3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
b'SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, transcription
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
2GW4B 4EFOA 4WJQA 4OVUA 4ZINA 1QYFA 4W7RA 2BTJA 4IWQA 1ZGPA 4WQOB 2VADA 4IWPA 1YZWA 3CGLA 4NPNA 2L7RA 3ML9A 4GMVA 3SSPA 4WJPA 5J2RA 1RFAA 2DZKA 4HE4A 5E6NA 4GIVA 2RPQA 2FUHB 3ZO5B 4IC7B 1OGWA 4XOVA 3VTWA 4B9KA 2REXA 2KK8A 3RCZA 3IVFA 4ZYNA 3DBSA 2JZ3B 3PRPB 3IR8A 4FHJA 2MBOA 3DVNU 4ICUA 1JC1A 4EN1A 3BXCA 1RMOA 1XMZA 5FHVA 4LJPB 1I42A 2C60A 4Q9WA 4CO7A 3X23A 3QCAA 4LJBA 2ZMUA 2LXAA 3WALA 1WM3A 3DQ8A 2CHXA 4XOWA 1YFPA 2LGYA 3W1CA 1XQQA 2DUEA 1Q73A 4ANWA 3DPZA 2J0MA 4KF5C 4A3OA 2D2QA 3DQUA 2NBWB 4ICVA 4PS3A 3ZTDA 4W9HA 2K39A 4JQWC 5H89A 3QHTA 1YJ1A 4K81A 4LQUA 4HDOA 4Q7TA 5J17A 3LA1A 1OXDA 3SVCA 2KWVB 2QLGA 4W7XA 1ZGOA 2C7MB 1T0YA 5LTQA 4EDOA 3MGFA 1P1AA 1XA9A 2DAFA 3E5WA 1BFPA 1HCJA 5CTRC 4JEOA 4BOZB 3DQKA 3GJ2A 2QLHA 4ASWC 2KO3A 3DVGY 2R2QA 1C1YB 2G4DB 3S05A 3OSRA 4ZF5A 1J19A 3U8CA 2EMSA 3QARA 2NPTA 1TTNA 1KYPA 5BTTA 1QZEA 2ZCCA 3QC8B 2NBVB 1WM2A 4MDKE 4W74A 3WANA 2LGXA 1Q4DA 4W6HA 4J6IA 2AWKA 2LRUA 4JLCA 3ZVVA 1RAXA 1GNUA 2NCNA 2KDEB 2AWJA 3ZUNA 2DUIA 2KJ6A 2H5RA 2N9XA 3DQEA 3EVRA 3JYUA 5DPRA 3D32A 1E5WA 1PQSA 4MM3A 2G16B 2WSOA 5LTRA 3UINB 3KCTA 5HZSA 1YJ2A 5L83A 1RMMA 2ARLA 3UFZA 4EZLA 4KZ0A 2G4SA 2BGFA 4HPMB 5HZTA 2KMCA 2V1YA 4K1RB 2EMDA 4KDLB 5DCNA 3EK4A 3WA0A 3LVCA 3GL4A 2KDFB 3UIPB 2DYMA 2LZ6A 4GXBA 2V4EB 3R66C 5F9GA 2KLGA 1H4UA 2PE6B 2KTRA 3NT3A 3SG2A 5DY6A 2KDBA 2N9EB 1YHGA 4LW5A 3PIBA 2IO3B 4PS7A 2WHUA 2GBJA 4KA9A 3ZNHB 2A54B 3U0NA 3KUCB 1XSSA 3RWTA 4ZBLA 2N1WA 4KVGB 4Q9XA 3V6EB 3NT9A 3SSKA 4MEMA 5EXCI 2AL6A 4LDTB 1AARA 4WWPA 1WGGA 5EXUA 4MJSA 4BVUC 4N9F4 4NNJB 1W7TA 2AEHA 4EZJA 2ZO7A 2MCNB 1ZGUB 2M8SA 5HBDA 2L00B 4RM8A 4E3CA 2K8BA 4PPJA 1XT9B 2JRIB 2A47A 2J0JA 3ZTCA 4W73A 2K25A 1P3QU 4JIOU 5D94A 3VUWA 4R6BA 3ZW3A 3SSYA 1QYOA 4PPKA 3RD2A 3M22A 4W6AA 1VCBA 2R2OA 4EDSA 4MGYE 1WX7A 2G3QB 2G5ZB 2WX1A 2IY1B 2KQSA 2K8CA 4IUMB 3DOWA 3A4SC 3EHVA 3ZDTA 2YVCA 3L54A 2ZMWA 5H88A 1WXAA 2MP2A 3SVUA 4TUUA 3WCKA 2LRWA 4GDKB 4E71A 2QRFA 4KSKC 1I35A 5EB7A 1ZKHA 2I1KA 3JVZX 4H48A 3APFA 2FCMA 3APCA 3RZFA 1GL4A 5G55A 4L12A 3K9PB 3A8SA 2OGRA 2A4ZA 4XC2A 1WGHA 5EXBA 3KUZA 3H7PB 5FVGA 5AQBB 3V60A 3B0AA 4W7AA 3LSAA 3AI4A 1E8XA 4K7WA 1WYWB 3U8PA 4W6GA 4DXQA 1GC7A 1IPGA 4RMAA 4HQ9A 3QIJA 1EMLA 2ZVOA 4MELA 2V4EC 5GMVA 5TR5A 2XEWA 4ANUA 4BDUA 3EVUA 2IE2A 5AZFA 5G2NA 3V6CB 3SVOA 2DHZA 4OJ0A 4URKA 3U7DA 2KMAA 4G50A 1UISA 3SVBA 3JW0X 2CR5A 2UYZB 2DDCA 4TZAA 3SG4A 3VQIA 2GW3A 3QQ8B 2QZ0A 4DXPA 4DXNA 2YE0A 1S6ZA 2WYQA 2WIQA 3RZWC 2Q57A 4ORNA 3CSTA 3AULA 3NHEB 4FULA 2IO0B 4DK5A 3PJ7A 3EVPA 1XAEA 1B9CA 3AI5A 5EBJA 2JADA 5E6OA 4IK8A 4MGIE 2I1JA 3PREA 4L13A 3HK0A 4W6CA 1KYRA 2HE7A 4BBNC 4EUTA 1Q1OA 3PRZA 2DD9A 1V2YA 1YJFA 2K1FA 5J18A 2UWQA 3L17A 4DBGA 3IHPC 2AWTA 4GB9A 3QA8A 4IW0A 4EOYA 3TMPB 5LXIB 2CHZA 3KUDB 1U4AA 5EHUA 2WWZA 2DZMA 3SVSA 2DYBA 5DU0A 3ED8A 2LVQA 2MW5A 4PFEA 2A56B 2AWMA 1WZ3A 4P7IA 4GU2A 1WH3A 4FA6A 4BKSD 4DXOA 4JGHB 4JC2A 4BKSA 4XZ4A 5FVIA 2GBRA 4P1QA 4W76A 3DPXA 4LJCA 4EEWA 3KW5B 3SHQA 4LQTA 2KC1A 3VH3B 2CHWA 2V4EA 4DHJB 2IY0B 2LI5A 3U8ZA 1UZXB 1LM8B 4FLHA 4G11A 1GUAB 2KNBA 2D10A 1A5RA 2HGYA 4ZRJA 1RM9A 1K8RB 1WGRA 2HJOA 3DQ7A 4AOFA 3HHMA 2G6XA 2MP2B 2H6VA 3DQCA 1WI0A 5CHWA 3NZSA 2Z0DB 2A53B 4HQ8A 2IOVA 3SSHA 2HD5B 1RRBA 2JXXA 3DCGA 2PXWA 1UD7A 4GGQA 1KOTA 4W6JA 4BBNF 5EB6A 2RD0A 4LDTD 1BT0A 4ANXA 4XVPA 1QY3A 2BYVE 1EMMA 4I6LB 2IZVB 3TMRA 3N32A 4GOCA 3SSLA 4HDQA 2PJHA 3I19A 3CFHA 3SS0A 5DPJA 4WJNA 1G6JA 4BOSC 3MHSD 3U30A 3AXCA 4H3LA 2BWFA 3PZDA 1WRDB 3KYDD 1EO6A 2J7QB 2MBBB 5C23A 3SG6A 1OTRB 3DQ4A 3O78A 1V80A 4W72A 4OY4A 2QHOA 4AJWA 3NOBA 3PJ5A 3U8AA 4ZF4A 2L76A 3EFUA 1GGXA 1F9JA 4A20A 4KV2A 1P0RA 4KF4A 1SIFA 3CD9A 3CFFA 1H4RA 4DHZE 3AU4A 4HJKA 2C7HA 5EJUA 1JC0A 2Y5BB 1R4MI 2MBEA 2LVOA 5CX3A 3A33B 2CS4A 2ZEQA 3RULA 3ST4A 1Z5SB 1G7KA 1W7UA 3B1LX 3CSFA 3R3MA 2H9WA 4W7FA 1E7UA 4TQ0A 2KX0A 3LVDA 3SSVA 2W9NA 1C3TA 4XGYA 3SG5A 3PHWB 4GDKA 4W6RA 2ZNVC 4KW9A 3SRYA 3IP2A 5BT0A 4HCPB 3GB3A 4WAAA 2O6VB 4PYZA 3WLCA 3OJ4B 4IWOA 3EK7A 5LXHA 2OKYA 2A52B 1X1MA 3NZUA 3H7PA 3A1QB 1WY8A 1EMCA 3VHTC 3H7SA 5KTGA 3HM3A 4RM9A 2KJRA 4KSLC 2OOBB 3DPDA 1HE8A 3TL5A 3UIOB 3LJ3A 5BO4B 2M1MA 2Z6YA 3TCAA 3TBLD 1GJZA 4IM3A 3VFKA 4KEXA 3GOEA 3MTNB 3PSEB 2YFPA 5J2OA 2IYDB 1WGDA 3V62A 3SG3A 1WXMA 1E7VA 3H6NA 2C9JA 4DDID 4KIKB 4GF6B 2JPHA 3IBEA 3E5VA 3P2BA 4AWJA 2POXA 5HZUA 4W6KA 3BINA 4KF5A 4LJOB 5DTXA 2V3SA 1KYSA 2ZO6A 4M8MA 3DQ9A 3SG7A 3KH0A 2WX0A 2FZUA 3WAMA 4HK2A 3EK8A 1UGMA 2D3GA 1GFLA 4DDGD 3G9AA 4LJDC 3SDLC 4KGEA 3NY5A 2VZXA 1E8WA 1E90A 4W9JA 4Z4KA 2MX2A 1YD8U 1E8ZA 2N1VA 4AJYB 2JZZA 1Z2MA 4Z4MA 1ISNA 3BX9A 2ZPNA 4DWFA 3DQIA 2KXJA 3W1SC 4R6DA 3O77A 3SVNA 3S2AA 3DVNV 4HXDA 2J0KA 1WX9A 5DPGA 1J8CA 2O2VB 3ZRCA 1WGYA 3DQ6A 1EMFA 2KWCA 2MRPA 5BQLA 2ICRA 3M3JA 4N3DA 2OKWA 5DRGA 2PXSA 3QK0A 2KD0A 2BF8B 3L13A 1KLVA 4KDIC 4AS8A 3GZNI 1RLFA 2OTEA 2BKRB 4IK1A 2A48A 3DQFA 2AH8A 3V61A 1EUVB 3CB9A 3NF0A 5JHAA 4NWSA 1JBZA 2PPHA 4GSWA 4H3MA 4W7DA 2B3QA 1Y8RC 4DHJD 4W6FA 2RR9A 2KVRA 3VDZA 3ZNGC 3DBHI 3ZRFA 2ZJDA 4J89A 4MH0E 3PJBA 4OGSA 1Q5WB 1C4FA 4W7EA 1CV7A 1MOUA 3VXWA 4DKMA 3K1KA 3DQJA 2AL3A 5IAAC 3DQ3A 2FIDA 1R4NI 4Q7RA 1V9JA 3SVRA 2PE9A 3VH4B 4W77A 1KJTA 3I3TB 3HM6X 4PS8A 1EMGA 4ZDVA 4L1IA 2BWES 2ZCBA 5D6JB 4LJDA 2KJHB 4JRBA 1MYWA 1S3SG 3ZULA 2KQ7A 4KZCA 1L2NA 1LFDA 5HZOA 3H1OA 4IM0A 1D3ZA 4BFRA 5DTLA 5IA7A 4TKNA 3H1RA 3NEZA 2Z59B 1WMHB 2DUFA 2PEAA 3W1SA 4B6WA 2ZPYA 2DX5B 2KTFA 2NVUI 1RRXA 2M17A 4TZGA 2KANA 2KWUB 4J88A 1WJNA 4K7UA 4E74A 2Z1OA 2DYOA 3DQMA 3M95A 1V81A 3ADFA 3ZUFA 4W69A 2LJ5A 2O29A 1OXFA 3ZTFA 3PHXB 2L05A 3WAOA 3EKJA 1V5OA 3DVGX 2XK5B 2D07B 2WSNA 3U0MA 3RT3B 4IZNA 1F09A 2DD7A 2Q6PA 3V3DA 2H5QA 3T9LA 1Q4EA 2V4LA 3IFWB 4U2VA 4J8AA 4W6PA 3PTFC 2G6YA 2C9IA 2JY6A 2HTHA 4W6IA 3SU8X 1WE7A 3WAPA 4HQCA 2EMOA 4AP4C 2O6VD 3VICA 2HRSA 2O6VA 4B5YA 4AUQC 2HFCA 4W9CA 2WISA 1MG8A 2YE1A 5C1ZA 1YHHA 2DZIA 4M0WB 3SV5A 3AKOA 3JSVB 3ZDMC 3A1QA 1YQBA 1TGZB 2HQKA 2RSUA 2ZZPB 1Z1QA 3PLUA 2QLEA 4KGFA 5DTZA 3T8MA 4W9IA 3ZNID 3GJ1A 3B08A 4I2YA 2KX3A 1ZGQA 2ZNVB 2OJRA 1W7SA 2MWSB 1S1QB 4JGEA 4PPLA 2GX2A 3H1UA 1OEYA 2KFJA 4F1SA 2VVJA 1ZW7A 2MBHA 3W1DA 4B30B 1UH6A 2HGDA 3UGBB 3AU5A 3BY4B 4KIKA 4I6PA 3ZIMA 4NAWA 5JZEB 3X0WA 3SVDA 2GBMA 1EF1A 2OTBA 3VHTB 2FNJB 4MGKE 4LCDE 2MSED 3CMMB 4HLEA 2G3OA 1Q4CA 2GBNA 2DUHA 3KYCD 2KHWB 4XL5A 4W6BA 5EDSA 3ST2A 3ST0A 3DBLI 3ST3A 2G3DB 3A9JB 4HVFA 5HKHA 1OQYA 2FCNA 4MSQB 4DKNA 4GESB 3DQVA 2O24A 2OJKA 4IK5A 2BYFA 3N3KB 4BKTA 2KC2A 4W9KA 2QT2A 3KCSA 3PPAA 3EECA 2FAZA 1WZ0A 2JRHA 3RUIB 2JUOA 1WJUA 3UQBA 4KAGA 3LDZE 4H47A 3UQAA 4JF9A 4RTCA 4W6DA 5DQMA 4FBJB 4KPIA 2O2VA 1P9DU 2QU1A 5DPIA 4NJ7A 1WFYA 4CYEA 3DQHA 1L7YA 2DENB 2GMIC 4RYSA 2EMNA 5AZGA 1YIWA 3A9KB 1WXVA 1VD2A 2IO2B 2KZRA 1WX8A 4IM2A 4FADA 4JFGA 3EC8A 4AR7A 2FL1A 3U0LA 2RH7A 2LVPA 3H9DA 4FJVB 1H8CA 3OSQA 2IO1B 2H5OA 2Z6ZA 3M24A 4W9GA 4W6LA 4IK3A 4WWNA 4GDLA 2YDZA 4W7CA 2HJ8A 2JT4B 2FWQA 2FCSA 3EVVA 5FR6A 4DXIA 3KVFB 2VVHA 3DQ1A 1E8YA 2BKFA 4NJ6A 2G6EA 1QXTA 3QX1A 4HPLB 2GBKA 5AEKB 5LLIA 1WJ4A 4X57B 3Q3JA 3QWZB 2NS5A 4OQWA 4IG7B 3OGOA 1UELA 2ASQA 2D11A 4W6TA 3CF6E 2DDDA 1WJ6A 3LS3A 1WIAA 4HVBA 2FCQA 2KN5A 1WMHA 4FHKA 5JH5C 2LXCA 1RMPA 4K7SA 2KLCA 2WHSA 3ENEA 3TJPA 4W6OA 4ANJA 1Z1PA 4EKUA 2C5LC 4HWIB 4MSMB 1YHIA 4H3NA 2DUGA 1EMKA 2KFKB 4KW4A 1YX6B 4NAWB 3IG3A 3L10B 2BYEA 2M4NA 2LD9A 2NBUA 4P76A 2XK5A 1YX5B 2C7NB 2K6QA 2YLMA 4ANVA 5FVFA 2Z6XA 3LF3A 5JHBA 3UG0A 3LF4B 2EMTA 1P98A 4TQ1A 2JWZA 2MBQA 4WJOA 2MLBA 2JF5A 3UF8A 1Q4AA 1NDDA 3L0WB 3VUXA 2BPSA 1FXTB 3RYTA 3VTVA 4G3XB 4W6SA 5E6PA 2WDTB 4PYUA 3RWAA 3TMTA 4YL8A 2O2BA 5AZHA 2A5UA 3A4RA 2GX0A 2CKHB 1EMEA 1UBQA 2VVIA 1NI2A 2NR2A 3JSVA 4ZB1A 4F7ZA 2H5PA 3LVAA 3OJ3A 5H87A 3OLMD 3MJWA 1WE6A 3PV1A 3R7RA 3M62B 1TZ1A 1SGHA 4F8CB 3PRMB 1KM7A 4B95A 5D7GA 2FIFA 4EULA 3R7QA 3SSTA 2IBIB 1WXSA 2WURA 1LXDA 3PVLA 1GG3A 2EKEC 4DXAB 2JVCA 3ZKJC 4XX5A 4B30A 1GC6A 2LASA 5DPWA 4W6NA 2IB6A 2L3ZA 1TBEA 3L08A 1HUYA 3DQAA 1LQBA 4W75A 1Q0WB 3VHTA 2L0FA 1V49A 3TIXA 2AWLA 4GN1A 1OXEA 2WHTA 3HIZA 4FN2A 3P8UA 4JL9A 2HCGA 1JBYA 5DTYA 3NS8A 4ZF3A 2N7DA 3M63B 2N4FA 4G0NB 4ZIOA 4NQKE 3A9JA 2K6DB 3P28A 1SE9A 2LGDA 1KP5A 5DRFA 2B3AA 3VVWB 1MOVA 5CHVC 2CU1A 2QLGB 1F0BA 1V5TA 3ZLZA 2Y0GA 3E5TA 4W9EA 1EMBA 4GDLB 2HPWA 2LUEA 4DXMA 3APDA 4ZFSA 2ZVNA 3PS6A 3CBEA 3L16A 5L95C 3BXBA 2MQJA 4NY0A 3CFAA 4EMQA 4ZRKA 5CHFA 1WF9A 2XBBC 2G45B 4KW8A 3WLDA 1XD3B 4W9LA 4CHKA 4MGZE 5DPSA 3W1YA 3VTUA 4W9FA 2NPTB 3A9KA 3PLVA 5BTTB 5D2MB 3GEXA 5DPTA 3ONSA 3PT2B 4ZRIA 4OVVA 4UTSA 1NBFC 2KOXA 2QLIA 3C0RB 2IB5A 5KHOA 2VRRB 2VAEA 1JRUA 4NQLB 3ECIA 4W9DA 3BXAA 2A50B 1V86A 1QYQA 4IK4A 2GOWA 2C9WB 4FJYA 4A3PA 3NEDA 4HCNB 2HQZA 2N9PC 2M0XA 2L8JA 2Z0EB 3ZUJA 1EMAA 5KHQA 3DQ5A 3O65B 1IYFA 5HGEA 1M94A 4II3B 4OHSA 4TV3A 1CMXB 4RYWA 4BKGA 1XQMA 2DAJA 2KKCA 2LWPA 2RGFA 3CD1A 1H6RA 3U0KA 3PGEA 1WR1A 5LTPA 2MA9B 4II2B 3DPWA 3DBRI 3VK1A 2L0TA 1WR6E 5HW9A 3VUYA 1EF5A 3QJZA 1ZUXA 2KTRB 4WWOA 5DPHA 2P4MA 3DQ2A 3SVEA 3DQLA 3EKHA 3ALBA 4M8NA 1Q4BA 4Q7UA 2DZJA 4GOBA 2A46A 2AHAA 5LK4A 3QAQA 4FJZA 2B3PA 3K9OB 3Q3FA 2G2SB 1UBIA 3SD5A 3WIMA 1J0GA 2N7EA 3N30A 3VAWA 5T3IA 4I6NB 1OEYJ 3OAWA 3DQOA 4MJSB 4W6MA 4W6UA 2H8QA 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 4IK9A 2K8HA 2KDIA 5DQBA 1V6EA 3DQDA 3DQNA 3ZNZB 2AYOB 3DDCB
chains in the Genus database with same CATH superfamily
2GW4B 4EFOA 4DXGA 4WJQA 2QDFA 3GB1A 5BYRA 4OVUA 4ZINA 2FUG1 1QYFA 4W7RA 2BTJA 4IWQA 1ZGPA 2NTSA 4WQOB 2VADA 4M00A 3AE5B 4IWPA 4ZHOA 2LGIA 1YZWA 3CGLA 2KN4A 4NPNA 2L7RA 3ML9A 4RGTA 4GMVA 4A9AA 3SSPA 4WJPA 5FKAC 5J2RA 1RFAA 2DZKA 4HE4A 2J42A 2XNAC 5E6NA 4GIVA 2E3TA 2RPQA 4OW0A 2FUHB 3ZO5B 1TKGA 3MFGA 3BVZA 4IC7B 1OGWA 4XOVA 3VTWA 1HQRD 1XF5L 4B9KA 2REXA 2KK8A 3RCZA 4L2YA 3IVFA 4ZYNA 3DBSA 2JZ3B 1DGJA 3GE3C 3PRPB 3IR8A 3ETRA 3NVWA 4FHJA 2MBOA 1QOBA 1ZDVA 3DVNU 4ICUA 1JC1A 4EN1A 3BXCA 1RMOA 1XMZA 5FHVA 4LJPB 1I42A 1EWCA 1R7SA 2OEDA 2C60A 5HI1A 4Q9WA 4CO7A 1WYGA 3X23A 3QCAA 4LJBA 2ZMUA 3RNEC 2LXAA 3WALA 1CZPA 1WM3A 3DQ8A 2CHXA 4XOWA 1YFPA 1C4PA 1VZ8A 2LGYA 5EE3A 3W1CA 1XQQA 2DUEA 1Q73A 4ANWA 3DPZA 1KTKA 2J0MA 4ZHPA 1QLBB 4KF5C 1NI3A 2PLPA 5FK9C 4A3OA 2D2QA 3VRAB 3DQUA 2NBWB 4ICVA 5BYQA 2SEBD 4PS3A 1C77A 2QC8A 4K3CA 3CWIA 3NZ3A 3ZTDA 3ZJTA 4W9HA 2K39A 4JQWC 5H89A 2K5PA 1YN3A 4USAA 3QHTA 1YJ1A 4K81A 4LQUA 1RM6C 4HDOA 3U7ZA 1E9MA 4Q7TA 1K50A 5J17A 3LA1A 1Q10A 1OXDA 3SVCA 2KWVB 1GAQB 2QLGA 4W7XA 3IAS1 1ZXHA 1N5WA 2RDHA 1ZGOA 3WCQA 2C7MB 1I4HA 1T0YA 5LTQA 1ZPSA 4EDOA 3MGFA 1P1AA 1XA9A 2PKOA 2DAFA 1F77A 3E5WA 1BFPA 2LEKA 1SJHD 2DBYA 1HCJA 4PK1A 2WXJA 2JU6X 3GZNB 2K22A 5CTRC 2GRIA 4JEOA 2L52A 4BOZB 1FRRA 3DQKA 3GJ2A 4L23A 2QLHA 4ASWC 4TSSA 2KO3A 3DVGY 2R2QA 1C1YB 1YNTE 2G4DB 3S05A 2HTME 3OSRA 4ZF5A 1J19A 3U8CA 2EMSA 3QARA 2NPTA 1TTNA 1HZ5A 1KYPA 5BTTA 1QZEA 1F0ZA 2ZCCA 3DBHB 3QC8B 1L0YB 2NBVB 3AE2B 2GB1A 1WM2A 4MDKE 4W74A 2QCZA 3WANA 2LGXA 1Q4DA 4W6HA 4J6IA 3AE8B 1IBXB 2AWKA 2LRUA 3Q3OC 4JLCA 3AECB 1TY0A 2IGHA 1MPEA 3ZVVA 1RAXA 1GNUA 1R4NB 2NCNA 2KDEB 2AWJA 1C78A 1NENB 3W5UB 3ZUNA 2DUIA 2KJ6A 2H5RA 4YSXB 2N9XA 3DQEA 3EVRA 3JYUA 2JYEA 1YQ4B 3AN1A 5DPRA 3D32A 2JYTA 5BMGA 4A90A 4XYCA 1E5WA 1PQSA 2MH7A 4MM3A 2G16B 2WSOA 5LTRA 3UINB 1SBBB 5HFYA 3KCTA 5HZSA 1YJ2A 3ZXRA 1RMMA 2ARLA 3UFZA 3VRBB 3W2DA 4EZLA 5L83A 4P6VF 4KZ0A 2G4SA 1I4RA 2BGFA 4HPMB 5HZTA 2KMCA 2EKIA 2V1YA 4K1RB 2BT6A 2EMDA 4KDLB 5DCNA 3EK4A 1I4PA 3WA0A 4HPPA 1WSPA 3LVCA 1PDXA 3GL4A 2KDFB 3UIPB 2DYMA 2LZ6A 4GXBA 2V4EB 3R66C 5F9GA 2KLGA 1H4UA 2CJOA 2PE6B 1FNWA 1F52A 2KTRA 1PUTA 3NT3A 3SG2A 5DY6A 4ZYSA 2KDBA 3OWEB 3DWGC 2QIEB 2N9EB 1YHGA 4LW5A 1CK1A 1FCCC 3PIBA 2IO3B 2KMMA 3FAHA 4PS7A 2WHUA 2GBJA 4KA9A 2WU5B 3ZNHB 2A54B 3U0NA 1YN4A 2WXPA 3TUOA 1E0ZA 3KUCB 1XSSA 3RWTA 4ZBLA 2N1WA 4KVGB 4HROA 3ZQ4A 1QKZA 2KQ4X 1VJKA 4Q9XA 3V6EB 3NT9A 1HTQA 3SSKA 4B0MA 4MEMA 5EXCI 4K3BA 2AL6A 2V0GA 2RDBC 4LDTB 1AARA 4QAYA 2K9XA 4WWPA 1WGGA 2WXLA 1CQVA 2JXTA 5EXUA 4MJSA 4BVUC 4N9F4 4NNJB 1W7TA 3Q8BA 2AEHA 4EZJA 2ZO7A 2MCNB 1ZGUB 2M8SA 2LFIA 3Q2AC 5HBDA 2BB5A 2L00B 4RM8A 4ACFA 4E3CA 2K8BA 4PPJA 1NEKB 3HRDD 1FD6A 1XT9B 4MT5A 4WAFA 1EU4A 3Q69A 2JRIB 2A47A 2J0JA 3ZTCA 4W73A 2K25A 1P3QU 4JIOU 5D94A 3VR8B 2LGSA 3VUWA 4R6BA 4IOIE 3ZW3A 2RMMA 3SSYA 1QYOA 3TEZA 4PPKA 1HZ6A 3RD2A 3M22A 4W6AA 1VCBA 2R2OA 4EDSA 4MGYE 1WX7A 2G3QB 2G5ZB 1FCLA 2WX1A 4BAXA 1QOGA 1YOVB 2J53A 2IY1B 2KQSA 2K8CA 1E7PB 3BYTB 4IUMB 1C76A 1ESFA 3DOWA 3A4SC 3EHVA 3GS2A 4US8A 3ZDTA 2YVCA 3L54A 2MHJA 1D5ZC 2ZMWA 5H88A 1L6VA 1WXAA 2MP2A 2E6XA 3SVUA 2MJ3A 4TUUA 3U4EG 3WCKA 2LRWA 3DHHC 3R2TA 4GDKB 4E71A 2QRFA 3AH7A 4KSKC 1I35A 4RCOA 5EB7A 1ZKHA 2I1KA 3JVZX 4H48A 3APFA 4S0RA 2MJDA 2FCMA 3APCA 3RZFA 1GL4A 5G55A 1XLPA 2KAJA 4L12A 3K9PB 2WP9B 3A8SA 2OGRA 2A4ZA 4XC2A 1WGHA 2GLSA 5EXBA 4DQOC 3KUZA 4O1NA 4ZOHC 3DBLB 3H7PB 3Q8FA 5FVGA 2KDMA 5AQBB 3V60A 3B0AA 4W7AA 3LSAA 3AI4A 2BS3B 1E8XA 3Q8AA 4K7WA 1WYWB 2KT7A 1RFKA 2ON8A 1ZDXA 1MJDA 3U8PA 4W6GA 3GE8C 4XWTA 4DXQA 1GC7A 1IPGA 4RMAA 4HQ9A 1JW9D 3QIJA 3T3NA 1EMLA 2ZVOA 4MELA 2XN9C 2V4EC 5GMVA 5TR5A 1AWDA 2XEWA 4ANUA 1F2RI 2LJIA 4BDUA 1JROA 2W3RA 3EVUA 2IE2A 5AZFA 5G2NA 3V6CB 3SVOA 1Y56A 2DHZA 3Q6BA 4N58A 4OJ0A 4URKA 3U7DA 1MHHE 3NRZA 2KMAA 3E56A 5BYSA 4G50A 1C4AA 2HDEA 1UISA 1DOIA 3SVBA 3JW0X 2CR5A 2UYZB 4ARIA 2DDCA 4TZAA 3SG4A 3BYYB 3VQIA 4LNOA 4WURA 4LLGM 2GW3A 2ZW0A 3QQ8B 3RN9C 2QZ0A 4DXPA 1T5XD 4DXNA 1TS5A 2YE0A 1S6ZA 2WYQA 2WIQA 3RZWC 2Q57A 4ORNA 3CSTA 3AULA 5IOIA 5IO9A 3NHEB 3TEWA 5LNK1 1UGJA 2W3SA 1ZE3D 1TKEA 2IO0B 4FULA 4DK5A 3PJ7A 3EVPA 1XAEA 2JZPA 1B9CA 3AI5A 5EBJA 2JADA 3KLSX 1IGDA 3EUB2 5E6OA 1L5PA 4IK8A 4MGIE 1V97A 2I1JA 3NVZA 3PREA 4L13A 3HK0A 4W6CA 1VLBA 2KYWA 1KYRA 2HE7A 4BBNC 2BS2B 4EUTA 3LXFA 1Q1OA 3PRZA 4ITKA 1C9FA 2DD9A 4RF0A 1V2YA 1YJFA 2ACZB 2K1FA 5J18A 2QEJC 2UWQA 3L17A 4DBGA 3IHPC 2AWTA 4GB9A 1IBXA 3QA8A 3T3OA 4IW0A 2R61A 1I7HA 4EE2A 3AV8A 2WXOA 4HKZE 3TMPB 4EOYA 5LXIB 5HHDG 2CHZA 1BXTA 3KUDB 1T0QC 1U4AA 2IGGA 5EHUA 2WWZA 2DZMA 1YQ3B 3SVSA 2DYBA 5DU0A 3ED8A 2LVQA 2MW5A 4PFEA 3NS1A 2A56B 1HA5A 2AWMA 1WZ3A 3PZ8A 4P7IA 4GU2A 3AEEB 1WH3A 3HVDA 5BMHA 3AEDB 4FA6A 4BKSD 4DXOA 4JGHB 2K3UA 1J7BA 4JC2A 4BKSA 4XZ4A 5FVIA 2GBRA 4P1QA 2H89B 4W76A 3DPXA 3I5JC 4LJCA 4EEWA 3KW5B 2JQRB 3SHQA 4LQTA 2KC1A 1ENFA 3VH3B 2Y5CA 2CHWA 4XE0A 3C19A 2V4EA 2Y5PA 4DHJB 2IY0B 2LI5A 2J4XA 4N59A 3U8ZA 1UZXB 2WDQB 1LM8B 4FLHA 1V1PB 4G11A 1GUAB 2KNBA 2D10A 1A5RA 2HGYA 4ZRJA 1RM9A 1K8RB 1WGRA 2HJOA 4J3OD 3DQ7A 4MH8A 4AOFA 3HHMA 5TSSA 2G6XA 2MP2B 2H6VA 5HG2A 3DQCA 1QOAA 1WI0A 5CHWA 3NZSA 2V3NA 4P1CC 2Z0DB 1JALA 2A53B 4IDIA 4HQ8A 2IOVA 2MEKA 3SSHA 1XO3A 2HD5B 1RRBA 1MHXA 2JXXA 3DCGA 2PXWA 1UD7A 3FILB 4GGQA 1KOTA 4W6JA 1L0XB 4BBNF 5EB6A 1ZUD2 5IKCM 2RD0A 3SFDB 4LDTD 4NZLB 1BT0A 4ANXA 3N9YC 2IJ0A 4XVPA 3Q3MC 1QY3A 2BYVE 1EMMA 4I6LB 2IZVB 1SJED 4A8XC 3TMRA 3N32A 4GOCA 3SSLA 4HDQA 2BBCA 2PJHA 3AE9B 3I19A 1DOXA 3AE6B 3CFHA 3SS0A 5DPJA 3P4QB 4WJNA 2IDYA 1G6JA 4BOSC 3MHSD 1ROEA 3U52E 3U30A 3AXCA 4H3LA 2BWFA 1UUPA 3PZDA 1WRDB 3KYDD 5FR3A 1UF0A 1EO6A 2AQ3B 2J7QB 3BVMA 2MBBB 2VH2A 5C23A 3SG6A 3AMZA 1OTRB 3DQ4A 3O78A 1V80A 4W72A 4OY4A 2QHOA 4AJWA 1I4XA 3NOBA 2DWQA 3PJ5A 3U8AA 4ZF4A 4ARCA 2L76A 1F1HA 3EFUA 1GGXA 1F9JA 4A20A 4KV2A 3ZXVA 1P0RA 3IT6B 4KF4A 1SIFA 4M02A 3CD9A 1ZOYB 3CFFA 1H4RA 3H8HA 4DHZE 3AU4A 1VRAB 4HJKA 2C7HA 4KKJA 5EJUA 1JC0A 2Y5BB 1R4MI 2MBEA 2LVOA 5CX3A 3A33B 2CS4A 1QOFA 2ZEQA 3RULA 3ST4A 2DNFA 1Z5SB 2WXQA 1SEBD 1G7KA 1W7UA 3B1LX 3CSFA 3R3MA 2H9WA 4W7FA 1E7UA 2BVCA 4TQ0A 2KX0A 1K52A 2QSDA 3LVDA 3SSVA 2W9NA 1C3TA 4XGYA 3SG5A 4S17A 3PHWB 3B9JA 4GDKA 4R3DA 4W6RA 2ZNVC 4KW9A 3SRYA 5BMIA 2WQYB 3IP2A 1QT9A 2PVGC 2YEPF 5BT0A 4HCPB 3GB3A 2FE8A 4WAAA 2O6VB 1NVID 1PGXA 4PYZA 3WLCA 2FBWB 3B2FA 3OJ4B 4IWOA 3EK7A 4RFBA 3FKYA 4RF1A 5E6JA 5LXHA 2OKYA 2WU2B 2A52B 1X1MA 3NZUA 1YJJA 3H7PA 3A1QB 1WY8A 1EMCA 3VHTC 3H7SA 5KTGA 3B2GA 3HM3A 1KLGD 2KJRA 4KSLC 4RM9A 2OOBB 3DPDA 1HE8A 3TL5A 2D3BA 1SIJA 3UIOB 1KRHA 3LJ3A 2L1AA 5BO4B 2UU7A 2M1MA 2Z6YA 3TCAA 3LB8C 3P1MA 1FEHA 3TBLD 2WDVB 3V3XA 5EE1A 1P7FA 1GJZA 4IM3A 1XCTL 3VFKA 4KEXA 3GOEA 4D2KA 3MTNB 3N1YC 3PSEB 2YFPA 5J2OA 2IYDB 1WGDA 4TMAB 5G5HA 3V62A 3SG3A 1WXMA 1I4GA 1E7VA 3H6NA 2C9JA 3W9CB 4DDID 4KIKB 3VR9B 4GF6B 2JPHA 3IBEA 3I57A 3RNAC 3E5VA 3P2BA 4AWJA 1IGCA 2PIAA 2POXA 5HZUA 4W6KA 3BINA 3O13A 4KF5A 1T6BX 4YXDB 4LJOB 5DTXA 4C7ZA 2V3SA 3RNCC 4NAMA 3BWUD 1KYSA 2ZO6A 1OFFA 4M8MA 1V8CA 3DQ9A 3SG7A 3KH0A 2WX0A 4YSYB 3IAM1 2FZUA 3WAMA 4HK2A 3EK8A 1ZP0B 5T8IA 1UGMA 1C4CA 2D3GA 1GFLA 1IUEA 4DDGD 3G9AA 3N1XC 4LJDC 3SDLC 3AE3B 4C7YA 4KGEA 3P4RB 1PGBA 1JWSD 2VZXA 1E8WA 3NY5A 1E90A 3ZJVA 4HRSA 2WXHA 4W9JA 1LO5D 4Z4KA 2MX2A 2AX5A 1YD8U 3MJ5A 1E8ZA 2N1VA 4AJYB 2JZZA 1Z2MA 1A70A 4Z4MA 1ISNA 5EE0A 1N6ZA 3BX9A 2KWDA 2ZPNA 4DWFA 1C79A 3NVYA 3DQIA 2KXJA 3W1SC 1T3QA 2BB6A 3BVGA 4R6DA 3O77A 3SVNA 2WXMA 3U2SC 3S2AA 3DVNV 3BIID 4HXDA 1L6UA 3ZJUA 2J0KA 1WX9A 5DPGA 3OG5A 1J8CA 2O2VB 3ZRCA 1WGYA 3DQ6A 1EMFA 2KWCA 2MRPA 5BQLA 2ICRA 3M3JA 4N3DA 2OKWA 5JXVA 5DRGA 2PXSA 3QK0A 4LK0M 2KD0A 2BF8B 1UWXA 3L13A 1KLVA 4KDIC 4AS8A 3GZNI 2PVOD 2PMVA 1RLFA 4L1BA 2OTEA 1YMHE 3DBRB 2BKRB 4IK1A 2A48A 3DQFA 4YT0B 1VR9A 2AH8A 3V61A 1EUVB 3CB9A 3RFZB 3NF0A 5JHAA 4NWSA 4IKGA 1JBZA 1ACCA 2PPHA 1PFDA 4MACA 4GSWA 4H3MA 3P42A 1CJEA 1FFVA 4W7DA 2WNMA 2B3QA 1Y8RC 4DHJD 4YSZB 4W6FA 3J9CA 2RR9A 2KVRA 3SFEB 3VDZA 3ZNGC 3DBHI 3ZRFA 2ZJDA 4J89A 1V1PA 3PJBA 4OGSA 2WS3B 4MH0E 1Q5WB 4NJCA 2BTEA 1C4FA 4W7EA 1CV7A 2QJLA 2LHDA 3AE7B 1MOUA 3VXWA 4DKMA 3K1KA 1FNVA 3DQJA 2IGDA 2AL3A 3NUHB 5IAAC 3DQ3A 2FIDA 1R4NI 4Q7RA 1V9JA 3SVRA 2M56B 2N7JA 2PE9A 3VH4B 1HTOA 4W77A 1KJTA 3I3TB 1LGRA 1SB3C 3HM6X 4PS8A 1EMGA 1FM0D 4ZDVA 3FILA 1V1OA 1QF6A 4UDUC 4L1IA 2BWES 2ZCBA 5D6JB 4KGTA 1XLNA 4LJDA 1WWTA 2KJHB 4JRBA 1MYWA 1S3SG 3ZULA 2KQ7A 1MFWA 4KZCA 1L2NA 2INDC 1LFDA 5HZOA 3H1OA 4IM0A 1DYQA 2WXKA 1D3ZA 1WRIA 2AQ1B 4BFRA 1N60A 5DTLA 5IA7A 1FIQA 4TKNA 1YJIA 3H1RA 3NEZA 2WHIA 2Z59B 1WMHB 2YEPB 3Q14C 4WQMA 2DUFA 1GB1A 2PEAA 3W1SA 4B6WA 2ZPYA 2DX5B 2KTFA 2NVUI 3C8YA 1RRXA 1D5MC 2M17A 4TZGA 2KANA 2KWUB 4J88A 1WJNA 4K7UA 4E74A 2Z1OA 2DYOA 2W55A 3DQMA 3BZDB 1EU3A 3M95A 1V81A 3ADFA 3ZUFA 4W69A 1GB4A 2LJ5A 2O29A 1BUIC 4HKQA 1OXFA 3ZTFA 3PHXB 2L05A 3WAOA 4REZA 3EKJA 1V5OA 3DVGX 2XK5B 5D3DA 2LUMA 2D07B 2WSNA 3U0MA 1SF0A 3RT3B 4IZNA 1F09A 4CQNA 2DD7A 2Q6PA 3V3DA 2H5QA 4JPSA 4OZCA 1HXYD 3T9LA 3AM9A 1Q4EA 2V4LA 1L0VB 3IFWB 2NTTA 2X8XX 4U2VA 4J8AA 4W6PA 3PTFC 2G6YA 2C9IA 2JY6A 2HTHA 1D4BA 4W6IA 1K53A 1B1ZA 4OZBA 1WE7A 3SU8X 3WAPA 4HQCA 2EMOA 4AP4C 1XXGA 2O6VD 3VICA 1TKYA 3RNFC 4YWGG 2HRSA 2O6VA 4B5YA 1MVKA 4AUQC 4C56C 2HFCA 4W9CA 2WISA 3AEAB 1MG8A 3RMKC 2YE1A 1FO4A 5C1ZA 1YHHA 4LNKA 2DZIA 2DLBA 4M0WB 3SV5A 3AKOA 3JSVB 3ZDMC 3A1QA 3EGRA 1YQBA 1TGZB 3RI7C 1HEZE 2HQKA 4US9A 4WWMA 2RSUA 1T0RC 2ZZPB 1Z1QA 1QQRA 1D5XC 3PLUA 2QLEA 4KGFA 4KX6B 1KLUD 5DTZA 3T8MA 4W9IA 3ZNID 3GJ1A 3B08A 4I2YA 1JWBD 1VZ7A 2KX3A 4OZAA 4RGOS 1ZGQA 2ZNVB 2OJRA 1W7SA 2EELA 2MWSB 1S1QB 4JGEA 4PPLA 1JWAD 2GX2A 2W82A 3H1UA 1K51A 1OEYA 4JE3B 3RNGC 1L4DB 4B0EA 1E10A 2KFJA 5G5GA 4F1SA 2VVJA 2BW2A 1ZW7A 2MBHA 3W1DA 4B30B 1UH6A 2HGDA 3UGBB 2OJWA 1EM7A 3AU5A 3BY4B 4KIKA 4ZRQA 4I6PA 3ZIMA 4NAWA 3AE1B 5JZEB 4AQ7A 3X0WA 3SVDA 2GBMA 4C4VB 2NMQA 1EF1A 2OTBA 3VHTB 2FNJB 4MGKE 4LCDE 2MSED 3CMMB 4HLEA 2WXIA 2G3OA 1Q4CA 2GBNA 1SE4A 4C80A 2WXGA 2DUHA 1P7EA 3KYCD 2KHWB 4XL5A 5IN7A 4W6BA 5EDSA 3ST2A 3ST0A 3MP9A 2CJNA 1TY2A 2VZKB 3DBLI 3ST3A 2G3DB 3A9JB 4HVFA 5HKHA 1OQYA 2FCNA 4MSQB 4DKNA 4GESB 3DQVA 2O24A 2OJKA 4IK5A 2BYFA 3N3KB 2WXFA 1FRDA 4BKTA 4JWSC 1I4QA 2KC2A 1TS4A 4W9KA 2QT2A 3KCSA 3PPAA 3EECA 1RYJA 2FAZA 3R2IA 1UNSA 1WZ0A 1ET9A 2JRHA 3RUIB 2JUOA 1WJUA 3UQBA 3EFCA 4KAGA 4Q2JA 3V05A 2L83A 3LDZE 2LMCA 3I9V1 5I4DA 2QMTA 4H47A 3UQAA 4JF9A 2N0SB 4RTCA 4W6DA 5DQMA 1J7CA 1M4VA 4FBJB 4KPIA 2O2VA 3IXSA 1P9DU 2QU1A 5DPIA 4NJ7A 4RNAA 5H92C 1WFYA 4N6EB 4CYEA 3DQHA 1L7YA 1SE3A 2DENB 2GMIC 4RYSA 2EMNA 5AZGA 1YIWA 3A9KB 3NJTA 2JWUA 1WXVA 1VD2A 2IO2B 2WDRB 2KZRA 1WX8A 4IM2A 1GPXA 4FADA 4JFGA 3EC8A 3TEYA 4AR7A 2FL1A 1OQRA 2Z8LA 2V4IB 4OVZA 3U0LA 2RH7A 1FFUA 2LVPA 2VH1A 4XDCA 2M19A 2I2YA 3H9DA 4LNNA 4M01A 1JWUD 1TT5B 1TS2A 4FJVB 3KQ4A 2BQQA 1MI0A 1H8CA 5IP4D 3OSQA 1TYGB 2IO1B 2H5OA 3Q8CA 2Z6ZA 1NYRA 4OHJA 2CU3A 2RPVA 4A6QA 3M24A 4W9GA 2G9HD 4W6LA 4IK3A 4WWNA 3N1ZC 3AEGB 4GDLA 2YDZA 1JCKB 4W7CA 4KGRA 1FXAA 2HJ8A 2JT4B 2FWQA 3PZ7A 3DHGC 2FCSA 3EVVA 5FR6A 2MJEA 4DXIA 3KVFB 2VVHA 2D3AA 3DQ1A 1E8YA 2BKFA 1VDVA 4BZAA 4YTNB 4KKIA 4NJ6A 2G6EA 3BK1A 1QXTA 3QX1A 4HPLB 3CIRB 2GBKA 4JWUC 5AEKB 5LLIA 2TSSA 1WJ4A 4X57B 3Q3JA 3QWZB 2NS5A 4OQWA 4IG7B 3OGOA 1UELA 2ASQA 4HEA1 2D11A 1AYFA 4W6TA 3GP7A 3CF6E 1VZ6A 2DDDA 2WXNA 4RH6A 4FXCA 1WJ6A 3LS3A 1WIAA 4HVBA 2W54A 2FCQA 3MC9A 2KN5A 1WMHA 5GXGB 4FHKA 5JH5C 2LXCA 1RMPA 4K7SA 3FC4A 3UI3A 2KLCA 1KFYB 2WHSA 3ENEA 3MHZA 2H88B 3TJPA 4W6OA 4ANJA 1Z1PA 3AEFB 1QILA 4EKUA 2J52A 2C5LC 4HWIB 4MSMB 1RWSA 1YHIA 4H3NA 2DUGA 2D3CA 1EMKA 2KFKB 4KW4A 1YX6B 4NAWB 3IG3A 3L10B 2BYEA 2M4NA 2LD9A 1TZOA 2NBUA 4P76A 2XK5A 3IT4B 4XGAB 1YX5B 2C7NB 1AW7A 3ABVB 2K6QA 2PW9A 2YLMA 4ANVA 5FVFA 4GLSC 2Z6XA 3LF3A 5JHBA 3UG0A 3LF4B 1SSNA 2EMTA 1P98A 2V9HA 4TQ1A 2JWZA 2RDGA 1ET6A 2MBQA 4WJOA 1T0SC 4P1BC 2MLBA 2JF5A 2B76B 1Q4AA 3UF8A 1NDDA 3L0WB 3VUXA 1PGAA 3L4PA 4KGSA 2BPSA 1FXTB 3RYTA 3VTVA 3P4PB 4G3XB 4W6SA 2WGSA 1SXTA 5E6PA 2WDTB 4PYUA 3RWAA 3TMTA 3R8BA 4YL8A 2ZW1A 2O2BA 1N5XA 2A5UA 5AZHA 3ZGZA 3A4RA 2GX0A 2CKHB 1EMEA 1PYWD 3NVVA 3TSSA 5H8YE 1UBQA 5D3IB 2VVIA 1NI2A 4M0WA 2NR2A 3JSVA 4ZB1A 4F7ZA 2H5PA 4HJGE 3LVAA 3KWVA 3OJ3A 5H87A 3OLMD 3TEXA 3MJWA 1WE6A 3PV1A 3R7RA 3M62B 3AEBB 3DWMA 1TZ1A 2ICIA 1SGHA 4F8CB 3PRMB 1KM7A 4B95A 5D7GA 1KF6B 1STEA 2FIFA 4EULA 4PT5A 3R7QA 3SSTA 4C00A 2JSVX 2IBIB 1WXSA 3DHIC 1UWMA 2IPKD 3I63C 2WURA 1LXDA 3PVLA 1GG3A 2EKEC 3HUIA 2WXRA 3EA6A 4XWWA 4DXAB 2JVCA 1TJEA 3ZKJC 4XX5A 4B30A 1OQQA 1GC6A 2LASA 1FXIA 5AUKA 5DPWA 4W6NA 4LNFA 2IB6A 2L3ZA 1TBEA 1HUYA 1LQBA 3DQAA 3L08A 4C4VA 4W75A 1Q0WB 3VHTA 2L0FA 1V49A 3TIXA 2AWLA 4GN1A 1OXEA 4LTUA 2WHTA 3HIZA 4FN2A 1WGKA 3P4SB 2V3PA 3P8UA 4JL9A 3RNBC 2HCGA 2JX5A 2VZKD 1JBYA 5DTYA 3NS8A 4ZF3A 2N7DA 3M63B 2N4FA 2INNE 4G0NB 4ZIOA 4NQKE 5MPOA 3A9JA 1XCQL 2K6DB 3P28A 1SE9A 2LGDA 2GI9A 1KP5A 2G1EA 5DRFA 2B3AA 2ONQA 2Y3AA 3VVWB 1MOVA 5CHVC 2CU1A 2QLGB 1F0BA 1V5TA 3ZLZA 2Y0GA 3E5TA 4W9EA 1EMBA 4GDLB 2HPWA 5AUIA 2LUEA 4DXMA 3URYA 1XLOA 3APDA 4ZFSA 2D5GA 4XDDA 2ZVNA 3PS6A 5EE9A 4P16A 4WH4A 3CBEA 1JWMD 3L16A 5L95C 3BXBA 1AN8A 1FNUA 2MQJA 4NY0A 1MG4A 3CFAA 4YTPB 4EMQA 1L4ZB 3Q8EA 4ZRKA 3AE4B 5CHFA 2Q5WD 1WF9A 2XBBC 2HJ1A 2G45B 4KW8A 3WLDA 3SEBA 1XD3B 4W9LA 1ZXIA 3BK2A 4CHKA 2N9KA 4MGZE 1D6EC 2K0PA 3PO0A 5DPSA 3W1YA 3VTUA 1J7AA 4W9FA 1N63A 2NPTB 3A9KA 1XEEA 2WLBA 3PLVA 5BTTB 4ZRPA 3W5VB 5D2MB 4JX1C 3GEXA 5DPTA 1GOZA 2AQ2B 3ONSA 2M0AA 3PT2B 1TIFA 4OVVA 1JMLA 4UTSA 1NBFC 1XLQA 2KOXA 3P63A 4ZRIA 2QLIA 3C0RB 2IB5A 3NG0A 2L32A 5KHOA 2I38A 2VRRB 3N20C 2VAEA 1JRUA 1YN5A 4NQLB 1B9RA 3ECIA 4W9DA 1WXQA 3BXAA 2A50B 1V86A 1QYQA 4IK4A 2KVZA 2GOWA 1TS3A 2C9WB 3Q3NC 4FJYA 4A3PA 3NEDA 4HCNB 2HQZA 1F2RC 2N9PC 1N61A 2M0XA 3AB5A 4RGNA 5C2TB 2L8JA 2Z0EB 1EWYC 3ZUJA 4H2AA 1EMAA 2N9LA 5KHQA 3DQ5A 4MM3B 3O65B 1IYFA 5HGEA 1M94A 1DOYA 4II3B 4OHSA 2QILA 4TV3A 1CMXB 4RYWA 4BKGA 4A55A 1XQMA 2DAJA 2KKCA 2LWPA 2SAKA 2RGFA 2BS4B 3CD1A 3HVZA 2BYTA 1FPYA 1H6RA 3U0KA 3PGEA 2LHEA 2PTLA 1WR1A 5LTPA 2INPE 2MA9B 4II2B 3DPWA 3DBRI 3VK1A 1SE2A 3E9SA 2L0TA 1WR6E 5HW9A 4AS1A 3VUYA 1EF5A 3QJZA 4DXFA 1ZUXA 2KTRB 3KWLA 4WWOA 5C3JB 1BMLC 5DPHA 1JQ4A 2P4MA 3DQ2A 3SVEA 3DQLA 3EKHA 3ALBA 4M8NA 1Q4BA 4Q7UA 4LNIA 3MC8A 2DZJA 1FMAD 4GOBA 2A46A 2AHAA 5LK4A 3QAQA 4FJZA 1JRPA 2B3PA 1E6EB 3K9OB 3Q3FA 1KH0A 2G2SB 4WIPA 1UBIA 3ZYYX 3SD5A 4YTMB 2X38A 3WIMA 1R4MB 1J0GA 2INCC 2N7EA 4RGMA 3N30A 3LYYA 3VAWA 5T3IA 4I6NB 1NYQA 1OEYJ 3OAWA 3DQOA 4MJSB 4W6MA 4W6UA 2H8QA 3RPFC 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 4IK9A 2K8HA 2KDIA 3SR6A 5DQBA 3MC0B 2OHFA 1V6EA 3DQDA 3DQNA 1N62A 3ZNZB 2KACA 2AYOB 3DDCB
chains in the Genus database with same CATH topology
2GW4B 4EFOA 4WJQA 4OVUA 4ZINA 1QYFA 4W7RA 2BTJA 4IWQA 1ZGPA 4WQOB 2VADA 4IWPA 1YZWA 3CGLA 4NPNA 2L7RA 3ML9A 4GMVA 3SSPA 4WJPA 5J2RA 1RFAA 2DZKA 4HE4A 5E6NA 4GIVA 2RPQA 2FUHB 3ZO5B 4IC7B 1OGWA 4XOVA 3VTWA 4B9KA 2REXA 2KK8A 3RCZA 3IVFA 4ZYNA 3DBSA 2JZ3B 3PRPB 3IR8A 4FHJA 2MBOA 3DVNU 4ICUA 1JC1A 4EN1A 3BXCA 1RMOA 1XMZA 5FHVA 4LJPB 1I42A 2C60A 4Q9WA 4CO7A 3X23A 3QCAA 4LJBA 2ZMUA 2LXAA 3WALA 1WM3A 3DQ8A 2CHXA 4XOWA 1YFPA 2LGYA 3W1CA 1XQQA 2DUEA 1Q73A 4ANWA 3DPZA 2J0MA 4KF5C 4A3OA 2D2QA 3DQUA 2NBWB 4ICVA 4PS3A 3ZTDA 4W9HA 2K39A 4JQWC 5H89A 3QHTA 1YJ1A 4K81A 4LQUA 4HDOA 4Q7TA 5J17A 3LA1A 1OXDA 3SVCA 2KWVB 2QLGA 4W7XA 1ZGOA 2C7MB 1T0YA 5LTQA 4EDOA 3MGFA 1P1AA 1XA9A 2DAFA 3E5WA 1BFPA 1HCJA 5CTRC 4JEOA 4BOZB 3DQKA 3GJ2A 2QLHA 4ASWC 2KO3A 3DVGY 2R2QA 1C1YB 2G4DB 3S05A 3OSRA 4ZF5A 1J19A 3U8CA 2EMSA 3QARA 2NPTA 1TTNA 1KYPA 5BTTA 1QZEA 2ZCCA 3QC8B 2NBVB 1WM2A 4MDKE 4W74A 3WANA 2LGXA 1Q4DA 4W6HA 4J6IA 2AWKA 2LRUA 4JLCA 3ZVVA 1RAXA 1GNUA 2NCNA 2KDEB 2AWJA 3ZUNA 2DUIA 2KJ6A 2H5RA 2N9XA 3DQEA 3EVRA 3JYUA 5DPRA 3D32A 1E5WA 1PQSA 4MM3A 2G16B 2WSOA 5LTRA 3UINB 3KCTA 5HZSA 1YJ2A 5L83A 1RMMA 2ARLA 3UFZA 4EZLA 4KZ0A 2G4SA 2BGFA 4HPMB 5HZTA 2KMCA 2V1YA 4K1RB 2EMDA 4KDLB 5DCNA 3EK4A 3WA0A 3LVCA 3GL4A 2KDFB 3UIPB 2DYMA 2LZ6A 4GXBA 2V4EB 3R66C 5F9GA 2KLGA 1H4UA 2PE6B 2KTRA 3NT3A 3SG2A 5DY6A 2KDBA 2N9EB 1YHGA 4LW5A 3PIBA 2IO3B 4PS7A 2WHUA 2GBJA 4KA9A 3ZNHB 2A54B 3U0NA 3KUCB 1XSSA 3RWTA 4ZBLA 2N1WA 4KVGB 4Q9XA 3V6EB 3NT9A 3SSKA 4MEMA 5EXCI 2AL6A 4LDTB 1AARA 4WWPA 1WGGA 5EXUA 4MJSA 4BVUC 4N9F4 4NNJB 1W7TA 2AEHA 4EZJA 2ZO7A 2MCNB 1ZGUB 2M8SA 5HBDA 2L00B 4RM8A 4E3CA 2K8BA 4PPJA 1XT9B 2JRIB 2A47A 2J0JA 3ZTCA 4W73A 2K25A 1P3QU 4JIOU 5D94A 3VUWA 4R6BA 3ZW3A 3SSYA 1QYOA 4PPKA 3RD2A 3M22A 4W6AA 1VCBA 2R2OA 4EDSA 4MGYE 1WX7A 2G3QB 2G5ZB 2WX1A 2IY1B 2KQSA 2K8CA 4IUMB 3DOWA 3A4SC 3EHVA 3ZDTA 2YVCA 3L54A 2ZMWA 5H88A 1WXAA 2MP2A 3SVUA 4TUUA 3WCKA 2LRWA 4GDKB 4E71A 2QRFA 4KSKC 1I35A 5EB7A 1ZKHA 2I1KA 3JVZX 4H48A 3APFA 2FCMA 3APCA 3RZFA 1GL4A 5G55A 4L12A 3K9PB 3A8SA 2OGRA 2A4ZA 4XC2A 1WGHA 5EXBA 3KUZA 3H7PB 5FVGA 5AQBB 3V60A 3B0AA 4W7AA 3LSAA 3AI4A 1E8XA 4K7WA 1WYWB 3U8PA 4W6GA 4DXQA 1GC7A 1IPGA 4RMAA 4HQ9A 3QIJA 1EMLA 2ZVOA 4MELA 2V4EC 5GMVA 5TR5A 2XEWA 4ANUA 4BDUA 3EVUA 2IE2A 5AZFA 5G2NA 3V6CB 3SVOA 2DHZA 4OJ0A 4URKA 3U7DA 2KMAA 4G50A 1UISA 3SVBA 3JW0X 2CR5A 2UYZB 2DDCA 4TZAA 3SG4A 3VQIA 2GW3A 3QQ8B 2QZ0A 4DXPA 4DXNA 2YE0A 1S6ZA 2WYQA 2WIQA 3RZWC 2Q57A 4ORNA 3CSTA 3AULA 3NHEB 4FULA 2IO0B 4DK5A 3PJ7A 3EVPA 1XAEA 1B9CA 3AI5A 5EBJA 2JADA 5E6OA 4IK8A 4MGIE 2I1JA 3PREA 4L13A 3HK0A 4W6CA 1KYRA 2HE7A 4BBNC 4EUTA 1Q1OA 3PRZA 2DD9A 1V2YA 1YJFA 2K1FA 5J18A 2UWQA 3L17A 4DBGA 3IHPC 2AWTA 4GB9A 3QA8A 4IW0A 4EOYA 3TMPB 5LXIB 2CHZA 3KUDB 1U4AA 5EHUA 2WWZA 2DZMA 3SVSA 2DYBA 5DU0A 3ED8A 2LVQA 2MW5A 4PFEA 2A56B 2AWMA 1WZ3A 4P7IA 4GU2A 1WH3A 4FA6A 4BKSD 4DXOA 4JGHB 4JC2A 4BKSA 4XZ4A 5FVIA 2GBRA 4P1QA 4W76A 3DPXA 4LJCA 4EEWA 3KW5B 3SHQA 4LQTA 2KC1A 3VH3B 2CHWA 2V4EA 4DHJB 2IY0B 2LI5A 3U8ZA 1UZXB 1LM8B 4FLHA 4G11A 1GUAB 2KNBA 2D10A 1A5RA 2HGYA 4ZRJA 1RM9A 1K8RB 1WGRA 2HJOA 3DQ7A 4AOFA 3HHMA 2G6XA 2MP2B 2H6VA 3DQCA 1WI0A 5CHWA 3NZSA 2Z0DB 2A53B 4HQ8A 2IOVA 3SSHA 2HD5B 1RRBA 2JXXA 3DCGA 2PXWA 1UD7A 4GGQA 1KOTA 4W6JA 4BBNF 5EB6A 2RD0A 4LDTD 1BT0A 4ANXA 4XVPA 1QY3A 2BYVE 1EMMA 4I6LB 2IZVB 3TMRA 3N32A 4GOCA 3SSLA 4HDQA 2PJHA 3I19A 3CFHA 3SS0A 5DPJA 4WJNA 1G6JA 4BOSC 3MHSD 3U30A 3AXCA 4H3LA 2BWFA 3PZDA 1WRDB 3KYDD 1EO6A 2J7QB 2MBBB 5C23A 3SG6A 1OTRB 3DQ4A 3O78A 1V80A 4W72A 4OY4A 2QHOA 4AJWA 3NOBA 3PJ5A 3U8AA 4ZF4A 2L76A 3EFUA 1GGXA 1F9JA 4A20A 4KV2A 1P0RA 4KF4A 1SIFA 3CD9A 3CFFA 1H4RA 4DHZE 3AU4A 4HJKA 2C7HA 5EJUA 1JC0A 2Y5BB 1R4MI 2MBEA 2LVOA 5CX3A 3A33B 2CS4A 2ZEQA 3RULA 3ST4A 1Z5SB 1G7KA 1W7UA 3B1LX 3CSFA 3R3MA 2H9WA 4W7FA 1E7UA 4TQ0A 2KX0A 3LVDA 3SSVA 2W9NA 1C3TA 4XGYA 3SG5A 3PHWB 4GDKA 4W6RA 2ZNVC 4KW9A 3SRYA 3IP2A 5BT0A 4HCPB 3GB3A 4WAAA 2O6VB 4PYZA 3WLCA 3OJ4B 4IWOA 3EK7A 5LXHA 2OKYA 2A52B 1X1MA 3NZUA 3H7PA 3A1QB 1WY8A 1EMCA 3VHTC 3H7SA 5KTGA 3HM3A 4RM9A 2KJRA 4KSLC 2OOBB 3DPDA 1HE8A 3TL5A 3UIOB 3LJ3A 5BO4B 2M1MA 2Z6YA 3TCAA 3TBLD 1GJZA 4IM3A 3VFKA 4KEXA 3GOEA 3MTNB 3PSEB 2YFPA 5J2OA 2IYDB 1WGDA 3V62A 3SG3A 1WXMA 1E7VA 3H6NA 2C9JA 4DDID 4KIKB 4GF6B 2JPHA 3IBEA 3E5VA 3P2BA 4AWJA 2POXA 5HZUA 4W6KA 3BINA 4KF5A 4LJOB 5DTXA 2V3SA 1KYSA 2ZO6A 4M8MA 3DQ9A 3SG7A 3KH0A 2WX0A 2FZUA 3WAMA 4HK2A 3EK8A 1UGMA 2D3GA 1GFLA 4DDGD 3G9AA 4LJDC 3SDLC 4KGEA 3NY5A 2VZXA 1E8WA 1E90A 4W9JA 4Z4KA 2MX2A 1YD8U 1E8ZA 2N1VA 4AJYB 2JZZA 1Z2MA 4Z4MA 1ISNA 3BX9A 2ZPNA 4DWFA 3DQIA 2KXJA 3W1SC 4R6DA 3O77A 3SVNA 3S2AA 3DVNV 4HXDA 2J0KA 1WX9A 5DPGA 1J8CA 2O2VB 3ZRCA 1WGYA 3DQ6A 1EMFA 2KWCA 2MRPA 5BQLA 2ICRA 3M3JA 4N3DA 2OKWA 5DRGA 2PXSA 3QK0A 2KD0A 2BF8B 3L13A 1KLVA 4KDIC 4AS8A 3GZNI 1RLFA 2OTEA 2BKRB 4IK1A 2A48A 3DQFA 2AH8A 3V61A 1EUVB 3CB9A 3NF0A 5JHAA 4NWSA 1JBZA 2PPHA 4GSWA 4H3MA 4W7DA 2B3QA 1Y8RC 4DHJD 4W6FA 2RR9A 2KVRA 3VDZA 3ZNGC 3DBHI 3ZRFA 2ZJDA 4J89A 4MH0E 3PJBA 4OGSA 1Q5WB 1C4FA 4W7EA 1CV7A 1MOUA 3VXWA 4DKMA 3K1KA 3DQJA 2AL3A 5IAAC 3DQ3A 2FIDA 1R4NI 4Q7RA 1V9JA 3SVRA 2PE9A 3VH4B 4W77A 1KJTA 3I3TB 3HM6X 4PS8A 1EMGA 4ZDVA 4L1IA 2BWES 2ZCBA 5D6JB 4LJDA 2KJHB 4JRBA 1MYWA 1S3SG 3ZULA 2KQ7A 4KZCA 1L2NA 1LFDA 5HZOA 3H1OA 4IM0A 1D3ZA 4BFRA 5DTLA 5IA7A 4TKNA 3H1RA 3NEZA 2Z59B 1WMHB 2DUFA 2PEAA 3W1SA 4B6WA 2ZPYA 2DX5B 2KTFA 2NVUI 1RRXA 2M17A 4TZGA 2KANA 2KWUB 4J88A 1WJNA 4K7UA 4E74A 2Z1OA 2DYOA 3DQMA 3M95A 1V81A 3ADFA 3ZUFA 4W69A 2LJ5A 2O29A 1OXFA 3ZTFA 3PHXB 2L05A 3WAOA 3EKJA 1V5OA 3DVGX 2XK5B 2D07B 2WSNA 3U0MA 3RT3B 4IZNA 1F09A 2DD7A 2Q6PA 3V3DA 2H5QA 3T9LA 1Q4EA 2V4LA 3IFWB 4U2VA 4J8AA 4W6PA 3PTFC 2G6YA 2C9IA 2JY6A 2HTHA 4W6IA 3SU8X 1WE7A 3WAPA 4HQCA 2EMOA 4AP4C 2O6VD 3VICA 2HRSA 2O6VA 4B5YA 4AUQC 2HFCA 4W9CA 2WISA 1MG8A 2YE1A 5C1ZA 1YHHA 2DZIA 4M0WB 3SV5A 3AKOA 3JSVB 3ZDMC 3A1QA 1YQBA 1TGZB 2HQKA 2RSUA 2ZZPB 1Z1QA 3PLUA 2QLEA 4KGFA 5DTZA 3T8MA 4W9IA 3ZNID 3GJ1A 3B08A 4I2YA 2KX3A 1ZGQA 2ZNVB 2OJRA 1W7SA 2MWSB 1S1QB 4JGEA 4PPLA 2GX2A 3H1UA 1OEYA 2KFJA 4F1SA 2VVJA 1ZW7A 2MBHA 3W1DA 4B30B 1UH6A 2HGDA 3UGBB 3AU5A 3BY4B 4KIKA 4I6PA 3ZIMA 4NAWA 5JZEB 3X0WA 3SVDA 2GBMA 1EF1A 2OTBA 3VHTB 2FNJB 4MGKE 4LCDE 2MSED 3CMMB 4HLEA 2G3OA 1Q4CA 2GBNA 2DUHA 3KYCD 2KHWB 4XL5A 4W6BA 5EDSA 3ST2A 3ST0A 3DBLI 3ST3A 2G3DB 3A9JB 4HVFA 5HKHA 1OQYA 2FCNA 4MSQB 4DKNA 4GESB 3DQVA 2O24A 2OJKA 4IK5A 2BYFA 3N3KB 4BKTA 2KC2A 4W9KA 2QT2A 3KCSA 3PPAA 3EECA 2FAZA 1WZ0A 2JRHA 3RUIB 2JUOA 1WJUA 3UQBA 4KAGA 3LDZE 4H47A 3UQAA 4JF9A 4RTCA 4W6DA 5DQMA 4FBJB 4KPIA 2O2VA 1P9DU 2QU1A 5DPIA 4NJ7A 1WFYA 4CYEA 3DQHA 1L7YA 2DENB 2GMIC 4RYSA 2EMNA 5AZGA 1YIWA 3A9KB 1WXVA 1VD2A 2IO2B 2KZRA 1WX8A 4IM2A 4FADA 4JFGA 3EC8A 4AR7A 2FL1A 3U0LA 2RH7A 2LVPA 3H9DA 4FJVB 1H8CA 3OSQA 2IO1B 2H5OA 2Z6ZA 3M24A 4W9GA 4W6LA 4IK3A 4WWNA 4GDLA 2YDZA 4W7CA 2HJ8A 2JT4B 2FWQA 2FCSA 3EVVA 5FR6A 4DXIA 3KVFB 2VVHA 3DQ1A 1E8YA 2BKFA 4NJ6A 2G6EA 1QXTA 3QX1A 4HPLB 2GBKA 5AEKB 5LLIA 1WJ4A 4X57B 3Q3JA 3QWZB 2NS5A 4OQWA 4IG7B 3OGOA 1UELA 2ASQA 2D11A 4W6TA 3CF6E 2DDDA 1WJ6A 3LS3A 1WIAA 4HVBA 2FCQA 2KN5A 1WMHA 4FHKA 5JH5C 2LXCA 1RMPA 4K7SA 2KLCA 2WHSA 3ENEA 3TJPA 4W6OA 4ANJA 1Z1PA 4EKUA 2C5LC 4HWIB 4MSMB 1YHIA 4H3NA 2DUGA 1EMKA 2KFKB 4KW4A 1YX6B 4NAWB 3IG3A 3L10B 2BYEA 2M4NA 2LD9A 2NBUA 4P76A 2XK5A 1YX5B 2C7NB 2K6QA 2YLMA 4ANVA 5FVFA 2Z6XA 3LF3A 5JHBA 3UG0A 3LF4B 2EMTA 1P98A 4TQ1A 2JWZA 2MBQA 4WJOA 2MLBA 2JF5A 3UF8A 1Q4AA 1NDDA 3L0WB 3VUXA 2BPSA 1FXTB 3RYTA 3VTVA 4G3XB 4W6SA 5E6PA 2WDTB 4PYUA 3RWAA 3TMTA 4YL8A 2O2BA 5AZHA 2A5UA 3A4RA 2GX0A 2CKHB 1EMEA 1UBQA 2VVIA 1NI2A 2NR2A 3JSVA 4ZB1A 4F7ZA 2H5PA 3LVAA 3OJ3A 5H87A 3OLMD 3MJWA 1WE6A 3PV1A 3R7RA 3M62B 1TZ1A 1SGHA 4F8CB 3PRMB 1KM7A 4B95A 5D7GA 2FIFA 4EULA 3R7QA 3SSTA 2IBIB 1WXSA 2WURA 1LXDA 3PVLA 1GG3A 2EKEC 4DXAB 2JVCA 3ZKJC 4XX5A 4B30A 1GC6A 2LASA 5DPWA 4W6NA 2IB6A 2L3ZA 1TBEA 3L08A 1HUYA 3DQAA 1LQBA 4W75A 1Q0WB 3VHTA 2L0FA 1V49A 3TIXA 2AWLA 4GN1A 1OXEA 2WHTA 3HIZA 4FN2A 3P8UA 4JL9A 2HCGA 1JBYA 5DTYA 3NS8A 4ZF3A 2N7DA 3M63B 2N4FA 4G0NB 4ZIOA 4NQKE 3A9JA 2K6DB 3P28A 1SE9A 2LGDA 1KP5A 5DRFA 2B3AA 3VVWB 1MOVA 5CHVC 2CU1A 2QLGB 1F0BA 1V5TA 3ZLZA 2Y0GA 3E5TA 4W9EA 1EMBA 4GDLB 2HPWA 2LUEA 4DXMA 3APDA 4ZFSA 2ZVNA 3PS6A 3CBEA 3L16A 5L95C 3BXBA 2MQJA 4NY0A 3CFAA 4EMQA 4ZRKA 5CHFA 1WF9A 2XBBC 2G45B 4KW8A 3WLDA 1XD3B 4W9LA 4CHKA 4MGZE 5DPSA 3W1YA 3VTUA 4W9FA 2NPTB 3A9KA 3PLVA 5BTTB 5D2MB 3GEXA 5DPTA 3ONSA 3PT2B 4ZRIA 4OVVA 4UTSA 1NBFC 2KOXA 2QLIA 3C0RB 2IB5A 5KHOA 2VRRB 2VAEA 1JRUA 4NQLB 3ECIA 4W9DA 3BXAA 2A50B 1V86A 1QYQA 4IK4A 2GOWA 2C9WB 4FJYA 4A3PA 3NEDA 4HCNB 2HQZA 2N9PC 2M0XA 2L8JA 2Z0EB 3ZUJA 1EMAA 5KHQA 3DQ5A 3O65B 1IYFA 5HGEA 1M94A 4II3B 4OHSA 4TV3A 1CMXB 4RYWA 4BKGA 1XQMA 2DAJA 2KKCA 2LWPA 2RGFA 3CD1A 1H6RA 3U0KA 3PGEA 1WR1A 5LTPA 2MA9B 4II2B 3DPWA 3DBRI 3VK1A 2L0TA 1WR6E 5HW9A 3VUYA 1EF5A 3QJZA 1ZUXA 2KTRB 4WWOA 5DPHA 2P4MA 3DQ2A 3SVEA 3DQLA 3EKHA 3ALBA 4M8NA 1Q4BA 4Q7UA 2DZJA 4GOBA 2A46A 2AHAA 5LK4A 3QAQA 4FJZA 2B3PA 3K9OB 3Q3FA 2G2SB 1UBIA 3SD5A 3WIMA 1J0GA 2N7EA 3N30A 3VAWA 5T3IA 4I6NB 1OEYJ 3OAWA 3DQOA 4MJSB 4W6MA 4W6UA 2H8QA 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 4IK9A 2K8HA 2KDIA 5DQBA 1V6EA 3DQDA 3DQNA 3ZNZB 2AYOB 3DDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GW4 B;  4EFO A;  4WJQ A;  4OVU A;  4ZIN A;  1QYF A;  4W7R A;  2BTJ A;  4IWQ A;  1ZGP A;  4WQO B;  2VAD A;  4IWP A;  1YZW A;  3CGL A;  4NPN A;  2L7R A;  3ML9 A;  4GMV A;  3SSP A;  4WJP A;  5J2R A;  1RFA A;  2DZK A;  4HE4 A;  5E6N A;  4GIV A;  2RPQ A;  2FUH B;  3ZO5 B;  4IC7 B;  1OGW A;  4XOV A;  3VTW A;  4B9K A;  2REX A;  2KK8 A;  3RCZ A;  3IVF A;  4ZYN A;  3DBS A;  2JZ3 B;  3PRP B;  3IR8 A;  4FHJ A;  2MBO A;  3DVN U;  4ICU A;  1JC1 A;  4EN1 A;  3BXC A;  1RMO A;  1XMZ A;  5FHV A;  4LJP B;  1I42 A;  2C60 A;  4Q9W A;  4CO7 A;  3X23 A;  3QCA A;  4LJB A;  2ZMU A;  2LXA A;  3WAL A;  1WM3 A;  3DQ8 A;  2CHX A;  4XOW A;  1YFP A;  2LGY A;  3W1C A;  1XQQ A;  2DUE A;  1Q73 A;  4ANW A;  3DPZ A;  2J0M A;  4KF5 C;  4A3O A;  2D2Q A;  3DQU A;  2NBW B;  4ICV A;  4PS3 A;  3ZTD A;  4W9H A;  2K39 A;  4JQW C;  5H89 A;  3QHT A;  1YJ1 A;  4K81 A;  4LQU A;  4HDO A;  4Q7T A;  5J17 A;  3LA1 A;  1OXD A;  3SVC A;  2KWV B;  2QLG A;  4W7X A;  1ZGO A;  2C7M B;  1T0Y A;  5LTQ A;  4EDO A;  3MGF A;  1P1A A;  1XA9 A;  2DAF A;  3E5W A;  1BFP A;  1HCJ A;  5CTR C;  4JEO A;  4BOZ B;  3DQK A;  3GJ2 A;  2QLH A;  4ASW C;  2KO3 A;  3DVG Y;  2R2Q A;  1C1Y B;  2G4D B;  3S05 A;  3OSR A;  4ZF5 A;  1J19 A;  3U8C A;  2EMS A;  3QAR A;  2NPT A;  1TTN A;  1KYP A;  5BTT A;  1QZE A;  2ZCC A;  3QC8 B;  2NBV B;  1WM2 A;  4MDK E;  4W74 A;  3WAN A;  2LGX A;  1Q4D A;  4W6H A;  4J6I A;  2AWK A;  2LRU A;  4JLC A;  3ZVV A;  1RAX A;  1GNU A;  2NCN A;  2KDE B;  2AWJ A;  3ZUN A;  2DUI A;  2KJ6 A;  2H5R A;  2N9X A;  3DQE A;  3EVR A;  3JYU A;  5DPR A;  3D32 A;  1E5W A;  1PQS A;  4MM3 A;  2G16 B;  2WSO A;  5LTR A;  3UIN B;  3KCT A;  5HZS A;  1YJ2 A;  5L83 A;  1RMM A;  2ARL A;  3UFZ A;  4EZL A;  4KZ0 A;  2G4S A;  2BGF A;  4HPM B;  5HZT A;  2KMC A;  2V1Y A;  4K1R B;  2EMD A;  4KDL B;  5DCN A;  3EK4 A;  3WA0 A;  3LVC A;  3GL4 A;  2KDF B;  3UIP B;  2DYM A;  2LZ6 A;  4GXB A;  2V4E B;  3R66 C;  5F9G A;  2KLG A;  1H4U A;  2PE6 B;  2KTR A;  3NT3 A;  3SG2 A;  5DY6 A;  2KDB A;  2N9E B;  1YHG A;  4LW5 A;  3PIB A;  2IO3 B;  4PS7 A;  2WHU A;  2GBJ A;  4KA9 A;  3ZNH B;  2A54 B;  3U0N A;  3KUC B;  1XSS A;  3RWT A;  4ZBL A;  2N1W A;  4KVG B;  4Q9X A;  3V6E B;  3NT9 A;  3SSK A;  4MEM A;  5EXC I;  2AL6 A;  4LDT B;  1AAR A;  4WWP A;  1WGG A;  5EXU A;  4MJS A;  4BVU C;  4N9F 4;  4NNJ B;  1W7T A;  2AEH A;  4EZJ A;  2ZO7 A;  2MCN B;  1ZGU B;  2M8S A;  5HBD A;  2L00 B;  4RM8 A;  4E3C A;  2K8B A;  4PPJ A;  1XT9 B;  2JRI B;  2A47 A;  2J0J A;  3ZTC A;  4W73 A;  2K25 A;  1P3Q U;  4JIO U;  5D94 A;  3VUW A;  4R6B A;  3ZW3 A;  3SSY A;  1QYO A;  4PPK A;  3RD2 A;  3M22 A;  4W6A A;  1VCB A;  2R2O A;  4EDS A;  4MGY E;  1WX7 A;  2G3Q B;  2G5Z B;  2WX1 A;  2IY1 B;  2KQS A;  2K8C A;  4IUM B;  3DOW A;  3A4S C;  3EHV A;  3ZDT A;  2YVC A;  3L54 A;  2ZMW A;  5H88 A;  1WXA A;  2MP2 A;  3SVU A;  4TUU A;  3WCK A;  2LRW A;  4GDK B;  4E71 A;  2QRF A;  4KSK C;  1I35 A;  5EB7 A;  1ZKH A;  2I1K A;  3JVZ X;  4H48 A;  3APF A;  2FCM A;  3APC A;  3RZF A;  1GL4 A;  5G55 A;  4L12 A;  3K9P B;  3A8S A;  2OGR A;  2A4Z A;  4XC2 A;  1WGH A;  5EXB A;  3KUZ A;  3H7P B;  5FVG A;  5AQB B;  3V60 A;  3B0A A;  4W7A A;  3LSA A;  3AI4 A;  1E8X A;  4K7W A;  1WYW B;  3U8P A;  4W6G A;  4DXQ A;  1GC7 A;  1IPG A;  4RMA A;  4HQ9 A;  3QIJ A;  1EML A;  2ZVO A;  4MEL A;  2V4E C;  5GMV A;  5TR5 A;  2XEW A;  4ANU A;  4BDU A;  3EVU A;  2IE2 A;  5AZF A;  5G2N A;  3V6C B;  3SVO A;  2DHZ A;  4OJ0 A;  4URK A;  3U7D A;  2KMA A;  4G50 A;  1UIS A;  3SVB A;  3JW0 X;  2CR5 A;  2UYZ B;  2DDC A;  4TZA A;  3SG4 A;  3VQI A;  2GW3 A;  3QQ8 B;  2QZ0 A;  4DXP A;  4DXN A;  2YE0 A;  1S6Z A;  2WYQ A;  2WIQ A;  3RZW C;  2Q57 A;  4ORN A;  3CST A;  3AUL A;  3NHE B;  4FUL A;  2IO0 B;  4DK5 A;  3PJ7 A;  3EVP A;  1XAE A;  1B9C A;  3AI5 A;  5EBJ A;  2JAD A;  5E6O A;  4IK8 A;  4MGI E;  2I1J A;  3PRE A;  4L13 A;  3HK0 A;  4W6C A;  1KYR A;  2HE7 A;  4BBN C;  4EUT A;  1Q1O A;  3PRZ A;  2DD9 A;  1V2Y A;  1YJF A;  2K1F A;  5J18 A;  2UWQ A;  3L17 A;  4DBG A;  3IHP C;  2AWT A;  4GB9 A;  3QA8 A;  4IW0 A;  4EOY A;  3TMP B;  5LXI B;  2CHZ A;  3KUD B;  1U4A A;  5EHU A;  2WWZ A;  2DZM A;  3SVS A;  2DYB A;  5DU0 A;  3ED8 A;  2LVQ A;  2MW5 A;  4PFE A;  2A56 B;  2AWM A;  1WZ3 A;  4P7I A;  4GU2 A;  1WH3 A;  4FA6 A;  4BKS D;  4DXO A;  4JGH B;  4JC2 A;  4BKS A;  4XZ4 A;  5FVI A;  2GBR A;  4P1Q A;  4W76 A;  3DPX A;  4LJC A;  4EEW A;  3KW5 B;  3SHQ A;  4LQT A;  2KC1 A;  3VH3 B;  2CHW A;  2V4E A;  4DHJ B;  2IY0 B;  2LI5 A;  3U8Z A;  1UZX B;  1LM8 B;  4FLH A;  4G11 A;  1GUA B;  2KNB A;  2D10 A;  1A5R A;  2HGY A;  4ZRJ A;  1RM9 A;  1K8R B;  1WGR A;  2HJO A;  3DQ7 A;  4AOF A;  3HHM A;  2G6X A;  2MP2 B;  2H6V A;  3DQC A;  1WI0 A;  5CHW A;  3NZS A;  2Z0D B;  2A53 B;  4HQ8 A;  2IOV A;  3SSH A;  2HD5 B;  1RRB A;  2JXX A;  3DCG A;  2PXW A;  1UD7 A;  4GGQ A;  1KOT A;  4W6J A;  4BBN F;  5EB6 A;  2RD0 A;  4LDT D;  1BT0 A;  4ANX A;  4XVP A;  1QY3 A;  2BYV E;  1EMM A;  4I6L B;  2IZV B;  3TMR A;  3N32 A;  4GOC A;  3SSL A;  4HDQ A;  2PJH A;  3I19 A;  3CFH A;  3SS0 A;  5DPJ A;  4WJN A;  1G6J A;  4BOS C;  3MHS D;  3U30 A;  3AXC A;  4H3L A;  2BWF A;  3PZD A;  1WRD B;  3KYD D;  1EO6 A;  2J7Q B;  2MBB B;  5C23 A;  3SG6 A;  1OTR B;  3DQ4 A;  3O78 A;  1V80 A;  4W72 A;  4OY4 A;  2QHO A;  4AJW A;  3NOB A;  3PJ5 A;  3U8A A;  4ZF4 A;  2L76 A;  3EFU A;  1GGX A;  1F9J A;  4A20 A;  4KV2 A;  1P0R A;  4KF4 A;  1SIF A;  3CD9 A;  3CFF A;  1H4R A;  4DHZ E;  3AU4 A;  4HJK A;  2C7H A;  5EJU A;  1JC0 A;  2Y5B B;  1R4M I;  2MBE A;  2LVO A;  5CX3 A;  3A33 B;  2CS4 A;  2ZEQ A;  3RUL A;  3ST4 A;  1Z5S B;  1G7K A;  1W7U A;  3B1L X;  3CSF A;  3R3M A;  2H9W A;  4W7F A;  1E7U A;  4TQ0 A;  2KX0 A;  3LVD A;  3SSV A;  2W9N A;  1C3T A;  4XGY A;  3SG5 A;  3PHW B;  4GDK A;  4W6R A;  2ZNV C;  4KW9 A;  3SRY A;  3IP2 A;  5BT0 A;  4HCP B;  3GB3 A;  4WAA A;  2O6V B;  4PYZ A;  3WLC A;  3OJ4 B;  4IWO A;  3EK7 A;  5LXH A;  2OKY A;  2A52 B;  1X1M A;  3NZU A;  3H7P A;  3A1Q B;  1WY8 A;  1EMC A;  3VHT C;  3H7S A;  5KTG A;  3HM3 A;  4RM9 A;  2KJR A;  4KSL C;  2OOB B;  3DPD A;  1HE8 A;  3TL5 A;  3UIO B;  3LJ3 A;  5BO4 B;  2M1M A;  2Z6Y A;  3TCA A;  3TBL D;  1GJZ A;  4IM3 A;  3VFK A;  4KEX A;  3GOE A;  3MTN B;  3PSE B;  2YFP A;  5J2O A;  2IYD B;  1WGD A;  3V62 A;  3SG3 A;  1WXM A;  1E7V A;  3H6N A;  2C9J A;  4DDI D;  4KIK B;  4GF6 B;  2JPH A;  3IBE A;  3E5V A;  3P2B A;  4AWJ A;  2POX A;  5HZU A;  4W6K A;  3BIN A;  4KF5 A;  4LJO B;  5DTX A;  2V3S A;  1KYS A;  2ZO6 A;  4M8M A;  3DQ9 A;  3SG7 A;  3KH0 A;  2WX0 A;  2FZU A;  3WAM A;  4HK2 A;  3EK8 A;  1UGM A;  2D3G A;  1GFL A;  4DDG D;  3G9A A;  4LJD C;  3SDL C;  4KGE A;  3NY5 A;  2VZX A;  1E8W A;  1E90 A;  4W9J A;  4Z4K A;  2MX2 A;  1YD8 U;  1E8Z A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  4Z4M A;  1ISN A;  3BX9 A;  2ZPN A;  4DWF A;  3DQI A;  2KXJ A;  3W1S C;  4R6D A;  3O77 A;  3SVN A;  3S2A A;  3DVN V;  4HXD A;  2J0K A;  1WX9 A;  5DPG A;  1J8C A;  2O2V B;  3ZRC A;  1WGY A;  3DQ6 A;  1EMF A;  2KWC A;  2MRP A;  5BQL A;  2ICR A;  3M3J A;  4N3D A;  2OKW A;  5DRG A;  2PXS A;  3QK0 A;  2KD0 A;  2BF8 B;  3L13 A;  1KLV A;  4KDI C;  4AS8 A;  3GZN I;  1RLF A;  2OTE A;  2BKR B;  4IK1 A;  2A48 A;  3DQF A;  2AH8 A;  3V61 A;  1EUV B;  3CB9 A;  3NF0 A;  5JHA A;  4NWS A;  1JBZ A;  2PPH A;  4GSW A;  4H3M A;  4W7D A;  2B3Q A;  1Y8R C;  4DHJ D;  4W6F A;  2RR9 A;  2KVR A;  3VDZ A;  3ZNG C;  3DBH I;  3ZRF A;  2ZJD A;  4J89 A;  4MH0 E;  3PJB A;  4OGS A;  1Q5W B;  1C4F A;  4W7E A;  1CV7 A;  1MOU A;  3VXW A;  4DKM A;  3K1K A;  3DQJ A;  2AL3 A;  5IAA C;  3DQ3 A;  2FID A;  1R4N I;  4Q7R A;  1V9J A;  3SVR A;  2PE9 A;  3VH4 B;  4W77 A;  1KJT A;  3I3T B;  3HM6 X;  4PS8 A;  1EMG A;  4ZDV A;  4L1I A;  2BWE S;  2ZCB A;  5D6J B;  4LJD A;  2KJH B;  4JRB A;  1MYW A;  1S3S G;  3ZUL A;  2KQ7 A;  4KZC A;  1L2N A;  1LFD A;  5HZO A;  3H1O A;  4IM0 A;  1D3Z A;  4BFR A;  5DTL A;  5IA7 A;  4TKN A;  3H1R A;  3NEZ A;  2Z59 B;  1WMH B;  2DUF A;  2PEA A;  3W1S A;  4B6W A;  2ZPY A;  2DX5 B;  2KTF A;  2NVU I;  1RRX A;  2M17 A;  4TZG A;  2KAN A;  2KWU B;  4J88 A;  1WJN A;  4K7U A;  4E74 A;  2Z1O A;  2DYO A;  3DQM A;  3M95 A;  1V81 A;  3ADF A;  3ZUF A;  4W69 A;  2LJ5 A;  2O29 A;  1OXF A;  3ZTF A;  3PHX B;  2L05 A;  3WAO A;  3EKJ A;  1V5O A;  3DVG X;  2XK5 B;  2D07 B;  2WSN A;  3U0M A;  3RT3 B;  4IZN A;  1F09 A;  2DD7 A;  2Q6P A;  3V3D A;  2H5Q A;  3T9L A;  1Q4E A;  2V4L A;  3IFW B;  4U2V A;  4J8A A;  4W6P A;  3PTF C;  2G6Y A;  2C9I A;  2JY6 A;  2HTH A;  4W6I A;  3SU8 X;  1WE7 A;  3WAP A;  4HQC A;  2EMO A;  4AP4 C;  2O6V D;  3VIC A;  2HRS A;  2O6V A;  4B5Y A;  4AUQ C;  2HFC A;  4W9C A;  2WIS A;  1MG8 A;  2YE1 A;  5C1Z A;  1YHH A;  2DZI A;  4M0W B;  3SV5 A;  3AKO A;  3JSV B;  3ZDM C;  3A1Q A;  1YQB A;  1TGZ B;  2HQK A;  2RSU A;  2ZZP B;  1Z1Q A;  3PLU A;  2QLE A;  4KGF A;  5DTZ A;  3T8M A;  4W9I A;  3ZNI D;  3GJ1 A;  3B08 A;  4I2Y A;  2KX3 A;  1ZGQ A;  2ZNV B;  2OJR A;  1W7S A;  2MWS B;  1S1Q B;  4JGE A;  4PPL A;  2GX2 A;  3H1U A;  1OEY A;  2KFJ A;  4F1S A;  2VVJ A;  1ZW7 A;  2MBH A;  3W1D A;  4B30 B;  1UH6 A;  2HGD A;  3UGB B;  3AU5 A;  3BY4 B;  4KIK A;  4I6P A;  3ZIM A;  4NAW A;  5JZE B;  3X0W A;  3SVD A;  2GBM A;  1EF1 A;  2OTB A;  3VHT B;  2FNJ B;  4MGK E;  4LCD E;  2MSE D;  3CMM B;  4HLE A;  2G3O A;  1Q4C A;  2GBN A;  2DUH A;  3KYC D;  2KHW B;  4XL5 A;  4W6B A;  5EDS A;  3ST2 A;  3ST0 A;  3DBL I;  3ST3 A;  2G3D B;  3A9J B;  4HVF A;  5HKH A;  1OQY A;  2FCN A;  4MSQ B;  4DKN A;  4GES B;  3DQV A;  2O24 A;  2OJK A;  4IK5 A;  2BYF A;  3N3K B;  4BKT A;  2KC2 A;  4W9K A;  2QT2 A;  3KCS A;  3PPA A;  3EEC A;  2FAZ A;  1WZ0 A;  2JRH A;  3RUI B;  2JUO A;  1WJU A;  3UQB A;  4KAG A;  3LDZ E;  4H47 A;  3UQA A;  4JF9 A;  4RTC A;  4W6D A;  5DQM A;  4FBJ B;  4KPI A;  2O2V A;  1P9D U;  2QU1 A;  5DPI A;  4NJ7 A;  1WFY A;  4CYE A;  3DQH A;  1L7Y A;  2DEN B;  2GMI C;  4RYS A;  2EMN A;  5AZG A;  1YIW A;  3A9K B;  1WXV A;  1VD2 A;  2IO2 B;  2KZR A;  1WX8 A;  4IM2 A;  4FAD A;  4JFG A;  3EC8 A;  4AR7 A;  2FL1 A;  3U0L A;  2RH7 A;  2LVP A;  3H9D A;  4FJV B;  1H8C A;  3OSQ A;  2IO1 B;  2H5O A;  2Z6Z A;  3M24 A;  4W9G A;  4W6L A;  4IK3 A;  4WWN A;  4GDL A;  2YDZ A;  4W7C A;  2HJ8 A;  2JT4 B;  2FWQ A;  2FCS A;  3EVV A;  5FR6 A;  4DXI A;  3KVF B;  2VVH A;  3DQ1 A;  1E8Y A;  2BKF A;  4NJ6 A;  2G6E A;  1QXT A;  3QX1 A;  4HPL B;  2GBK A;  5AEK B;  5LLI A;  1WJ4 A;  4X57 B;  3Q3J A;  3QWZ B;  2NS5 A;  4OQW A;  4IG7 B;  3OGO A;  1UEL A;  2ASQ A;  2D11 A;  4W6T A;  3CF6 E;  2DDD A;  1WJ6 A;  3LS3 A;  1WIA A;  4HVB A;  2FCQ A;  2KN5 A;  1WMH A;  4FHK A;  5JH5 C;  2LXC A;  1RMP A;  4K7S A;  2KLC A;  2WHS A;  3ENE A;  3TJP A;  4W6O A;  4ANJ A;  1Z1P A;  4EKU A;  2C5L C;  4HWI B;  4MSM B;  1YHI A;  4H3N A;  2DUG A;  1EMK A;  2KFK B;  4KW4 A;  1YX6 B;  4NAW B;  3IG3 A;  3L10 B;  2BYE A;  2M4N A;  2LD9 A;  2NBU A;  4P76 A;  2XK5 A;  1YX5 B;  2C7N B;  2K6Q A;  2YLM A;  4ANV A;  5FVF A;  2Z6X A;  3LF3 A;  5JHB A;  3UG0 A;  3LF4 B;  2EMT A;  1P98 A;  4TQ1 A;  2JWZ A;  2MBQ A;  4WJO A;  2MLB A;  2JF5 A;  3UF8 A;  1Q4A A;  1NDD A;  3L0W B;  3VUX A;  2BPS A;  1FXT B;  3RYT A;  3VTV A;  4G3X B;  4W6S A;  5E6P A;  2WDT B;  4PYU A;  3RWA A;  3TMT A;  4YL8 A;  2O2B A;  5AZH A;  2A5U A;  3A4R A;  2GX0 A;  2CKH B;  1EME A;  1UBQ A;  2VVI A;  1NI2 A;  2NR2 A;  3JSV A;  4ZB1 A;  4F7Z A;  2H5P A;  3LVA A;  3OJ3 A;  5H87 A;  3OLM D;  3MJW A;  1WE6 A;  3PV1 A;  3R7R A;  3M62 B;  1TZ1 A;  1SGH A;  4F8C B;  3PRM B;  1KM7 A;  4B95 A;  5D7G A;  2FIF A;  4EUL A;  3R7Q A;  3SST A;  2IBI B;  1WXS A;  2WUR A;  1LXD A;  3PVL A;  1GG3 A;  2EKE C;  4DXA B;  2JVC A;  3ZKJ C;  4XX5 A;  4B30 A;  1GC6 A;  2LAS A;  5DPW A;  4W6N A;  2IB6 A;  2L3Z A;  1TBE A;  3L08 A;  1HUY A;  3DQA A;  1LQB A;  4W75 A;  1Q0W B;  3VHT A;  2L0F A;  1V49 A;  3TIX A;  2AWL A;  4GN1 A;  1OXE A;  2WHT A;  3HIZ A;  4FN2 A;  3P8U A;  4JL9 A;  2HCG A;  1JBY A;  5DTY A;  3NS8 A;  4ZF3 A;  2N7D A;  3M63 B;  2N4F A;  4G0N B;  4ZIO A;  4NQK E;  3A9J A;  2K6D B;  3P28 A;  1SE9 A;  2LGD A;  1KP5 A;  5DRF A;  2B3A A;  3VVW B;  1MOV A;  5CHV C;  2CU1 A;  2QLG B;  1F0B A;  1V5T A;  3ZLZ A;  2Y0G A;  3E5T A;  4W9E A;  1EMB A;  4GDL B;  2HPW A;  2LUE A;  4DXM A;  3APD A;  4ZFS A;  2ZVN A;  3PS6 A;  3CBE A;  3L16 A;  5L95 C;  3BXB A;  2MQJ A;  4NY0 A;  3CFA A;  4EMQ A;  4ZRK A;  5CHF A;  1WF9 A;  2XBB C;  2G45 B;  4KW8 A;  3WLD A;  1XD3 B;  4W9L A;  4CHK A;  4MGZ E;  5DPS A;  3W1Y A;  3VTU A;  4W9F A;  2NPT B;  3A9K A;  3PLV A;  5BTT B;  5D2M B;  3GEX A;  5DPT A;  3ONS A;  3PT2 B;  4ZRI A;  4OVV A;  4UTS A;  1NBF C;  2KOX A;  2QLI A;  3C0R B;  2IB5 A;  5KHO A;  2VRR B;  2VAE A;  1JRU A;  4NQL B;  3ECI A;  4W9D A;  3BXA A;  2A50 B;  1V86 A;  1QYQ A;  4IK4 A;  2GOW A;  2C9W B;  4FJY A;  4A3P A;  3NED A;  4HCN B;  2HQZ A;  2N9P C;  2M0X A;  2L8J A;  2Z0E B;  3ZUJ A;  1EMA A;  5KHQ A;  3DQ5 A;  3O65 B;  1IYF A;  5HGE A;  1M94 A;  4II3 B;  4OHS A;  4TV3 A;  1CMX B;  4RYW A;  4BKG A;  1XQM A;  2DAJ A;  2KKC A;  2LWP A;  2RGF A;  3CD1 A;  1H6R A;  3U0K A;  3PGE A;  1WR1 A;  5LTP A;  2MA9 B;  4II2 B;  3DPW A;  3DBR I;  3VK1 A;  2L0T A;  1WR6 E;  5HW9 A;  3VUY A;  1EF5 A;  3QJZ A;  1ZUX A;  2KTR B;  4WWO A;  5DPH A;  2P4M A;  3DQ2 A;  3SVE A;  3DQL A;  3EKH A;  3ALB A;  4M8N A;  1Q4B A;  4Q7U A;  2DZJ A;  4GOB A;  2A46 A;  2AHA A;  5LK4 A;  3QAQ A;  4FJZ A;  2B3P A;  3K9O B;  3Q3F A;  2G2S B;  1UBI A;  3SD5 A;  3WIM A;  1J0G A;  2N7E A;  3N30 A;  3VAW A;  5T3I A;  4I6N B;  1OEY J;  3OAW A;  3DQO A;  4MJS B;  4W6M A;  4W6U A;  2H8Q A;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  4IK9 A;  2K8H A;  2KDI A;  5DQB A;  1V6E A;  3DQD A;  3DQN A;  3ZNZ B;  2AYO B;  3DDC B; 
#chains in the Genus database with same CATH topology
 2GW4 B;  4EFO A;  4DXG A;  4WJQ A;  2QDF A;  3GB1 A;  5BYR A;  4OVU A;  4ZIN A;  2FUG 1;  1QYF A;  4W7R A;  2BTJ A;  4IWQ A;  1ZGP A;  2NTS A;  4WQO B;  2VAD A;  4M00 A;  3AE5 B;  4IWP A;  4ZHO A;  2LGI A;  1YZW A;  3CGL A;  2KN4 A;  4NPN A;  2L7R A;  3ML9 A;  4RGT A;  4GMV A;  4A9A A;  3SSP A;  4WJP A;  5FKA C;  5J2R A;  1RFA A;  2DZK A;  4HE4 A;  2J42 A;  2XNA C;  5E6N A;  4GIV A;  2E3T A;  2RPQ A;  4OW0 A;  2FUH B;  3ZO5 B;  1TKG A;  3MFG A;  3BVZ A;  4IC7 B;  1OGW A;  4XOV A;  3VTW A;  1HQR D;  1XF5 L;  4B9K A;  2REX A;  2KK8 A;  3RCZ A;  4L2Y A;  3IVF A;  4ZYN A;  3DBS A;  2JZ3 B;  1DGJ A;  3GE3 C;  3PRP B;  3IR8 A;  3ETR A;  3NVW A;  4FHJ A;  2MBO A;  1QOB A;  1ZDV A;  3DVN U;  4ICU A;  1JC1 A;  4EN1 A;  3BXC A;  1RMO A;  1XMZ A;  5FHV A;  4LJP B;  1I42 A;  1EWC A;  1R7S A;  2OED A;  2C60 A;  5HI1 A;  4Q9W A;  4CO7 A;  1WYG A;  3X23 A;  3QCA A;  4LJB A;  2ZMU A;  3RNE C;  2LXA A;  3WAL A;  1CZP A;  1WM3 A;  3DQ8 A;  2CHX A;  4XOW A;  1YFP A;  1C4P A;  1VZ8 A;  2LGY A;  5EE3 A;  3W1C A;  1XQQ A;  2DUE A;  1Q73 A;  4ANW A;  3DPZ A;  1KTK A;  2J0M A;  4ZHP A;  1QLB B;  4KF5 C;  1NI3 A;  2PLP A;  5FK9 C;  4A3O A;  2D2Q A;  3VRA B;  3DQU A;  2NBW B;  4ICV A;  5BYQ A;  2SEB D;  4PS3 A;  1C77 A;  2QC8 A;  4K3C A;  3CWI A;  3NZ3 A;  3ZTD A;  3ZJT A;  4W9H A;  2K39 A;  4JQW C;  5H89 A;  2K5P A;  1YN3 A;  4USA A;  3QHT A;  1YJ1 A;  4K81 A;  4LQU A;  1RM6 C;  4HDO A;  3U7Z A;  1E9M A;  4Q7T A;  1K50 A;  5J17 A;  3LA1 A;  1Q10 A;  1OXD A;  3SVC A;  2KWV B;  1GAQ B;  2QLG A;  4W7X A;  3IAS 1;  1ZXH A;  1N5W A;  2RDH A;  1ZGO A;  3WCQ A;  2C7M B;  1I4H A;  1T0Y A;  5LTQ A;  1ZPS A;  4EDO A;  3MGF A;  1P1A A;  1XA9 A;  2PKO A;  2DAF A;  1F77 A;  3E5W A;  1BFP A;  2LEK A;  1SJH D;  2DBY A;  1HCJ A;  4PK1 A;  2WXJ A;  2JU6 X;  3GZN B;  2K22 A;  5CTR C;  2GRI A;  4JEO A;  2L52 A;  4BOZ B;  1FRR A;  3DQK A;  3GJ2 A;  4L23 A;  2QLH A;  4ASW C;  4TSS A;  2KO3 A;  3DVG Y;  2R2Q A;  1C1Y B;  1YNT E;  2G4D B;  3S05 A;  2HTM E;  3OSR A;  4ZF5 A;  1J19 A;  3U8C A;  2EMS A;  3QAR A;  2NPT A;  1TTN A;  1HZ5 A;  1KYP A;  5BTT A;  1QZE A;  1F0Z A;  2ZCC A;  3DBH B;  3QC8 B;  1L0Y B;  2NBV B;  3AE2 B;  2GB1 A;  1WM2 A;  4MDK E;  4W74 A;  2QCZ A;  3WAN A;  2LGX A;  1Q4D A;  4W6H A;  4J6I A;  3AE8 B;  1IBX B;  2AWK A;  2LRU A;  3Q3O C;  4JLC A;  3AEC B;  1TY0 A;  2IGH A;  1MPE A;  3ZVV A;  1RAX A;  1GNU A;  1R4N B;  2NCN A;  2KDE B;  2AWJ A;  1C78 A;  1NEN B;  3W5U B;  3ZUN A;  2DUI A;  2KJ6 A;  2H5R A;  4YSX B;  2N9X A;  3DQE A;  3EVR A;  3JYU A;  2JYE A;  1YQ4 B;  3AN1 A;  5DPR A;  3D32 A;  2JYT A;  5BMG A;  4A90 A;  4XYC A;  1E5W A;  1PQS A;  2MH7 A;  4MM3 A;  2G16 B;  2WSO A;  5LTR A;  3UIN B;  1SBB B;  5HFY A;  3KCT A;  5HZS A;  1YJ2 A;  3ZXR A;  1RMM A;  2ARL A;  3UFZ A;  3VRB B;  3W2D A;  4EZL A;  5L83 A;  4P6V F;  4KZ0 A;  2G4S A;  1I4R A;  2BGF A;  4HPM B;  5HZT A;  2KMC A;  2EKI A;  2V1Y A;  4K1R B;  2BT6 A;  2EMD A;  4KDL B;  5DCN A;  3EK4 A;  1I4P A;  3WA0 A;  4HPP A;  1WSP A;  3LVC A;  1PDX A;  3GL4 A;  2KDF B;  3UIP B;  2DYM A;  2LZ6 A;  4GXB A;  2V4E B;  3R66 C;  5F9G A;  2KLG A;  1H4U A;  2CJO A;  2PE6 B;  1FNW A;  1F52 A;  2KTR A;  1PUT A;  3NT3 A;  3SG2 A;  5DY6 A;  4ZYS A;  2KDB A;  3OWE B;  3DWG C;  2QIE B;  2N9E B;  1YHG A;  4LW5 A;  1CK1 A;  1FCC C;  3PIB A;  2IO3 B;  2KMM A;  3FAH A;  4PS7 A;  2WHU A;  2GBJ A;  4KA9 A;  2WU5 B;  3ZNH B;  2A54 B;  3U0N A;  1YN4 A;  2WXP A;  3TUO A;  1E0Z A;  3KUC B;  1XSS A;  3RWT A;  4ZBL A;  2N1W A;  4KVG B;  4HRO A;  3ZQ4 A;  1QKZ A;  2KQ4 X;  1VJK A;  4Q9X A;  3V6E B;  3NT9 A;  1HTQ A;  3SSK A;  4B0M A;  4MEM A;  5EXC I;  4K3B A;  2AL6 A;  2V0G A;  2RDB C;  4LDT B;  1AAR A;  4QAY A;  2K9X A;  4WWP A;  1WGG A;  2WXL A;  1CQV A;  2JXT A;  5EXU A;  4MJS A;  4BVU C;  4N9F 4;  4NNJ B;  1W7T A;  3Q8B A;  2AEH A;  4EZJ A;  2ZO7 A;  2MCN B;  1ZGU B;  2M8S A;  2LFI A;  3Q2A C;  5HBD A;  2BB5 A;  2L00 B;  4RM8 A;  4ACF A;  4E3C A;  2K8B A;  4PPJ A;  1NEK B;  3HRD D;  1FD6 A;  1XT9 B;  4MT5 A;  4WAF A;  1EU4 A;  3Q69 A;  2JRI B;  2A47 A;  2J0J A;  3ZTC A;  4W73 A;  2K25 A;  1P3Q U;  4JIO U;  5D94 A;  3VR8 B;  2LGS A;  3VUW A;  4R6B A;  4IOI E;  3ZW3 A;  2RMM A;  3SSY A;  1QYO A;  3TEZ A;  4PPK A;  1HZ6 A;  3RD2 A;  3M22 A;  4W6A A;  1VCB A;  2R2O A;  4EDS A;  4MGY E;  1WX7 A;  2G3Q B;  2G5Z B;  1FCL A;  2WX1 A;  4BAX A;  1QOG A;  1YOV B;  2J53 A;  2IY1 B;  2KQS A;  2K8C A;  1E7P B;  3BYT B;  4IUM B;  1C76 A;  1ESF A;  3DOW A;  3A4S C;  3EHV A;  3GS2 A;  4US8 A;  3ZDT A;  2YVC A;  3L54 A;  2MHJ A;  1D5Z C;  2ZMW A;  5H88 A;  1L6V A;  1WXA A;  2MP2 A;  2E6X A;  3SVU A;  2MJ3 A;  4TUU A;  3U4E G;  3WCK A;  2LRW A;  3DHH C;  3R2T A;  4GDK B;  4E71 A;  2QRF A;  3AH7 A;  4KSK C;  1I35 A;  4RCO A;  5EB7 A;  1ZKH A;  2I1K A;  3JVZ X;  4H48 A;  3APF A;  4S0R A;  2MJD A;  2FCM A;  3APC A;  3RZF A;  1GL4 A;  5G55 A;  1XLP A;  2KAJ A;  4L12 A;  3K9P B;  2WP9 B;  3A8S A;  2OGR A;  2A4Z A;  4XC2 A;  1WGH A;  2GLS A;  5EXB A;  4DQO C;  3KUZ A;  4O1N A;  4ZOH C;  3DBL B;  3H7P B;  3Q8F A;  5FVG A;  2KDM A;  5AQB B;  3V60 A;  3B0A A;  4W7A A;  3LSA A;  3AI4 A;  2BS3 B;  1E8X A;  3Q8A A;  4K7W A;  1WYW B;  2KT7 A;  1RFK A;  2ON8 A;  1ZDX A;  1MJD A;  3U8P A;  4W6G A;  3GE8 C;  4XWT A;  4DXQ A;  1GC7 A;  1IPG A;  4RMA A;  4HQ9 A;  1JW9 D;  3QIJ A;  3T3N A;  1EML A;  2ZVO A;  4MEL A;  2XN9 C;  2V4E C;  5GMV A;  5TR5 A;  1AWD A;  2XEW A;  4ANU A;  1F2R I;  2LJI A;  4BDU A;  1JRO A;  2W3R A;  3EVU A;  2IE2 A;  5AZF A;  5G2N A;  3V6C B;  3SVO A;  1Y56 A;  2DHZ A;  3Q6B A;  4N58 A;  4OJ0 A;  4URK A;  3U7D A;  1MHH E;  3NRZ A;  2KMA A;  3E56 A;  5BYS A;  4G50 A;  1C4A A;  2HDE A;  1UIS A;  1DOI A;  3SVB A;  3JW0 X;  2CR5 A;  2UYZ B;  4ARI A;  2DDC A;  4TZA A;  3SG4 A;  3BYY B;  3VQI A;  4LNO A;  4WUR A;  4LLG M;  2GW3 A;  2ZW0 A;  3QQ8 B;  3RN9 C;  2QZ0 A;  4DXP A;  1T5X D;  4DXN A;  1TS5 A;  2YE0 A;  1S6Z A;  2WYQ A;  2WIQ A;  3RZW C;  2Q57 A;  4ORN A;  3CST A;  3AUL A;  5IOI A;  5IO9 A;  3NHE B;  3TEW A;  5LNK 1;  1UGJ A;  2W3S A;  1ZE3 D;  1TKE A;  2IO0 B;  4FUL A;  4DK5 A;  3PJ7 A;  3EVP A;  1XAE A;  2JZP A;  1B9C A;  3AI5 A;  5EBJ A;  2JAD A;  3KLS X;  1IGD A;  3EUB 2;  5E6O A;  1L5P A;  4IK8 A;  4MGI E;  1V97 A;  2I1J A;  3NVZ A;  3PRE A;  4L13 A;  3HK0 A;  4W6C A;  1VLB A;  2KYW A;  1KYR A;  2HE7 A;  4BBN C;  2BS2 B;  4EUT A;  3LXF A;  1Q1O A;  3PRZ A;  4ITK A;  1C9F A;  2DD9 A;  4RF0 A;  1V2Y A;  1YJF A;  2ACZ B;  2K1F A;  5J18 A;  2QEJ C;  2UWQ A;  3L17 A;  4DBG A;  3IHP C;  2AWT A;  4GB9 A;  1IBX A;  3QA8 A;  3T3O A;  4IW0 A;  2R61 A;  1I7H A;  4EE2 A;  3AV8 A;  2WXO A;  4HKZ E;  3TMP B;  4EOY A;  5LXI B;  5HHD G;  2CHZ A;  1BXT A;  3KUD B;  1T0Q C;  1U4A A;  2IGG A;  5EHU A;  2WWZ A;  2DZM A;  1YQ3 B;  3SVS A;  2DYB A;  5DU0 A;  3ED8 A;  2LVQ A;  2MW5 A;  4PFE A;  3NS1 A;  2A56 B;  1HA5 A;  2AWM A;  1WZ3 A;  3PZ8 A;  4P7I A;  4GU2 A;  3AEE B;  1WH3 A;  3HVD A;  5BMH A;  3AED B;  4FA6 A;  4BKS D;  4DXO A;  4JGH B;  2K3U A;  1J7B A;  4JC2 A;  4BKS A;  4XZ4 A;  5FVI A;  2GBR A;  4P1Q A;  2H89 B;  4W76 A;  3DPX A;  3I5J C;  4LJC A;  4EEW A;  3KW5 B;  2JQR B;  3SHQ A;  4LQT A;  2KC1 A;  1ENF A;  3VH3 B;  2Y5C A;  2CHW A;  4XE0 A;  3C19 A;  2V4E A;  2Y5P A;  4DHJ B;  2IY0 B;  2LI5 A;  2J4X A;  4N59 A;  3U8Z A;  1UZX B;  2WDQ B;  1LM8 B;  4FLH A;  1V1P B;  4G11 A;  1GUA B;  2KNB A;  2D10 A;  1A5R A;  2HGY A;  4ZRJ A;  1RM9 A;  1K8R B;  1WGR A;  2HJO A;  4J3O D;  3DQ7 A;  4MH8 A;  4AOF A;  3HHM A;  5TSS A;  2G6X A;  2MP2 B;  2H6V A;  5HG2 A;  3DQC A;  1QOA A;  1WI0 A;  5CHW A;  3NZS A;  2V3N A;  4P1C C;  2Z0D B;  1JAL A;  2A53 B;  4IDI A;  4HQ8 A;  2IOV A;  2MEK A;  3SSH A;  1XO3 A;  2HD5 B;  1RRB A;  1MHX A;  2JXX A;  3DCG A;  2PXW A;  1UD7 A;  3FIL B;  4GGQ A;  1KOT A;  4W6J A;  1L0X B;  4BBN F;  5EB6 A;  1ZUD 2;  5IKC M;  2RD0 A;  3SFD B;  4LDT D;  4NZL B;  1BT0 A;  4ANX A;  3N9Y C;  2IJ0 A;  4XVP A;  3Q3M C;  1QY3 A;  2BYV E;  1EMM A;  4I6L B;  2IZV B;  1SJE D;  4A8X C;  3TMR A;  3N32 A;  4GOC A;  3SSL A;  4HDQ A;  2BBC A;  2PJH A;  3AE9 B;  3I19 A;  1DOX A;  3AE6 B;  3CFH A;  3SS0 A;  5DPJ A;  3P4Q B;  4WJN A;  2IDY A;  1G6J A;  4BOS C;  3MHS D;  1ROE A;  3U52 E;  3U30 A;  3AXC A;  4H3L A;  2BWF A;  1UUP A;  3PZD A;  1WRD B;  3KYD D;  5FR3 A;  1UF0 A;  1EO6 A;  2AQ3 B;  2J7Q B;  3BVM A;  2MBB B;  2VH2 A;  5C23 A;  3SG6 A;  3AMZ A;  1OTR B;  3DQ4 A;  3O78 A;  1V80 A;  4W72 A;  4OY4 A;  2QHO A;  4AJW A;  1I4X A;  3NOB A;  2DWQ A;  3PJ5 A;  3U8A A;  4ZF4 A;  4ARC A;  2L76 A;  1F1H A;  3EFU A;  1GGX A;  1F9J A;  4A20 A;  4KV2 A;  3ZXV A;  1P0R A;  3IT6 B;  4KF4 A;  1SIF A;  4M02 A;  3CD9 A;  1ZOY B;  3CFF A;  1H4R A;  3H8H A;  4DHZ E;  3AU4 A;  1VRA B;  4HJK A;  2C7H A;  4KKJ A;  5EJU A;  1JC0 A;  2Y5B B;  1R4M I;  2MBE A;  2LVO A;  5CX3 A;  3A33 B;  2CS4 A;  1QOF A;  2ZEQ A;  3RUL A;  3ST4 A;  2DNF A;  1Z5S B;  2WXQ A;  1SEB D;  1G7K A;  1W7U A;  3B1L X;  3CSF A;  3R3M A;  2H9W A;  4W7F A;  1E7U A;  2BVC A;  4TQ0 A;  2KX0 A;  1K52 A;  2QSD A;  3LVD A;  3SSV A;  2W9N A;  1C3T A;  4XGY A;  3SG5 A;  4S17 A;  3PHW B;  3B9J A;  4GDK A;  4R3D A;  4W6R A;  2ZNV C;  4KW9 A;  3SRY A;  5BMI A;  2WQY B;  3IP2 A;  1QT9 A;  2PVG C;  2YEP F;  5BT0 A;  4HCP B;  3GB3 A;  2FE8 A;  4WAA A;  2O6V B;  1NVI D;  1PGX A;  4PYZ A;  3WLC A;  2FBW B;  3B2F A;  3OJ4 B;  4IWO A;  3EK7 A;  4RFB A;  3FKY A;  4RF1 A;  5E6J A;  5LXH A;  2OKY A;  2WU2 B;  2A52 B;  1X1M A;  3NZU A;  1YJJ A;  3H7P A;  3A1Q B;  1WY8 A;  1EMC A;  3VHT C;  3H7S A;  5KTG A;  3B2G A;  3HM3 A;  1KLG D;  2KJR A;  4KSL C;  4RM9 A;  2OOB B;  3DPD A;  1HE8 A;  3TL5 A;  2D3B A;  1SIJ A;  3UIO B;  1KRH A;  3LJ3 A;  2L1A A;  5BO4 B;  2UU7 A;  2M1M A;  2Z6Y A;  3TCA A;  3LB8 C;  3P1M A;  1FEH A;  3TBL D;  2WDV B;  3V3X A;  5EE1 A;  1P7F A;  1GJZ A;  4IM3 A;  1XCT L;  3VFK A;  4KEX A;  3GOE A;  4D2K A;  3MTN B;  3N1Y C;  3PSE B;  2YFP A;  5J2O A;  2IYD B;  1WGD A;  4TMA B;  5G5H A;  3V62 A;  3SG3 A;  1WXM A;  1I4G A;  1E7V A;  3H6N A;  2C9J A;  3W9C B;  4DDI D;  4KIK B;  3VR9 B;  4GF6 B;  2JPH A;  3IBE A;  3I57 A;  3RNA C;  3E5V A;  3P2B A;  4AWJ A;  1IGC A;  2PIA A;  2POX A;  5HZU A;  4W6K A;  3BIN A;  3O13 A;  4KF5 A;  1T6B X;  4YXD B;  4LJO B;  5DTX A;  4C7Z A;  2V3S A;  3RNC C;  4NAM A;  3BWU D;  1KYS A;  2ZO6 A;  1OFF A;  4M8M A;  1V8C A;  3DQ9 A;  3SG7 A;  3KH0 A;  2WX0 A;  4YSY B;  3IAM 1;  2FZU A;  3WAM A;  4HK2 A;  3EK8 A;  1ZP0 B;  5T8I A;  1UGM A;  1C4C A;  2D3G A;  1GFL A;  1IUE A;  4DDG D;  3G9A A;  3N1X C;  4LJD C;  3SDL C;  3AE3 B;  4C7Y A;  4KGE A;  3P4R B;  1PGB A;  1JWS D;  2VZX A;  1E8W A;  3NY5 A;  1E90 A;  3ZJV A;  4HRS A;  2WXH A;  4W9J A;  1LO5 D;  4Z4K A;  2MX2 A;  2AX5 A;  1YD8 U;  3MJ5 A;  1E8Z A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  1A70 A;  4Z4M A;  1ISN A;  5EE0 A;  1N6Z A;  3BX9 A;  2KWD A;  2ZPN A;  4DWF A;  1C79 A;  3NVY A;  3DQI A;  2KXJ A;  3W1S C;  1T3Q A;  2BB6 A;  3BVG A;  4R6D A;  3O77 A;  3SVN A;  2WXM A;  3U2S C;  3S2A A;  3DVN V;  3BII D;  4HXD A;  1L6U A;  3ZJU A;  2J0K A;  1WX9 A;  5DPG A;  3OG5 A;  1J8C A;  2O2V B;  3ZRC A;  1WGY A;  3DQ6 A;  1EMF A;  2KWC A;  2MRP A;  5BQL A;  2ICR A;  3M3J A;  4N3D A;  2OKW A;  5JXV A;  5DRG A;  2PXS A;  3QK0 A;  4LK0 M;  2KD0 A;  2BF8 B;  1UWX A;  3L13 A;  1KLV A;  4KDI C;  4AS8 A;  3GZN I;  2PVO D;  2PMV A;  1RLF A;  4L1B A;  2OTE A;  1YMH E;  3DBR B;  2BKR B;  4IK1 A;  2A48 A;  3DQF A;  4YT0 B;  1VR9 A;  2AH8 A;  3V61 A;  1EUV B;  3CB9 A;  3RFZ B;  3NF0 A;  5JHA A;  4NWS A;  4IKG A;  1JBZ A;  1ACC A;  2PPH A;  1PFD A;  4MAC A;  4GSW A;  4H3M A;  3P42 A;  1CJE A;  1FFV A;  4W7D A;  2WNM A;  2B3Q A;  1Y8R C;  4DHJ D;  4YSZ B;  4W6F A;  3J9C A;  2RR9 A;  2KVR A;  3SFE B;  3VDZ A;  3ZNG C;  3DBH I;  3ZRF A;  2ZJD A;  4J89 A;  1V1P A;  3PJB A;  4OGS A;  2WS3 B;  4MH0 E;  1Q5W B;  4NJC A;  2BTE A;  1C4F A;  4W7E A;  1CV7 A;  2QJL A;  2LHD A;  3AE7 B;  1MOU A;  3VXW A;  4DKM A;  3K1K A;  1FNV A;  3DQJ A;  2IGD A;  2AL3 A;  3NUH B;  5IAA C;  3DQ3 A;  2FID A;  1R4N I;  4Q7R A;  1V9J A;  3SVR A;  2M56 B;  2N7J A;  2PE9 A;  3VH4 B;  1HTO A;  4W77 A;  1KJT A;  3I3T B;  1LGR A;  1SB3 C;  3HM6 X;  4PS8 A;  1EMG A;  1FM0 D;  4ZDV A;  3FIL A;  1V1O A;  1QF6 A;  4UDU C;  4L1I A;  2BWE S;  2ZCB A;  5D6J B;  4KGT A;  1XLN A;  4LJD A;  1WWT A;  2KJH B;  4JRB A;  1MYW A;  1S3S G;  3ZUL A;  2KQ7 A;  1MFW A;  4KZC A;  1L2N A;  2IND C;  1LFD A;  5HZO A;  3H1O A;  4IM0 A;  1DYQ A;  2WXK A;  1D3Z A;  1WRI A;  2AQ1 B;  4BFR A;  1N60 A;  5DTL A;  5IA7 A;  1FIQ A;  4TKN A;  1YJI A;  3H1R A;  3NEZ A;  2WHI A;  2Z59 B;  1WMH B;  2YEP B;  3Q14 C;  4WQM A;  2DUF A;  1GB1 A;  2PEA A;  3W1S A;  4B6W A;  2ZPY A;  2DX5 B;  2KTF A;  2NVU I;  3C8Y A;  1RRX A;  1D5M C;  2M17 A;  4TZG A;  2KAN A;  2KWU B;  4J88 A;  1WJN A;  4K7U A;  4E74 A;  2Z1O A;  2DYO A;  2W55 A;  3DQM A;  3BZD B;  1EU3 A;  3M95 A;  1V81 A;  3ADF A;  3ZUF A;  4W69 A;  1GB4 A;  2LJ5 A;  2O29 A;  1BUI C;  4HKQ A;  1OXF A;  3ZTF A;  3PHX B;  2L05 A;  3WAO A;  4REZ A;  3EKJ A;  1V5O A;  3DVG X;  2XK5 B;  5D3D A;  2LUM A;  2D07 B;  2WSN A;  3U0M A;  1SF0 A;  3RT3 B;  4IZN A;  1F09 A;  4CQN A;  2DD7 A;  2Q6P A;  3V3D A;  2H5Q A;  4JPS A;  4OZC A;  1HXY D;  3T9L A;  3AM9 A;  1Q4E A;  2V4L A;  1L0V B;  3IFW B;  2NTT A;  2X8X X;  4U2V A;  4J8A A;  4W6P A;  3PTF C;  2G6Y A;  2C9I A;  2JY6 A;  2HTH A;  1D4B A;  4W6I A;  1K53 A;  1B1Z A;  4OZB A;  1WE7 A;  3SU8 X;  3WAP A;  4HQC A;  2EMO A;  4AP4 C;  1XXG A;  2O6V D;  3VIC A;  1TKY A;  3RNF C;  4YWG G;  2HRS A;  2O6V A;  4B5Y A;  1MVK A;  4AUQ C;  4C56 C;  2HFC A;  4W9C A;  2WIS A;  3AEA B;  1MG8 A;  3RMK C;  2YE1 A;  1FO4 A;  5C1Z A;  1YHH A;  4LNK A;  2DZI A;  2DLB A;  4M0W B;  3SV5 A;  3AKO A;  3JSV B;  3ZDM C;  3A1Q A;  3EGR A;  1YQB A;  1TGZ B;  3RI7 C;  1HEZ E;  2HQK A;  4US9 A;  4WWM A;  2RSU A;  1T0R C;  2ZZP B;  1Z1Q A;  1QQR A;  1D5X C;  3PLU A;  2QLE A;  4KGF A;  4KX6 B;  1KLU D;  5DTZ A;  3T8M A;  4W9I A;  3ZNI D;  3GJ1 A;  3B08 A;  4I2Y A;  1JWB D;  1VZ7 A;  2KX3 A;  4OZA A;  4RGO S;  1ZGQ A;  2ZNV B;  2OJR A;  1W7S A;  2EEL A;  2MWS B;  1S1Q B;  4JGE A;  4PPL A;  1JWA D;  2GX2 A;  2W82 A;  3H1U A;  1K51 A;  1OEY A;  4JE3 B;  3RNG C;  1L4D B;  4B0E A;  1E10 A;  2KFJ A;  5G5G A;  4F1S A;  2VVJ A;  2BW2 A;  1ZW7 A;  2MBH A;  3W1D A;  4B30 B;  1UH6 A;  2HGD A;  3UGB B;  2OJW A;  1EM7 A;  3AU5 A;  3BY4 B;  4KIK A;  4ZRQ A;  4I6P A;  3ZIM A;  4NAW A;  3AE1 B;  5JZE B;  4AQ7 A;  3X0W A;  3SVD A;  2GBM A;  4C4V B;  2NMQ A;  1EF1 A;  2OTB A;  3VHT B;  2FNJ B;  4MGK E;  4LCD E;  2MSE D;  3CMM B;  4HLE A;  2WXI A;  2G3O A;  1Q4C A;  2GBN A;  1SE4 A;  4C80 A;  2WXG A;  2DUH A;  1P7E A;  3KYC D;  2KHW B;  4XL5 A;  5IN7 A;  4W6B A;  5EDS A;  3ST2 A;  3ST0 A;  3MP9 A;  2CJN A;  1TY2 A;  2VZK B;  3DBL I;  3ST3 A;  2G3D B;  3A9J B;  4HVF A;  5HKH A;  1OQY A;  2FCN A;  4MSQ B;  4DKN A;  4GES B;  3DQV A;  2O24 A;  2OJK A;  4IK5 A;  2BYF A;  3N3K B;  2WXF A;  1FRD A;  4BKT A;  4JWS C;  1I4Q A;  2KC2 A;  1TS4 A;  4W9K A;  2QT2 A;  3KCS A;  3PPA A;  3EEC A;  1RYJ A;  2FAZ A;  3R2I A;  1UNS A;  1WZ0 A;  1ET9 A;  2JRH A;  3RUI B;  2JUO A;  1WJU A;  3UQB A;  3EFC A;  4KAG A;  4Q2J A;  3V05 A;  2L83 A;  3LDZ E;  2LMC A;  3I9V 1;  5I4D A;  2QMT A;  4H47 A;  3UQA A;  4JF9 A;  2N0S B;  4RTC A;  4W6D A;  5DQM A;  1J7C A;  1M4V A;  4FBJ B;  4KPI A;  2O2V A;  3IXS A;  1P9D U;  2QU1 A;  5DPI A;  4NJ7 A;  4RNA A;  5H92 C;  1WFY A;  4N6E B;  4CYE A;  3DQH A;  1L7Y A;  1SE3 A;  2DEN B;  2GMI C;  4RYS A;  2EMN A;  5AZG A;  1YIW A;  3A9K B;  3NJT A;  2JWU A;  1WXV A;  1VD2 A;  2IO2 B;  2WDR B;  2KZR A;  1WX8 A;  4IM2 A;  1GPX A;  4FAD A;  4JFG A;  3EC8 A;  3TEY A;  4AR7 A;  2FL1 A;  1OQR A;  2Z8L A;  2V4I B;  4OVZ A;  3U0L A;  2RH7 A;  1FFU A;  2LVP A;  2VH1 A;  4XDC A;  2M19 A;  2I2Y A;  3H9D A;  4LNN A;  4M01 A;  1JWU D;  1TT5 B;  1TS2 A;  4FJV B;  3KQ4 A;  2BQQ A;  1MI0 A;  1H8C A;  5IP4 D;  3OSQ A;  1TYG B;  2IO1 B;  2H5O A;  3Q8C A;  2Z6Z A;  1NYR A;  4OHJ A;  2CU3 A;  2RPV A;  4A6Q A;  3M24 A;  4W9G A;  2G9H D;  4W6L A;  4IK3 A;  4WWN A;  3N1Z C;  3AEG B;  4GDL A;  2YDZ A;  1JCK B;  4W7C A;  4KGR A;  1FXA A;  2HJ8 A;  2JT4 B;  2FWQ A;  3PZ7 A;  3DHG C;  2FCS A;  3EVV A;  5FR6 A;  2MJE A;  4DXI A;  3KVF B;  2VVH A;  2D3A A;  3DQ1 A;  1E8Y A;  2BKF A;  1VDV A;  4BZA A;  4YTN B;  4KKI A;  4NJ6 A;  2G6E A;  3BK1 A;  1QXT A;  3QX1 A;  4HPL B;  3CIR B;  2GBK A;  4JWU C;  5AEK B;  5LLI A;  2TSS A;  1WJ4 A;  4X57 B;  3Q3J A;  3QWZ B;  2NS5 A;  4OQW A;  4IG7 B;  3OGO A;  1UEL A;  2ASQ A;  4HEA 1;  2D11 A;  1AYF A;  4W6T A;  3GP7 A;  3CF6 E;  1VZ6 A;  2DDD A;  2WXN A;  4RH6 A;  4FXC A;  1WJ6 A;  3LS3 A;  1WIA A;  4HVB A;  2W54 A;  2FCQ A;  3MC9 A;  2KN5 A;  1WMH A;  5GXG B;  4FHK A;  5JH5 C;  2LXC A;  1RMP A;  4K7S A;  3FC4 A;  3UI3 A;  2KLC A;  1KFY B;  2WHS A;  3ENE A;  3MHZ A;  2H88 B;  3TJP A;  4W6O A;  4ANJ A;  1Z1P A;  3AEF B;  1QIL A;  4EKU A;  2J52 A;  2C5L C;  4HWI B;  4MSM B;  1RWS A;  1YHI A;  4H3N A;  2DUG A;  2D3C A;  1EMK A;  2KFK B;  4KW4 A;  1YX6 B;  4NAW B;  3IG3 A;  3L10 B;  2BYE A;  2M4N A;  2LD9 A;  1TZO A;  2NBU A;  4P76 A;  2XK5 A;  3IT4 B;  4XGA B;  1YX5 B;  2C7N B;  1AW7 A;  3ABV B;  2K6Q A;  2PW9 A;  2YLM A;  4ANV A;  5FVF A;  4GLS C;  2Z6X A;  3LF3 A;  5JHB A;  3UG0 A;  3LF4 B;  1SSN A;  2EMT A;  1P98 A;  2V9H A;  4TQ1 A;  2JWZ A;  2RDG A;  1ET6 A;  2MBQ A;  4WJO A;  1T0S C;  4P1B C;  2MLB A;  2JF5 A;  2B76 B;  1Q4A A;  3UF8 A;  1NDD A;  3L0W B;  3VUX A;  1PGA A;  3L4P A;  4KGS A;  2BPS A;  1FXT B;  3RYT A;  3VTV A;  3P4P B;  4G3X B;  4W6S A;  2WGS A;  1SXT A;  5E6P A;  2WDT B;  4PYU A;  3RWA A;  3TMT A;  3R8B A;  4YL8 A;  2ZW1 A;  2O2B A;  1N5X A;  2A5U A;  5AZH A;  3ZGZ A;  3A4R A;  2GX0 A;  2CKH B;  1EME A;  1PYW D;  3NVV A;  3TSS A;  5H8Y E;  1UBQ A;  5D3I B;  2VVI A;  1NI2 A;  4M0W A;  2NR2 A;  3JSV A;  4ZB1 A;  4F7Z A;  2H5P A;  4HJG E;  3LVA A;  3KWV A;  3OJ3 A;  5H87 A;  3OLM D;  3TEX A;  3MJW A;  1WE6 A;  3PV1 A;  3R7R A;  3M62 B;  3AEB B;  3DWM A;  1TZ1 A;  2ICI A;  1SGH A;  4F8C B;  3PRM B;  1KM7 A;  4B95 A;  5D7G A;  1KF6 B;  1STE A;  2FIF A;  4EUL A;  4PT5 A;  3R7Q A;  3SST A;  4C00 A;  2JSV X;  2IBI B;  1WXS A;  3DHI C;  1UWM A;  2IPK D;  3I63 C;  2WUR A;  1LXD A;  3PVL A;  1GG3 A;  2EKE C;  3HUI A;  2WXR A;  3EA6 A;  4XWW A;  4DXA B;  2JVC A;  1TJE A;  3ZKJ C;  4XX5 A;  4B30 A;  1OQQ A;  1GC6 A;  2LAS A;  1FXI A;  5AUK A;  5DPW A;  4W6N A;  4LNF A;  2IB6 A;  2L3Z A;  1TBE A;  1HUY A;  1LQB A;  3DQA A;  3L08 A;  4C4V A;  4W75 A;  1Q0W B;  3VHT A;  2L0F A;  1V49 A;  3TIX A;  2AWL A;  4GN1 A;  1OXE A;  4LTU A;  2WHT A;  3HIZ A;  4FN2 A;  1WGK A;  3P4S B;  2V3P A;  3P8U A;  4JL9 A;  3RNB C;  2HCG A;  2JX5 A;  2VZK D;  1JBY A;  5DTY A;  3NS8 A;  4ZF3 A;  2N7D A;  3M63 B;  2N4F A;  2INN E;  4G0N B;  4ZIO A;  4NQK E;  5MPO A;  3A9J A;  1XCQ L;  2K6D B;  3P28 A;  1SE9 A;  2LGD A;  2GI9 A;  1KP5 A;  2G1E A;  5DRF A;  2B3A A;  2ONQ A;  2Y3A A;  3VVW B;  1MOV A;  5CHV C;  2CU1 A;  2QLG B;  1F0B A;  1V5T A;  3ZLZ A;  2Y0G A;  3E5T A;  4W9E A;  1EMB A;  4GDL B;  2HPW A;  5AUI A;  2LUE A;  4DXM A;  3URY A;  1XLO A;  3APD A;  4ZFS A;  2D5G A;  4XDD A;  2ZVN A;  3PS6 A;  5EE9 A;  4P16 A;  4WH4 A;  3CBE A;  1JWM D;  3L16 A;  5L95 C;  3BXB A;  1AN8 A;  1FNU A;  2MQJ A;  4NY0 A;  1MG4 A;  3CFA A;  4YTP B;  4EMQ A;  1L4Z B;  3Q8E A;  4ZRK A;  3AE4 B;  5CHF A;  2Q5W D;  1WF9 A;  2XBB C;  2HJ1 A;  2G45 B;  4KW8 A;  3WLD A;  3SEB A;  1XD3 B;  4W9L A;  1ZXI A;  3BK2 A;  4CHK A;  2N9K A;  4MGZ E;  1D6E C;  2K0P A;  3PO0 A;  5DPS A;  3W1Y A;  3VTU A;  1J7A A;  4W9F A;  1N63 A;  2NPT B;  3A9K A;  1XEE A;  2WLB A;  3PLV A;  5BTT B;  4ZRP A;  3W5V B;  5D2M B;  4JX1 C;  3GEX A;  5DPT A;  1GOZ A;  2AQ2 B;  3ONS A;  2M0A A;  3PT2 B;  1TIF A;  4OVV A;  1JML A;  4UTS A;  1NBF C;  1XLQ A;  2KOX A;  3P63 A;  4ZRI A;  2QLI A;  3C0R B;  2IB5 A;  3NG0 A;  2L32 A;  5KHO A;  2I38 A;  2VRR B;  3N20 C;  2VAE A;  1JRU A;  1YN5 A;  4NQL B;  1B9R A;  3ECI A;  4W9D A;  1WXQ A;  3BXA A;  2A50 B;  1V86 A;  1QYQ A;  4IK4 A;  2KVZ A;  2GOW A;  1TS3 A;  2C9W B;  3Q3N C;  4FJY A;  4A3P A;  3NED A;  4HCN B;  2HQZ A;  1F2R C;  2N9P C;  1N61 A;  2M0X A;  3AB5 A;  4RGN A;  5C2T B;  2L8J A;  2Z0E B;  1EWY C;  3ZUJ A;  4H2A A;  1EMA A;  2N9L A;  5KHQ A;  3DQ5 A;  4MM3 B;  3O65 B;  1IYF A;  5HGE A;  1M94 A;  1DOY A;  4II3 B;  4OHS A;  2QIL A;  4TV3 A;  1CMX B;  4RYW A;  4BKG A;  4A55 A;  1XQM A;  2DAJ A;  2KKC A;  2LWP A;  2SAK A;  2RGF A;  2BS4 B;  3CD1 A;  3HVZ A;  2BYT A;  1FPY A;  1H6R A;  3U0K A;  3PGE A;  2LHE A;  2PTL A;  1WR1 A;  5LTP A;  2INP E;  2MA9 B;  4II2 B;  3DPW A;  3DBR I;  3VK1 A;  1SE2 A;  3E9S A;  2L0T A;  1WR6 E;  5HW9 A;  4AS1 A;  3VUY A;  1EF5 A;  3QJZ A;  4DXF A;  1ZUX A;  2KTR B;  3KWL A;  4WWO A;  5C3J B;  1BML C;  5DPH A;  1JQ4 A;  2P4M A;  3DQ2 A;  3SVE A;  3DQL A;  3EKH A;  3ALB A;  4M8N A;  1Q4B A;  4Q7U A;  4LNI A;  3MC8 A;  2DZJ A;  1FMA D;  4GOB A;  2A46 A;  2AHA A;  5LK4 A;  3QAQ A;  4FJZ A;  1JRP A;  2B3P A;  1E6E B;  3K9O B;  3Q3F A;  1KH0 A;  2G2S B;  4WIP A;  1UBI A;  3ZYY X;  3SD5 A;  4YTM B;  2X38 A;  3WIM A;  1R4M B;  1J0G A;  2INC C;  2N7E A;  4RGM A;  3N30 A;  3LYY A;  3VAW A;  5T3I A;  4I6N B;  1NYQ A;  1OEY J;  3OAW A;  3DQO A;  4MJS B;  4W6M A;  4W6U A;  2H8Q A;  3RPF C;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  4IK9 A;  2K8H A;  2KDI A;  3SR6 A;  5DQB A;  3MC0 B;  2OHF A;  1V6E A;  3DQD A;  3DQN A;  1N62 A;  3ZNZ B;  2KAC A;  2AYO B;  3DDC B; 
#chains in the Genus database with same CATH homology
 2GW4 B;  4EFO A;  4WJQ A;  4OVU A;  4ZIN A;  1QYF A;  4W7R A;  2BTJ A;  4IWQ A;  1ZGP A;  4WQO B;  2VAD A;  4IWP A;  1YZW A;  3CGL A;  4NPN A;  2L7R A;  3ML9 A;  4GMV A;  3SSP A;  4WJP A;  5J2R A;  1RFA A;  2DZK A;  4HE4 A;  5E6N A;  4GIV A;  2RPQ A;  2FUH B;  3ZO5 B;  4IC7 B;  1OGW A;  4XOV A;  3VTW A;  4B9K A;  2REX A;  2KK8 A;  3RCZ A;  3IVF A;  4ZYN A;  3DBS A;  2JZ3 B;  3PRP B;  3IR8 A;  4FHJ A;  2MBO A;  3DVN U;  4ICU A;  1JC1 A;  4EN1 A;  3BXC A;  1RMO A;  1XMZ A;  5FHV A;  4LJP B;  1I42 A;  2C60 A;  4Q9W A;  4CO7 A;  3X23 A;  3QCA A;  4LJB A;  2ZMU A;  2LXA A;  3WAL A;  1WM3 A;  3DQ8 A;  2CHX A;  4XOW A;  1YFP A;  2LGY A;  3W1C A;  1XQQ A;  2DUE A;  1Q73 A;  4ANW A;  3DPZ A;  2J0M A;  4KF5 C;  4A3O A;  2D2Q A;  3DQU A;  2NBW B;  4ICV A;  4PS3 A;  3ZTD A;  4W9H A;  2K39 A;  4JQW C;  5H89 A;  3QHT A;  1YJ1 A;  4K81 A;  4LQU A;  4HDO A;  4Q7T A;  5J17 A;  3LA1 A;  1OXD A;  3SVC A;  2KWV B;  2QLG A;  4W7X A;  1ZGO A;  2C7M B;  1T0Y A;  5LTQ A;  4EDO A;  3MGF A;  1P1A A;  1XA9 A;  2DAF A;  3E5W A;  1BFP A;  1HCJ A;  5CTR C;  4JEO A;  4BOZ B;  3DQK A;  3GJ2 A;  2QLH A;  4ASW C;  2KO3 A;  3DVG Y;  2R2Q A;  1C1Y B;  2G4D B;  3S05 A;  3OSR A;  4ZF5 A;  1J19 A;  3U8C A;  2EMS A;  3QAR A;  2NPT A;  1TTN A;  1KYP A;  5BTT A;  1QZE A;  2ZCC A;  3QC8 B;  2NBV B;  1WM2 A;  4MDK E;  4W74 A;  3WAN A;  2LGX A;  1Q4D A;  4W6H A;  4J6I A;  2AWK A;  2LRU A;  4JLC A;  3ZVV A;  1RAX A;  1GNU A;  2NCN A;  2KDE B;  2AWJ A;  3ZUN A;  2DUI A;  2KJ6 A;  2H5R A;  2N9X A;  3DQE A;  3EVR A;  3JYU A;  5DPR A;  3D32 A;  1E5W A;  1PQS A;  4MM3 A;  2G16 B;  2WSO A;  5LTR A;  3UIN B;  3KCT A;  5HZS A;  1YJ2 A;  5L83 A;  1RMM A;  2ARL A;  3UFZ A;  4EZL A;  4KZ0 A;  2G4S A;  2BGF A;  4HPM B;  5HZT A;  2KMC A;  2V1Y A;  4K1R B;  2EMD A;  4KDL B;  5DCN A;  3EK4 A;  3WA0 A;  3LVC A;  3GL4 A;  2KDF B;  3UIP B;  2DYM A;  2LZ6 A;  4GXB A;  2V4E B;  3R66 C;  5F9G A;  2KLG A;  1H4U A;  2PE6 B;  2KTR A;  3NT3 A;  3SG2 A;  5DY6 A;  2KDB A;  2N9E B;  1YHG A;  4LW5 A;  3PIB A;  2IO3 B;  4PS7 A;  2WHU A;  2GBJ A;  4KA9 A;  3ZNH B;  2A54 B;  3U0N A;  3KUC B;  1XSS A;  3RWT A;  4ZBL A;  2N1W A;  4KVG B;  4Q9X A;  3V6E B;  3NT9 A;  3SSK A;  4MEM A;  5EXC I;  2AL6 A;  4LDT B;  1AAR A;  4WWP A;  1WGG A;  5EXU A;  4MJS A;  4BVU C;  4N9F 4;  4NNJ B;  1W7T A;  2AEH A;  4EZJ A;  2ZO7 A;  2MCN B;  1ZGU B;  2M8S A;  5HBD A;  2L00 B;  4RM8 A;  4E3C A;  2K8B A;  4PPJ A;  1XT9 B;  2JRI B;  2A47 A;  2J0J A;  3ZTC A;  4W73 A;  2K25 A;  1P3Q U;  4JIO U;  5D94 A;  3VUW A;  4R6B A;  3ZW3 A;  3SSY A;  1QYO A;  4PPK A;  3RD2 A;  3M22 A;  4W6A A;  1VCB A;  2R2O A;  4EDS A;  4MGY E;  1WX7 A;  2G3Q B;  2G5Z B;  2WX1 A;  2IY1 B;  2KQS A;  2K8C A;  4IUM B;  3DOW A;  3A4S C;  3EHV A;  3ZDT A;  2YVC A;  3L54 A;  2ZMW A;  5H88 A;  1WXA A;  2MP2 A;  3SVU A;  4TUU A;  3WCK A;  2LRW A;  4GDK B;  4E71 A;  2QRF A;  4KSK C;  1I35 A;  5EB7 A;  1ZKH A;  2I1K A;  3JVZ X;  4H48 A;  3APF A;  2FCM A;  3APC A;  3RZF A;  1GL4 A;  5G55 A;  4L12 A;  3K9P B;  3A8S A;  2OGR A;  2A4Z A;  4XC2 A;  1WGH A;  5EXB A;  3KUZ A;  3H7P B;  5FVG A;  5AQB B;  3V60 A;  3B0A A;  4W7A A;  3LSA A;  3AI4 A;  1E8X A;  4K7W A;  1WYW B;  3U8P A;  4W6G A;  4DXQ A;  1GC7 A;  1IPG A;  4RMA A;  4HQ9 A;  3QIJ A;  1EML A;  2ZVO A;  4MEL A;  2V4E C;  5GMV A;  5TR5 A;  2XEW A;  4ANU A;  4BDU A;  3EVU A;  2IE2 A;  5AZF A;  5G2N A;  3V6C B;  3SVO A;  2DHZ A;  4OJ0 A;  4URK A;  3U7D A;  2KMA A;  4G50 A;  1UIS A;  3SVB A;  3JW0 X;  2CR5 A;  2UYZ B;  2DDC A;  4TZA A;  3SG4 A;  3VQI A;  2GW3 A;  3QQ8 B;  2QZ0 A;  4DXP A;  4DXN A;  2YE0 A;  1S6Z A;  2WYQ A;  2WIQ A;  3RZW C;  2Q57 A;  4ORN A;  3CST A;  3AUL A;  3NHE B;  4FUL A;  2IO0 B;  4DK5 A;  3PJ7 A;  3EVP A;  1XAE A;  1B9C A;  3AI5 A;  5EBJ A;  2JAD A;  5E6O A;  4IK8 A;  4MGI E;  2I1J A;  3PRE A;  4L13 A;  3HK0 A;  4W6C A;  1KYR A;  2HE7 A;  4BBN C;  4EUT A;  1Q1O A;  3PRZ A;  2DD9 A;  1V2Y A;  1YJF A;  2K1F A;  5J18 A;  2UWQ A;  3L17 A;  4DBG A;  3IHP C;  2AWT A;  4GB9 A;  3QA8 A;  4IW0 A;  4EOY A;  3TMP B;  5LXI B;  2CHZ A;  3KUD B;  1U4A A;  5EHU A;  2WWZ A;  2DZM A;  3SVS A;  2DYB A;  5DU0 A;  3ED8 A;  2LVQ A;  2MW5 A;  4PFE A;  2A56 B;  2AWM A;  1WZ3 A;  4P7I A;  4GU2 A;  1WH3 A;  4FA6 A;  4BKS D;  4DXO A;  4JGH B;  4JC2 A;  4BKS A;  4XZ4 A;  5FVI A;  2GBR A;  4P1Q A;  4W76 A;  3DPX A;  4LJC A;  4EEW A;  3KW5 B;  3SHQ A;  4LQT A;  2KC1 A;  3VH3 B;  2CHW A;  2V4E A;  4DHJ B;  2IY0 B;  2LI5 A;  3U8Z A;  1UZX B;  1LM8 B;  4FLH A;  4G11 A;  1GUA B;  2KNB A;  2D10 A;  1A5R A;  2HGY A;  4ZRJ A;  1RM9 A;  1K8R B;  1WGR A;  2HJO A;  3DQ7 A;  4AOF A;  3HHM A;  2G6X A;  2MP2 B;  2H6V A;  3DQC A;  1WI0 A;  5CHW A;  3NZS A;  2Z0D B;  2A53 B;  4HQ8 A;  2IOV A;  3SSH A;  2HD5 B;  1RRB A;  2JXX A;  3DCG A;  2PXW A;  1UD7 A;  4GGQ A;  1KOT A;  4W6J A;  4BBN F;  5EB6 A;  2RD0 A;  4LDT D;  1BT0 A;  4ANX A;  4XVP A;  1QY3 A;  2BYV E;  1EMM A;  4I6L B;  2IZV B;  3TMR A;  3N32 A;  4GOC A;  3SSL A;  4HDQ A;  2PJH A;  3I19 A;  3CFH A;  3SS0 A;  5DPJ A;  4WJN A;  1G6J A;  4BOS C;  3MHS D;  3U30 A;  3AXC A;  4H3L A;  2BWF A;  3PZD A;  1WRD B;  3KYD D;  1EO6 A;  2J7Q B;  2MBB B;  5C23 A;  3SG6 A;  1OTR B;  3DQ4 A;  3O78 A;  1V80 A;  4W72 A;  4OY4 A;  2QHO A;  4AJW A;  3NOB A;  3PJ5 A;  3U8A A;  4ZF4 A;  2L76 A;  3EFU A;  1GGX A;  1F9J A;  4A20 A;  4KV2 A;  1P0R A;  4KF4 A;  1SIF A;  3CD9 A;  3CFF A;  1H4R A;  4DHZ E;  3AU4 A;  4HJK A;  2C7H A;  5EJU A;  1JC0 A;  2Y5B B;  1R4M I;  2MBE A;  2LVO A;  5CX3 A;  3A33 B;  2CS4 A;  2ZEQ A;  3RUL A;  3ST4 A;  1Z5S B;  1G7K A;  1W7U A;  3B1L X;  3CSF A;  3R3M A;  2H9W A;  4W7F A;  1E7U A;  4TQ0 A;  2KX0 A;  3LVD A;  3SSV A;  2W9N A;  1C3T A;  4XGY A;  3SG5 A;  3PHW B;  4GDK A;  4W6R A;  2ZNV C;  4KW9 A;  3SRY A;  3IP2 A;  5BT0 A;  4HCP B;  3GB3 A;  4WAA A;  2O6V B;  4PYZ A;  3WLC A;  3OJ4 B;  4IWO A;  3EK7 A;  5LXH A;  2OKY A;  2A52 B;  1X1M A;  3NZU A;  3H7P A;  3A1Q B;  1WY8 A;  1EMC A;  3VHT C;  3H7S A;  5KTG A;  3HM3 A;  4RM9 A;  2KJR A;  4KSL C;  2OOB B;  3DPD A;  1HE8 A;  3TL5 A;  3UIO B;  3LJ3 A;  5BO4 B;  2M1M A;  2Z6Y A;  3TCA A;  3TBL D;  1GJZ A;  4IM3 A;  3VFK A;  4KEX A;  3GOE A;  3MTN B;  3PSE B;  2YFP A;  5J2O A;  2IYD B;  1WGD A;  3V62 A;  3SG3 A;  1WXM A;  1E7V A;  3H6N A;  2C9J A;  4DDI D;  4KIK B;  4GF6 B;  2JPH A;  3IBE A;  3E5V A;  3P2B A;  4AWJ A;  2POX A;  5HZU A;  4W6K A;  3BIN A;  4KF5 A;  4LJO B;  5DTX A;  2V3S A;  1KYS A;  2ZO6 A;  4M8M A;  3DQ9 A;  3SG7 A;  3KH0 A;  2WX0 A;  2FZU A;  3WAM A;  4HK2 A;  3EK8 A;  1UGM A;  2D3G A;  1GFL A;  4DDG D;  3G9A A;  4LJD C;  3SDL C;  4KGE A;  3NY5 A;  2VZX A;  1E8W A;  1E90 A;  4W9J A;  4Z4K A;  2MX2 A;  1YD8 U;  1E8Z A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  4Z4M A;  1ISN A;  3BX9 A;  2ZPN A;  4DWF A;  3DQI A;  2KXJ A;  3W1S C;  4R6D A;  3O77 A;  3SVN A;  3S2A A;  3DVN V;  4HXD A;  2J0K A;  1WX9 A;  5DPG A;  1J8C A;  2O2V B;  3ZRC A;  1WGY A;  3DQ6 A;  1EMF A;  2KWC A;  2MRP A;  5BQL A;  2ICR A;  3M3J A;  4N3D A;  2OKW A;  5DRG A;  2PXS A;  3QK0 A;  2KD0 A;  2BF8 B;  3L13 A;  1KLV A;  4KDI C;  4AS8 A;  3GZN I;  1RLF A;  2OTE A;  2BKR B;  4IK1 A;  2A48 A;  3DQF A;  2AH8 A;  3V61 A;  1EUV B;  3CB9 A;  3NF0 A;  5JHA A;  4NWS A;  1JBZ A;  2PPH A;  4GSW A;  4H3M A;  4W7D A;  2B3Q A;  1Y8R C;  4DHJ D;  4W6F A;  2RR9 A;  2KVR A;  3VDZ A;  3ZNG C;  3DBH I;  3ZRF A;  2ZJD A;  4J89 A;  4MH0 E;  3PJB A;  4OGS A;  1Q5W B;  1C4F A;  4W7E A;  1CV7 A;  1MOU A;  3VXW A;  4DKM A;  3K1K A;  3DQJ A;  2AL3 A;  5IAA C;  3DQ3 A;  2FID A;  1R4N I;  4Q7R A;  1V9J A;  3SVR A;  2PE9 A;  3VH4 B;  4W77 A;  1KJT A;  3I3T B;  3HM6 X;  4PS8 A;  1EMG A;  4ZDV A;  4L1I A;  2BWE S;  2ZCB A;  5D6J B;  4LJD A;  2KJH B;  4JRB A;  1MYW A;  1S3S G;  3ZUL A;  2KQ7 A;  4KZC A;  1L2N A;  1LFD A;  5HZO A;  3H1O A;  4IM0 A;  1D3Z A;  4BFR A;  5DTL A;  5IA7 A;  4TKN A;  3H1R A;  3NEZ A;  2Z59 B;  1WMH B;  2DUF A;  2PEA A;  3W1S A;  4B6W A;  2ZPY A;  2DX5 B;  2KTF A;  2NVU I;  1RRX A;  2M17 A;  4TZG A;  2KAN A;  2KWU B;  4J88 A;  1WJN A;  4K7U A;  4E74 A;  2Z1O A;  2DYO A;  3DQM A;  3M95 A;  1V81 A;  3ADF A;  3ZUF A;  4W69 A;  2LJ5 A;  2O29 A;  1OXF A;  3ZTF A;  3PHX B;  2L05 A;  3WAO A;  3EKJ A;  1V5O A;  3DVG X;  2XK5 B;  2D07 B;  2WSN A;  3U0M A;  3RT3 B;  4IZN A;  1F09 A;  2DD7 A;  2Q6P A;  3V3D A;  2H5Q A;  3T9L A;  1Q4E A;  2V4L A;  3IFW B;  4U2V A;  4J8A A;  4W6P A;  3PTF C;  2G6Y A;  2C9I A;  2JY6 A;  2HTH A;  4W6I A;  3SU8 X;  1WE7 A;  3WAP A;  4HQC A;  2EMO A;  4AP4 C;  2O6V D;  3VIC A;  2HRS A;  2O6V A;  4B5Y A;  4AUQ C;  2HFC A;  4W9C A;  2WIS A;  1MG8 A;  2YE1 A;  5C1Z A;  1YHH A;  2DZI A;  4M0W B;  3SV5 A;  3AKO A;  3JSV B;  3ZDM C;  3A1Q A;  1YQB A;  1TGZ B;  2HQK A;  2RSU A;  2ZZP B;  1Z1Q A;  3PLU A;  2QLE A;  4KGF A;  5DTZ A;  3T8M A;  4W9I A;  3ZNI D;  3GJ1 A;  3B08 A;  4I2Y A;  2KX3 A;  1ZGQ A;  2ZNV B;  2OJR A;  1W7S A;  2MWS B;  1S1Q B;  4JGE A;  4PPL A;  2GX2 A;  3H1U A;  1OEY A;  2KFJ A;  4F1S A;  2VVJ A;  1ZW7 A;  2MBH A;  3W1D A;  4B30 B;  1UH6 A;  2HGD A;  3UGB B;  3AU5 A;  3BY4 B;  4KIK A;  4I6P A;  3ZIM A;  4NAW A;  5JZE B;  3X0W A;  3SVD A;  2GBM A;  1EF1 A;  2OTB A;  3VHT B;  2FNJ B;  4MGK E;  4LCD E;  2MSE D;  3CMM B;  4HLE A;  2G3O A;  1Q4C A;  2GBN A;  2DUH A;  3KYC D;  2KHW B;  4XL5 A;  4W6B A;  5EDS A;  3ST2 A;  3ST0 A;  3DBL I;  3ST3 A;  2G3D B;  3A9J B;  4HVF A;  5HKH A;  1OQY A;  2FCN A;  4MSQ B;  4DKN A;  4GES B;  3DQV A;  2O24 A;  2OJK A;  4IK5 A;  2BYF A;  3N3K B;  4BKT A;  2KC2 A;  4W9K A;  2QT2 A;  3KCS A;  3PPA A;  3EEC A;  2FAZ A;  1WZ0 A;  2JRH A;  3RUI B;  2JUO A;  1WJU A;  3UQB A;  4KAG A;  3LDZ E;  4H47 A;  3UQA A;  4JF9 A;  4RTC A;  4W6D A;  5DQM A;  4FBJ B;  4KPI A;  2O2V A;  1P9D U;  2QU1 A;  5DPI A;  4NJ7 A;  1WFY A;  4CYE A;  3DQH A;  1L7Y A;  2DEN B;  2GMI C;  4RYS A;  2EMN A;  5AZG A;  1YIW A;  3A9K B;  1WXV A;  1VD2 A;  2IO2 B;  2KZR A;  1WX8 A;  4IM2 A;  4FAD A;  4JFG A;  3EC8 A;  4AR7 A;  2FL1 A;  3U0L A;  2RH7 A;  2LVP A;  3H9D A;  4FJV B;  1H8C A;  3OSQ A;  2IO1 B;  2H5O A;  2Z6Z A;  3M24 A;  4W9G A;  4W6L A;  4IK3 A;  4WWN A;  4GDL A;  2YDZ A;  4W7C A;  2HJ8 A;  2JT4 B;  2FWQ A;  2FCS A;  3EVV A;  5FR6 A;  4DXI A;  3KVF B;  2VVH A;  3DQ1 A;  1E8Y A;  2BKF A;  4NJ6 A;  2G6E A;  1QXT A;  3QX1 A;  4HPL B;  2GBK A;  5AEK B;  5LLI A;  1WJ4 A;  4X57 B;  3Q3J A;  3QWZ B;  2NS5 A;  4OQW A;  4IG7 B;  3OGO A;  1UEL A;  2ASQ A;  2D11 A;  4W6T A;  3CF6 E;  2DDD A;  1WJ6 A;  3LS3 A;  1WIA A;  4HVB A;  2FCQ A;  2KN5 A;  1WMH A;  4FHK A;  5JH5 C;  2LXC A;  1RMP A;  4K7S A;  2KLC A;  2WHS A;  3ENE A;  3TJP A;  4W6O A;  4ANJ A;  1Z1P A;  4EKU A;  2C5L C;  4HWI B;  4MSM B;  1YHI A;  4H3N A;  2DUG A;  1EMK A;  2KFK B;  4KW4 A;  1YX6 B;  4NAW B;  3IG3 A;  3L10 B;  2BYE A;  2M4N A;  2LD9 A;  2NBU A;  4P76 A;  2XK5 A;  1YX5 B;  2C7N B;  2K6Q A;  2YLM A;  4ANV A;  5FVF A;  2Z6X A;  3LF3 A;  5JHB A;  3UG0 A;  3LF4 B;  2EMT A;  1P98 A;  4TQ1 A;  2JWZ A;  2MBQ A;  4WJO A;  2MLB A;  2JF5 A;  3UF8 A;  1Q4A A;  1NDD A;  3L0W B;  3VUX A;  2BPS A;  1FXT B;  3RYT A;  3VTV A;  4G3X B;  4W6S A;  5E6P A;  2WDT B;  4PYU A;  3RWA A;  3TMT A;  4YL8 A;  2O2B A;  5AZH A;  2A5U A;  3A4R A;  2GX0 A;  2CKH B;  1EME A;  1UBQ A;  2VVI A;  1NI2 A;  2NR2 A;  3JSV A;  4ZB1 A;  4F7Z A;  2H5P A;  3LVA A;  3OJ3 A;  5H87 A;  3OLM D;  3MJW A;  1WE6 A;  3PV1 A;  3R7R A;  3M62 B;  1TZ1 A;  1SGH A;  4F8C B;  3PRM B;  1KM7 A;  4B95 A;  5D7G A;  2FIF A;  4EUL A;  3R7Q A;  3SST A;  2IBI B;  1WXS A;  2WUR A;  1LXD A;  3PVL A;  1GG3 A;  2EKE C;  4DXA B;  2JVC A;  3ZKJ C;  4XX5 A;  4B30 A;  1GC6 A;  2LAS A;  5DPW A;  4W6N A;  2IB6 A;  2L3Z A;  1TBE A;  3L08 A;  1HUY A;  3DQA A;  1LQB A;  4W75 A;  1Q0W B;  3VHT A;  2L0F A;  1V49 A;  3TIX A;  2AWL A;  4GN1 A;  1OXE A;  2WHT A;  3HIZ A;  4FN2 A;  3P8U A;  4JL9 A;  2HCG A;  1JBY A;  5DTY A;  3NS8 A;  4ZF3 A;  2N7D A;  3M63 B;  2N4F A;  4G0N B;  4ZIO A;  4NQK E;  3A9J A;  2K6D B;  3P28 A;  1SE9 A;  2LGD A;  1KP5 A;  5DRF A;  2B3A A;  3VVW B;  1MOV A;  5CHV C;  2CU1 A;  2QLG B;  1F0B A;  1V5T A;  3ZLZ A;  2Y0G A;  3E5T A;  4W9E A;  1EMB A;  4GDL B;  2HPW A;  2LUE A;  4DXM A;  3APD A;  4ZFS A;  2ZVN A;  3PS6 A;  3CBE A;  3L16 A;  5L95 C;  3BXB A;  2MQJ A;  4NY0 A;  3CFA A;  4EMQ A;  4ZRK A;  5CHF A;  1WF9 A;  2XBB C;  2G45 B;  4KW8 A;  3WLD A;  1XD3 B;  4W9L A;  4CHK A;  4MGZ E;  5DPS A;  3W1Y A;  3VTU A;  4W9F A;  2NPT B;  3A9K A;  3PLV A;  5BTT B;  5D2M B;  3GEX A;  5DPT A;  3ONS A;  3PT2 B;  4ZRI A;  4OVV A;  4UTS A;  1NBF C;  2KOX A;  2QLI A;  3C0R B;  2IB5 A;  5KHO A;  2VRR B;  2VAE A;  1JRU A;  4NQL B;  3ECI A;  4W9D A;  3BXA A;  2A50 B;  1V86 A;  1QYQ A;  4IK4 A;  2GOW A;  2C9W B;  4FJY A;  4A3P A;  3NED A;  4HCN B;  2HQZ A;  2N9P C;  2M0X A;  2L8J A;  2Z0E B;  3ZUJ A;  1EMA A;  5KHQ A;  3DQ5 A;  3O65 B;  1IYF A;  5HGE A;  1M94 A;  4II3 B;  4OHS A;  4TV3 A;  1CMX B;  4RYW A;  4BKG A;  1XQM A;  2DAJ A;  2KKC A;  2LWP A;  2RGF A;  3CD1 A;  1H6R A;  3U0K A;  3PGE A;  1WR1 A;  5LTP A;  2MA9 B;  4II2 B;  3DPW A;  3DBR I;  3VK1 A;  2L0T A;  1WR6 E;  5HW9 A;  3VUY A;  1EF5 A;  3QJZ A;  1ZUX A;  2KTR B;  4WWO A;  5DPH A;  2P4M A;  3DQ2 A;  3SVE A;  3DQL A;  3EKH A;  3ALB A;  4M8N A;  1Q4B A;  4Q7U A;  2DZJ A;  4GOB A;  2A46 A;  2AHA A;  5LK4 A;  3QAQ A;  4FJZ A;  2B3P A;  3K9O B;  3Q3F A;  2G2S B;  1UBI A;  3SD5 A;  3WIM A;  1J0G A;  2N7E A;  3N30 A;  3VAW A;  5T3I A;  4I6N B;  1OEY J;  3OAW A;  3DQO A;  4MJS B;  4W6M A;  4W6U A;  2H8Q A;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  4IK9 A;  2K8H A;  2KDI A;  5DQB A;  1V6E A;  3DQD A;  3DQN A;  3ZNZ B;  2AYO B;  3DDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...