUYA 4MGIE 2KZRA 2V4EB 2LASA 3WIMA 2XEWA 5LXIB 4RM9A 4JRBA 1EMCA 3QHTA 3CGLA 1F0BA 2POXA 3U8AA 3L54A 3QJZA 3H9DA 2LZ6A 3CD1A 4MH0E 2ZVNA 1YHHA 4W7CA 3WA0A 4I6PA 3DPXA 4K7SA 1LQBA 1WGHA 1YD8U 5CHFA 4EZJA 2Y0GA 3B08A 3PRZA 2O2VA 4LQUA 2OJRA 4HQ8A 3EK8A 1V9JA 2Z6YA 2BWES 3SVDA 2K25A 3M62B 3DQNA 2YFPA 2OKWA 1U4AA 1YFPA 3Q3FA 2LJ5A 2KHWB 2FWQA 3DVNV 2AL3A 4U2VA 2KC2A 1JBYA 3ZUFA 3APDA 5JH5C 2DDCA 5J18A 4IK8A 2WSOA 4GDKB 2DHZA 4A20A 3OAWA 1G6JA 2HGDA 4LJPB 2C7MB 3KYDD 1I35A 3AU5A 3ED8A 4E71A 3P28A 5DQMA 1Q1OA 3SVNA 3DQ2A 1WXMA 3VH4B 3UQAA 4MM3A 2EMSA 2KC1A 4BBNF 2WURA 4IM3A 3DQHA 5D7GA 5HZSA 2XK5B 4W6AA 4OGSA 4K7WA 2G4SA 4DDGD 3ZDTA 4KIKB 4RTCA 5CHWA 2L3ZA 2DUGA 2XBBC 1KOTA 3C0RB 2QLHA 2QLEA 3APFA 3UFZA 4IK3A 2H6VA 2AWKA 1H4RA 2AL6A 3SG3A 3DVGX 4XZ4A 4BFRA 4DWFA 2MP2B 4NPNA 3DQDA 3APCA 4ORNA 1V86A 4JQWC 4P7IA 1SIFA 1WI0A 1WXSA 4GXBA 4IWQA 1CV7A 1Q73A 2LUEA 2RSUA 3SSPA 5FHVA 2C7NB 3GJ2A 4E74A 3HIZA 4EZKA 3M22A 1V2YA 2ZPYA 2JADA 2A56B 3DQ7A 3IFWB 5JHBA 5GMVA 2LD9A 1ZGOA 4K81A 4WQOB 4PYZA 2G6XA 1K8RB 4MGZE 5DTZA 4TZAA 4Q7TA 2HCGA 2KVRA 2LVPA 1WGDA 2Q6PA 4GGQA 4KSLC 2G3QB 1YIWA 4TV3A 5DU0A 3NS8A 4HPLB 1OXEA 1JC1A 3DQKA 4W7DA 1EMFA 1Q4AA 5DTXA 4ICUA 2BYEA 4LQTA 5J17A 4W75A 3PT2B 4KF4A 3DQ1A 3ML8A 5C23A 5LTQA 3ZNGC 1WJ6A 3EKHA 3EECA 3K1KA 2FUHB 2BF8B 4W7EA 3RUIB 2C7HA 4HWIB 1KJTA 2JRIB 1T0YA 2NVUI 1MOUA 4H3LA 5LTPA 4TZGA 4FULA 2W9NA 5FVIA 3DQAA 2CS4A 3TMPB 4WWOA 4ICVA 2R2QA 2WX0A 4G3XB 3UIPB 3SHQA 4OVVA 4IK4A 4KGEA 4PPJA 2ZEQA 3VUWA 4NJ7A 4W7FA 3SSYA 4HXDA 3CB9A 3O77A 3NEZA 3UQBA 4KEXA 3EVVA 1GNUA 4W9FA 3EVUA 4XOWA 1RRBA 5AZFA 3ST2A 1OEYA 1E8WA 3U8CA 4HVFA 4JC2A 2NBVB 4GDLA 4RYSA 1ZUXA 1Q4CA 4JLCA 3ZIMA 2MW5A 1TGZB 4ZINA 3ZTCA 5H88A 4XVPA 3E5WA 2KJHB 3ZDMC 2ZMUA 4BOZB 3DQLA 5DPTA 2LGDA 2MBEA 3DQEA 5LXHA 1WJNA 2GBNA 3RT3B 2IOVA 1S6ZA 1QXTA 2GW3A 3O78A 3NF0A 3LA1A 1VD2A 2O2VB 4FN2A 4W9JA 2JF5A 4ZF5A 3W1SA 2JXXA 2K1FA 1M94A 4N3DA 4GOCA 3DQVA 2Z6XA 2VVHA 4EEWA 3P8UA 2YDZA 4UTSA 2KFJA 4HCNB 4FA6A 3EVRA 3WAPA 3HM3A 3SSLA 2O2BA 3OSQA 3GZNI 5DRFA 3BXBA 2DD9A 2NS5A 2GW4B 4G50A 1LFDA 4P1QA 2AYOB 3ZW3A 4W6SA 4GF6B 2M0XA 1C3TA 3DQIA 2BYVE 1WFYA 3PLUA 3CD9A 2G3OA 4W9EA 1J19A 5BQLA 4W9GA 3S2AA 3OSRA 4ANVA 2QLIA 2BWFA 4FHJA 3ZO5B 4WJOA 2KJ6A 2ZNVB 5FVGA 1Z1PA 4XOVA 4M0WB 5LK4A 1Z5SB 2CHXA 5EB7A 3SG5A 4EDOA 3VHTC 3A9JA 4LJCA 3W1DA 2LGYA 5JZEB 4EUTA 4HDQA 4DHZB 4JIOU 2C60A 1YJ2A 1WJ4A 4W6NA 3DVNU 4P76A 1S1QB 2NR2A 3AI5A 4BOSC 1LM8B 3M63B 4AJWA 2IE2A 5DPIA 4W6TA 2KFKA 4NJ6A 2H9WA 3N3KB 4MEMA 3ZRCA 2IB5A 2ASQA 3NEDA 2HQKA 4GU2A 3R66C 3WAOA 4J6IA 4W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKH B;  4Z4M A;  5T3I A;  4KW9 A;  2H5P A;  3VDZ A;  3B0A A;  4GB9 A;  5EXC I;  3VFK A;  4WAA A;  3U0K A;  4IC7 B;  4H48 A;  2KNB A;  2RPQ A;  3HK0 A;  1P98 A;  5DPH A;  3NHE B;  3SSK A;  3SST A;  2HFC A;  1P3Q U;  1WMH A;  4HVB A;  3ONS A;  1S3S G;  2BKF A;  5DPG A;  3AKO A;  3TL5 A;  3SVR A;  2L05 A;  3ZTF A;  1RLF A;  3CST A;  1NI2 A;  4W6F A;  4KZ0 A;  1Q4D A;  2V1Y A;  1OQY A;  4HJK A;  5EBJ A;  1E90 A;  2L00 B;  2V4E C;  2A52 B;  4K1R B;  3DDC B;  4MGK E;  3SVE A;  1Y8R C;  3ENE A;  4I6L B;  2QU1 A;  4N9F 4;  5L83 A;  2ZCC A;  4ZIO A;  2KMC A;  1UH6 A;  4J8A A;  2H8Q A;  4F1S A;  2IY0 B;  1WGY A;  3E5V A;  4EOY A;  3I19 A;  1ZGQ A;  4PFE A;  4ANU A;  2HJO A;  5KHO A;  2WWZ A;  3PJB A;  3WLD A;  4GDL B;  4ZB1 A;  3DQJ A;  4W6K A;  5AQB B;  2I1K A;  4PPL A;  1YHI A;  4KGF A;  1QZE A;  1YX6 B;  4ANX A;  3DQ3 A;  4IM0 A;  4HE4 A;  4DKM A;  2QHO A;  3GL4 A;  3SV5 A;  4OY4 A;  4GIV A;  1OGW A;  4W7A A;  2GX0 A;  1KP5 A;  3QAR A;  2I1J A;  1WX8 A;  5DPR A;  2M4N A;  2PE9 A;  2N7E A;  3RD2 A;  1Q4E A;  3NY5 A;  3V62 A;  3H1R A;  4EN1 A;  2C9I A;  2N7D A;  2PXW A;  5HGE A;  4ANW A;  4AJY B;  5DPJ A;  2DZK A;  4W6J A;  4Q7U A;  3QC8 B;  2MRP A;  3RCZ A;  2DAJ A;  1ZGP A;  3PLV A;  4WJN A;  4ZYN A;  3DOW A;  4W9H A;  1E8Y A;  4FJV B;  1WE6 A;  1EMK A;  1XD3 B;  2PJH A;  3OLM D;  4W72 A;  3B1L X;  1XQQ A;  2EMD A;  2LXC A;  1E5W A;  2ICR A;  4WWN A;  3LVA A;  3KYC D;  3PJ7 A;  2JPH A;  3DBH I;  3L16 A;  1UBI A;  2FL1 A;  5HBD A;  1XSS A;  3I3T B;  5FR6 A;  5J2O A;  3RUL A;  3DQ8 A;  4B5Y A;  3ZRF A;  3TJP A;  3HM6 X;  4DXA B;  2IBI B;  1EME A;  4DXN A;  4GOB A;  2H5O A;  3EK7 A;  3KUZ A;  4Q9W A;  1WYW B;  4Q9X A;  4KV2 A;  1WY8 A;  4TUU A;  3QAQ A;  2ZMW A;  2J7Q B;  4XL5 A;  4LJD A;  3IG3 A;  3A1Q A;  5H89 A;  2KWC A;  4IM2 A;  2DAF A;  3PHW B;  2CR5 A;  2K8B A;  4LDT D;  3A9J B;  1XQM A;  4Q7R A;  2OGR A;  3WAN A;  2LXA A;  4IUM B;  4G0N B;  2GBJ A;  3DPD A;  3KUD B;  2KDI A;  3PTF C;  1L2N A;  4KZC A;  4MSQ B;  4HCP B;  1E7U A;  3T9L A;  2B3P A;  1E7V A;  4IG7 B;  1WGR A;  2EKE C;  5BO4 B;  1V81 A;  2M8S A;  4CO7 A;  2FZU A;  4KA9 A;  2N9X A;  2GBK A;  3N30 A;  2KFK B;  1NDD A;  4IK5 A;  2B3Q A;  2UWQ A;  1UZX B;  3U30 A;  3SG6 A;  3KCT A;  4HDO A;  1EMA A;  4L12 A;  3JSV A;  1OXD A;  4TQ1 A;  1RMP A;  2G2S B;  3VUX A;  3UG0 A;  1RFA A;  3N32 A;  5CTR C;  2C9J A;  1WR1 A;  4IWO A;  5EXU A;  1KYR A;  1EO6 A;  2KD0 A;  3M24 A;  3ZKJ C;  4W6U A;  1MG8 A;  2GX2 A;  2J0M A;  3ZNZ B;  3ADF A;  1WMH B;  3VXW A;  2V4L A;  4W6D A;  1X1M A;  3WCK A;  3AI4 A;  3R7R A;  4CYE A;  4DXM A;  2NPT A;  1YHG A;  2KDE B;  2Z0D B;  1V80 A;  1UIS A;  2NCN A;  2REX A;  2QRF A;  2JRH A;  4PS7 A;  4W6H A;  2FNJ B;  4NAW A;  2PEA A;  2AH8 A;  1QY3 A;  3DPW A;  5LLI A;  1BT0 A;  4ZRJ A;  4AS8 A;  4W77 A;  2LGX A;  2JVC A;  4ZFS A;  3VVW B;  3QQ8 B;  2J0J A;  3CMM B;  4ASW C;  2LVO A;  2DUE A;  4NY0 A;  4MEL A;  4JEO A;  3BIN A;  1KM7 A;  1UGM A;  3CFA A;  1HE8 A;  1OEY J;  2D07 B;  3LSA A;  3ZNH B;  4W9I A;  4B95 A;  4W74 A;  2RD0 A;  3ST3 A;  3DQO A;  4FHK A;  2D2Q A;  3EVP A;  5HW9 A;  2OTB A;  2V3S A;  5DQB A;  2IYD B;  1WJU A;  5HZU A;  2G6Y A;  1JBZ A;  2ZPN A;  1UBQ A;  2GBR A;  3V3D A;  2N1W A;  3ST4 A;  2WHT A;  3V61 A;  2K8H A;  2Q57 A;  1HCJ A;  4DKN A;  5KTG A;  1YX5 B;  3SD5 A;  4LJB A;  2MBB B;  2DYO A;  4TKN A;  4X57 B;  1YZW A;  2DEN B;  2WX1 A;  2H5R A;  3JYU A;  3PJ5 A;  3EKJ A;  4NQK E;  2KO3 A;  2AWT A;  2AWL A;  3JW0 X;  3AUL A;  3DQF A;  4ZRI A;  1V49 A;  5IA7 A;  4L13 A;  4TQ0 A;  2FIF A;  1CMX B;  3CSF A;  4LCD E;  4L1I A;  2WIS A;  4W7R A;  2G5Z B;  4IK1 A;  2LVQ A;  2K6D B;  1RMO A;  2L0T A;  4KW4 A;  2ZCB A;  3KH0 A;  2DUF A;  2DX5 B;  2JT4 B;  1WH3 A;  3DBR I;  1W7T A;  1WIA A;  4E3C A;  3U0N A;  4BKS A;  4FJY A;  4R6B A;  2WIQ A;  5E6O A;  2KDB A;  3JVZ X;  1VCB A;  4LDT B;  1WX9 A;  4PS3 A;  4A3O A;  1Z2M A;  2OJK A;  2KTF A;  2GMI C;  5DRG A;  4WWP A;  2VAE A;  1WZ3 A;  3UIN B;  4BDU A;  3KUC B;  2KJR A;  1IYF A;  3OJ3 A;  3PS6 A;  5C1Z A;  2N4F A;  4W6C A;  4MGY E;  1YJF A;  5AZH A;  2O6V A;  4BKS D;  3U7D A;  3V6C B;  3A1Q B;  3WAL A;  5HZO A;  4W9D A;  5LTR A;  3MHS D;  3U0L A;  4LW5 A;  2L0F A;  2KLC A;  3DQ9 A;  2KX3 A;  1J0G A;  3DBS A;  1XA9 A;  2CHW A;  3RZF A;  3VTU A;  1WM2 A;  2WYQ A;  4WJP A;  1GG3 A;  1F9J A;  2KX0 A;  4ZBL A;  4JGE A;  3PRM B;  4RM8 A;  3U0M A;  2BKR B;  2FCS A;  4II3 B;  3L13 A;  3V60 A;  3ZTD A;  4FBJ B;  3PIB A;  4OHS A;  5DTL A;  2BPS A;  4HQ9 A;  1RRX A;  2DD7 A;  1GC7 A;  4BBN C;  2G45 B;  3JSV B;  3G9A A;  2IO0 B;  2NBW B;  5E6N A;  1YQB A;  3IBE A;  2HPW A;  3RWA A;  4W6O A;  1JC0 A;  4J89 A;  2IZV B;  4XX5 A;  4W6M A;  5EJU A;  3KCS A;  2DZM A;  1C1Y B;  2A46 A;  2A50 B;  1KYP A;  3GJ1 A;  3SVU A;  2HQZ A;  2MBH A;  2OKY A;  3SVC A;  3K9O B;  1V5T A;  4KF5 C;  2QZ0 A;  3SVB A;  1WGG A;  3EK4 A;  2HE7 A;  4W76 A;  5BTT A;  1LXD A;  3PVL A;  1H8C A;  4DHJ B;  1GL4 A;  2KXJ A;  2NPT B;  3UGB B;  3EC8 A;  2JZZ A;  5G55 A;  2YLM A;  2K8C A;  3AU4 A;  2HGY A;  4BVU C;  3BX9 A;  5KHQ A;  4NAW B;  1EF5 A;  3SDL C;  3IP2 A;  2G16 B;  2K39 A;  3IHP C;  5BT0 A;  3M3J A;  1KYS A;  3SSV A;  5HZT A;  1L7Y A;  4FLH A;  5EHU A;  3PRP B;  4B30 A;  5G2N A;  3GOE A;  3QK0 A;  4EZL A;  2AHA A;  1QYO A;  3ALB A;  2RGF A;  1IP9 A;  5FVF A;  1R4N I;  4AWJ A;  1ZW7 A;  3D32 A;  1V5O A;  1WXA A;  1E8Z A;  1E8X A;  2EMN A;  4M8M A;  2M1M A;  3PRE A;  3UF8 A;  3W1S C;  1KLV A;  2KKC A;  3SU8 X;  4M8N A;  1IPG A;  4HPM B;  3A4R A;  2DUI A;  3WLC A;  2BYF A;  4EDS A;  2YE0 A;  2FAZ A;  1WRD B;  3W1C A;  2IY1 B;  3DQU A;  2B3A A;  3X0W A;  2KQ7 A;  1P0R A;  1J8C A;  3SG2 A;  3H7S A;  4ZF4 A;  3U8P A;  2HD5 B;  1RM9 A;  4AUQ C;  2KMA A;  4IK9 A;  1UD7 A;  2BGF A;  5EXB A;  5EB6 A;  1I42 A;  1WR6 E;  3IVF A;  3ZNI D;  3SS0 A;  2H5Q A;  1H4U A;  3NZU A;  2QLG A;  3QWZ B;  1TZ1 A;  4XGY A;  2Z6Z A;  4W6B A;  2G6E A;  5DPW A;  4EKU A;  1H6R A;  4PYU A;  1EUV B;  2RR9 A;  2A4Z A;  4KDI C;  4YL8 A;  4EFO A;  1FXT B;  3ECI A;  2QT2 A;  2L8J A;  2MWS B;  2KAN A;  3ZUJ A;  4URK A;  3SG7 A;  4AR7 A;  3GB3 A;  1EMB A;  4HLE A;  4PS8 A;  1A5R A;  3EFU A;  1P9D U;  2MCN B;  2MX2 A;  3H1U A;  3VQI A;  5EDS A;  5TR5 A;  2P4M A;  4W9K A;  2G3D B;  3QIJ A;  4JL9 A;  2G4D B;  4XC2 A;  4AP4 C;  3LVC A;  4ANJ A;  3H7P A;  2DZI A;  3DCG A;  2KLG A;  4IZN A;  3TIX A;  1P1A A;  4KW8 A;  3ZUL A;  1WM3 A;  4DDI D;  2AWJ A;  2MLB A;  1WE7 A;  2JY6 A;  3A33 B;  3VIC A;  2BTJ A;  2IB6 A;  3VHT A;  2N9P C;  2Z0E B;  2O6V B;  3VH3 B;  3L10 B;  3BXC A;  4W9C A;  4JF9 A;  4MJS A;  3ML9 A;  4BKT A;  1B9C A;  3U8Z A;  1GJZ A;  4DXQ A;  3CFH A;  2KN5 A;  1D3Z A;  5HKH A;  5IAA C;  2KK8 A;  4NNJ B;  2MBQ A;  4W6P A;  1ZKH A;  1TTN A;  1Q4B A;  4EUL A;  4KDL B;  3PV1 A;  3A9K A;  1MOV A;  2CHZ A;  4JGH B;  4RYW A;  1SGH A;  4WJQ A;  3O65 B;  3A8S A;  3DQ4 A;  1GUA B;  3SG4 A;  3LF3 A;  3LVD A;  3CFF A;  4DXO A;  2A5U A;  3NZS A;  1TBE A;  3SVS A;  4W9L A;  2PPH A;  1Q5W B;  1RAX A;  2UYZ B;  1OTR B;  2EMT A;  4W69 A;  2FCM A;  4F8C B;  3BY4 B;  2KTR A;  2IO3 B;  3VAW A;  3VUY A;  3L0W B;  5D6J B;  4FJZ A;  5BTT B;  2L7R A;  4G11 A;  4DK5 A;  3NOB A;  3RZW C;  4JFG A;  3EHV A;  4IWP A;  3PPA A;  2V4E A;  4Z4K A;  3W1Y A;  3DBL I;  4KF5 A;  3VTW A;  4ZRK A;  5DCN A;  2FCQ A;  4IW0 A;  4DHJ D;  2HTH A;  3PHX B;  4OQW A;  2JZ3 B;  3QCA A;  5L95 C;  5J2R A;  2KOX A;  1EML A;  3K9P B;  3S05 A;  2A54 B;  5D2M B;  4KVG B;  4NQL B;  5JHA A;  4PPK A;  3E5T A;  3MTN B;  4B30 B;  3A4S C;  4B9K A;  3QA8 A;  4HQC A;  4LJO B;  2MBO A;  2WHU A;  2YVC A;  2ZO6 A;  3OJ4 B;  2Y5B B;  3Q3J A;  2Z1O A;  4W6G A;  4MSM B;  4A3P A;  2WSN A;  4H3N A;  1QYF A;  1SE9 A;  3TBL D;  2C9W B;  4ZF3 A;  4AOF A;  1QYQ A;  2HJ8 A;  4BKG A;  5CX3 A;  3UIO B;  2OOB B;  1AAR A;  4GDK A;  3TMT A;  2HRS A;  4II2 B;  3CBE A;  5AEK B;  2DDD A;  2LI5 A;  2JWZ A;  2ZJD A;  2CU1 A;  2VVJ A;  2WHS A;  4KPI A;  2A47 A;  1ISN A;  2LRU A;  3R3M A;  4DXI A;  2KQS A;  3SRY A;  4W7X A;  2J0K A;  3R7Q A;  2MQJ A;  3ZLZ A;  3NT9 A;  1JRU A;  4J88 A;  3DVG Y;  3PSE B;  1GGX A;  2XK5 A;  1WZ0 A;  3WAM A;  2ZNV C;  4OVU A;  1XAE A;  3TCA A;  3T8M A;  4HK2 A;  3M95 A;  4I6N B;  2GOW A;  4KIK A;  2ZZP B;  2FID A;  2EMO A;  2QLG B;  3L08 A;  2KWV B;  3V6E B;  4FAD A;  4GMV A;  5DPS A;  2Z59 B;  3VK1 A;  2OTE A;  4H3M A;  3P2B A;  1PQS A;  3KW5 B;  3DPZ A;  4DXP A;  2NBU A;  4I2Y A;  3L17 A;  2FCN A;  2PE6 B;  2MP2 A;  4MDK E;  1W7S A;  5D94 A;  5E6P A;  3PGE A;  2VRR B;  5F9G A;  1XT9 B;  4LJD C;  2L76 A;  3ST0 A;  2DUH A;  2N9E B;  2ZVO A;  4R6D A;  1RMM A;  3RYT A;  3OGO A;  2PXS A;  3ZVV A;  2D11 A;  5H87 A;  3LDZ E;  3CF6 E;  2DYB A;  2O29 A;  1YJ1 A;  2VZX A;  3KVF B;  2AEH A;  2K6Q A;  3RWT A;  4W6R A;  5DY6 A;  4KSK C;  2GBM A;  4K7U A;  3VTV A;  3H6N A;  5DTY A;  3GEX A;  1EMG A;  3H7P B;  3DQ5 A;  1R4M I;  5AZG A;  4GSW A;  3DQC A;  3LS3 A;  4DHZ E;  1GC6 A;  4KAG A;  4EMQ A;  3VHT B;  1MYW A;  2LWP A;  4GES B;  1WXV A;  2KWU B;  3ZUN A;  4MJS B;  2R2O A;  3LJ3 A;  2WDT B;  3DQ6 A;  2YE1 A;  3IR8 A;  1W7U A;  3MJW A;  5CHV C;  2M17 A;  4H47 A;  2MSE D;  2O6V D;  1EF1 A;  1V6E A;  1GFL A;  3BXA A;  2IO2 B;  1C4F A;  2DZJ A;  2ZO7 A;  3LF4 B;  2N1V A;  1NBF C;  2D10 A;  4F7Z A;  1Z1Q A;  3SVO A;  1WF9 A;  4CHK A;  2A48 A;  2C5L C;  3DQM A;  4NWS A;  1UEL A;  3A9K B;  3X23 A;  2IO1 B;  1G7K A;  3NT3 A;  3HHM A;  2DYM A;  1F09 A;  4W6I A;  2KDF B;  3TMR A;  4RMA A;  2MA9 B;  4B6W A;  2D3G A;  4OJ0 A;  3AXC A;  2RH7 A;  2VVI A;  2O24 A;  1EMM A;  1BFP A;  4W73 A;  3QX1 A;  3SSH A;  2A53 B;  1Q0W B;  4ZDV A;  1XMZ A;  3H1O A;  2LRW A;  3MGF A;  1ZGU B;  1WX7 A;  2ARL A;  1OXF A;  3PZD A;  4DBG A;  2VAD A;  2KTR B;  4GN1 A;  2JUO A;  2AWM A;  1HUY A;  4MGI E;  2KZR A;  2V4E B;  2LAS A;  3WIM A;  2XEW A;  5LXI B;  4RM9 A;  4JRB A;  1EMC A;  3QHT A;  3CGL A;  1F0B A;  2POX A;  3U8A A;  3L54 A;  3QJZ A;  3H9D A;  2LZ6 A;  3CD1 A;  4MH0 E;  2ZVN A;  1YHH A;  4W7C A;  3WA0 A;  4I6P A;  3DPX A;  4K7S A;  1LQB A;  1WGH A;  1YD8 U;  5CHF A;  4EZJ A;  2Y0G A;  3B08 A;  3PRZ A;  2O2V A;  4LQU A;  2OJR A;  4HQ8 A;  3EK8 A;  1V9J A;  2Z6Y A;  2BWE S;  3SVD A;  2K25 A;  3M62 B;  3DQN A;  2YFP A;  2OKW A;  1U4A A;  1YFP A;  3Q3F A;  2LJ5 A;  2KHW B;  2FWQ A;  3DVN V;  2AL3 A;  4U2V A;  2KC2 A;  1JBY A;  3ZUF A;  3APD A;  5JH5 C;  2DDC A;  5J18 A;  4IK8 A;  2WSO A;  4GDK B;  2DHZ A;  4A20 A;  3OAW A;  1G6J A;  2HGD A;  4LJP B;  2C7M B;  3KYD D;  1I35 A;  3AU5 A;  3ED8 A;  4E71 A;  3P28 A;  5DQM A;  1Q1O A;  3SVN A;  3DQ2 A;  1WXM A;  3VH4 B;  3UQA A;  4MM3 A;  2EMS A;  2KC1 A;  4BBN F;  2WUR A;  4IM3 A;  3DQH A;  5D7G A;  5HZS A;  2XK5 B;  4W6A A;  4OGS A;  4K7W A;  2G4S A;  4DDG D;  3ZDT A;  4KIK B;  4RTC A;  5CHW A;  2L3Z A;  2DUG A;  2XBB C;  1KOT A;  3C0R B;  2QLH A;  2QLE A;  3APF A;  3UFZ A;  4IK3 A;  2H6V A;  2AWK A;  1H4R A;  2AL6 A;  3SG3 A;  3DVG X;  4XZ4 A;  4BFR A;  4DWF A;  2MP2 B;  4NPN A;  3DQD A;  3APC A;  4ORN A;  1V86 A;  4JQW C;  4P7I A;  1SIF A;  1WI0 A;  1WXS A;  4GXB A;  4IWQ A;  1CV7 A;  1Q73 A;  2LUE A;  2RSU A;  3SSP A;  5FHV A;  2C7N B;  3GJ2 A;  4E74 A;  3HIZ A;  4EZK A;  3M22 A;  1V2Y A;  2ZPY A;  2JAD A;  2A56 B;  3DQ7 A;  3IFW B;  5JHB A;  5GMV A;  2LD9 A;  1ZGO A;  4K81 A;  4WQO B;  4PYZ A;  2G6X A;  1K8R B;  4MGZ E;  5DTZ A;  4TZA A;  4Q7T A;  2HCG A;  2KVR A;  2LVP A;  1WGD A;  2Q6P A;  4GGQ A;  4KSL C;  2G3Q B;  1YIW A;  4TV3 A;  5DU0 A;  3NS8 A;  4HPL B;  1OXE A;  1JC1 A;  3DQK A;  4W7D A;  1EMF A;  1Q4A A;  5DTX A;  4ICU A;  2BYE A;  4LQT A;  5J17 A;  4W75 A;  3PT2 B;  4KF4 A;  3DQ1 A;  3ML8 A;  5C23 A;  5LTQ A;  3ZNG C;  1WJ6 A;  3EKH A;  3EEC A;  3K1K A;  2FUH B;  2BF8 B;  4W7E A;  3RUI B;  2C7H A;  4HWI B;  1KJT A;  2JRI B;  1T0Y A;  2NVU I;  1MOU A;  4H3L A;  5LTP A;  4TZG A;  4FUL A;  2W9N A;  5FVI A;  3DQA A;  2CS4 A;  3TMP B;  4WWO A;  4ICV A;  2R2Q A;  2WX0 A;  4G3X B;  3UIP B;  3SHQ A;  4OVV A;  4IK4 A;  4KGE A;  4PPJ A;  2ZEQ A;  3VUW A;  4NJ7 A;  4W7F A;  3SSY A;  4HXD A;  3CB9 A;  3O77 A;  3NEZ A;  3UQB A;  4KEX A;  3EVV A;  1GNU A;  4W9F A;  3EVU A;  4XOW A;  1RRB A;  5AZF A;  3ST2 A;  1OEY A;  1E8W A;  3U8C A;  4HVF A;  4JC2 A;  2NBV B;  4GDL A;  4RYS A;  1ZUX A;  1Q4C A;  4JLC A;  3ZIM A;  2MW5 A;  1TGZ B;  4ZIN A;  3ZTC A;  5H88 A;  4XVP A;  3E5W A;  2KJH B;  3ZDM C;  2ZMU A;  4BOZ B;  3DQL A;  5DPT A;  2LGD A;  2MBE A;  3DQE A;  5LXH A;  1WJN A;  2GBN A;  3RT3 B;  2IOV A;  1S6Z A;  1QXT A;  2GW3 A;  3O78 A;  3NF0 A;  3LA1 A;  1VD2 A;  2O2V B;  4FN2 A;  4W9J A;  2JF5 A;  4ZF5 A;  3W1S A;  2JXX A;  2K1F A;  1M94 A;  4N3D A;  4GOC A;  3DQV A;  2Z6X A;  2VVH A;  4EEW A;  3P8U A;  2YDZ A;  4UTS A;  2KFJ A;  4HCN B;  4FA6 A;  3EVR A;  3WAP A;  3HM3 A;  3SSL A;  2O2B A;  3OSQ A;  3GZN I;  5DRF A;  3BXB A;  2DD9 A;  2NS5 A;  2GW4 B;  4G50 A;  1LFD A;  4P1Q A;  2AYO B;  3ZW3 A;  4W6S A;  4GF6 B;  2M0X A;  1C3T A;  3DQI A;  2BYV E;  1WFY A;  3PLU A;  3CD9 A;  2G3O A;  4W9E A;  1J19 A;  5BQL A;  4W9G A;  3S2A A;  3OSR A;  4ANV A;  2QLI A;  2BWF A;  4FHJ A;  3ZO5 B;  4WJO A;  2KJ6 A;  2ZNV B;  5FVG A;  1Z1P A;  4XOV A;  4M0W B;  5LK4 A;  1Z5S B;  2CHX A;  5EB7 A;  3SG5 A;  4EDO A;  3VHT C;  3A9J A;  4LJC A;  3W1D A;  2LGY A;  5JZE B;  4EUT A;  4HDQ A;  4DHZ B;  4JIO U;  2C60 A;  1YJ2 A;  1WJ4 A;  4W6N A;  3DVN U;  4P76 A;  1S1Q B;  2NR2 A;  3AI5 A;  4BOS C;  1LM8 B;  3M63 B;  4AJW A;  2IE2 A;  5DPI A;  4W6T A;  2KFK A;  4NJ6 A;  2H9W A;  3N3K B;  4MEM A;  3ZRC A;  2IB5 A;  2ASQ A;  3NED A;  2HQK A;  4GU2 A;  3R66 C;  3WAO A;  4J6I A;  4W6L A; 
#chains in the Genus database with same CATH topology
 4P16 A;  1VRA B;  2CKH B;  4Z4M A;  5T3I A;  4KW9 A;  2H5P A;  3VDZ A;  1UF0 A;  3B0A A;  4GB9 A;  5EXC I;  3VFK A;  4WAA A;  3U0K A;  4IC7 B;  4H48 A;  2KNB A;  4PT5 A;  2RPQ A;  3HK0 A;  1P98 A;  2G1E A;  5DPH A;  4C4V A;  3NHE B;  3SSK A;  3SST A;  2HFC A;  1P3Q U;  1NI3 A;  1WMH A;  4HVB A;  4DXF A;  3ONS A;  1S3S G;  2BKF A;  3AED B;  5DPG A;  2JZP A;  3AKO A;  3TL5 A;  3SVR A;  2L05 A;  1L4D B;  3ZTF A;  1RLF A;  2GRI A;  3CST A;  1NI2 A;  4W6F A;  3NVY A;  4KZ0 A;  2ON8 A;  4L2Y A;  1V8C A;  1Q4D A;  3I5J C;  2V1Y A;  1OQY A;  4HJK A;  5EBJ A;  3NZ3 A;  1E90 A;  1L0X B;  3C19 A;  2L00 B;  2V4E C;  2A52 B;  1OQQ A;  4K1R B;  3RNA C;  3DDC B;  4MGK E;  3SVE A;  4O1N A;  1YMH E;  1Y8R C;  4YTP B;  1XF5 L;  3ENE A;  4I6L B;  2QU1 A;  4OZC A;  3BYY B;  4N9F 4;  5L83 A;  2PIA A;  2ZCC A;  3Q6B A;  4ZIO A;  4UDU C;  2KMC A;  1UH6 A;  1N5W A;  4J8A A;  1BXT A;  2H8Q A;  4F1S A;  2IY0 B;  1WGY A;  2OJW A;  3E5V A;  4EOY A;  3I19 A;  1ZGQ A;  1RWS A;  4PFE A;  4ANU A;  2HJO A;  5KHO A;  2WWZ A;  3PJB A;  3WLD A;  1I4H A;  1CJE A;  4GDL B;  2EEL A;  1D6E C;  4ZB1 A;  2WDV B;  3DQJ A;  2D5G A;  1QLB B;  4LNK A;  4W6K A;  5AQB B;  2I1K A;  4PPL A;  3E56 A;  2OHF A;  1YHI A;  4KGF A;  1QZE A;  1YX6 B;  4ANX A;  1HZ5 A;  3HVD A;  1D5Z C;  3DQ3 A;  1FFV A;  2D3B A;  1JML A;  4TMA B;  3PO0 A;  4IM0 A;  4HE4 A;  4DKM A;  2WP9 B;  3BYT B;  2QHO A;  2V4I B;  3GL4 A;  3SV5 A;  4OY4 A;  4GIV A;  1ET9 A;  1OGW A;  4RGO S;  4W7A A;  3U7Z A;  2GX0 A;  1KP5 A;  1K50 A;  4XDD A;  3EA6 A;  3QAR A;  2I1J A;  1WX8 A;  5DPR A;  2M4N A;  2PE9 A;  2D3C A;  5BMG A;  2N7E A;  2LMC A;  3RD2 A;  1Q4E A;  2J42 A;  1E6E B;  1UUP A;  3NY5 A;  3V62 A;  3H1R A;  4EN1 A;  2QC8 A;  2C9I A;  2N7D A;  2PXW A;  1I4R A;  5HGE A;  3AEG B;  4ANW A;  1UWM A;  4AJY B;  1TYG B;  1YJJ A;  5DPJ A;  1F0Z A;  2DZK A;  4W6J A;  4Q7U A;  3QC8 B;  2MRP A;  2Z8L A;  1PGA A;  3RCZ A;  1GPX A;  1SE3 A;  2DAJ A;  3ZJT A;  1ZGP A;  1LGR A;  3PLV A;  4WJN A;  4ZYN A;  3DOW A;  4KKI A;  4W9H A;  2GLS A;  2INN E;  1E8Y A;  3GB1 A;  4FJV B;  1WE6 A;  1ZP0 B;  1B1Z A;  1EMK A;  1XD3 B;  2PJH A;  3OLM D;  4W72 A;  3B1L X;  1XQQ A;  2EMD A;  3AH7 A;  2LXC A;  4DQO C;  1E5W A;  4YSY B;  1A70 A;  2ICR A;  4WWN A;  3LVA A;  3KYC D;  3PJ7 A;  1KLU D;  2JPH A;  2RDB C;  3DBH I;  3L16 A;  3HRD D;  1AW7 A;  1UBI A;  3N1X C;  2FL1 A;  5HBD A;  1XSS A;  3I3T B;  5FR6 A;  1JW9 D;  5J2O A;  3RUL A;  3DQ8 A;  4B5Y A;  3ZRF A;  3TJP A;  2WXN A;  4JWU C;  2IGH A;  3HM6 X;  4DXA B;  2IBI B;  1EME A;  4DXN A;  4GOB A;  2H5O A;  3EK7 A;  3KUZ A;  4Q9W A;  1R4N B;  4Q9X A;  1WYW B;  4KV2 A;  1WY8 A;  1L6V A;  4TUU A;  3QAQ A;  2ZMW A;  2J7Q B;  5EE0 A;  4XL5 A;  4LJD A;  3IG3 A;  3A1Q A;  5H89 A;  2KWC A;  4IM2 A;  2DAF A;  3PHW B;  2CR5 A;  2K8B A;  4LDT D;  3A9J B;  1XQM A;  4Q7R A;  2OGR A;  2HTM E;  2WXR A;  3WAN A;  2LXA A;  3RNB C;  4IUM B;  4G0N B;  2GBJ A;  3DPD A;  3OG5 A;  3KUD B;  2KDI A;  3PTF C;  4L1B A;  1L2N A;  4KZC A;  4MSQ B;  3V05 A;  4HCP B;  1E7U A;  3T9L A;  4HRS A;  2B3P A;  1E7V A;  4IG7 B;  5H92 C;  1WGR A;  2EKE C;  1D5M C;  1VDV A;  5BO4 B;  2NTS A;  1V81 A;  2M8S A;  4CO7 A;  3RNF C;  3BZD B;  4B0E A;  2FZU A;  4KA9 A;  2N9X A;  2GBK A;  3N30 A;  4C80 A;  2KFK B;  1NDD A;  2KN4 A;  4IK5 A;  3I57 A;  2B3Q A;  1HEZ E;  2UWQ A;  1UZX B;  3U30 A;  3SG6 A;  3KCT A;  4HDO A;  2H89 B;  2WDQ B;  1EMA A;  4L12 A;  3JSV A;  1OXD A;  3TUO A;  4TQ1 A;  1RMP A;  2G2S B;  3VUX A;  3UG0 A;  4MH8 A;  1RFA A;  3N32 A;  5GXG B;  5CTR C;  3B2F A;  2C9J A;  1FEH A;  1K53 A;  1WR1 A;  4IWO A;  5EXU A;  1KYR A;  1XLQ A;  1EO6 A;  4M02 A;  2K5P A;  2KD0 A;  2X38 A;  3M24 A;  1FRD A;  3ZKJ C;  4W6U A;  1MG8 A;  2GX2 A;  2WXQ A;  2J0M A;  4C4V B;  1PGX A;  2QEJ C;  3ZNZ B;  4A9A A;  3ADF A;  1WMH B;  1SJH D;  3VXW A;  1FM0 D;  2V4L A;  4W6D A;  2LEK A;  1X1M A;  3PZ8 A;  3WCK A;  3AI4 A;  1XCT L;  4KGR A;  4DXG A;  3R7R A;  4CYE A;  4A8X C;  4DXM A;  2NPT A;  1YHG A;  2KDE B;  3DHH C;  3VR8 B;  2Z0D B;  1V80 A;  1UIS A;  2NCN A;  2REX A;  2QRF A;  2JRH A;  4PS7 A;  1SSN A;  1YN4 A;  4W6H A;  2BBC A;  2FNJ B;  4NAW A;  2DLB A;  2PEA A;  2AH8 A;  1QY3 A;  3DPW A;  5LLI A;  1BT0 A;  4ZRJ A;  4AS8 A;  2D3A A;  4W77 A;  1HXY D;  2LGX A;  2JVC A;  4RCO A;  4ZFS A;  3VVW B;  1ESF A;  3QQ8 B;  2ICI A;  1T0S C;  2WXM A;  2J0J A;  3CMM B;  3SR6 A;  4ASW C;  2BVC A;  2LVO A;  2DUE A;  5HI1 A;  4NY0 A;  1ZXI A;  4MEL A;  1JWU D;  4JEO A;  4P1C C;  1V1P A;  2LUM A;  3N20 C;  1YN3 A;  3BIN A;  1KM7 A;  1RFK A;  3OWE B;  1UGM A;  3CFA A;  1WGK A;  1HE8 A;  1OEY J;  5IP4 D;  5T8I A;  2BW2 A;  2D07 B;  3LSA A;  3ZNH B;  4W9I A;  4B95 A;  3N1Y C;  4W74 A;  2RD0 A;  2V9H A;  3ST3 A;  2DNF A;  3DQO A;  4FHK A;  4WAF A;  2D2Q A;  1XLN A;  3EVP A;  5HW9 A;  2OTB A;  4C7Z A;  2V3S A;  5DQB A;  2IYD B;  1WJU A;  5HZU A;  2G6Y A;  1JBZ A;  4OHJ A;  5C2T B;  2ZPN A;  1DOY A;  1UBQ A;  2GBR A;  3V3D A;  2N1W A;  4KKJ A;  3ST4 A;  1KLG D;  3AEE B;  2WHT A;  3V61 A;  2K8H A;  2Q57 A;  1HCJ A;  2RDH A;  1NEN B;  4DKN A;  1ROE A;  1SF0 A;  1FD6 A;  5KTG A;  3N1Z C;  1YX5 B;  3P4P B;  3SD5 A;  4LJB A;  2MBB B;  2DYO A;  1C4P A;  4TKN A;  1FPY A;  4X57 B;  1YZW A;  2DEN B;  2WX1 A;  2H5R A;  3JYU A;  3PJ5 A;  3EKJ A;  4NQK E;  2KO3 A;  3H8H A;  3IAM 1;  3W9C B;  3FKY A;  2AWT A;  2AWL A;  3JW0 X;  3AUL A;  4RGN A;  2GB1 A;  3DQF A;  1HZ6 A;  1GB1 A;  4ZRI A;  1V49 A;  5IA7 A;  4L13 A;  1D5X C;  2K9X A;  2FIF A;  2QCZ A;  4TQ0 A;  4KGT A;  1CMX B;  2WU5 B;  3CSF A;  4LCD E;  4YSX B;  4L1I A;  2WIS A;  2TSS A;  4W7R A;  2G5Z B;  4IK1 A;  2LVQ A;  1UWX A;  2K6D B;  1RMO A;  2L0T A;  1I7H A;  4KW4 A;  2ZCB A;  3KH0 A;  2DUF A;  2DX5 B;  1V1O A;  2JT4 B;  1WH3 A;  3DBR I;  1W7T A;  1WIA A;  4YTN B;  4E3C A;  3U0N A;  4BKS A;  4FJY A;  4R6B A;  2WIQ A;  5E6O A;  2KDB A;  3JVZ X;  1HTQ A;  2RDG A;  1VCB A;  4LDT B;  3DBL B;  2WXP A;  4NZL B;  3SFD B;  1JWB D;  3T3N A;  1WX9 A;  4PS3 A;  3AE6 B;  4A3O A;  1E10 A;  1YNT E;  2N7J A;  1Z2M A;  1XCQ L;  2OJK A;  4M00 A;  2KTF A;  2GMI C;  1MHX A;  4S17 A;  5DRG A;  4WWP A;  2VAE A;  1WZ3 A;  3UIN B;  4BDU A;  3KUC B;  2KJR A;  1WRI A;  4ITK A;  1IYF A;  3OJ3 A;  3PS6 A;  2HDE A;  4ZHP A;  5C1Z A;  1DOI A;  2N4F A;  4W6C A;  4MGY E;  1YJF A;  1CZP A;  2BTE A;  5D3I B;  5AZH A;  2O6V A;  4BKS D;  2QMT A;  1MVK A;  3U7D A;  2B76 B;  3V6C B;  3A1Q B;  1L5P A;  3WAL A;  5HZO A;  4W9D A;  2W54 A;  3Q3O C;  5LTR A;  1RYJ A;  3MHS D;  3U0L A;  4LW5 A;  2L0F A;  4KX6 B;  2KLC A;  3DQ9 A;  2Y5C A;  4ZOH C;  2KX3 A;  1J0G A;  3DBS A;  1Y56 A;  1XA9 A;  2CHW A;  3RZF A;  3VTU A;  1WM2 A;  2WYQ A;  1GAQ B;  1P7E A;  4WJP A;  1GG3 A;  1F9J A;  5H8Y E;  2KX0 A;  4ZBL A;  4JGE A;  3BK2 A;  4RFB A;  5BYQ A;  2WXK A;  3PRM B;  1L0Y B;  5EE9 A;  4RM8 A;  3U0M A;  2BKR B;  2FCS A;  4II3 B;  2J53 A;  1JWA D;  3L13 A;  3V60 A;  3ZTD A;  4FBJ B;  3PIB A;  4OHS A;  5DTL A;  2BPS A;  4LTU A;  4HQ9 A;  2CJN A;  3P4Q B;  4ZYS A;  3KWV A;  1RRX A;  2DD7 A;  1GC7 A;  4BBN C;  1MJD A;  2G45 B;  3JSV B;  2IGD A;  2IJ0 A;  3G9A A;  2IO0 B;  4BAX A;  1PYW D;  4RF1 A;  2NBW B;  5E6N A;  1YQB A;  2H88 B;  3IBE A;  3WCQ A;  2HPW A;  3RWA A;  1Q10 A;  2R61 A;  4W6O A;  3NUH B;  1JC0 A;  4J89 A;  2IZV B;  4XX5 A;  4W6M A;  5EJU A;  3KCS A;  1M4V A;  2DZM A;  3AV8 A;  1C1Y B;  2A46 A;  1ET6 A;  4US9 A;  2A50 B;  5FR3 A;  1KYP A;  3GJ1 A;  3SVU A;  2HQZ A;  2INC C;  2MBH A;  3AE1 B;  4C7Y A;  2OKY A;  3E9S A;  1EU4 A;  3BVM A;  3SVC A;  3K9O B;  1V5T A;  4KF5 C;  2QZ0 A;  4L23 A;  3SVB A;  1WGG A;  3EK4 A;  2HE7 A;  4W76 A;  1ZDX A;  5BTT A;  1LXD A;  3PVL A;  1H8C A;  4DHJ B;  5I4D A;  1GL4 A;  1NEK B;  2KXJ A;  2NPT B;  3UGB B;  3EC8 A;  1T3Q A;  2JZZ A;  5G55 A;  2YLM A;  2K8C A;  4NJC A;  3P63 A;  2L32 A;  1C76 A;  3AU4 A;  2HGY A;  4BVU C;  1E0Z A;  3BX9 A;  5KHQ A;  4NAW B;  1WXQ A;  1EF5 A;  3SDL C;  3IP2 A;  1YOV B;  2G16 B;  2K39 A;  2M0A A;  3IHP C;  5BT0 A;  1R4M B;  1KH0 A;  3M3J A;  3BWU D;  1KYS A;  3SSV A;  5HZT A;  1L4Z B;  1L7Y A;  3L4P A;  5EHU A;  4FLH A;  3PRP B;  4GLS C;  4B30 A;  5G2N A;  3GOE A;  3QK0 A;  1FNW A;  4EZL A;  2AHA A;  1QYO A;  3ALB A;  2RGF A;  1IP9 A;  5FVF A;  1R4N I;  2WS3 B;  2INP E;  2PVG C;  4AWJ A;  1JCK B;  1ZW7 A;  3D32 A;  1V5O A;  1WXA A;  1V1P B;  3C8Y A;  5BYS A;  1E8Z A;  1E8X A;  2LHE A;  4WIP A;  2EMN A;  3AM9 A;  2VH1 A;  4M8M A;  2N9L A;  4LK0 M;  2M1M A;  3PRE A;  3UF8 A;  3W1S C;  1KLV A;  2KKC A;  1JAL A;  3SU8 X;  4RNA A;  4M8N A;  1IPG A;  4HPM B;  4YXD B;  3A4R A;  5IO9 A;  3AEC B;  2DUI A;  3WLC A;  2BYF A;  4EDS A;  3IAS 1;  2YE0 A;  2FAZ A;  1WRD B;  3W1C A;  2FUG 1;  2IY1 B;  3DQU A;  5AUK A;  2B3A A;  3X0W A;  2YEP B;  2KQ7 A;  2IND C;  1P0R A;  2EKI A;  3ETR A;  4ARI A;  1J8C A;  3SG2 A;  3H7S A;  4ZF4 A;  3U8P A;  2HD5 B;  1RM9 A;  4AUQ C;  2LGS A;  2KMA A;  4IK9 A;  1UD7 A;  1EM7 A;  2BGF A;  2FE8 A;  5EXB A;  5EB6 A;  1I42 A;  1VJK A;  1FMA D;  3AE2 B;  5IN7 A;  1QIL A;  2NMQ A;  1WR6 E;  3IVF A;  3ZNI D;  3Q8F A;  3ZQ4 A;  1GOZ A;  3SS0 A;  2H5Q A;  1H4U A;  4HPP A;  4ZRP A;  3NZU A;  2QLG A;  3QWZ B;  1TZ1 A;  4XGY A;  2Z6Z A;  4W6B A;  2G6E A;  1C9F A;  3Q8E A;  5DPW A;  3URY A;  4EKU A;  1H6R A;  4PYU A;  1EUV B;  2RR9 A;  4LNN A;  2A4Z A;  4KDI C;  2XN9 C;  4YL8 A;  3TEZ A;  1T5X D;  4EFO A;  1FXT B;  3ECI A;  4HRO A;  2QT2 A;  5LNK 1;  2L8J A;  3BVZ A;  2MWS B;  4AS1 A;  2KAN A;  3ZUJ A;  3GE8 C;  4URK A;  3SG7 A;  2WXJ A;  4AR7 A;  3GB3 A;  1XEE A;  4OZA A;  2QJL A;  3NS1 A;  1EMB A;  4HLE A;  4PS8 A;  1A5R A;  3EFU A;  1P9D U;  2JYT A;  2MCN B;  2PVO D;  2MX2 A;  3H1U A;  3VQI A;  5EDS A;  5IKC M;  4K3B A;  5TR5 A;  2P4M A;  4W9K A;  3W5V B;  2G3D B;  3MFG A;  1TS4 A;  1I4Q A;  3QIJ A;  4JL9 A;  3RNE C;  2G4D B;  3ZYY X;  4XC2 A;  4AP4 C;  3LVC A;  4ANJ A;  3H7P A;  1TY0 A;  2DZI A;  3DCG A;  2KLG A;  4IZN A;  3TIX A;  1P1A A;  1F2R I;  4KW8 A;  3ZUL A;  1WM3 A;  4RGT A;  2AWJ A;  4DDI D;  3P4R B;  2WU2 B;  2MLB A;  1WE7 A;  2JY6 A;  3A33 B;  3VIC A;  2BTJ A;  2HJ1 A;  5HG2 A;  2IB6 A;  1QOA A;  3VHT A;  3B9J A;  3RI7 C;  2N9P C;  2Z0E B;  1K52 A;  2BT6 A;  2O6V B;  3VH3 B;  2W82 A;  3L10 B;  5HFY A;  4XE0 A;  3BXC A;  4W9C A;  4JF9 A;  1I4G A;  1TY2 A;  4MJS A;  3ML9 A;  4BKT A;  1B9C A;  3U8Z A;  1GJZ A;  3LB8 C;  1FFU A;  4DXQ A;  3CFH A;  4HKQ A;  2KN5 A;  2KWD A;  2YEP F;  1AN8 A;  3R2T A;  1D3Z A;  5HKH A;  2BB6 A;  5IAA C;  2IDY A;  3GE3 C;  2KK8 A;  4NNJ B;  4C00 A;  2MBQ A;  2WXL A;  1TS3 A;  4W6P A;  1ZKH A;  1TTN A;  2QIL A;  1Q4B A;  2PW9 A;  4EUL A;  4KDL B;  3PV1 A;  3A9K A;  5AUI A;  1MOV A;  2CHZ A;  4JGH B;  1F77 A;  4RYW A;  1SGH A;  4WJQ A;  3O65 B;  1IBX A;  3A8S A;  3DQ4 A;  1GUA B;  2IGG A;  4LNF A;  3SG4 A;  3LF3 A;  3LVD A;  3CFF A;  2X8X X;  4DXO A;  1J7C A;  2A5U A;  2LHD A;  5G5H A;  3VRA B;  1NYQ A;  3NZS A;  1TBE A;  3SVS A;  1L6U A;  1IGC A;  1F2R C;  1ZDV A;  3DBH B;  4W9L A;  2BS3 B;  2JX5 A;  2PPH A;  1Q5W B;  1RAX A;  3FIL A;  2NTT A;  2UYZ B;  1OTR B;  1PUT A;  2EMT A;  4W69 A;  3AEA B;  1YQ4 B;  2FCM A;  4F8C B;  4ZHO A;  3NVV A;  3BY4 B;  2KTR A;  1QOB A;  2IO3 B;  3VAW A;  3VUY A;  3L0W B;  1N62 A;  5D6J B;  4FJZ A;  1T0R C;  5BTT B;  1AYF A;  2L7R A;  4G11 A;  4DK5 A;  3NOB A;  2E3T A;  3RZW C;  2JSV X;  2JYE A;  4JFG A;  3EHV A;  4IWP A;  1JRO A;  2AQ2 B;  3PPA A;  2V4E A;  4Z4K A;  3W1Y A;  3KWL A;  3DBL I;  4KF5 A;  1PDX A;  3VTW A;  2KVZ A;  1WSP A;  3MC9 A;  4ZRK A;  5DCN A;  2FCQ A;  4IW0 A;  4DHJ D;  2HTH A;  1OFF A;  3PHX B;  4OQW A;  2JZ3 B;  3QCA A;  1ENF A;  5L95 C;  5J2R A;  2KOX A;  5EE1 A;  1SIJ A;  1EML A;  3K9P B;  3S05 A;  1TZO A;  2A54 B;  2SAK A;  5D2M B;  3RFZ B;  4KVG B;  4NQL B;  5JHA A;  2BYT A;  4PPK A;  3LYY A;  3E5T A;  2M19 A;  3MTN B;  3ABV B;  3AE4 B;  3ZXR A;  4EE2 A;  2WXH A;  4B30 B;  3A4S C;  4B9K A;  3QA8 A;  4HQC A;  4LJO B;  2MBO A;  2WHU A;  2RPV A;  2YVC A;  2ZO6 A;  3OJ4 B;  2Y5B B;  1STE A;  2MH7 A;  3Q3J A;  2Z1O A;  1ZPS A;  4W6G A;  4MSM B;  4A3P A;  1CK1 A;  4A90 A;  2WSN A;  4LNO A;  4H3N A;  1QYF A;  1RM6 C;  1SE9 A;  3TBL D;  2WLB A;  2C9W B;  4ZF3 A;  4AOF A;  1QYQ A;  3EGR A;  2HJ8 A;  4BKG A;  5CX3 A;  3UIO B;  2ONQ A;  2OOB B;  1ZOY B;  3DWG C;  1WYG A;  1AAR A;  4GDK A;  3TMT A;  2HRS A;  4II2 B;  3CBE A;  5AEK B;  2DDD A;  2KAJ A;  2LI5 A;  2JWZ A;  4YWG G;  2ZJD A;  2CU1 A;  2VVJ A;  2WHS A;  4KPI A;  3O13 A;  2A47 A;  1ISN A;  2ZW1 A;  2LRU A;  3R3M A;  4DXI A;  5E6J A;  2KQS A;  3SRY A;  4W7X A;  2J0K A;  3R7Q A;  2MQJ A;  4LLG M;  3NT9 A;  3ZLZ A;  1JRU A;  2WXO A;  1VZ8 A;  4J88 A;  3DVG Y;  3PSE B;  1D4B A;  2WDR B;  4YT0 B;  1GGX A;  2XK5 A;  2AX5 A;  1WZ0 A;  3WAM A;  1N61 A;  2ZNV C;  4OVU A;  1XAE A;  3TCA A;  3T8M A;  4HK2 A;  3M95 A;  1FCL A;  4OVZ A;  4I6N B;  3W2D A;  2GOW A;  4KIK A;  4JE3 B;  2ZZP B;  2FID A;  2EMO A;  2QLG B;  4HKZ E;  3L08 A;  1IGD A;  2KWV B;  3V6E B;  3V3X A;  4N58 A;  4FAD A;  4GMV A;  1EWY C;  4JWS C;  5DPS A;  2Z59 B;  3VK1 A;  2OTE A;  4H3M A;  3P2B A;  1PQS A;  3KW5 B;  3DPZ A;  4DXP A;  2NBU A;  1AWD A;  4I2Y A;  1FNU A;  3L17 A;  2FCN A;  2PE6 B;  3BK1 A;  3R2I A;  2MP2 A;  4MDK E;  1W7S A;  1QKZ A;  4WUR A;  5D94 A;  5E6P A;  3PGE A;  2VRR B;  5F9G A;  1XT9 B;  4LJD C;  2L76 A;  4AQ7 A;  3ST0 A;  2DUH A;  2N9E B;  3Q14 C;  1C4A A;  2ZVO A;  4R6D A;  1JWM D;  1RMM A;  3RYT A;  3OGO A;  2PXS A;  3ZVV A;  2D11 A;  5H87 A;  3LDZ E;  3CF6 E;  2DYB A;  4N59 A;  2O29 A;  1YJ1 A;  2VZX A;  3KVF B;  1N5X A;  2AEH A;  2K6Q A;  3RWT A;  4W6R A;  2L83 A;  5DY6 A;  3U52 E;  2W55 A;  4KSK C;  2GBM A;  4K7U A;  3VTV A;  3H6N A;  4IKG A;  4RF0 A;  5DTY A;  3GEX A;  1EMG A;  3H7P B;  3B2G A;  1MPE A;  3DQ5 A;  3FAH A;  1L0V B;  1R4M I;  5AZG A;  1JQ4 A;  4GSW A;  3DQC A;  3LS3 A;  5FK9 C;  4DHZ E;  3ZJU A;  2LJI A;  2WNM A;  3P1M A;  1GC6 A;  4KAG A;  2WXG A;  4EMQ A;  3VHT B;  1SJE D;  3DWM A;  1MYW A;  2LWP A;  1N6Z A;  4GES B;  1WXV A;  2SEB D;  2KWU B;  3ZUN A;  2MEK A;  4MJS B;  2CJO A;  4YTM B;  2R2O A;  3LJ3 A;  2WDT B;  3DQ6 A;  2YE1 A;  4WH4 A;  3IR8 A;  3ZXV A;  1W7U A;  3MJW A;  5CHV C;  3SFE B;  2M17 A;  4H47 A;  2MSE D;  2JWU A;  2O6V D;  1C78 A;  4H2A A;  1EF1 A;  1J7A A;  1TJE A;  1V6E A;  1GFL A;  3BXA A;  2IO2 B;  1C4F A;  2DZJ A;  2ZO7 A;  3LF4 B;  2N1V A;  1ACC A;  1NBF C;  2D10 A;  3TEX A;  4F7Z A;  1Z1Q A;  3SVO A;  1WF9 A;  2QIE B;  4CHK A;  3J9C A;  2C5L C;  2A48 A;  3DQM A;  4NWS A;  1I4P A;  1UEL A;  3GZN B;  3A9K B;  3X23 A;  2IO1 B;  1G7K A;  3R8B A;  3AE7 B;  3NT3 A;  3HHM A;  2JXT A;  3CIR B;  2DYM A;  1F09 A;  1IBX B;  4W6I A;  1T0Q C;  2KDF B;  3TMR A;  3RPF C;  1QT9 A;  4RMA A;  2MA9 B;  4B6W A;  2D3G A;  1PGB A;  2KYW A;  4OJ0 A;  1P7F A;  2KQ4 X;  3DBR B;  3AXC A;  4N6E B;  4CQN A;  2RH7 A;  2VVI A;  2O24 A;  1EMM A;  1BFP A;  4W73 A;  3QX1 A;  5C3J B;  3SSH A;  2A53 B;  4S0R A;  1Q0W B;  4ZDV A;  1FXA A;  3FIL B;  1XMZ A;  3GP7 A;  3H1O A;  2LRW A;  3NVZ A;  3MGF A;  3EUB 2;  2JQR B;  1ZGU B;  1WX7 A;  2ARL A;  3NRZ A;  1OXF A;  3PZD A;  4DBG A;  2VAD A;  2KTR B;  4LNI A;  4QAY A;  1XLP A;  4GN1 A;  2JUO A;  4K3C A;  2AWM A;  1HUY A;  4A6Q A;  2LGI A;  4MGI E;  2W3R A;  2KZR A;  5G5G A;  5MPO A;  2V4E B;  3I63 C;  3RN9 C;  2LAS A;  3WIM A;  2XEW A;  5LXI B;  4B0M A;  4RM9 A;  4JRB A;  3AEB B;  1EMC A;  3AN1 A;  1KRH A;  3IT6 B;  3QHT A;  3CGL A;  2N9K A;  1F0B A;  2POX A;  3Q8A A;  4ZRQ A;  4YSZ B;  2K22 A;  3MC8 A;  3U8A A;  3L54 A;  1C77 A;  3H9D A;  3QJZ A;  2LZ6 A;  3CD1 A;  4MH0 E;  2ZVN A;  1YHH A;  4W7C A;  1NYR A;  3BII D;  2K0P A;  4I6P A;  3WA0 A;  1FRR A;  3DPX A;  2XNA C;  4K7S A;  1LQB A;  4OZB A;  3MHZ A;  1WGH A;  1YD8 U;  5CHF A;  4EZJ A;  4BZA A;  2Y0G A;  3B08 A;  2E6X A;  3PRZ A;  2O2V A;  4LQU A;  2OJR A;  1E9M A;  3HUI A;  4HQ8 A;  3EK8 A;  1XO3 A;  1V9J A;  4IOI E;  2Z6Y A;  2BWE S;  1JRP A;  3SVD A;  1N63 A;  2K25 A;  3M62 B;  4XWW A;  3DQN A;  1SEB D;  2YFP A;  1E7P B;  3Q3N C;  2OKW A;  1U4A A;  1YFP A;  3Q3F A;  2LJ5 A;  2KHW B;  2FWQ A;  3DVN V;  2AL3 A;  4RGM A;  4U2V A;  3TSS A;  2KC2 A;  2WGS A;  4P6V F;  1JBY A;  3GS2 A;  3ZUF A;  3APD A;  5JH5 C;  2DDC A;  5J18 A;  4IK8 A;  1EU3 A;  2PTL A;  3EFC A;  2WSO A;  4GDK B;  4J3O D;  2DHZ A;  4A20 A;  3OAW A;  1G6J A;  2HGD A;  4LJP B;  2C7M B;  3KYD D;  1I35 A;  3AU5 A;  3U2S C;  3ED8 A;  4E71 A;  3P28 A;  2I2Y A;  5DQM A;  1Q1O A;  2VZK B;  3SVN A;  3DQ2 A;  2JU6 X;  3NG0 A;  4P1B C;  1WXM A;  1VLB A;  3VH4 B;  3ZJV A;  3UQA A;  4MM3 A;  3BVG A;  2WHI A;  2EMS A;  2KC1 A;  4BBN F;  1FO4 A;  2WUR A;  4IM3 A;  4XDC A;  3DQH A;  5D7G A;  3RNG C;  5HZS A;  2XK5 B;  3Q8C A;  4W6A A;  4OGS A;  5BYR A;  2BQQ A;  4K7W A;  2G4S A;  4DDG D;  3RNC C;  3ZDT A;  4KIK B;  4RTC A;  5CHW A;  3MP9 A;  2L3Z A;  3SEB A;  1SBB B;  1WWT A;  2DUG A;  2XBB C;  1KOT A;  2G9H D;  3C0R B;  2QLH A;  2QLE A;  3APF A;  3UFZ A;  4IK3 A;  2H6V A;  2AWK A;  1H4R A;  3UI3 A;  2AL6 A;  4XGA B;  3SG3 A;  4M0W A;  3DVG X;  4HJG E;  4XZ4 A;  4BFR A;  4DWF A;  2MP2 B;  4NPN A;  3DQD A;  3AE5 B;  3APC A;  1YN5 A;  3VRB B;  4ORN A;  1V86 A;  4JQW C;  5EE3 A;  4P7I A;  4HEA 1;  1SIF A;  3AE9 B;  3IXS A;  5JXV A;  1WI0 A;  3NVW A;  1WXS A;  4GXB A;  4IWQ A;  1CV7 A;  1Q73 A;  2LUE A;  2RSU A;  3SSP A;  5FHV A;  2C7N B;  3GJ2 A;  4E74 A;  3HIZ A;  4EZK A;  3M22 A;  2Y3A A;  1V2Y A;  2WXF A;  2ZPY A;  3AE8 B;  3LXF A;  2JAD A;  2A56 B;  3DQ7 A;  3IFW B;  5JHB A;  5GMV A;  3AE3 B;  2OED A;  2LD9 A;  1ZGO A;  4K81 A;  4WWM A;  4WQO B;  2V3P A;  4PYZ A;  2IPK D;  4NAM A;  2UU7 A;  1FCC C;  2G6X A;  1K8R B;  4XWT A;  4MGZ E;  2VH2 A;  5DTZ A;  4TZA A;  1SB3 C;  4Q7T A;  2HCG A;  2KVR A;  2LVP A;  1XLO A;  4TSS A;  1K51 A;  1WGD A;  2Q6P A;  4GGQ A;  4REZ A;  5IOI A;  4KSL C;  2G3Q B;  1YIW A;  3PZ7 A;  3CWI A;  4TV3 A;  5DU0 A;  3I9V 1;  3NS8 A;  4USA A;  4ARC A;  4R3D A;  4HPL B;  1OXE A;  4A55 A;  1JC1 A;  1TKE A;  3DQK A;  4W7D A;  2L52 A;  1EMF A;  1Q4A A;  5DTX A;  1F1H A;  2Y5P A;  4ICU A;  2BYE A;  4LQT A;  4XYC A;  5J17 A;  4W75 A;  3PT2 B;  4KF4 A;  3DQ1 A;  3N9Y C;  3ML8 A;  5C23 A;  5LTQ A;  1KFY B;  3ZNG C;  1WJ6 A;  3EKH A;  3EEC A;  2MJD A;  1SE2 A;  4JX1 C;  3K1K A;  1DGJ A;  2ACZ B;  2FUH B;  4MAC A;  2BF8 B;  4W7E A;  3RUI B;  2C7H A;  4HWI B;  1KJT A;  1DYQ A;  2JRI B;  2N0S B;  1T0Y A;  2NVU I;  1OQR A;  1TS5 A;  1MOU A;  4H3L A;  5LTP A;  1CQV A;  4TZG A;  1EWC A;  4FUL A;  2W9N A;  1SE4 A;  1TKY A;  4Q2J A;  2KDM A;  5FVI A;  3DQA A;  2ZW0 A;  2CS4 A;  3RMK C;  3TMP B;  4WWO A;  4US8 A;  4ICV A;  2R2Q A;  2WX0 A;  4G3X B;  3MJ5 A;  4IDI A;  2QSD A;  3UIP B;  3SHQ A;  4OVV A;  2PLP A;  4IK4 A;  4KGE A;  4M01 A;  4PPJ A;  2ZEQ A;  3VUW A;  4NJ7 A;  5D3D A;  4W7F A;  3SSY A;  4HXD A;  3CB9 A;  3MC0 B;  1BML C;  3O77 A;  3NEZ A;  3UQB A;  4RH6 A;  4KEX A;  2MHJ A;  3EVV A;  2RMM A;  1GNU A;  4W9F A;  3EVU A;  2MJ3 A;  4XOW A;  1RRB A;  2AQ3 B;  4PK1 A;  5AZF A;  3ST2 A;  1J7B A;  1OEY A;  1E8W A;  3U8C A;  2BS4 B;  4HVF A;  5TSS A;  4JC2 A;  2NBV B;  4GDL A;  4RYS A;  4C56 C;  1ZUX A;  2V0G A;  1Q4C A;  4JLC A;  3ZIM A;  3TEY A;  1TKG A;  2CU3 A;  3VR9 B;  2MW5 A;  1TGZ B;  2I38 A;  2WXI A;  3HVZ A;  5HHD G;  4ZIN A;  3ZTC A;  5H88 A;  1IUE A;  3P4S B;  4XVP A;  2DBY A;  3E5W A;  4FXC A;  2KJH B;  1KTK A;  2FBW B;  1DOX A;  3ZDM C;  1QOF A;  1HTO A;  2ZMU A;  4MT5 A;  4BOZ B;  3Q8B A;  2KMM A;  3AEF B;  3DQL A;  5DPT A;  2K3U A;  1HA5 A;  2LGD A;  3DQE A;  2MBE A;  4JPS A;  2M56 B;  5LXH A;  4KGS A;  1WJN A;  2GBN A;  3RT3 B;  2IOV A;  1S6Z A;  1QXT A;  2GW3 A;  3Q2A C;  3O78 A;  4OW0 A;  3NF0 A;  1FIQ A;  1FNV A;  3NJT A;  3KLS X;  3LA1 A;  1VD2 A;  2O2V B;  4FN2 A;  4W9J A;  2JF5 A;  4ZF5 A;  2LFI A;  3U4E G;  3W1S A;  1F52 A;  2JXX A;  2K1F A;  1LO5 D;  1M94 A;  3FC4 A;  3AB5 A;  4N3D A;  4GOC A;  3DQV A;  2Z6X A;  2VVH A;  4EEW A;  3Q3M C;  3P8U A;  2YDZ A;  4UTS A;  1TT5 B;  1YQ3 B;  2KFJ A;  1MFW A;  4HCN B;  3W5U B;  4FA6 A;  3KQ4 A;  5BMH A;  2BB5 A;  3EVR A;  3WAP A;  1XXG A;  3HM3 A;  3ZGZ A;  3SSL A;  2O2B A;  3OSQ A;  3GZN I;  5DRF A;  2DWQ A;  3BXB A;  1MHH E;  2DD9 A;  2NS5 A;  2GW4 B;  4G50 A;  1LFD A;  4P1Q A;  2AYO B;  2PKO A;  3ZW3 A;  4MM3 B;  1VZ7 A;  2KAC A;  4W6S A;  3T3O A;  1I4X A;  1NVI D;  4GF6 B;  1TS2 A;  2M0X A;  1C3T A;  2KT7 A;  1C79 A;  3DQI A;  2BYV E;  1WFY A;  4ACF A;  2VZK D;  3PLU A;  3CD9 A;  1MG4 A;  2BS2 B;  2QDF A;  2G3O A;  1VR9 A;  2MJE A;  4WQM A;  4W9E A;  1J19 A;  5BQL A;  4W9G A;  3S2A A;  1QF6 A;  3OSR A;  4ANV A;  2QLI A;  2BWF A;  4FHJ A;  3ZO5 B;  1B9R A;  3TEW A;  4WJO A;  2KJ6 A;  2ZNV B;  1T6B X;  1UNS A;  5FVG A;  2J4X A;  2L1A A;  3IT4 B;  2WQY B;  1Z1P A;  4XOV A;  4M0W B;  5LK4 A;  1Z5S B;  2CHX A;  5EB7 A;  3SG5 A;  1C4C A;  3Q69 A;  4EDO A;  1UGJ A;  3VHT C;  3A9J A;  1MI0 A;  2AQ1 B;  4LJC A;  3W1D A;  1ZUD 2;  2LGY A;  5JZE B;  4EUT A;  1YJI A;  4HDQ A;  3P42 A;  4DHZ B;  2GI9 A;  2Q5W D;  4JIO U;  2C60 A;  1YJ2 A;  1QOG A;  1WJ4 A;  4W6N A;  3DVN U;  4P76 A;  1S1Q B;  1GB4 A;  1PFD A;  2NR2 A;  3AI5 A;  1V97 A;  1HQR D;  3DHI C;  4BOS C;  1ZE3 D;  1LM8 B;  1JWS D;  1N60 A;  3M63 B;  4AJW A;  1BUI C;  2IE2 A;  5DPI A;  1TIF A;  4W6T A;  1R7S A;  2J52 A;  2KFK A;  1SXT A;  4D2K A;  2PMV A;  2V3N A;  2W3S A;  4NJ6 A;  2H9W A;  3N3K B;  5BMI A;  4MEM A;  1ZXH A;  2IB5 A;  3ZRC A;  2ASQ A;  1VZ6 A;  1KF6 B;  3NED A;  2HQK A;  4GU2 A;  5FKA C;  1QQR A;  3DHG C;  3AMZ A;  3R66 C;  3WAO A;  1FXI A;  4J6I A;  4W6L A; 
#chains in the Genus database with same CATH homology
 2CKH B;  4Z4M A;  5T3I A;  4KW9 A;  2H5P A;  3VDZ A;  3B0A A;  4GB9 A;  5EXC I;  3VFK A;  4WAA A;  3U0K A;  4IC7 B;  4H48 A;  2KNB A;  2RPQ A;  3HK0 A;  1P98 A;  5DPH A;  3NHE B;  3SSK A;  3SST A;  2HFC A;  1P3Q U;  1WMH A;  4HVB A;  3ONS A;  1S3S G;  2BKF A;  5DPG A;  3AKO A;  3TL5 A;  3SVR A;  2L05 A;  3ZTF A;  1RLF A;  3CST A;  1NI2 A;  4W6F A;  4KZ0 A;  1Q4D A;  2V1Y A;  1OQY A;  4HJK A;  5EBJ A;  1E90 A;  2L00 B;  2V4E C;  2A52 B;  4K1R B;  3DDC B;  4MGK E;  3SVE A;  1Y8R C;  3ENE A;  4I6L B;  2QU1 A;  4N9F 4;  5L83 A;  2ZCC A;  4ZIO A;  2KMC A;  1UH6 A;  4J8A A;  2H8Q A;  4F1S A;  2IY0 B;  1WGY A;  3E5V A;  4EOY A;  3I19 A;  1ZGQ A;  4PFE A;  4ANU A;  2HJO A;  5KHO A;  2WWZ A;  3PJB A;  3WLD A;  4GDL B;  4ZB1 A;  3DQJ A;  4W6K A;  5AQB B;  2I1K A;  4PPL A;  1YHI A;  4KGF A;  1QZE A;  1YX6 B;  4ANX A;  3DQ3 A;  4IM0 A;  4HE4 A;  4DKM A;  2QHO A;  3GL4 A;  3SV5 A;  4OY4 A;  4GIV A;  1OGW A;  4W7A A;  2GX0 A;  1KP5 A;  3QAR A;  2I1J A;  1WX8 A;  5DPR A;  2M4N A;  2PE9 A;  2N7E A;  3RD2 A;  1Q4E A;  3NY5 A;  3V62 A;  3H1R A;  4EN1 A;  2C9I A;  2N7D A;  2PXW A;  5HGE A;  4ANW A;  4AJY B;  5DPJ A;  2DZK A;  4W6J A;  4Q7U A;  3QC8 B;  2MRP A;  3RCZ A;  2DAJ A;  1ZGP A;  3PLV A;  4WJN A;  4ZYN A;  3DOW A;  4W9H A;  1E8Y A;  4FJV B;  1WE6 A;  1EMK A;  1XD3 B;  2PJH A;  3OLM D;  4W72 A;  3B1L X;  1XQQ A;  2EMD A;  2LXC A;  1E5W A;  2ICR A;  4WWN A;  3LVA A;  3KYC D;  3PJ7 A;  2JPH A;  3DBH I;  3L16 A;  1UBI A;  2FL1 A;  5HBD A;  1XSS A;  3I3T B;  5FR6 A;  5J2O A;  3RUL A;  3DQ8 A;  4B5Y A;  3ZRF A;  3TJP A;  3HM6 X;  4DXA B;  2IBI B;  1EME A;  4DXN A;  4GOB A;  2H5O A;  3EK7 A;  3KUZ A;  4Q9W A;  1WYW B;  4Q9X A;  4KV2 A;  1WY8 A;  4TUU A;  3QAQ A;  2ZMW A;  2J7Q B;  4XL5 A;  4LJD A;  3IG3 A;  3A1Q A;  5H89 A;  2KWC A;  4IM2 A;  2DAF A;  3PHW B;  2CR5 A;  2K8B A;  4LDT D;  3A9J B;  1XQM A;  4Q7R A;  2OGR A;  3WAN A;  2LXA A;  4IUM B;  4G0N B;  2GBJ A;  3DPD A;  3KUD B;  2KDI A;  3PTF C;  1L2N A;  4KZC A;  4MSQ B;  4HCP B;  1E7U A;  3T9L A;  2B3P A;  1E7V A;  4IG7 B;  1WGR A;  2EKE C;  5BO4 B;  1V81 A;  2M8S A;  4CO7 A;  2FZU A;  4KA9 A;  2N9X A;  2GBK A;  3N30 A;  2KFK B;  1NDD A;  4IK5 A;  2B3Q A;  2UWQ A;  1UZX B;  3U30 A;  3SG6 A;  3KCT A;  4HDO A;  1EMA A;  4L12 A;  3JSV A;  1OXD A;  4TQ1 A;  1RMP A;  2G2S B;  3VUX A;  3UG0 A;  1RFA A;  3N32 A;  5CTR C;  2C9J A;  1WR1 A;  4IWO A;  5EXU A;  1KYR A;  1EO6 A;  2KD0 A;  3M24 A;  3ZKJ C;  4W6U A;  1MG8 A;  2GX2 A;  2J0M A;  3ZNZ B;  3ADF A;  1WMH B;  3VXW A;  2V4L A;  4W6D A;  1X1M A;  3WCK A;  3AI4 A;  3R7R A;  4CYE A;  4DXM A;  2NPT A;  1YHG A;  2KDE B;  2Z0D B;  1V80 A;  1UIS A;  2NCN A;  2REX A;  2QRF A;  2JRH A;  4PS7 A;  4W6H A;  2FNJ B;  4NAW A;  2PEA A;  2AH8 A;  1QY3 A;  3DPW A;  5LLI A;  1BT0 A;  4ZRJ A;  4AS8 A;  4W77 A;  2LGX A;  2JVC A;  4ZFS A;  3VVW B;  3QQ8 B;  2J0J A;  3CMM B;  4ASW C;  2LVO A;  2DUE A;  4NY0 A;  4MEL A;  4JEO A;  3BIN A;  1KM7 A;  1UGM A;  3CFA A;  1HE8 A;  1OEY J;  2D07 B;  3LSA A;  3ZNH B;  4W9I A;  4B95 A;  4W74 A;  2RD0 A;  3ST3 A;  3DQO A;  4FHK A;  2D2Q A;  3EVP A;  5HW9 A;  2OTB A;  2V3S A;  5DQB A;  2IYD B;  1WJU A;  5HZU A;  2G6Y A;  1JBZ A;  2ZPN A;  1UBQ A;  2GBR A;  3V3D A;  2N1W A;  3ST4 A;  2WHT A;  3V61 A;  2K8H A;  2Q57 A;  1HCJ A;  4DKN A;  5KTG A;  1YX5 B;  3SD5 A;  4LJB A;  2MBB B;  2DYO A;  4TKN A;  4X57 B;  1YZW A;  2DEN B;  2WX1 A;  2H5R A;  3JYU A;  3PJ5 A;  3EKJ A;  4NQK E;  2KO3 A;  2AWT A;  2AWL A;  3JW0 X;  3AUL A;  3DQF A;  4ZRI A;  1V49 A;  5IA7 A;  4L13 A;  4TQ0 A;  2FIF A;  1CMX B;  3CSF A;  4LCD E;  4L1I A;  2WIS A;  4W7R A;  2G5Z B;  4IK1 A;  2LVQ A;  2K6D B;  1RMO A;  2L0T A;  4KW4 A;  2ZCB A;  3KH0 A;  2DUF A;  2DX5 B;  2JT4 B;  1WH3 A;  3DBR I;  1W7T A;  1WIA A;  4E3C A;  3U0N A;  4BKS A;  4FJY A;  4R6B A;  2WIQ A;  5E6O A;  2KDB A;  3JVZ X;  1VCB A;  4LDT B;  1WX9 A;  4PS3 A;  4A3O A;  1Z2M A;  2OJK A;  2KTF A;  2GMI C;  5DRG A;  4WWP A;  2VAE A;  1WZ3 A;  3UIN B;  4BDU A;  3KUC B;  2KJR A;  1IYF A;  3OJ3 A;  3PS6 A;  5C1Z A;  2N4F A;  4W6C A;  4MGY E;  1YJF A;  5AZH A;  2O6V A;  4BKS D;  3U7D A;  3V6C B;  3A1Q B;  3WAL A;  5HZO A;  4W9D A;  5LTR A;  3MHS D;  3U0L A;  4LW5 A;  2L0F A;  2KLC A;  3DQ9 A;  2KX3 A;  1J0G A;  3DBS A;  1XA9 A;  2CHW A;  3RZF A;  3VTU A;  1WM2 A;  2WYQ A;  4WJP A;  1GG3 A;  1F9J A;  2KX0 A;  4ZBL A;  4JGE A;  3PRM B;  4RM8 A;  3U0M A;  2BKR B;  2FCS A;  4II3 B;  3L13 A;  3V60 A;  3ZTD A;  4FBJ B;  3PIB A;  4OHS A;  5DTL A;  2BPS A;  4HQ9 A;  1RRX A;  2DD7 A;  1GC7 A;  4BBN C;  2G45 B;  3JSV B;  3G9A A;  2IO0 B;  2NBW B;  5E6N A;  1YQB A;  3IBE A;  2HPW A;  3RWA A;  4W6O A;  1JC0 A;  4J89 A;  2IZV B;  4XX5 A;  4W6M A;  5EJU A;  3KCS A;  2DZM A;  1C1Y B;  2A46 A;  2A50 B;  1KYP A;  3GJ1 A;  3SVU A;  2HQZ A;  2MBH A;  2OKY A;  3SVC A;  3K9O B;  1V5T A;  4KF5 C;  2QZ0 A;  3SVB A;  1WGG A;  3EK4 A;  2HE7 A;  4W76 A;  5BTT A;  1LXD A;  3PVL A;  1H8C A;  4DHJ B;  1GL4 A;  2KXJ A;  2NPT B;  3UGB B;  3EC8 A;  2JZZ A;  5G55 A;  2YLM A;  2K8C A;  3AU4 A;  2HGY A;  4BVU C;  3BX9 A;  5KHQ A;  4NAW B;  1EF5 A;  3SDL C;  3IP2 A;  2G16 B;  2K39 A;  3IHP C;  5BT0 A;  3M3J A;  1KYS A;  3SSV A;  5HZT A;  1L7Y A;  4FLH A;  5EHU A;  3PRP B;  4B30 A;  5G2N A;  3GOE A;  3QK0 A;  4EZL A;  2AHA A;  1QYO A;  3ALB A;  2RGF A;  1IP9 A;  5FVF A;  1R4N I;  4AWJ A;  1ZW7 A;  3D32 A;  1V5O A;  1WXA A;  1E8Z A;  1E8X A;  2EMN A;  4M8M A;  2M1M A;  3PRE A;  3UF8 A;  3W1S C;  1KLV A;  2KKC A;  3SU8 X;  4M8N A;  1IPG A;  4HPM B;  3A4R A;  2DUI A;  3WLC A;  2BYF A;  4EDS A;  2YE0 A;  2FAZ A;  1WRD B;  3W1C A;  2IY1 B;  3DQU A;  2B3A A;  3X0W A;  2KQ7 A;  1P0R A;  1J8C A;  3SG2 A;  3H7S A;  4ZF4 A;  3U8P A;  2HD5 B;  1RM9 A;  4AUQ C;  2KMA A;  4IK9 A;  1UD7 A;  2BGF A;  5EXB A;  5EB6 A;  1I42 A;  1WR6 E;  3IVF A;  3ZNI D;  3SS0 A;  2H5Q A;  1H4U A;  3NZU A;  2QLG A;  3QWZ B;  1TZ1 A;  4XGY A;  2Z6Z A;  4W6B A;  2G6E A;  5DPW A;  4EKU A;  1H6R A;  4PYU A;  1EUV B;  2RR9 A;  2A4Z A;  4KDI C;  4YL8 A;  4EFO A;  1FXT B;  3ECI A;  2QT2 A;  2L8J A;  2MWS B;  2KAN A;  3ZUJ A;  4URK A;  3SG7 A;  4AR7 A;  3GB3 A;  1EMB A;  4HLE A;  4PS8 A;  1A5R A;  3EFU A;  1P9D U;  2MCN B;  2MX2 A;  3H1U A;  3VQI A;  5EDS A;  5TR5 A;  2P4M A;  4W9K A;  2G3D B;  3QIJ A;  4JL9 A;  2G4D B;  4XC2 A;  4AP4 C;  3LVC A;  4ANJ A;  3H7P A;  2DZI A;  3DCG A;  2KLG A;  4IZN A;  3TIX A;  1P1A A;  4KW8 A;  3ZUL A;  1WM3 A;  4DDI D;  2AWJ A;  2MLB A;  1WE7 A;  2JY6 A;  3A33 B;  3VIC A;  2BTJ A;  2IB6 A;  3VHT A;  2N9P C;  2Z0E B;  2O6V B;  3VH3 B;  3L10 B;  3BXC A;  4W9C A;  4JF9 A;  4MJS A;  3ML9 A;  4BKT A;  1B9C A;  3U8Z A;  1GJZ A;  4DXQ A;  3CFH A;  2KN5 A;  1D3Z A;  5HKH A;  5IAA C;  2KK8 A;  4NNJ B;  2MBQ A;  4W6P A;  1ZKH A;  1TTN A;  1Q4B A;  4EUL A;  4KDL B;  3PV1 A;  3A9K A;  1MOV A;  2CHZ A;  4JGH B;  4RYW A;  1SGH A;  4WJQ A;  3O65 B;  3A8S A;  3DQ4 A;  1GUA B;  3SG4 A;  3LF3 A;  3LVD A;  3CFF A;  4DXO A;  2A5U A;  3NZS A;  1TBE A;  3SVS A;  4W9L A;  2PPH A;  1Q5W B;  1RAX A;  2UYZ B;  1OTR B;  2EMT A;  4W69 A;  2FCM A;  4F8C B;  3BY4 B;  2KTR A;  2IO3 B;  3VAW A;  3VUY A;  3L0W B;  5D6J B;  4FJZ A;  5BTT B;  2L7R A;  4G11 A;  4DK5 A;  3NOB A;  3RZW C;  4JFG A;  3EHV A;  4IWP A;  3PPA A;  2V4E A;  4Z4K A;  3W1Y A;  3DBL I;  4KF5 A;  3VTW A;  4ZRK A;  5DCN A;  2FCQ A;  4IW0 A;  4DHJ D;  2HTH A;  3PHX B;  4OQW A;  2JZ3 B;  3QCA A;  5L95 C;  5J2R A;  2KOX A;  1EML A;  3K9P B;  3S05 A;  2A54 B;  5D2M B;  4KVG B;  4NQL B;  5JHA A;  4PPK A;  3E5T A;  3MTN B;  4B30 B;  3A4S C;  4B9K A;  3QA8 A;  4HQC A;  4LJO B;  2MBO A;  2WHU A;  2YVC A;  2ZO6 A;  3OJ4 B;  2Y5B B;  3Q3J A;  2Z1O A;  4W6G A;  4MSM B;  4A3P A;  2WSN A;  4H3N A;  1QYF A;  1SE9 A;  3TBL D;  2C9W B;  4ZF3 A;  4AOF A;  1QYQ A;  2HJ8 A;  4BKG A;  5CX3 A;  3UIO B;  2OOB B;  1AAR A;  4GDK A;  3TMT A;  2HRS A;  4II2 B;  3CBE A;  5AEK B;  2DDD A;  2LI5 A;  2JWZ A;  2ZJD A;  2CU1 A;  2VVJ A;  2WHS A;  4KPI A;  2A47 A;  1ISN A;  2LRU A;  3R3M A;  4DXI A;  2KQS A;  3SRY A;  4W7X A;  2J0K A;  3R7Q A;  2MQJ A;  3ZLZ A;  3NT9 A;  1JRU A;  4J88 A;  3DVG Y;  3PSE B;  1GGX A;  2XK5 A;  1WZ0 A;  3WAM A;  2ZNV C;  4OVU A;  1XAE A;  3TCA A;  3T8M A;  4HK2 A;  3M95 A;  4I6N B;  2GOW A;  4KIK A;  2ZZP B;  2FID A;  2EMO A;  2QLG B;  3L08 A;  2KWV B;  3V6E B;  4FAD A;  4GMV A;  5DPS A;  2Z59 B;  3VK1 A;  2OTE A;  4H3M A;  3P2B A;  1PQS A;  3KW5 B;  3DPZ A;  4DXP A;  2NBU A;  4I2Y A;  3L17 A;  2FCN A;  2PE6 B;  2MP2 A;  4MDK E;  1W7S A;  5D94 A;  5E6P A;  3PGE A;  2VRR B;  5F9G A;  1XT9 B;  4LJD C;  2L76 A;  3ST0 A;  2DUH A;  2N9E B;  2ZVO A;  4R6D A;  1RMM A;  3RYT A;  3OGO A;  2PXS A;  3ZVV A;  2D11 A;  5H87 A;  3LDZ E;  3CF6 E;  2DYB A;  2O29 A;  1YJ1 A;  2VZX A;  3KVF B;  2AEH A;  2K6Q A;  3RWT A;  4W6R A;  5DY6 A;  4KSK C;  2GBM A;  4K7U A;  3VTV A;  3H6N A;  5DTY A;  3GEX A;  1EMG A;  3H7P B;  3DQ5 A;  1R4M I;  5AZG A;  4GSW A;  3DQC A;  3LS3 A;  4DHZ E;  1GC6 A;  4KAG A;  4EMQ A;  3VHT B;  1MYW A;  2LWP A;  4GES B;  1WXV A;  2KWU B;  3ZUN A;  4MJS B;  2R2O A;  3LJ3 A;  2WDT B;  3DQ6 A;  2YE1 A;  3IR8 A;  1W7U A;  3MJW A;  5CHV C;  2M17 A;  4H47 A;  2MSE D;  2O6V D;  1EF1 A;  1V6E A;  1GFL A;  3BXA A;  2IO2 B;  1C4F A;  2DZJ A;  2ZO7 A;  3LF4 B;  2N1V A;  1NBF C;  2D10 A;  4F7Z A;  1Z1Q A;  3SVO A;  1WF9 A;  4CHK A;  2A48 A;  2C5L C;  3DQM A;  4NWS A;  1UEL A;  3A9K B;  3X23 A;  2IO1 B;  1G7K A;  3NT3 A;  3HHM A;  2DYM A;  1F09 A;  4W6I A;  2KDF B;  3TMR A;  4RMA A;  2MA9 B;  4B6W A;  2D3G A;  4OJ0 A;  3AXC A;  2RH7 A;  2VVI A;  2O24 A;  1EMM A;  1BFP A;  4W73 A;  3QX1 A;  3SSH A;  2A53 B;  1Q0W B;  4ZDV A;  1XMZ A;  3H1O A;  2LRW A;  3MGF A;  1ZGU B;  1WX7 A;  2ARL A;  1OXF A;  3PZD A;  4DBG A;  2VAD A;  2KTR B;  4GN1 A;  2JUO A;  2AWM A;  1HUY A;  4MGI E;  2KZR A;  2V4E B;  2LAS A;  3WIM A;  2XEW A;  5LXI B;  4RM9 A;  4JRB A;  1EMC A;  3QHT A;  3CGL A;  1F0B A;  2POX A;  3U8A A;  3L54 A;  3QJZ A;  3H9D A;  2LZ6 A;  3CD1 A;  4MH0 E;  2ZVN A;  1YHH A;  4W7C A;  3WA0 A;  4I6P A;  3DPX A;  4K7S A;  1LQB A;  1WGH A;  1YD8 U;  5CHF A;  4EZJ A;  2Y0G A;  3B08 A;  3PRZ A;  2O2V A;  4LQU A;  2OJR A;  4HQ8 A;  3EK8 A;  1V9J A;  2Z6Y A;  2BWE S;  3SVD A;  2K25 A;  3M62 B;  3DQN A;  2YFP A;  2OKW A;  1U4A A;  1YFP A;  3Q3F A;  2LJ5 A;  2KHW B;  2FWQ A;  3DVN V;  2AL3 A;  4U2V A;  2KC2 A;  1JBY A;  3ZUF A;  3APD A;  5JH5 C;  2DDC A;  5J18 A;  4IK8 A;  2WSO A;  4GDK B;  2DHZ A;  4A20 A;  3OAW A;  1G6J A;  2HGD A;  4LJP B;  2C7M B;  3KYD D;  1I35 A;  3AU5 A;  3ED8 A;  4E71 A;  3P28 A;  5DQM A;  1Q1O A;  3SVN A;  3DQ2 A;  1WXM A;  3VH4 B;  3UQA A;  4MM3 A;  2EMS A;  2KC1 A;  4BBN F;  2WUR A;  4IM3 A;  3DQH A;  5D7G A;  5HZS A;  2XK5 B;  4W6A A;  4OGS A;  4K7W A;  2G4S A;  4DDG D;  3ZDT A;  4KIK B;  4RTC A;  5CHW A;  2L3Z A;  2DUG A;  2XBB C;  1KOT A;  3C0R B;  2QLH A;  2QLE A;  3APF A;  3UFZ A;  4IK3 A;  2H6V A;  2AWK A;  1H4R A;  2AL6 A;  3SG3 A;  3DVG X;  4XZ4 A;  4BFR A;  4DWF A;  2MP2 B;  4NPN A;  3DQD A;  3APC A;  4ORN A;  1V86 A;  4JQW C;  4P7I A;  1SIF A;  1WI0 A;  1WXS A;  4GXB A;  4IWQ A;  1CV7 A;  1Q73 A;  2LUE A;  2RSU A;  3SSP A;  5FHV A;  2C7N B;  3GJ2 A;  4E74 A;  3HIZ A;  4EZK A;  3M22 A;  1V2Y A;  2ZPY A;  2JAD A;  2A56 B;  3DQ7 A;  3IFW B;  5JHB A;  5GMV A;  2LD9 A;  1ZGO A;  4K81 A;  4WQO B;  4PYZ A;  2G6X A;  1K8R B;  4MGZ E;  5DTZ A;  4TZA A;  4Q7T A;  2HCG A;  2KVR A;  2LVP A;  1WGD A;  2Q6P A;  4GGQ A;  4KSL C;  2G3Q B;  1YIW A;  4TV3 A;  5DU0 A;  3NS8 A;  4HPL B;  1OXE A;  1JC1 A;  3DQK A;  4W7D A;  1EMF A;  1Q4A A;  5DTX A;  4ICU A;  2BYE A;  4LQT A;  5J17 A;  4W75 A;  3PT2 B;  4KF4 A;  3DQ1 A;  3ML8 A;  5C23 A;  5LTQ A;  3ZNG C;  1WJ6 A;  3EKH A;  3EEC A;  3K1K A;  2FUH B;  2BF8 B;  4W7E A;  3RUI B;  2C7H A;  4HWI B;  1KJT A;  2JRI B;  1T0Y A;  2NVU I;  1MOU A;  4H3L A;  5LTP A;  4TZG A;  4FUL A;  2W9N A;  5FVI A;  3DQA A;  2CS4 A;  3TMP B;  4WWO A;  4ICV A;  2R2Q A;  2WX0 A;  4G3X B;  3UIP B;  3SHQ A;  4OVV A;  4IK4 A;  4KGE A;  4PPJ A;  2ZEQ A;  3VUW A;  4NJ7 A;  4W7F A;  3SSY A;  4HXD A;  3CB9 A;  3O77 A;  3NEZ A;  3UQB A;  4KEX A;  3EVV A;  1GNU A;  4W9F A;  3EVU A;  4XOW A;  1RRB A;  5AZF A;  3ST2 A;  1OEY A;  1E8W A;  3U8C A;  4HVF A;  4JC2 A;  2NBV B;  4GDL A;  4RYS A;  1ZUX A;  1Q4C A;  4JLC A;  3ZIM A;  2MW5 A;  1TGZ B;  4ZIN A;  3ZTC A;  5H88 A;  4XVP A;  3E5W A;  2KJH B;  3ZDM C;  2ZMU A;  4BOZ B;  3DQL A;  5DPT A;  2LGD A;  2MBE A;  3DQE A;  5LXH A;  1WJN A;  2GBN A;  3RT3 B;  2IOV A;  1S6Z A;  1QXT A;  2GW3 A;  3O78 A;  3NF0 A;  3LA1 A;  1VD2 A;  2O2V B;  4FN2 A;  4W9J A;  2JF5 A;  4ZF5 A;  3W1S A;  2JXX A;  2K1F A;  1M94 A;  4N3D A;  4GOC A;  3DQV A;  2Z6X A;  2VVH A;  4EEW A;  3P8U A;  2YDZ A;  4UTS A;  2KFJ A;  4HCN B;  4FA6 A;  3EVR A;  3WAP A;  3HM3 A;  3SSL A;  2O2B A;  3OSQ A;  3GZN I;  5DRF A;  3BXB A;  2DD9 A;  2NS5 A;  2GW4 B;  4G50 A;  1LFD A;  4P1Q A;  2AYO B;  3ZW3 A;  4W6S A;  4GF6 B;  2M0X A;  1C3T A;  3DQI A;  2BYV E;  1WFY A;  3PLU A;  3CD9 A;  2G3O A;  4W9E A;  1J19 A;  5BQL A;  4W9G A;  3S2A A;  3OSR A;  4ANV A;  2QLI A;  2BWF A;  4FHJ A;  3ZO5 B;  4WJO A;  2KJ6 A;  2ZNV B;  5FVG A;  1Z1P A;  4XOV A;  4M0W B;  5LK4 A;  1Z5S B;  2CHX A;  5EB7 A;  3SG5 A;  4EDO A;  3VHT C;  3A9J A;  4LJC A;  3W1D A;  2LGY A;  5JZE B;  4EUT A;  4HDQ A;  4DHZ B;  4JIO U;  2C60 A;  1YJ2 A;  1WJ4 A;  4W6N A;  3DVN U;  4P76 A;  1S1Q B;  2NR2 A;  3AI5 A;  4BOS C;  1LM8 B;  3M63 B;  4AJW A;  2IE2 A;  5DPI A;  4W6T A;  2KFK A;  4NJ6 A;  2H9W A;  3N3K B;  4MEM A;  3ZRC A;  2IB5 A;  2ASQ A;  3NED A;  2HQK A;  4GU2 A;  3R66 C;  3WAO A;  4J6I A;  4W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...