3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein, transcription
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
2KDEB 3SVOA 3LJ3A 2QU1A 4IK8A 4E71A 3RZFA 2KC2A 3U0MA 2N7DA 2Z1OA 1HUYA 1LXDA 4OHSA 3A1QA 1JBZA 2MP2B 3CFHA 1XAEA 5EJUA 2ZCCA 3VH4B 3ZNID 5HZOA 3AULA 2VADA 3ZNZB 2JZZA 4WJPA 3CD1A 2RSUA 3PRZA 4PS8A 1JBYA 1BT0A 1YHIA 2Z6ZA 4RMAA 3TBLD 2YE0A 2D3GA 1YX5B 2A4ZA 2DAJA 1V5OA 4NWSA 3M62B 2JUOA 4IWQA 2HRSA 4IG7B 4AUQC 4PYUA 3SG2A 3G9AA 3PTFC 2Y5BB 2ZVNA 2I1JA 3KYDD 1EMCA 2J0JA 3DQ8A 5DCNA 1GC6A 2AWLA 3DPWA 4FULA 2WWZA 1D3ZA 3T9LA 3VQIA 2K8BA 4B5YA 4H3LA 3A9JA 2ZMUA 3QX1A 5IAAC 4DDGD 4B95A 4HQ8A 1E90A 4B30A 1NDDA 3GJ1A 1C3TA 4XOWA 3H1OA 3IR8A 1ZGUB 3VHTC 1A5RA 3CD9A 4GIVA 3A1QB 2HJ8A 2KQSA 2MA9B 2M1MA 3IG3A 3RWTA 3EK7A 1KLVA 1YJ2A 4JIOU 1WXMA 2KOXA 4HK2A 4DBGA 3PJ5A 3DVNV 1WJ6A 5HZTA 2BGFA 3ML8A 3H6NA 1J8CA 2KWVB 4ZRJA 2K1FA 1I42A 2ASQA 2QLEA 4BOSC 2KMAA 3L10B 3ML9A 3U8PA 4H48A 4WWPA 2VAEA 1WXVA 4W6BA 5HZUA 2A46A 2H8QA 3C0RB 2EMSA 4IWOA 5DTLA 5HBDA 3GJ2A 3DQHA 4DHJB 4BKGA 1KP5A 3VTWA 1I35A 2IBIB 3E5TA 2EMTA 4CHKA 4DXNA 1G7KA 2QZ0A 3RULA 3O78A 3LF3A 5J2RA 1WM2A 5LTPA 3X0WA 4P76A 4XVPA 3ZVVA 1EO6A 5DPGA 5HW9A 2IOVA 3EVRA 2KTFA 2LXCA 1WE6A 3A9JB 4LJPB 5HGEA 4JRBA 4I6PA 3PPAA 3EC8A 2FL1A 4W6LA 4KW8A 5CHFA 4AOFA 1GG3A 1V5TA 3EK4A 4W9IA 2M8SA 3DQOA 3PRMB 3CFAA 4IK3A 2KXJA 2HTHA 3GOEA 4XX5A 3W1SC 4GOBA 2QLGA 4TZAA 3U8CA 2GW3A 2OJRA 5E6NA 4W6PA 4XC2A 1GFLA 1WFYA 4PYZA 1GNUA 3U8AA 4AJWA 2QRFA 3SVEA 3DQDA 2O29A 1X1MA 4EUTA 5BQLA 2VRRB 2AWTA 2WHTA 2YE1A 5DRFA 4HXDA 1YHGA 2IO2B 2V4LA 3TMRA 3TJPA 3U7DA 4KZ0A 3AI4A 3EVPA 4FADA 3DQKA 2DZIA 2C7HA 2KWCA 1WF9A 4IM0A 4JGHB 4GSWA 5DPIA 3CB9A 3R3MA 1UD7A 4J8AA 5AZGA 5TR5A 1V80A 2MX2A 4ASWC 4MEMA 4A3PA 2CHXA 3ZW3A 2AWMA 2IYDB 2FCNA 2QLGB 2HPWA 3RT3B 2DX5B 4ANUA 4DHJD 1GJZA 4HPLB 4W73A 2LVPA 2JRIB 4N9F4 4N3DA 3RYTA 2G2SB 2BWES 2RH7A 2DUGA 2AEHA 3H1UA 2ZPYA 3TIXA 2OKYA 1WX7A 3PGEA 3OLMD 2KZRA 3JW0X 4LQUA 3SD5A 4J89A 1UBIA 2PPHA 1V86A 2C60A 4G11A 5AZFA 3ZKJC 5D7GA 4HWIB 1WZ3A 3GL4A 3VUXA 2PEAA 3LVDA 2L8JA 2Z6XA 4OVVA 2YVCA 2GOWA 3SHQA 3ZTDA 5JH5C 4RYSA 2DZJA 2NS5A 2C9WB 2H6VA 2L05A 1UGMA 1E7UA 2KDBA 3SSPA 3GEXA 2KD0A 2G16B 4ICUA 5FHVA 2A54B 4W9EA 2REXA 5H89A 3UFZA 4LJBA 4UTSA 4KIKA 5LK4A 2Z0EB 1WYWB 4W9JA 5LXHA 3H1RA 1YIWA 2IO0B 2P4MA 2K25A 3ZIMA 5D94A 4NY0A 3VK1A 3PJ7A 5DPJA 2MW5A 2LJ5A 1MG8A 4IK5A 2KVRA 2DYOA 4L12A 2AL3A 4BVUC 2BPSA 2NBUA 4IUMB 2KQ7A 2L7RA 4DXQA 2BYFA 3DQEA 4M8NA 4ZYNA 2ICRA 4KF5A 3P2BA 4ZF3A 4W9GA 4MGKE 1KOTA 3AKOA 3ZRCA 1WX9A 2C7MB 4E74A 5H87A 2WHSA 2EMNA 5DRGA 3OAWA 5IA7A 1Q5WB 3PLUA 4MELA 1C4FA 2G4DB 3PS6A 1H6RA 1EMMA 5HKHA 1XA9A 1ZGQA 4GU2A 4W6TA 4WJNA 4TQ0A 3VICA 4MDKE 5LTRA 4KIKB 5E6PA 4MJSA 4W6GA 4DHZE 4DXMA 3EK8A 3M3JA 5EHUA 1TGZB 3SU8X 3RCZA 2OGRA 3DQAA 1V81A 4AJYB 2RD0A 2FIDA 4LJDC 1VCBA 3E5VA 4KEXA 1YX6B 3PHXB 4KGEA 2IB5A 1QYFA 2DDCA 5BTTA 2FZUA 1WGHA 3EVUA 3LF4B 2A5UA 2M4NA 2A48A 1HCJA 2LRWA 4KGFA 2L3ZA 2L0FA 2OTBA 2KLGA 2MBOA 1Q4DA 2H5RA 4U2VA 4OQWA 3LVAA 3ST0A 2KX3A 3DQ6A 3DBLI 1RLFA 4EN1A 4XGYA 3BX9A 4ZFSA 1WGYA 3IP2A 2K6QA 4LDTB 4W77A 2BYEA 1U4AA 3SG6A 3K9PB 2ZCBA 3VHTA 4M0WB 2N9EB 1Y8RC 3WALA 2O24A 4GMVA 2A53B 1RMPA 3KUZA 4WAAA 3SSKA 2H5OA 2GW4B 2FWQA 4WJQA 3NZSA 3DQ7A 1WR6E 4MJSB 5KHOA 4MM3A 1B9CA 3IHPC 1V6EA 2FCSA 4B9KA 2Q57A 4LQTA 1R4NI 3VXWA 4W9HA 1KYRA 4BDUA 4NJ7A 3CSTA 1JRUA 3QARA 2MCNB 2LI5A 5DQMA 2GBRA 4OGSA 1XD3B 1MYWA 3L17A 3KW5B 4BBNC 2VVIA 1GL4A 3SVSA 5BTTB 1WIAA 2KX0A 2K6DB 4EMQA 2Z59B 4W7CA 2D11A 1WJNA 1KYPA 4W76A 1Z1PA 2LXAA 4R6BA 2K8HA 4ZDVA 4DWFA 2H9WA 2KTRA 4J88A 3SSYA 2OKWA 3VAWA 2AL6A 2YFPA 1H4RA 1EF5A 3APFA 2NBVB 3EFUA 2WIQA 3QCAA 3ST3A 3NT3A 1RMOA 5H88A 3DQNA 2KJHB 3LVCA 1IP9A 2DUFA 3VHTB 1J19A 2AH8A 3RD2A 4DXAB 4XZ4A 2H5QA 3GZNI 2LWPA 3AU4A 3Q3FA 4XOVA 2KNBA 2BWFA 3SVUA 3AU5A 3W1SA 4WJOA 2KJRA 1S1QB 2A47A 4GOCA 2BTJA 4RM9A 4HDQA 3EHVA 4K7UA 1AARA 3IBEA 3DVNU 2KC1A 2C9JA 2V3SA 3DQ9A 2ZO6A 5DTYA 3HIZA 4MGYE 2ZVOA 5CTRC 3MGFA 3ALBA 4GB9A 2KTRB 2ZMWA 3DPZA 3CBEA 2V1YA 2HE7A 4Z4KA 3NHEB 4K7WA 1XT9B 2R2OA 4LDTD 2KWUB 4PFEA 4FJZA 4HCPB 1XQMA 2AHAA 2IE2A 3NOBA 4TZGA 2Y0GA 1ZW7A 2DENB 2CU1A 5DPHA 1QY3A 4PS7A 3HK0A 3ZUNA 3SVCA 3WAMA 4MGZE 4IZNA 2FNJB 3M63B 4NQLB 1T0YA 2D10A 2GBNA 5FR6A 4EDOA 2G45B 5CHWA 3R7RA 3NS8A 2FCMA 2JT4B 3W1CA 2G3QB 2O2VA 2IB6A 3WLCA 1UISA 4EZLA 5E6OA 4LW5A 4MH0E 4F1SA 4M8MA 4W9DA 1W7SA 4OVUA 4FJVB 1E8YA 3SG4A 2D07B 3O65B 1TZ1A 3DPDA 4HLEA 2QLHA 3DVGY 4EFOA 4W6DA 3DQUA 3PRPB 4DXPA 4KZCA 2DHZA 4KDIC 2DD9A 2N7EA 3JYUA 3M95A 4A20A 4GESB 3KVFB 3Q3JA 3U8ZA 2B3AA 5JHAA 4NQKE 2GX2A 1ISNA 2LGDA 2LGXA 1OEYA 4B6WA 3T8MA 1SIFA 2KDIA 2MSED 2B3QA 2G4SA 4JF9A 3L16A 4KDLB 5EXBA 3V6EB 1V9JA 2NPTA 1RFAA 2DYMA 4DXOA 1C1YB 2K8CA 2O2VB 3WAOA 4GF6B 4JFGA 3QQ8B 4JC2A 2G6YA 5DTZA 2GX0A 3UQBA 3BXAA 4W6NA 5L95C 2JZ3B 1EMLA 4KW4A 4ZF4A 1OXDA 4W6CA 3ZUJA 1WGGA 5DPTA 3UIPB 2ZNVC 2MWSB 1KYSA 4E3CA 3SSTA 3DQFA 3ST2A 3ZDMC 2LZ6A 2OOBB 2DAFA 3UG0A 3QC8B 3OJ4B 3NT9A 3V62A 4W72A 2OTEA 3NEZA 3U0NA 4W7XA 1SGHA 4OY4A 4JEOA 3B0AA 1QZEA 2L00B 1LQBA 3DQLA 3DBRI 5C1ZA 2KJ6A 1YQBA 3V3DA 3VFKA 2WDTB 1E8XA 2NPTB 2V4EC 1Q0WB 3ZUFA 1ZKHA 4Q7RA 1EMGA 3LA1A 2DDDA 1BFPA 3EKJA 4ANXA 3BY4B 1RAXA 2CHWA 4HQ9A 3DQ1A 2IZVB 4AP4C 4DHZB 3SG3A 4II2B 2KLCA 2HGYA 4ANJA 3R7QA 2MBEA 3EECA 1W7UA 2GBJA 1RRBA 5J2OA 2JRHA 3DQJA 1F0BA 2QHOA 4LJDA 4PPJA 4DXIA 3VTUA 2MBBB 5DPSA 3WIMA 2G3OA 2NCNA 2KHWB 3TMPB 4W6AA 2KKCA 4IC7B 1QYOA 3HM3A 4BOZB 4ANWA 3WCKA 2NVUI 3E5WA 1OGWA 4IW0A 2PE6B 3KCTA 1ZGPA 4Z4MA 2GMIC 3A8SA 3S2AA 4J6IA 3M24A 1IYFA 1S3SG 2WURA 2M17A 2C5LC 4KW9A 2DYBA 4F8CB 4JL9A 4TKNA 4HVBA 4W9LA 5AQBB 3QJZA 4IM2A 5EBJA 2JF5A 3VTVA 3P8UA 4PPLA 3DOWA 4NAWA 4NPNA 1OXEA 2KN5A 1YD8U 4RYWA 4W6JA 4LCDE 2EMOA 1WRDB 2J0KA 1Q1OA 2B3PA 4I2YA 3MTNB 3JVZX 1WE7A 2VVJA 2HJOA 4R6DA 1FXTB 4AS8A 2FUHB 3UQAA 2FIFA 3PVLA 4ZINA 3WA0A 2L0TA 2WYQA 3DQIA 5D2MB 1OTRB 3ST4A 2ZZPB 1M94A 4I6NB 5EDSA 5FVFA 3VUWA 1F09A 5J18A 3ZRFA 3GB3A 4BBNF 3P28A 4XL5A 5T3IA 4IK9A 5CHVC 2KFKA 4ORNA 1OEYJ 1Q73A 3U30A 2IY1B 4HJKA 4AWJA 2HFCA 2Q6PA 4W9FA 3WLDA 3KUCB 1P1AA 5EB6A 2PXWA 4HPMB 2BF8B 2O6VB 3QAQA 4KF5C 4ZIOA 2NBWB 4JLCA 4EZJA 4NAWB 3V61A 1TTNA 1P0RA 4RTCA 4W6OA 2N9XA 1EMFA 3IFWB 3VDZA 3OSRA 5L83A 2HCGA 2JVCA 2ZO7A 3ONSA 5LXIB 4EEWA 2ZJDA 3QHTA 2DUIA 2KMCA 4FBJB 3DQMA 4KPIA 2A52B 4W6FA 1GC7A 1YJFA 2IY0B 1OQYA 2H5PA 1Q4CA 4ZRKA 3PLVA 4W7EA 3SRYA 1S6ZA 2WISA 3BXCA 3CSFA 2G6EA 2J7QB 2KFKB 5BO4B 2O2BA 2K39A 2A50B 4A3OA 3RUIB 3RZWC 3TL5A 1UZXB 2JPHA 5J17A 2BYVE 5DPRA 1WMHA 1YHHA 1ZGOA 4HVFA 2OJKA 5AEKB 4TUUA 3DQVA 4GGQA 3ENEA 1WI0A 4Q9WA 4W75A 3KYCD 2MQJA 1Q4BA 3SSHA 1NI2A 2KFJA 4AR7A 2CKHB 2HD5B 4GDLA 4K81A 4W7DA 4LJCA 1EMEA 2DD7A 5F9GA 3DDCB 2DZKA 1XQQA 4IWPA 1WR1A 2ZEQA 4HCNB 1SE9A 2LVQA 4GDKA 2N9PC 3A33B 2A56B 2J0MA 2MRPA 3A9KA 1Q4AA 3APCA 1G6JA 4EOYA 4WWOA 2KK8A 1EUVB 2LVOA 4IK1A 3V6CB 1QYQA 3SSLA 2PXSA 2KDFB 1QXTA 3LDZE 2LASA 3PREA 2G3DB 1Z2MA 2N1VA 4L1IA 3L08A 4W7RA 5EXCI 2GBMA 4FJYA 2M0XA 4GN1A 2BKFA 4HQCA 4BKTA 3QK0A 4KVGB 1EMKA 4RM8A 4GXBA 2O6VD 1WMHB 4II3B 1GGXA 4IK4A 3NF0A 4BKSD 4FA6A 1RMMA 1L7YA 3X23A 1WXSA 3N30A 3AI5A 3TMTA 2MBQA 1RRXA 4ZRIA 4LJOB 4W6RA 4IM3A 4GDLB 4Q9XA 4G3XB 4MSMB 2L76A 1WGRA 3ZDTA 1E8ZA 5LLIA 4MGIE 1R4MI 3K1KA 1LFDA 2WSNA 4GDKB 2LRUA 4DDID 4P7IA 3A9KB 4TV3A 2BKRB 1WM3A 3SG7A 4W7AA 1H8CA 3D32A 2JADA 2C7NB 3DCGA 3PJBA 2UYZB 4B30B 2R2QA 3A4SC 3O77A 1F9JA 2XEWA 4KV2A 3QWZB 4KAGA 5KHQA 3CFFA 3DQ4A 2AWKA 2ARLA 5BT0A 3ZTFA 2NR2A 4KF4A 3OJ3A 2AWJA 2RR9A 1W7TA 5HZSA 4L13A 1LM8B 2CHZA 3PHWB 3NEDA 5FVGA 2UWQA 1J0GA 4H3NA 2C9IA 3WANA 1P9DU 2Z6YA 5DU0A 1GUAB 4Q7UA 3M22A 3BINA 5DTXA 3DQ5A 2WX0A 2EKEC 4CO7A 4DK5A 3H7PA 1H4UA 2YDZA 2HQZA 2LUEA 4W6UA 5G2NA 3CGLA 3PIBA 4DKMA 3OGOA 2V4EA 1E7VA 4G50A 4W7FA 2QT2A 2VVHA 2I1KA 4EKUA 2VZXA 1OXFA 4W6KA 1E5WA 3ZNGC 5G55A 3DBHI 3QIJA 5CX3A 2GBKA 4YL8A 4PPKA 2HGDA 4KSKC 1WGDA 3N32A 3SVRA 2FAZA 3PZDA 1KM7A 2LGYA 1WZ0A 3DPXA 3VH3B 2ZNVB 1NBFC 4HDOA 3AXCA 2DUHA 4WQOB 3ADFA 3CF6E 4W6SA 3K9OB 1Q4EA 3DQ3A 3H9DA 3JSVA 1EF1A 2G5ZB 3NZUA 3IVFA 5EB7A 4MSQB 3HHMA 3H7PB 1JC0A 2MBHA 3OSQA 4EULA 1IPGA 4ZB1A 2V4EB 1WY8A 1YZWA 1P98A 1WX8A 3SDLC 4URKA 3L0WB 2QLIA 1V2YA 1VD2A 5JHBA 2PJHA 1PQSA 2RGFA 4EDSA 4NJ6A 5FVIA 3L13A 1P3QU 1ZUXA 2RPQA 3WAPA 3A4RA 5LTQA 3LSAA 3EVVA 3QA8A 3DBSA 3HM6X 2HQKA 4W9KA 1L2NA 1Z1QA 3SS0A 4OJ0A 1WJ4A 3VUYA 1YJ1A 5GMVA 5DPWA 4PS3A 1XSSA 2WX1A 4W6HA 4W6IA 3SSVA 3KCSA 2G6XA 4G0NB 3LS3A 3W1DA 2Z0DB 2JWZA 1CMXB 5C23A 1MOVA 2IO3B 1CV7A 2JY6A 3CMMB 2MLBA 3JSVB 5KTGA 4KA9A 4FLHA 3SV5A 2WSOA 4F7ZA 2EMDA 3ED8A 1UH6A 5D6JB 1EMAA 4NNJB 2CR5A 4CYEA 1K8RB 3PT2B 3R66C 4K1RB 1RM9A 3KH0A 1HE8A 3RWAA 4ZBLA 3V60A 3SVDA 5DQBA 3U0KA 4FHKA 3ZULA 2CS4A 1JC1A 2O6VA 2XK5A 4BKSA 2JXXA 5EXUA 2D2QA 2ZPNA 4WWNA 4FN2A 3PV1A 3ZLZA 3B08A 1KJTA 3SG5A 2AYOB 3DQCA 1EMBA 2IO1B 3KUDB 2LD9A 3UIOB 4EZKA 1E8WA 3DVGX 2YLMA 3VVWB 5AZHA 3N3KB 4W6MA 4K7SA 4I6LB 4ICVA 2W9NA 3SVNA 2N1WA 3APDA 2KO3A 1V49A 3NY5A 1YFPA 2FCQA 3W1YA 4BFRA 4Q7TA 2DUEA 1UBQA 4JGEA 3S05A 2MP2A 2POXA 5JZEB 4H47A 4HE4A 4W9CA 3UF8A 4TQ1A 3B1LX 4W69A 4W74A 3ZO5B 3I19A 4ZF5A 2DZMA 3UGBB 4KSLC 3L54A 3MJWA 3ZNHB 3BXBA 4FHJA 3ZTCA 4DKNA 4ANVA 2N4FA 2XK5B 1Z5SB 3ECIA 1WJUA 3H7SA 1TBEA 4P1QA 2PE9A 3MHSD 3TCAA 1WXAA 1MOUA 4H3MA 2XBBC 3U0LA 1WH3A 2KANA 3EKHA 3UINB 3SVBA 2WHUA 3I3TB 1UELA 4JQWC 4X57B 1XMZA 3PSEB 5DY6A 3DQ2A
chains in the Genus database with same CATH superfamily
2KDEB 3SVOA 3LJ3A 1N60A 2WNMA 3ZXVA 3BVGA 2QU1A 4IK8A 1K51A 1P7FA 1ZXIA 4E71A 5HFYA 1C77A 3RZFA 3RNBC 2KC2A 3U0MA 2N7DA 1K50A 4ITKA 2Z1OA 1HUYA 1LXDA 4OHSA 3A1QA 1QOAA 4CQNA 1JBZA 2Y3AA 2MP2B 3CFHA 4O1NA 1I4PA 1XAEA 2G9HD 5EJUA 2ZCCA 3VH4B 3ZNID 5HZOA 3AULA 2VADA 3ZNZB 2JZZA 4WJPA 3CD1A 4LK0M 2RSUA 4D2KA 3PRZA 4PS8A 1KLGD 1JBYA 1BT0A 3NUHB 1YHIA 2Z6ZA 3P63A 4RMAA 3TBLD 2YE0A 1WSPA 1PGBA 2D3GA 2R61A 1YX5B 4JWSC 2KT7A 2A4ZA 2PKOA 2CJNA 2DAJA 1V5OA 4NWSA 1HTQA 3M62B 3W2DA 4XDDA 2JUOA 2HJ1A 4IWQA 2HRSA 4IG7B 4AUQC 2RDHA 3SG2A 4PYUA 1YMHE 3G9AA 3PTFC 2Y5BB 2ZVNA 1EU4A 2I1JA 3KYDD 1EMCA 2J0JA 3DQ8A 5DCNA 4C4VB 1JALA 1GC6A 2AWLA 1SF0A 3DPWA 4FULA 2WWZA 1D3ZA 1DOXA 4YWGG 3AE2B 1DOIA 3T9LA 1RM6C 5FKAC 1MPEA 1VJKA 3VQIA 3NVVA 2K8BA 4B5YA 4H3LA 3A9JA 2ZMUA 3QX1A 5IAAC 4DDGD 3SFEB 5I4DA 4B95A 4HQ8A 4LNKA 1E90A 4B30A 1NDDA 3GJ1A 1C3TA 4XOWA 1L0VB 3H1OA 3IR8A 5D3DA 1ZGUB 1UNSA 3VHTC 1A5RA 1ZUD2 2WQYB 3CD9A 4GIVA 3A1QB 2HJ8A 3Q8FA 2KQSA 2MA9B 2M1MA 3IG3A 3RWTA 3EK7A 1KLVA 1YJ2A 4JIOU 1WXMA 2WXKA 2KOXA 4HK2A 4DBGA 2GRIA 1GPXA 1XO3A 3PJ5A 3DVNV 3RI7C 2HTME 1WJ6A 5HZTA 2BGFA 3ML8A 3H6NA 1J8CA 2KWVB 4ZRJA 2K1FA 1I42A 2ASQA 2QLEA 4BOSC 1AW7A 2KMAA 3L10B 3ML9A 4RGNA 3U8PA 4H48A 2ONQA 4WWPA 2LHEA 2VAEA 1ROEA 1WXVA 4W6BA 5HZUA 3R8BA 2A46A 1YQ3B 2KN4A 1QILA 1NENB 1VDVA 4RF1A 2H8QA 3C0RB 2EMSA 2N9KA 4IWOA 5DTLA 5HBDA 3GJ2A 3DQHA 4DHJB 4BKGA 4OZAA 1KP5A 3VTWA 1I35A 2IBIB 3Q3NC 3E5TA 2EMTA 1F2RI 2JU6X 4CHKA 4DXNA 1G7KA 2QZ0A 3RULA 3O78A 4C80A 3LF3A 5J2RA 1WM2A 5LTPA 3AV8A 3ZYYX 3X0WA 4P76A 4XVPA 3ZVVA 1EO6A 5DPGA 5HW9A 3AE1B 3W5UB 2OEDA 2IOVA 3EVRA 1DYQA 4XWWA 2KTFA 2LXCA 4H2AA 1WE6A 3A9JB 3LB8C 4LJPB 5HGEA 4JRBA 4JWUC 4I6PA 4M00A 2NTTA 3PPAA 3EC8A 1IGCA 2FL1A 4W6LA 1C4CA 2RMMA 4LTUA 4PK1A 4KW8A 5AUKA 5CHFA 2TSSA 4AOFA 1GG3A 1V5TA 3EK4A 2M0AA 1T0QC 4W9IA 1QLBB 2M8SA 3DQOA 3PRMB 3RFZB 1TKEA 3CFAA 4IK3A 4L2YA 2KXJA 1L5PA 3N9YC 1PDXA 2HTHA 3GOEA 4XX5A 4LNFA 3W1SC 4GOBA 2QLGA 3VRBB 4TZAA 3U8CA 2GW3A 2FBWB 2OJRA 5E6NA 2EELA 4W6PA 1JWSD 1K52A 4XC2A 1GFLA 1WFYA 5HI1A 5H92C 1C79A 1GNUA 4PYZA 3U8AA 4XYCA 4AJWA 2QRFA 2B76B 3SVEA 3DQDA 4DXGA 1L4ZB 2O29A 1X1MA 2LGSA 4EUTA 5BQLA 2VRRB 2AWTA 2WHTA 2YE1A 5DRFA 4A6QA 4HXDA 1V1OA 1YHGA 2OJWA 2IO2B 1CK1A 3C19A 2V4LA 3GS2A 2JXTA 4PT5A 2GLSA 3TMRA 2J53A 3TJPA 3U7DA 4KZ0A 3AI4A 3EVPA 4FADA 1XLNA 3DQKA 2DZIA 2C7HA 3PZ8A 2KWCA 1WF9A 4IM0A 4B0MA 4JGHB 4GSWA 5DPIA 1WWTA 1GB1A 1CZPA 5G5GA 3CB9A 3R3MA 1ENFA 1L0XB 4HRSA 2WXMA 3BVMA 2V3PA 4FXCA 3FKYA 1UD7A 4J8AA 4J3OD 4N6EB 5AZGA 5TR5A 5FR3A 1V80A 4WIPA 2MX2A 4ASWC 2JYTA 1I4XA 1ZPSA 2LMCA 4MEMA 4A3PA 1JCKB 3Q8BA 2CHXA 3ZW3A 1I4HA 3EUB2 2AWMA 2IYDB 1CQVA 1VZ6A 2FCNA 2QLGB 2HPWA 3RT3B 2LEKA 2ZW1A 2DX5B 4ANUA 4DHJD 1GJZA 4HPLB 4W73A 2LVPA 2E3TA 2JRIB 4N9F4 4N3DA 3P4RB 5HHDG 4ZOHC 3RYTA 2G2SB 2BWES 4RF0A 1SJED 2RH7A 2DUGA 1V1PA 2AEHA 3H1UA 3SFDB 2ZPYA 4IKGA 3TIXA 2OKYA 1WX7A 3PGEA 3OLMD 2KZRA 3JW0X 4XWTA 2M19A 4LQUA 4YSYB 3SD5A 4J89A 1UBIA 4EE2A 2PPHA 1V86A 2QIEB 2C60A 4G11A 5AZFA 5HG2A 3ZKJC 5D7GA 1PYWD 3BIID 4HWIB 1WZ3A 3GL4A 3RNFC 1D5XC 4WAFA 3VUXA 4C56C 2PEAA 4KGSA 3LVDA 2L8JA 2Z6XA 3B2GA 4OVVA 4RGTA 1QOFA 2YVCA 4MH8A 2GOWA 3SHQA 2GB1A 2JZPA 3ZTDA 3TEXA 1C4AA 5JH5C 4RYSA 2DZJA 2NS5A 2C9WB 2H6VA 2L05A 1UGMA 1E7UA 2WDQB 2KDBA 1N6ZA 3SSPA 3GEXA 2KD0A 2G16B 4ICUA 1PFDA 1R4MB 1Q10A 4C7ZA 5FHVA 2A54B 4MT5A 3KWLA 4W9EA 2REXA 3MC8A 5H89A 3UFZA 4LJBA 4UTSA 4KIKA 5LK4A 2Z0EB 1WYWB 4W9JA 5LXHA 3H1RA 1YIWA 4ARCA 2IO0B 1UUPA 3HVDA 2P4MA 2K25A 4OZCA 3BK2A 3ZIMA 5D94A 1ZP0B 3VK1A 3PJ7A 5DPJA 1YN4A 2MW5A 4NY0A 2LJ5A 3EA6A 1MG8A 3AE5B 4IK5A 2KVRA 2DYOA 1MHXA 4HKZE 4L12A 2AL3A 4BVUC 2BPSA 1V1PB 2NBUA 2LHDA 4IUMB 2KQ7A 2L7RA 4DXQA 2QMTA 3P4SB 3BZDB 2BYFA 1PGAA 1F52A 3DQEA 1SE4A 4M8NA 4ZYNA 2ICRA 4KF5A 3P2BA 2BB6A 1JWBD 4Q2JA 4ZF3A 4ZYSA 4W9GA 4MGKE 1KOTA 3AKOA 3ZRCA 1WX9A 2C7MB 2BS4B 3AE8B 3N1ZC 4E74A 5H87A 2WHSA 2EMNA 2FE8A 3HVZA 4A9AA 3LYYA 3DWGC 5DRGA 2VH2A 2W54A 3OAWA 3RNAC 3DHGC 5IA7A 5C3JB 5H8YE 1Q5WB 3PLUA 4DXFA 4MELA 1C4FA 2PTLA 2G4DB 3PS6A 1H6RA 1EMMA 3AN1A 5HKHA 1XA9A 1ZGQA 2ICIA 4GU2A 4W6TA 2W3SA 4WJNA 4M0WA 4TQ0A 3VICA 4MDKE 5LTRA 1YN5A 4KIKB 5E6PA 1XEEA 4MJSA 1IUEA 1WYGA 4W6GA 4DHZE 4DXMA 3EK8A 4JX1C 1KLUD 3M3JA 5EHUA 2WXLA 1E9MA 1VZ7A 1TGZB 2H89B 3SU8X 3RCZA 2OGRA 3DQAA 1V81A 4A8XC 4AJYB 3DBHB 5BYQA 2RD0A 2FIDA 4LJDC 1FRRA 1VCBA 3E5VA 4KEXA 1YX6B 3HRDD 3NJTA 5EE1A 4S0RA 3PHXB 4KGEA 2CU3A 2IB5A 1QYFA 2DDCA 3NRZA 1TY0A 2LUMA 5BTTA 2FZUA 1WGHA 3BK1A 1SBBB 3EVUA 1EWCA 2L83A 3LF4B 1L0YB 1FM0D 2A5UA 2M4NA 2A48A 1HCJA 2LRWA 4KGFA 1MJDA 2L3ZA 2L0FA 2OTBA 1YJIA 2KLGA 2MBOA 2MJEA 1Q4DA 2I38A 2H5RA 4U2VA 4USAA 4OQWA 2IGDA 3LVAA 3ST0A 2KX3A 3DQ6A 4KGTA 2D5GA 3DBLI 3ZGZA 1RLFA 4EN1A 4XGYA 1OQRA 3BX9A 4ZFSA 1L6VA 2AQ3B 1WGYA 3IP2A 2K6QA 3NVYA 4LDTB 1JQ4A 4W77A 2BYEA 1U4AA 3SG6A 3K9PB 2ZCBA 3VHTA 4M0WB 2N9EB 1Y8RC 1NVID 3WALA 2O24A 4GMVA 3TUOA 3RPFC 3BYTB 2A53B 1RMPA 3KUZA 4WAAA 3SSKA 2H5OA 2GW4B 2FWQA 4WJQA 3NZSA 3DQ7A 1WR6E 1OFFA 4MJSB 2AQ2B 5KHOA 4MM3A 4NZLB 1B9CA 3IHPC 2KQ4X 1V6EA 4LNNA 3N1YC 2FCSA 2VZKB 4B9KA 2Q57A 4RGOS 4LQTA 3ZJVA 1R4NI 3AE7B 3VXWA 4W9HA 1KYRA 4BDUA 4NJ7A 3CSTA 1JRUA 3QARA 2MCNB 2LI5A 4OZBA 5DQMA 2GBRA 4OGSA 1XD3B 2BW2A 1FPYA 1MYWA 1N63A 4REZA 3MJ5A 4HROA 3CIRB 3L17A 3KW5B 4BBNC 2VVIA 1FCCC 2INDC 3AE6B 1IGDA 1GL4A 3SVSA 2AX5A 3N1XC 5BTTB 1YQ4B 1WIAA 2KX0A 2K6DB 4EMQA 1EU3A 2Z59B 4W7CA 2D11A 1WJNA 1KYPA 4W76A 1Z1PA 1MHHE 2LXAA 4R6BA 2K8HA 4ZDVA 4DWFA 3TSSA 2H9WA 2KTRA 4J88A 3SSYA 4RGMA 2OKWA 3Q6BA 5EE3A 3VAWA 2AL6A 2YFPA 1H4RA 1EF5A 1PGXA 1RYJA 3APFA 3VR9B 2K3UA 2NBVB 3EFUA 2WIQA 3EGRA 3QCAA 3ST3A 3NT3A 3AECB 1RMOA 1EM7A 5BYSA 5H88A 3DQNA 2KDMA 2KJHB 4ACFA 3LVCA 1IP9A 4KX6B 2DUFA 3TEYA 3VHTB 1J19A 2AH8A 3RD2A 4DXAB 5EE0A 4XZ4A 4M01A 2XNAC 2H5QA 3GZNI 3VRAB 4BAXA 4OVZA 4P1CC 2LWPA 3AU4A 4MM3B 4QAYA 1TS5A 3Q3FA 4XOVA 2KNBA 2BWFA 2WU2B 1LO5D 3SVUA 1NYQA 3AU5A 3AEGB 3SEBA 3W1SA 4WJOA 2KJRA 1S1QB 2A47A 4YXDB 4GOCA 2BTJA 4RM9A 4HDQA 3EHVA 4K7UA 1AARA 1CJEA 5IKCM 2WXHA 3IBEA 3DVNU 1N61A 2KC1A 2C9JA 1LGRA 2V3SA 3DQ9A 2ZO6A 5DTYA 3HIZA 1T6BX 1ZE3D 4MGYE 3HUIA 2ZVOA 5CTRC 3MGFA 3ALBA 4GB9A 4KGRA 2KTRB 2ZMWA 3DPZA 3CBEA 2V1YA 2HE7A 1ZDVA 4Z4KA 3NHEB 4K7WA 3FILA 1XT9B 2R2OA 4LDTD 4ZRPA 2KWUB 4PFEA 4FJZA 4HCPB 1XQMA 2E6XA 1TYGB 1J7CA 2AHAA 2IE2A 1MFWA 1FXAA 3NOBA 4TZGA 2Y0GA 1E0ZA 1ZW7A 2DENB 1XLPA 2CU1A 5DPHA 1QY3A 4PS7A 1ESFA 3HK0A 3ZUNA 3SVCA 3WAMA 4MGZE 2BBCA 2UU7A 1E6EB 3IT4B 2MHJA 1C76A 4IZNA 3C8YA 2VZKD 2FNJB 3NVZA 3M63B 3IAS1 2SAKA 3AEBB 4NQLB 1T0YA 5GXGB 2D10A 2GBNA 5FR6A 4US9A 4EDOA 2G45B 5CHWA 5C2TB 1YN3A 2WXRA 3R7RA 3NS8A 1GAQB 2FCMA 2JT4B 3B9JA 3W1CA 2G3QB 2WDVB 2O2VA 2IB6A 3WLCA 1UISA 1OQQA 3KLSX 4EZLA 5E6OA 4LW5A 4MH0E 4F1SA 4M8MA 4W9DA 1W7SA 1XCQL 4OVUA 1N5WA 4ZRQA 4FJVB 3DHHC 1E8YA 3SG4A 2CJOA 2D07B 3O65B 2INCC 1B9RA 1TZ1A 3DPDA 4HLEA 2EKIA 2QLHA 3DVGY 5TSSA 1JWUD 2KACA 4EFOA 4W6DA 3DQUA 3PRPB 4DXPA 4KZCA 1F0ZA 2DHZA 4KDIC 2D3BA 1T0SC 2WXJA 1MG4A 2DD9A 2N7EA 3JYUA 4LNOA 3M95A 4TMAB 4A20A 4GESB 3FILB 3KVFB 3Q3JA 3U8ZA 2B3AA 3I57A 5JHAA 4NQKE 2GX2A 3W9CB 1ISNA 2LGDA 2LGXA 1OEYA 1ZDXA 4B6WA 4K3CA 3T8MA 1TS2A 3MC9A 3RN9C 1BXTA 1SIFA 2KDIA 2MSED 5BMIA 2B3QA 2G4SA 2WXFA 1F1HA 4JF9A 3L16A 4KDLB 5EXBA 3V6EB 4XE0A 1V9JA 2NPTA 1JRPA 1XCTL 2BS3B 1RFAA 2DYMA 2KMMA 4DXOA 1C1YB 4BZAA 1N5XA 1TZOA 2K8CA 3URYA 2O2VB 4GLSC 4GF6B 3WAOA 1SEBD 3T3NA 4JFGA 2MJ3A 2WU5B 1FEHA 3QQ8B 4M02A 4JC2A 2G6YA 1RWSA 1UWMA 5DTZA 2GX0A 3UQBA 3BXAA 2NMQA 3TEZA 4W6NA 5L95C 4KKIA 1E7PB 2JZ3B 3AE9B 1STEA 1EMLA 4KW4A 4ZF4A 1OXDA 3GZNB 4W6CA 3U4EG 3ZUJA 2NTSA 1WGGA 3Q3OC 5DPTA 3UIPB 2ZNVC 2XN9C 2MWSB 3P4PB 1KTKA 1KYSA 4E3CA 2YEPF 3Q8CA 3SSTA 2WLBA 1SE2A 3DQFA 3ST2A 1XF5L 3ZDMC 2LZ6A 2OOBB 4WURA 2DAFA 3UG0A 3QC8B 3OJ4B 3NT9A 3V62A 4W72A 1AN8A 2K9XA 2OTEA 3NEZA 3U0NA 4W7XA 1SGHA 4OY4A 4JEOA 2J42A 3B0AA 1QZEA 1XLQA 2MEKA 2L00B 4N59A 1LQBA 3DQLA 3DBRI 3RMKC 5C1ZA 2KJ6A 1YQBA 3V3DA 2PMVA 1KFYB 3VFKA 2WDTB 1E8XA 2NPTB 2V4EC 1I4RA 1Q0WB 2LJIA 3ZUFA 1ZKHA 4Q7RA 3IXSA 3Q8AA 1EMGA 3LA1A 2WHIA 2DDDA 1BFPA 3EKJA 4ANXA 2IPKD 3BY4B 2ON8A 1RAXA 2CHWA 4HQ9A 3DQ1A 2IZVB 4AP4C 4DHZB 3SG3A 4II2B 2KLCA 2PVGC 2HGYA 4ANJA 3R7QA 2MBEA 2JSVX 3EECA 1N62A 2DBYA 1W7UA 2GBJA 1RRBA 5J2OA 2JRHA 3DQJA 1F0BA 2QHOA 2L52A 4LJDA 3B2FA 4PPJA 4DXIA 3VTUA 2MBBB 5DPSA 1I7HA 3WIMA 2G3OA 3U7ZA 1ET6A 2NCNA 2KHWB 3NVWA 3TMPB 2LFIA 3GE3C 4W6AA 2KKCA 3R2TA 4IC7B 5IOIA 2YEPB 1QYOA 3HM3A 4BOZB 1QKZA 4ANWA 4HKQA 5MPOA 3WCKA 2NVUI 3E5WA 1OGWA 4IW0A 2VH1A 2PE6B 1SE3A 3KCTA 1ZGPA 4Z4MA 2GMIC 3AEEB 3A8SA 3S2AA 3RNGC 1AWDA 4J6IA 3M24A 1IYFA 1S3SG 2WURA 2M17A 2C5LC 2BTEA 4P6VF 4C00A 4KW9A 1KRHA 2DYBA 1M4VA 1XXGA 4F8CB 1DGJA 1K53A 4JL9A 4L1BA 4TKNA 4HVBA 4W9LA 5AQBB 3SR6A 2W3RA 3QJZA 4IM2A 4B0EA 5LNK1 5EBJA 2JF5A 4MACA 3VTVA 3P8UA 4PPLA 3DOWA 4NAWA 4NPNA 1OXEA 2D3AA 4HEA1 2KN5A 1YD8U 4RYWA 4W6JA 1P7EA 4LCDE 2EMOA 1J7BA 1WRDB 2J0KA 1ZXHA 1Q1OA 2B3PA 4I2YA 3MTNB 3JVZX 1HA5A 2QDFA 3ZQ4A 1HXYD 1WE7A 2VVJA 1SJHD 2HJOA 4R6DA 1FXTB 4AS8A 1FNWA 3P1MA 3UI3A 1I4GA 2FUHB 3UQAA 2FIFA 2KAJA 3PVLA 4ZINA 3WA0A 3O13A 2L0TA 2WYQA 3DQIA 1VLBA 5D2MB 1OTRB 3ST4A 2ZZPB 1C78A 1M94A 4I6NB 5EDSA 5FVFA 4YTPB 3VUWA 1F09A 1C4PA 5J18A 3ZRFA 3GB3A 1KF6B 4BBNF 3P28A 4XL5A 5T3IA 1QOGA 2Y5PA 1D5ZC 4IK9A 5CHVC 3U2SC 2KFKA 4ORNA 1OEYJ 1Q73A 3U30A 2IY1B 3E56A 4AQ7A 3AH7A 4HJKA 1D6EC 3U52E 4AWJA 2HFCA 2QC8A 1UWXA 3BWUD 2WDRB 2Q6PA 4W9FA 1QT9A 3WLDA 3KUCB 3OWEB 1ACCA 1P1AA 2JQRB 3V05A 5EB6A 2PXWA 4HPMB 2W82A 2BF8B 2O6VB 2WXOA 1QQRA 3QAQA 4KF5C 3NZ3A 1T3QA 5T8IA 4ZIOA 2NBWB 4JLCA 3AEAB 4NAWB 3V61A 1TTNA 3VR8B 4EZJA 5JXVA 1P0RA 2BVCA 4XDCA 4RTCA 4W6OA 2N9XA 1EMFA 3IFWB 3VDZA 1FXIA 1WXQA 3OSRA 5L83A 1TKYA 1YJJA 2HCGA 1HTOA 2JVCA 2ZO7A 3ONSA 5LXIB 4EEWA 3NG0A 5EE9A 2ZJDA 3QHTA 2KYWA 2DUIA 2KMCA 4FBJB 3DQMA 2V4IB 2BQQA 3GE8C 4KPIA 2K5PA 2A52B 2INPE 5FK9C 4YSXB 4W6FA 3AE3B 1GC7A 3DBRB 1YJFA 2IY0B 1OQYA 2H5PA 1UGJA 1Q4CA 4ZRKA 3PLVA 4W7EA 4AS1A 2H88B 3SRYA 1S6ZA 2WISA 3BXCA 3CSFA 2G6EA 2J7QB 2KFKB 5BO4B 2O2BA 2K39A 2A50B 2WXPA 3RUIB 4A3OA 3RZWC 3TL5A 1UZXB 2JPHA 5J17A 2WXIA 1V97A 2BYVE 4HJGE 5DPRA 1WMHA 1YHHA 1ZGOA 4HVFA 1HEZE 4UDUC 3I9V1 2OJKA 5AEKB 4TUUA 5E6JA 3DQVA 4NAMA 1C9FA 4GGQA 3ENEA 3BYYB 1WI0A 3Q14C 4Q9WA 4W75A 3KYCD 2MQJA 1Q4BA 3SSHA 1NI2A 2KFJA 1TY2A 2QSDA 3IT6B 4AR7A 2CKHB 1ZOYB 2HD5B 4GDLA 4K81A 4W7DA 4LJCA 1EMEA 2DD7A 5F9GA 2N0SB 3DDCB 2DZKA 1XQQA 4IWPA 1WR1A 4YT0B 3WCQA 2ZEQA 2WXQA 1FFUA 4HCNB 3LXFA 1SE9A 2LVQA 4GDKA 2WGSA 2N9PC 3A33B 2A56B 5IN7A 2J0MA 2MRPA 3A9KA 3CWIA 1Q4AA 3APCA 4C7YA 1G6JA 4EOYA 4WWOA 2KK8A 1EUVB 2LVOA 2KWDA 3J9CA 4IK1A 3V6CB 1QYQA 3SSLA 2PXSA 2QILA 3ABVB 2KDFB 1QXTA 3LDZE 4RH6A 2LASA 3PREA 2G3DB 1Z2MA 2N1VA 1Y56A 4LLGM 4L1IA 1D5MC 2ZW0A 3L08A 2BYTA 1F77A 5IP4D 4W7RA 5EXCI 2GBMA 4RNAA 4FJYA 2M0XA 1I4QA 4P16A 4GN1A 4TSSA 2ACZB 2BKFA 4HQCA 4BKTA 3QK0A 2Q5WD 2RDBC 4KVGB 1L4DB 4ARIA 1T5XD 1EMKA 4RM8A 4GXBA 4YTNB 2O6VD 1WMHB 1NI3A 4II3B 1GGXA 4IK4A 3NF0A 2AQ1B 4BKSD 4FA6A 1RMMA 1IBXA 5AUIA 2L32A 1L7YA 3X23A 5BYRA 2V0GA 1WXSA 3N30A 3AI5A 3TMTA 2MBQA 1RRXA 4IOIE 4ZRIA 4LJOB 4W6RA 4IM3A 4GDLB 4Q9XA 5IO9A 1SXTA 4G3XB 4MSMB 2L76A 2IDYA 1WGRA 1MI0A 1E8ZA 3ZDTA 5LLIA 4MGIE 1R4MI 3P4QB 3K1KA 1WGKA 1LFDA 3P42A 1J7AA 2WSNA 1SB3C 3PO0A 2WXNA 4GDKB 4ZHPA 2LRUA 3RNCC 4DDID 2Z8LA 1BUIC 4P7IA 3A9KB 4TV3A 2BKRB 2N9LA 1WM3A 3SG7A 4W7AA 1H8CA 3D32A 5BMHA 2M56B 2JADA 2C7NB 3PZ7A 3DCGA 4A55A 4A90A 3PJBA 2UYZB 3ZJUA 2DLBA 2PW9A 4B30B 4R3DA 2R2QA 3FC4A 3A4SC 1TS4A 3O77A 1F9JA 1MVKA 2XEWA 3DBLB 4KV2A 3QWZB 2BB5A 4KAGA 5KHQA 3CFFA 3DQ4A 2D3CA 4KKJA 2AWKA 2RDGA 1VR9A 1SSNA 1FO4A 3IAM1 2ARLA 5BT0A 3Q2AC 3ZTFA 1VZ8A 2NR2A 4KF4A 3OJ3A 2AWJA 2RR9A 1W7TA 2WS3B 5HZSA 4L13A 2IJ0A 3I63C 1LM8B 2IGGA 4S17A 2CHZA 3PHWB 1IBXB 3NEDA 1XLOA 1FIQA 4YTMB 1V8CA 3TEWA 5FVGA 1JWAD 1R4NB 2UWQA 1J0GA 4H3NA 2C9IA 3WANA 1E10A 1UF0A 3H8HA 3ZXRA 3EFCA 2BS2B 1P9DU 3W5VB 2Z6YA 4HPPA 2K0PA 5DU0A 1GUAB 4Q7UA 4WQMA 3M22A 4RFBA 3BINA 1TIFA 5DTXA 3DQ5A 4K3BA 2BT6A 2WX0A 2EKEC 4CO7A 4DK5A 1NYRA 3H7PA 1T0RC 1H4UA 2YDZA 2HQZA 2LUEA 4W6UA 5G2NA 3CGLA 3PIBA 4DKMA 3OGOA 2V4EA 1E7VA 4G50A 3KWVA 4W7FA 3DWMA 2QT2A 2VVHA 2I1KA 4EKUA 2VZXA 1OXFA 4W6KA 1FNVA 2V9HA 1E5WA 3ZNGC 5G55A 2PVOD 3AMZA 1HZ6A 3DBHI 3QIJA 3FAHA 5CX3A 1BMLC 2GBKA 4N58A 4YL8A 4PPKA 3RNEC 2HGDA 4KSKC 1WGDA 3N32A 1WRIA 2PLPA 3SVRA 2FAZA 3AB5A 4JPSA 3PZDA 3MC0B 1KM7A 2J52A 2LGYA 1WZ0A 1TKGA 3DPXA 2W55A 3VH3B 2ZNVB 1HZ5A 4L23A 1NBFC 4HDOA 3AXCA 3AEDB 3MHZA 2DUHA 4WQOB 3ADFA 3CF6E 3AEFB 4W6SA 3K9OB 4JE3B 1Q4EA 3DQ3A 3H9DA 3JSVA 1EF1A 2G5ZB 1QOBA 4DQOC 3NZUA 3Q69A 3IVFA 5EB7A 5G5HA 2INNE 2RPVA 4MSQB 2J4XA 3HHMA 3H7PB 4RCOA 1JC0A 2MBHA 1FNUA 3OSQA 4XGAB 4EULA 3N20C 1YOVB 3V3XA 1IPGA 4ZB1A 5D3IB 2V4EB 1WY8A 1YZWA 1RFKA 2OHFA 1P98A 1WX8A 3SDLC 4URKA 3L0WB 1PUTA 2QLIA 1V2YA 1VD2A 1NEKB 5JHBA 1TT5B 1PQSA 2DNFA 2PJHA 2RGFA 4EDSA 2KVZA 3ZJTA 4NJ6A 5FVIA 3L13A 1P3QU 1FD6A 1ZUXA 2RPQA 3WAPA 4P1BC 3A4RA 3NS1A 1FMAD 2FUG1 5LTQA 3LSAA 3EVVA 2PIAA 3QA8A 3Q8EA 3DBSA 3HM6X 2HQKA 4W9KA 1L2NA 1Z1QA 3SS0A 4OJ0A 4OW0A 1WJ4A 3GP7A 3VUYA 1YJ1A 2G1EA 1EWYC 5GMVA 5DPWA 4PS3A 1XSSA 2WX1A 4US8A 4W6HA 4W6IA 1YNTE 3SSVA 1ET9A 1F2RC 3KCSA 2G6XA 4ZHOA 2LGIA 4G0NB 3LS3A 3W1DA 2K22A 2Z0DB 3AM9A 2JWZA 1CMXB 5C23A 1MOVA 3DHIC 2WXGA 2IO3B 1CV7A 2JY6A 1A70A 3CMMB 2QEJC 2Y5CA 2MLBA 3JSVB 5KTGA 4KA9A 4FLHA 3SV5A 2WSOA 3GB1A 4F7ZA 1FFVA 2EMDA 1JW9D 2I2YA 3ED8A 1UH6A 1JMLA 5D6JB 1EMAA 4NNJB 2MH7A 1KH0A 2CR5A 4CYEA 1HQRD 1TJEA 3AE4B 1K8RB 3PT2B 3R66C 4K1RB 1RM9A 3KH0A 1HE8A 3RWAA 4ZBLA 4WH4A 3V60A 3SVDA 5DQBA 3U0KA 4FHKA 3T3OA 1DOYA 3ZULA 2CS4A 1JC1A 3BVZA 1R7SA 2O6VA 2XK5A 3R2IA 4BKSA 2JXXA 5EXUA 2D2QA 3Q3MC 3KQ4A 4LNIA 2ZPNA 4WWNA 4FN2A 3PV1A 3ZLZA 3B08A 1KJTA 3SG5A 2AYOB 3DQCA 1EMBA 3ETRA 2IO1B 4OHJA 3KUDB 3I5JC 5BMGA 2HDEA 2LD9A 3UIOB 4EZKA 1E8WA 3DVGX 2YLMA 2WP9B 5AZHA 3VVWB 2V3NA 3N3KB 4W6MA 4K7SA 4I6LB 2MJDA 4ICVA 2W9NA 3SVNA 2N1WA 3APDA 1QF6A 2KO3A 1V49A 1FRDA 3NY5A 1YFPA 2FCQA 3W1YA 4IDIA 4BFRA 4Q7TA 2DUEA 1UBQA 2JX5A 4JGEA 3S05A 4WWMA 2MP2A 2L1AA 3MP9A 2POXA 5JZEB 2X38A 4H47A 4HE4A 2QJLA 1SIJA 4W9CA 3UF8A 1GB4A 4TQ1A 1JROA 3B1LX 4W69A 1VRAB 2DWQA 4W74A 4YSZB 1AYFA 4NJCA 3ZO5B 3I19A 4ZF5A 2DZMA 3UGBB 4KSLC 3L54A 3MJWA 2N7JA 3ZNHB 3BXBA 4FHJA 1JWMD 3ZTCA 2X8XX 4DKNA 1TS3A 4ANVA 2N4FA 2XK5B 2IGHA 1Z5SB 3ECIA 3L4PA 2QCZA 1WJUA 3H7SA 1TBEA 3OG5A 1D4BA 4P1QA 2PE9A 3MHSD 3TCAA 3E9SA 3MFGA 1GOZA 1WXAA 1MOUA 4H3MA 2JYEA 2XBBC 3U0LA 2SEBD 4C4VA 1WH3A 2KANA 3EKHA 3UINB 3SVBA 2WHUA 2GI9A 3I3TB 1FCLA 1UELA 4JQWC 4X57B 1XMZA 1B1ZA 3PSEB 2JWUA 5DY6A 1L6UA 3DQ2A
chains in the Genus database with same CATH topology
2KDEB 3SVOA 3LJ3A 2QU1A 4IK8A 4E71A 3RZFA 2KC2A 3U0MA 2N7DA 2Z1OA 1HUYA 1LXDA 4OHSA 3A1QA 1JBZA 2MP2B 3CFHA 1XAEA 5EJUA 2ZCCA 3VH4B 3ZNID 5HZOA 3AULA 2VADA 3ZNZB 2JZZA 4WJPA 3CD1A 2RSUA 3PRZA 4PS8A 1JBYA 1BT0A 1YHIA 2Z6ZA 4RMAA 3TBLD 2YE0A 2D3GA 1YX5B 2A4ZA 2DAJA 1V5OA 4NWSA 3M62B 2JUOA 4IWQA 2HRSA 4IG7B 4AUQC 4PYUA 3SG2A 3G9AA 3PTFC 2Y5BB 2ZVNA 2I1JA 3KYDD 1EMCA 2J0JA 3DQ8A 5DCNA 1GC6A 2AWLA 3DPWA 4FULA 2WWZA 1D3ZA 3T9LA 3VQIA 2K8BA 4B5YA 4H3LA 3A9JA 2ZMUA 3QX1A 5IAAC 4DDGD 4B95A 4HQ8A 1E90A 4B30A 1NDDA 3GJ1A 1C3TA 4XOWA 3H1OA 3IR8A 1ZGUB 3VHTC 1A5RA 3CD9A 4GIVA 3A1QB 2HJ8A 2KQSA 2MA9B 2M1MA 3IG3A 3RWTA 3EK7A 1KLVA 1YJ2A 4JIOU 1WXMA 2KOXA 4HK2A 4DBGA 3PJ5A 3DVNV 1WJ6A 5HZTA 2BGFA 3ML8A 3H6NA 1J8CA 2KWVB 4ZRJA 2K1FA 1I42A 2ASQA 2QLEA 4BOSC 2KMAA 3L10B 3ML9A 3U8PA 4H48A 4WWPA 2VAEA 1WXVA 4W6BA 5HZUA 2A46A 2H8QA 3C0RB 2EMSA 4IWOA 5DTLA 5HBDA 3GJ2A 3DQHA 4DHJB 4BKGA 1KP5A 3VTWA 1I35A 2IBIB 3E5TA 2EMTA 4CHKA 4DXNA 1G7KA 2QZ0A 3RULA 3O78A 3LF3A 5J2RA 1WM2A 5LTPA 3X0WA 4P76A 4XVPA 3ZVVA 1EO6A 5DPGA 5HW9A 2IOVA 3EVRA 2KTFA 2LXCA 1WE6A 3A9JB 4LJPB 5HGEA 4JRBA 4I6PA 3PPAA 3EC8A 2FL1A 4W6LA 4KW8A 5CHFA 4AOFA 1GG3A 1V5TA 3EK4A 4W9IA 2M8SA 3DQOA 3PRMB 3CFAA 4IK3A 2KXJA 2HTHA 3GOEA 4XX5A 3W1SC 4GOBA 2QLGA 4TZAA 3U8CA 2GW3A 2OJRA 5E6NA 4W6PA 4XC2A 1GFLA 1WFYA 4PYZA 1GNUA 3U8AA 4AJWA 2QRFA 3SVEA 3DQDA 2O29A 1X1MA 4EUTA 5BQLA 2VRRB 2AWTA 2WHTA 2YE1A 5DRFA 4HXDA 1YHGA 2IO2B 2V4LA 3TMRA 3TJPA 3U7DA 4KZ0A 3AI4A 3EVPA 4FADA 3DQKA 2DZIA 2C7HA 2KWCA 1WF9A 4IM0A 4JGHB 4GSWA 5DPIA 3CB9A 3R3MA 1UD7A 4J8AA 5AZGA 5TR5A 1V80A 2MX2A 4ASWC 4MEMA 4A3PA 2CHXA 3ZW3A 2AWMA 2IYDB 2FCNA 2QLGB 2HPWA 3RT3B 2DX5B 4ANUA 4DHJD 1GJZA 4HPLB 4W73A 2LVPA 2JRIB 4N9F4 4N3DA 3RYTA 2G2SB 2BWES 2RH7A 2DUGA 2AEHA 3H1UA 2ZPYA 3TIXA 2OKYA 1WX7A 3PGEA 3OLMD 2KZRA 3JW0X 4LQUA 3SD5A 4J89A 1UBIA 2PPHA 1V86A 2C60A 4G11A 5AZFA 3ZKJC 5D7GA 4HWIB 1WZ3A 3GL4A 3VUXA 2PEAA 3LVDA 2L8JA 2Z6XA 4OVVA 2YVCA 2GOWA 3SHQA 3ZTDA 5JH5C 4RYSA 2DZJA 2NS5A 2C9WB 2H6VA 2L05A 1UGMA 1E7UA 2KDBA 3SSPA 3GEXA 2KD0A 2G16B 4ICUA 5FHVA 2A54B 4W9EA 2REXA 5H89A 3UFZA 4LJBA 4UTSA 4KIKA 5LK4A 2Z0EB 1WYWB 4W9JA 5LXHA 3H1RA 1YIWA 2IO0B 2P4MA 2K25A 3ZIMA 5D94A 4NY0A 3VK1A 3PJ7A 5DPJA 2MW5A 2LJ5A 1MG8A 4IK5A 2KVRA 2DYOA 4L12A 2AL3A 4BVUC 2BPSA 2NBUA 4IUMB 2KQ7A 2L7RA 4DXQA 2BYFA 3DQEA 4M8NA 4ZYNA 2ICRA 4KF5A 3P2BA 4ZF3A 4W9GA 4MGKE 1KOTA 3AKOA 3ZRCA 1WX9A 2C7MB 4E74A 5H87A 2WHSA 2EMNA 5DRGA 3OAWA 5IA7A 1Q5WB 3PLUA 4MELA 1C4FA 2G4DB 3PS6A 1H6RA 1EMMA 5HKHA 1XA9A 1ZGQA 4GU2A 4W6TA 4WJNA 4TQ0A 3VICA 4MDKE 5LTRA 4KIKB 5E6PA 4MJSA 4W6GA 4DHZE 4DXMA 3EK8A 3M3JA 5EHUA 1TGZB 3SU8X 3RCZA 2OGRA 3DQAA 1V81A 4AJYB 2RD0A 2FIDA 4LJDC 1VCBA 3E5VA 4KEXA 1YX6B 3PHXB 4KGEA 2IB5A 1QYFA 2DDCA 5BTTA 2FZUA 1WGHA 3EVUA 3LF4B 2A5UA 2M4NA 2A48A 1HCJA 2LRWA 4KGFA 2L3ZA 2L0FA 2OTBA 2KLGA 2MBOA 1Q4DA 2H5RA 4U2VA 4OQWA 3LVAA 3ST0A 2KX3A 3DQ6A 3DBLI 1RLFA 4EN1A 4XGYA 3BX9A 4ZFSA 1WGYA 3IP2A 2K6QA 4LDTB 4W77A 2BYEA 1U4AA 3SG6A 3K9PB 2ZCBA 3VHTA 4M0WB 2N9EB 1Y8RC 3WALA 2O24A 4GMVA 2A53B 1RMPA 3KUZA 4WAAA 3SSKA 2H5OA 2GW4B 2FWQA 4WJQA 3NZSA 3DQ7A 1WR6E 4MJSB 5KHOA 4MM3A 1B9CA 3IHPC 1V6EA 2FCSA 4B9KA 2Q57A 4LQTA 1R4NI 3VXWA 4W9HA 1KYRA 4BDUA 4NJ7A 3CSTA 1JRUA 3QARA 2MCNB 2LI5A 5DQMA 2GBRA 4OGSA 1XD3B 1MYWA 3L17A 3KW5B 4BBNC 2VVIA 1GL4A 3SVSA 5BTTB 1WIAA 2KX0A 2K6DB 4EMQA 2Z59B 4W7CA 2D11A 1WJNA 1KYPA 4W76A 1Z1PA 2LXAA 4R6BA 2K8HA 4ZDVA 4DWFA 2H9WA 2KTRA 4J88A 3SSYA 2OKWA 3VAWA 2AL6A 2YFPA 1H4RA 1EF5A 3APFA 2NBVB 3EFUA 2WIQA 3QCAA 3ST3A 3NT3A 1RMOA 5H88A 3DQNA 2KJHB 3LVCA 1IP9A 2DUFA 3VHTB 1J19A 2AH8A 3RD2A 4DXAB 4XZ4A 2H5QA 3GZNI 2LWPA 3AU4A 3Q3FA 4XOVA 2KNBA 2BWFA 3SVUA 3AU5A 3W1SA 4WJOA 2KJRA 1S1QB 2A47A 4GOCA 2BTJA 4RM9A 4HDQA 3EHVA 4K7UA 1AARA 3IBEA 3DVNU 2KC1A 2C9JA 2V3SA 3DQ9A 2ZO6A 5DTYA 3HIZA 4MGYE 2ZVOA 5CTRC 3MGFA 3ALBA 4GB9A 2KTRB 2ZMWA 3DPZA 3CBEA 2V1YA 2HE7A 4Z4KA 3NHEB 4K7WA 1XT9B 2R2OA 4LDTD 2KWUB 4PFEA 4FJZA 4HCPB 1XQMA 2AHAA 2IE2A 3NOBA 4TZGA 2Y0GA 1ZW7A 2DENB 2CU1A 5DPHA 1QY3A 4PS7A 3HK0A 3ZUNA 3SVCA 3WAMA 4MGZE 4IZNA 2FNJB 3M63B 4NQLB 1T0YA 2D10A 2GBNA 5FR6A 4EDOA 2G45B 5CHWA 3R7RA 3NS8A 2FCMA 2JT4B 3W1CA 2G3QB 2O2VA 2IB6A 3WLCA 1UISA 4EZLA 5E6OA 4LW5A 4MH0E 4F1SA 4M8MA 4W9DA 1W7SA 4OVUA 4FJVB 1E8YA 3SG4A 2D07B 3O65B 1TZ1A 3DPDA 4HLEA 2QLHA 3DVGY 4EFOA 4W6DA 3DQUA 3PRPB 4DXPA 4KZCA 2DHZA 4KDIC 2DD9A 2N7EA 3JYUA 3M95A 4A20A 4GESB 3KVFB 3Q3JA 3U8ZA 2B3AA 5JHAA 4NQKE 2GX2A 1ISNA 2LGDA 2LGXA 1OEYA 4B6WA 3T8MA 1SIFA 2KDIA 2MSED 2B3QA 2G4SA 4JF9A 3L16A 4KDLB 5EXBA 3V6EB 1V9JA 2NPTA 1RFAA 2DYMA 4DXOA 1C1YB 2K8CA 2O2VB 3WAOA 4GF6B 4JFGA 3QQ8B 4JC2A 2G6YA 5DTZA 2GX0A 3UQBA 3BXAA 4W6NA 5L95C 2JZ3B 1EMLA 4KW4A 4ZF4A 1OXDA 4W6CA 3ZUJA 1WGGA 5DPTA 3UIPB 2ZNVC 2MWSB 1KYSA 4E3CA 3SSTA 3DQFA 3ST2A 3ZDMC 2LZ6A 2OOBB 2DAFA 3UG0A 3QC8B 3OJ4B 3NT9A 3V62A 4W72A 2OTEA 3NEZA 3U0NA 4W7XA 1SGHA 4OY4A 4JEOA 3B0AA 1QZEA 2L00B 1LQBA 3DQLA 3DBRI 5C1ZA 2KJ6A 1YQBA 3V3DA 3VFKA 2WDTB 1E8XA 2NPTB 2V4EC 1Q0WB 3ZUFA 1ZKHA 4Q7RA 1EMGA 3LA1A 2DDDA 1BFPA 3EKJA 4ANXA 3BY4B 1RAXA 2CHWA 4HQ9A 3DQ1A 2IZVB 4AP4C 4DHZB 3SG3A 4II2B 2KLCA 2HGYA 4ANJA 3R7QA 2MBEA 3EECA 1W7UA 2GBJA 1RRBA 5J2OA 2JRHA 3DQJA 1F0BA 2QHOA 4LJDA 4PPJA 4DXIA 3VTUA 2MBBB 5DPSA 3WIMA 2G3OA 2NCNA 2KHWB 3TMPB 4W6AA 2KKCA 4IC7B 1QYOA 3HM3A 4BOZB 4ANWA 3WCKA 2NVUI 3E5WA 1OGWA 4IW0A 2PE6B 3KCTA 1ZGPA 4Z4MA 2GMIC 3A8SA 3S2AA 4J6IA 3M24A 1IYFA 1S3SG 2WURA 2M17A 2C5LC 4KW9A 2DYBA 4F8CB 4JL9A 4TKNA 4HVBA 4W9LA 5AQBB 3QJZA 4IM2A 5EBJA 2JF5A 3VTVA 3P8UA 4PPLA 3DOWA 4NAWA 4NPNA 1OXEA 2KN5A 1YD8U 4RYWA 4W6JA 4LCDE 2EMOA 1WRDB 2J0KA 1Q1OA 2B3PA 4I2YA 3MTNB 3JVZX 1WE7A 2VVJA 2HJOA 4R6DA 1FXTB 4AS8A 2FUHB 3UQAA 2FIFA 3PVLA 4ZINA 3WA0A 2L0TA 2WYQA 3DQIA 5D2MB 1OTRB 3ST4A 2ZZPB 1M94A 4I6NB 5EDSA 5FVFA 3VUWA 1F09A 5J18A 3ZRFA 3GB3A 4BBNF 3P28A 4XL5A 5T3IA 4IK9A 5CHVC 2KFKA 4ORNA 1OEYJ 1Q73A 3U30A 2IY1B 4HJKA 4AWJA 2HFCA 2Q6PA 4W9FA 3WLDA 3KUCB 1P1AA 5EB6A 2PXWA 4HPMB 2BF8B 2O6VB 3QAQA 4KF5C 4ZIOA 2NBWB 4JLCA 4EZJA 4NAWB 3V61A 1TTNA 1P0RA 4RTCA 4W6OA 2N9XA 1EMFA 3IFWB 3VDZA 3OSRA 5L83A 2HCGA 2JVCA 2ZO7A 3ONSA 5LXIB 4EEWA 2ZJDA 3QHTA 2DUIA 2KMCA 4FBJB 3DQMA 4KPIA 2A52B 4W6FA 1GC7A 1YJFA 2IY0B 1OQYA 2H5PA 1Q4CA 4ZRKA 3PLVA 4W7EA 3SRYA 1S6ZA 2WISA 3BXCA 3CSFA 2G6EA 2J7QB 2KFKB 5BO4B 2O2BA 2K39A 2A50B 4A3OA 3RUIB 3RZWC 3TL5A 1UZXB 2JPHA 5J17A 2BYVE 5DPRA 1WMHA 1YHHA 1ZGOA 4HVFA 2OJKA 5AEKB 4TUUA 3DQVA 4GGQA 3ENEA 1WI0A 4Q9WA 4W75A 3KYCD 2MQJA 1Q4BA 3SSHA 1NI2A 2KFJA 4AR7A 2CKHB 2HD5B 4GDLA 4K81A 4W7DA 4LJCA 1EMEA 2DD7A 5F9GA 3DDCB 2DZKA 1XQQA 4IWPA 1WR1A 2ZEQA 4HCNB 1SE9A 2LVQA 4GDKA 2N9PC 3A33B 2A56B 2J0MA 2MRPA 3A9KA 1Q4AA 3APCA 1G6JA 4EOYA 4WWOA 2KK8A 1EUVB 2LVOA 4IK1A 3V6CB 1QYQA 3SSLA 2PXSA 2KDFB 1QXTA 3LDZE 2LASA 3PREA 2G3DB 1Z2MA 2N1VA 4L1IA 3L08A 4W7RA 5EXCI 2GBMA 4FJYA 2M0XA 4GN1A 2BKFA 4HQCA 4BKTA 3QK0A 4KVGB 1EMKA 4RM8A 4GXBA 2O6VD 1WMHB 4II3B 1GGXA 4IK4A 3NF0A 4BKSD 4FA6A 1RMMA 1L7YA 3X23A 1WXSA 3N30A 3AI5A 3TMTA 2MBQA 1RRXA 4ZRIA 4LJOB 4W6RA 4IM3A 4GDLB 4Q9XA 4G3XB 4MSMB 2L76A 1WGRA 3ZDTA 1E8ZA 5LLIA 4MGIE 1R4MI 3K1KA 1LFDA 2WSNA 4GDKB 2LRUA 4DDID 4P7IA 3A9KB 4TV3A 2BKRB 1WM3A 3SG7A 4W7AA 1H8CA 3D32A 2JADA 2C7NB 3DCGA 3PJBA 2UYZB 4B30B 2R2QA 3A4SC 3O77A 1F9JA 2XEWA 4KV2A 3QWZB 4KAGA 5KHQA 3CFFA 3DQ4A 2AWKA 2ARLA 5BT0A 3ZTFA 2NR2A 4KF4A 3OJ3A 2AWJA 2RR9A 1W7TA 5HZSA 4L13A 1LM8B 2CHZA 3PHWB 3NEDA 5FVGA 2UWQA 1J0GA 4H3NA 2C9IA 3WANA 1P9DU 2Z6YA 5DU0A 1GUAB 4Q7UA 3M22A 3BINA 5DTXA 3DQ5A 2WX0A 2EKEC 4CO7A 4DK5A 3H7PA 1H4UA 2YDZA 2HQZA 2LUEA 4W6UA 5G2NA 3CGLA 3PIBA 4DKMA 3OGOA 2V4EA 1E7VA 4G50A 4W7FA 2QT2A 2VVHA 2I1KA 4EKUA 2VZXA 1OXFA 4W6KA 1E5WA 3ZNGC 5G55A 3DBHI 3QIJA 5CX3A 2GBKA 4YL8A 4PPKA 2HGDA 4KSKC 1WGDA 3N32A 3SVRA 2FAZA 3PZDA 1KM7A 2LGYA 1WZ0A 3DPXA 3VH3B 2ZNVB 1NBFC 4HDOA 3AXCA 2DUHA 4WQOB 3ADFA 3CF6E 4W6SA 3K9OB 1Q4EA 3DQ3A 3H9DA 3JSVA 1EF1A 2G5ZB 3NZUA 3IVFA 5EB7A 4MSQB 3HHMA 3H7PB 1JC0A 2MBHA 3OSQA 4EULA 1IPGA 4ZB1A 2V4EB 1WY8A 1YZWA 1P98A 1WX8A 3SDLC 4URKA 3L0WB 2QLIA 1V2YA 1VD2A 5JHBA 2PJHA 1PQSA 2RGFA 4EDSA 4NJ6A 5FVIA 3L13A 1P3QU 1ZUXA 2RPQA 3WAPA 3A4RA 5LTQA 3LSAA 3EVVA 3QA8A 3DBSA 3HM6X 2HQKA 4W9KA 1L2NA 1Z1QA 3SS0A 4OJ0A 1WJ4A 3VUYA 1YJ1A 5GMVA 5DPWA 4PS3A 1XSSA 2WX1A 4W6HA 4W6IA 3SSVA 3KCSA 2G6XA 4G0NB 3LS3A 3W1DA 2Z0DB 2JWZA 1CMXB 5C23A 1MOVA 2IO3B 1CV7A 2JY6A 3CMMB 2MLBA 3JSVB 5KTGA 4KA9A 4FLHA 3SV5A 2WSOA 4F7ZA 2EMDA 3ED8A 1UH6A 5D6JB 1EMAA 4NNJB 2CR5A 4CYEA 1K8RB 3PT2B 3R66C 4K1RB 1RM9A 3KH0A 1HE8A 3RWAA 4ZBLA 3V60A 3SVDA 5DQBA 3U0KA 4FHKA 3ZULA 2CS4A 1JC1A 2O6VA 2XK5A 4BKSA 2JXXA 5EXUA 2D2QA 2ZPNA 4WWNA 4FN2A 3PV1A 3ZLZA 3B08A 1KJTA 3SG5A 2AYOB 3DQCA 1EMBA 2IO1B 3KUDB 2LD9A 3UIOB 4EZKA 1E8WA 3DVGX 2YLMA 3VVWB 5AZHA 3N3KB 4W6MA 4K7SA 4I6LB 4ICVA 2W9NA 3SVNA 2N1WA 3APDA 2KO3A 1V49A 3NY5A 1YFPA 2FCQA 3W1YA 4BFRA 4Q7TA 2DUEA 1UBQA 4JGEA 3S05A 2MP2A 2POXA 5JZEB 4H47A 4HE4A 4W9CA 3UF8A 4TQ1A 3B1LX 4W69A 4W74A 3ZO5B 3I19A 4ZF5A 2DZMA 3UGBB 4KSLC 3L54A 3MJWA 3ZNHB 3BXBA 4FHJA 3ZTCA 4DKNA 4ANVA 2N4FA 2XK5B 1Z5SB 3ECIA 1WJUA 3H7SA 1TBEA 4P1QA 2PE9A 3MHSD 3TCAA 1WXAA 1MOUA 4H3MA 2XBBC 3U0LA 1WH3A 2KANA 3EKHA 3UINB 3SVBA 2WHUA 3I3TB 1UELA 4JQWC 4X57B 1XMZA 3PSEB 5DY6A 3DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDE B;  3SVO A;  3LJ3 A;  2QU1 A;  4IK8 A;  4E71 A;  3RZF A;  2KC2 A;  3U0M A;  2N7D A;  2Z1O A;  1HUY A;  1LXD A;  4OHS A;  3A1Q A;  1JBZ A;  2MP2 B;  3CFH A;  1XAE A;  5EJU A;  2ZCC A;  3VH4 B;  3ZNI D;  5HZO A;  3AUL A;  2VAD A;  3ZNZ B;  2JZZ A;  4WJP A;  3CD1 A;  2RSU A;  3PRZ A;  4PS8 A;  1JBY A;  1BT0 A;  1YHI A;  2Z6Z A;  4RMA A;  3TBL D;  2YE0 A;  2D3G A;  1YX5 B;  2A4Z A;  2DAJ A;  1V5O A;  4NWS A;  3M62 B;  2JUO A;  4IWQ A;  2HRS A;  4IG7 B;  4AUQ C;  4PYU A;  3SG2 A;  3G9A A;  3PTF C;  2Y5B B;  2ZVN A;  2I1J A;  3KYD D;  1EMC A;  2J0J A;  3DQ8 A;  5DCN A;  1GC6 A;  2AWL A;  3DPW A;  4FUL A;  2WWZ A;  1D3Z A;  3T9L A;  3VQI A;  2K8B A;  4B5Y A;  4H3L A;  3A9J A;  2ZMU A;  3QX1 A;  5IAA C;  4DDG D;  4B95 A;  4HQ8 A;  1E90 A;  4B30 A;  1NDD A;  3GJ1 A;  1C3T A;  4XOW A;  3H1O A;  3IR8 A;  1ZGU B;  3VHT C;  1A5R A;  3CD9 A;  4GIV A;  3A1Q B;  2HJ8 A;  2KQS A;  2MA9 B;  2M1M A;  3IG3 A;  3RWT A;  3EK7 A;  1KLV A;  1YJ2 A;  4JIO U;  1WXM A;  2KOX A;  4HK2 A;  4DBG A;  3PJ5 A;  3DVN V;  1WJ6 A;  5HZT A;  2BGF A;  3ML8 A;  3H6N A;  1J8C A;  2KWV B;  4ZRJ A;  2K1F A;  1I42 A;  2ASQ A;  2QLE A;  4BOS C;  2KMA A;  3L10 B;  3ML9 A;  3U8P A;  4H48 A;  4WWP A;  2VAE A;  1WXV A;  4W6B A;  5HZU A;  2A46 A;  2H8Q A;  3C0R B;  2EMS A;  4IWO A;  5DTL A;  5HBD A;  3GJ2 A;  3DQH A;  4DHJ B;  4BKG A;  1KP5 A;  3VTW A;  1I35 A;  2IBI B;  3E5T A;  2EMT A;  4CHK A;  4DXN A;  1G7K A;  2QZ0 A;  3RUL A;  3O78 A;  3LF3 A;  5J2R A;  1WM2 A;  5LTP A;  3X0W A;  4P76 A;  4XVP A;  3ZVV A;  1EO6 A;  5DPG A;  5HW9 A;  2IOV A;  3EVR A;  2KTF A;  2LXC A;  1WE6 A;  3A9J B;  4LJP B;  5HGE A;  4JRB A;  4I6P A;  3PPA A;  3EC8 A;  2FL1 A;  4W6L A;  4KW8 A;  5CHF A;  4AOF A;  1GG3 A;  1V5T A;  3EK4 A;  4W9I A;  2M8S A;  3DQO A;  3PRM B;  3CFA A;  4IK3 A;  2KXJ A;  2HTH A;  3GOE A;  4XX5 A;  3W1S C;  4GOB A;  2QLG A;  4TZA A;  3U8C A;  2GW3 A;  2OJR A;  5E6N A;  4W6P A;  4XC2 A;  1GFL A;  1WFY A;  4PYZ A;  1GNU A;  3U8A A;  4AJW A;  2QRF A;  3SVE A;  3DQD A;  2O29 A;  1X1M A;  4EUT A;  5BQL A;  2VRR B;  2AWT A;  2WHT A;  2YE1 A;  5DRF A;  4HXD A;  1YHG A;  2IO2 B;  2V4L A;  3TMR A;  3TJP A;  3U7D A;  4KZ0 A;  3AI4 A;  3EVP A;  4FAD A;  3DQK A;  2DZI A;  2C7H A;  2KWC A;  1WF9 A;  4IM0 A;  4JGH B;  4GSW A;  5DPI A;  3CB9 A;  3R3M A;  1UD7 A;  4J8A A;  5AZG A;  5TR5 A;  1V80 A;  2MX2 A;  4ASW C;  4MEM A;  4A3P A;  2CHX A;  3ZW3 A;  2AWM A;  2IYD B;  2FCN A;  2QLG B;  2HPW A;  3RT3 B;  2DX5 B;  4ANU A;  4DHJ D;  1GJZ A;  4HPL B;  4W73 A;  2LVP A;  2JRI B;  4N9F 4;  4N3D A;  3RYT A;  2G2S B;  2BWE S;  2RH7 A;  2DUG A;  2AEH A;  3H1U A;  2ZPY A;  3TIX A;  2OKY A;  1WX7 A;  3PGE A;  3OLM D;  2KZR A;  3JW0 X;  4LQU A;  3SD5 A;  4J89 A;  1UBI A;  2PPH A;  1V86 A;  2C60 A;  4G11 A;  5AZF A;  3ZKJ C;  5D7G A;  4HWI B;  1WZ3 A;  3GL4 A;  3VUX A;  2PEA A;  3LVD A;  2L8J A;  2Z6X A;  4OVV A;  2YVC A;  2GOW A;  3SHQ A;  3ZTD A;  5JH5 C;  4RYS A;  2DZJ A;  2NS5 A;  2C9W B;  2H6V A;  2L05 A;  1UGM A;  1E7U A;  2KDB A;  3SSP A;  3GEX A;  2KD0 A;  2G16 B;  4ICU A;  5FHV A;  2A54 B;  4W9E A;  2REX A;  5H89 A;  3UFZ A;  4LJB A;  4UTS A;  4KIK A;  5LK4 A;  2Z0E B;  1WYW B;  4W9J A;  5LXH A;  3H1R A;  1YIW A;  2IO0 B;  2P4M A;  2K25 A;  3ZIM A;  5D94 A;  4NY0 A;  3VK1 A;  3PJ7 A;  5DPJ A;  2MW5 A;  2LJ5 A;  1MG8 A;  4IK5 A;  2KVR A;  2DYO A;  4L12 A;  2AL3 A;  4BVU C;  2BPS A;  2NBU A;  4IUM B;  2KQ7 A;  2L7R A;  4DXQ A;  2BYF A;  3DQE A;  4M8N A;  4ZYN A;  2ICR A;  4KF5 A;  3P2B A;  4ZF3 A;  4W9G A;  4MGK E;  1KOT A;  3AKO A;  3ZRC A;  1WX9 A;  2C7M B;  4E74 A;  5H87 A;  2WHS A;  2EMN A;  5DRG A;  3OAW A;  5IA7 A;  1Q5W B;  3PLU A;  4MEL A;  1C4F A;  2G4D B;  3PS6 A;  1H6R A;  1EMM A;  5HKH A;  1XA9 A;  1ZGQ A;  4GU2 A;  4W6T A;  4WJN A;  4TQ0 A;  3VIC A;  4MDK E;  5LTR A;  4KIK B;  5E6P A;  4MJS A;  4W6G A;  4DHZ E;  4DXM A;  3EK8 A;  3M3J A;  5EHU A;  1TGZ B;  3SU8 X;  3RCZ A;  2OGR A;  3DQA A;  1V81 A;  4AJY B;  2RD0 A;  2FID A;  4LJD C;  1VCB A;  3E5V A;  4KEX A;  1YX6 B;  3PHX B;  4KGE A;  2IB5 A;  1QYF A;  2DDC A;  5BTT A;  2FZU A;  1WGH A;  3EVU A;  3LF4 B;  2A5U A;  2M4N A;  2A48 A;  1HCJ A;  2LRW A;  4KGF A;  2L3Z A;  2L0F A;  2OTB A;  2KLG A;  2MBO A;  1Q4D A;  2H5R A;  4U2V A;  4OQW A;  3LVA A;  3ST0 A;  2KX3 A;  3DQ6 A;  3DBL I;  1RLF A;  4EN1 A;  4XGY A;  3BX9 A;  4ZFS A;  1WGY A;  3IP2 A;  2K6Q A;  4LDT B;  4W77 A;  2BYE A;  1U4A A;  3SG6 A;  3K9P B;  2ZCB A;  3VHT A;  4M0W B;  2N9E B;  1Y8R C;  3WAL A;  2O24 A;  4GMV A;  2A53 B;  1RMP A;  3KUZ A;  4WAA A;  3SSK A;  2H5O A;  2GW4 B;  2FWQ A;  4WJQ A;  3NZS A;  3DQ7 A;  1WR6 E;  4MJS B;  5KHO A;  4MM3 A;  1B9C A;  3IHP C;  1V6E A;  2FCS A;  4B9K A;  2Q57 A;  4LQT A;  1R4N I;  3VXW A;  4W9H A;  1KYR A;  4BDU A;  4NJ7 A;  3CST A;  1JRU A;  3QAR A;  2MCN B;  2LI5 A;  5DQM A;  2GBR A;  4OGS A;  1XD3 B;  1MYW A;  3L17 A;  3KW5 B;  4BBN C;  2VVI A;  1GL4 A;  3SVS A;  5BTT B;  1WIA A;  2KX0 A;  2K6D B;  4EMQ A;  2Z59 B;  4W7C A;  2D11 A;  1WJN A;  1KYP A;  4W76 A;  1Z1P A;  2LXA A;  4R6B A;  2K8H A;  4ZDV A;  4DWF A;  2H9W A;  2KTR A;  4J88 A;  3SSY A;  2OKW A;  3VAW A;  2AL6 A;  2YFP A;  1H4R A;  1EF5 A;  3APF A;  2NBV B;  3EFU A;  2WIQ A;  3QCA A;  3ST3 A;  3NT3 A;  1RMO A;  5H88 A;  3DQN A;  2KJH B;  3LVC A;  1IP9 A;  2DUF A;  3VHT B;  1J19 A;  2AH8 A;  3RD2 A;  4DXA B;  4XZ4 A;  2H5Q A;  3GZN I;  2LWP A;  3AU4 A;  3Q3F A;  4XOV A;  2KNB A;  2BWF A;  3SVU A;  3AU5 A;  3W1S A;  4WJO A;  2KJR A;  1S1Q B;  2A47 A;  4GOC A;  2BTJ A;  4RM9 A;  4HDQ A;  3EHV A;  4K7U A;  1AAR A;  3IBE A;  3DVN U;  2KC1 A;  2C9J A;  2V3S A;  3DQ9 A;  2ZO6 A;  5DTY A;  3HIZ A;  4MGY E;  2ZVO A;  5CTR C;  3MGF A;  3ALB A;  4GB9 A;  2KTR B;  2ZMW A;  3DPZ A;  3CBE A;  2V1Y A;  2HE7 A;  4Z4K A;  3NHE B;  4K7W A;  1XT9 B;  2R2O A;  4LDT D;  2KWU B;  4PFE A;  4FJZ A;  4HCP B;  1XQM A;  2AHA A;  2IE2 A;  3NOB A;  4TZG A;  2Y0G A;  1ZW7 A;  2DEN B;  2CU1 A;  5DPH A;  1QY3 A;  4PS7 A;  3HK0 A;  3ZUN A;  3SVC A;  3WAM A;  4MGZ E;  4IZN A;  2FNJ B;  3M63 B;  4NQL B;  1T0Y A;  2D10 A;  2GBN A;  5FR6 A;  4EDO A;  2G45 B;  5CHW A;  3R7R A;  3NS8 A;  2FCM A;  2JT4 B;  3W1C A;  2G3Q B;  2O2V A;  2IB6 A;  3WLC A;  1UIS A;  4EZL A;  5E6O A;  4LW5 A;  4MH0 E;  4F1S A;  4M8M A;  4W9D A;  1W7S A;  4OVU A;  4FJV B;  1E8Y A;  3SG4 A;  2D07 B;  3O65 B;  1TZ1 A;  3DPD A;  4HLE A;  2QLH A;  3DVG Y;  4EFO A;  4W6D A;  3DQU A;  3PRP B;  4DXP A;  4KZC A;  2DHZ A;  4KDI C;  2DD9 A;  2N7E A;  3JYU A;  3M95 A;  4A20 A;  4GES B;  3KVF B;  3Q3J A;  3U8Z A;  2B3A A;  5JHA A;  4NQK E;  2GX2 A;  1ISN A;  2LGD A;  2LGX A;  1OEY A;  4B6W A;  3T8M A;  1SIF A;  2KDI A;  2MSE D;  2B3Q A;  2G4S A;  4JF9 A;  3L16 A;  4KDL B;  5EXB A;  3V6E B;  1V9J A;  2NPT A;  1RFA A;  2DYM A;  4DXO A;  1C1Y B;  2K8C A;  2O2V B;  3WAO A;  4GF6 B;  4JFG A;  3QQ8 B;  4JC2 A;  2G6Y A;  5DTZ A;  2GX0 A;  3UQB A;  3BXA A;  4W6N A;  5L95 C;  2JZ3 B;  1EML A;  4KW4 A;  4ZF4 A;  1OXD A;  4W6C A;  3ZUJ A;  1WGG A;  5DPT A;  3UIP B;  2ZNV C;  2MWS B;  1KYS A;  4E3C A;  3SST A;  3DQF A;  3ST2 A;  3ZDM C;  2LZ6 A;  2OOB B;  2DAF A;  3UG0 A;  3QC8 B;  3OJ4 B;  3NT9 A;  3V62 A;  4W72 A;  2OTE A;  3NEZ A;  3U0N A;  4W7X A;  1SGH A;  4OY4 A;  4JEO A;  3B0A A;  1QZE A;  2L00 B;  1LQB A;  3DQL A;  3DBR I;  5C1Z A;  2KJ6 A;  1YQB A;  3V3D A;  3VFK A;  2WDT B;  1E8X A;  2NPT B;  2V4E C;  1Q0W B;  3ZUF A;  1ZKH A;  4Q7R A;  1EMG A;  3LA1 A;  2DDD A;  1BFP A;  3EKJ A;  4ANX A;  3BY4 B;  1RAX A;  2CHW A;  4HQ9 A;  3DQ1 A;  2IZV B;  4AP4 C;  4DHZ B;  3SG3 A;  4II2 B;  2KLC A;  2HGY A;  4ANJ A;  3R7Q A;  2MBE A;  3EEC A;  1W7U A;  2GBJ A;  1RRB A;  5J2O A;  2JRH A;  3DQJ A;  1F0B A;  2QHO A;  4LJD A;  4PPJ A;  4DXI A;  3VTU A;  2MBB B;  5DPS A;  3WIM A;  2G3O A;  2NCN A;  2KHW B;  3TMP B;  4W6A A;  2KKC A;  4IC7 B;  1QYO A;  3HM3 A;  4BOZ B;  4ANW A;  3WCK A;  2NVU I;  3E5W A;  1OGW A;  4IW0 A;  2PE6 B;  3KCT A;  1ZGP A;  4Z4M A;  2GMI C;  3A8S A;  3S2A A;  4J6I A;  3M24 A;  1IYF A;  1S3S G;  2WUR A;  2M17 A;  2C5L C;  4KW9 A;  2DYB A;  4F8C B;  4JL9 A;  4TKN A;  4HVB A;  4W9L A;  5AQB B;  3QJZ A;  4IM2 A;  5EBJ A;  2JF5 A;  3VTV A;  3P8U A;  4PPL A;  3DOW A;  4NAW A;  4NPN A;  1OXE A;  2KN5 A;  1YD8 U;  4RYW A;  4W6J A;  4LCD E;  2EMO A;  1WRD B;  2J0K A;  1Q1O A;  2B3P A;  4I2Y A;  3MTN B;  3JVZ X;  1WE7 A;  2VVJ A;  2HJO A;  4R6D A;  1FXT B;  4AS8 A;  2FUH B;  3UQA A;  2FIF A;  3PVL A;  4ZIN A;  3WA0 A;  2L0T A;  2WYQ A;  3DQI A;  5D2M B;  1OTR B;  3ST4 A;  2ZZP B;  1M94 A;  4I6N B;  5EDS A;  5FVF A;  3VUW A;  1F09 A;  5J18 A;  3ZRF A;  3GB3 A;  4BBN F;  3P28 A;  4XL5 A;  5T3I A;  4IK9 A;  5CHV C;  2KFK A;  4ORN A;  1OEY J;  1Q73 A;  3U30 A;  2IY1 B;  4HJK A;  4AWJ A;  2HFC A;  2Q6P A;  4W9F A;  3WLD A;  3KUC B;  1P1A A;  5EB6 A;  2PXW A;  4HPM B;  2BF8 B;  2O6V B;  3QAQ A;  4KF5 C;  4ZIO A;  2NBW B;  4JLC A;  4EZJ A;  4NAW B;  3V61 A;  1TTN A;  1P0R A;  4RTC A;  4W6O A;  2N9X A;  1EMF A;  3IFW B;  3VDZ A;  3OSR A;  5L83 A;  2HCG A;  2JVC A;  2ZO7 A;  3ONS A;  5LXI B;  4EEW A;  2ZJD A;  3QHT A;  2DUI A;  2KMC A;  4FBJ B;  3DQM A;  4KPI A;  2A52 B;  4W6F A;  1GC7 A;  1YJF A;  2IY0 B;  1OQY A;  2H5P A;  1Q4C A;  4ZRK A;  3PLV A;  4W7E A;  3SRY A;  1S6Z A;  2WIS A;  3BXC A;  3CSF A;  2G6E A;  2J7Q B;  2KFK B;  5BO4 B;  2O2B A;  2K39 A;  2A50 B;  4A3O A;  3RUI B;  3RZW C;  3TL5 A;  1UZX B;  2JPH A;  5J17 A;  2BYV E;  5DPR A;  1WMH A;  1YHH A;  1ZGO A;  4HVF A;  2OJK A;  5AEK B;  4TUU A;  3DQV A;  4GGQ A;  3ENE A;  1WI0 A;  4Q9W A;  4W75 A;  3KYC D;  2MQJ A;  1Q4B A;  3SSH A;  1NI2 A;  2KFJ A;  4AR7 A;  2CKH B;  2HD5 B;  4GDL A;  4K81 A;  4W7D A;  4LJC A;  1EME A;  2DD7 A;  5F9G A;  3DDC B;  2DZK A;  1XQQ A;  4IWP A;  1WR1 A;  2ZEQ A;  4HCN B;  1SE9 A;  2LVQ A;  4GDK A;  2N9P C;  3A33 B;  2A56 B;  2J0M A;  2MRP A;  3A9K A;  1Q4A A;  3APC A;  1G6J A;  4EOY A;  4WWO A;  2KK8 A;  1EUV B;  2LVO A;  4IK1 A;  3V6C B;  1QYQ A;  3SSL A;  2PXS A;  2KDF B;  1QXT A;  3LDZ E;  2LAS A;  3PRE A;  2G3D B;  1Z2M A;  2N1V A;  4L1I A;  3L08 A;  4W7R A;  5EXC I;  2GBM A;  4FJY A;  2M0X A;  4GN1 A;  2BKF A;  4HQC A;  4BKT A;  3QK0 A;  4KVG B;  1EMK A;  4RM8 A;  4GXB A;  2O6V D;  1WMH B;  4II3 B;  1GGX A;  4IK4 A;  3NF0 A;  4BKS D;  4FA6 A;  1RMM A;  1L7Y A;  3X23 A;  1WXS A;  3N30 A;  3AI5 A;  3TMT A;  2MBQ A;  1RRX A;  4ZRI A;  4LJO B;  4W6R A;  4IM3 A;  4GDL B;  4Q9X A;  4G3X B;  4MSM B;  2L76 A;  1WGR A;  3ZDT A;  1E8Z A;  5LLI A;  4MGI E;  1R4M I;  3K1K A;  1LFD A;  2WSN A;  4GDK B;  2LRU A;  4DDI D;  4P7I A;  3A9K B;  4TV3 A;  2BKR B;  1WM3 A;  3SG7 A;  4W7A A;  1H8C A;  3D32 A;  2JAD A;  2C7N B;  3DCG A;  3PJB A;  2UYZ B;  4B30 B;  2R2Q A;  3A4S C;  3O77 A;  1F9J A;  2XEW A;  4KV2 A;  3QWZ B;  4KAG A;  5KHQ A;  3CFF A;  3DQ4 A;  2AWK A;  2ARL A;  5BT0 A;  3ZTF A;  2NR2 A;  4KF4 A;  3OJ3 A;  2AWJ A;  2RR9 A;  1W7T A;  5HZS A;  4L13 A;  1LM8 B;  2CHZ A;  3PHW B;  3NED A;  5FVG A;  2UWQ A;  1J0G A;  4H3N A;  2C9I A;  3WAN A;  1P9D U;  2Z6Y A;  5DU0 A;  1GUA B;  4Q7U A;  3M22 A;  3BIN A;  5DTX A;  3DQ5 A;  2WX0 A;  2EKE C;  4CO7 A;  4DK5 A;  3H7P A;  1H4U A;  2YDZ A;  2HQZ A;  2LUE A;  4W6U A;  5G2N A;  3CGL A;  3PIB A;  4DKM A;  3OGO A;  2V4E A;  1E7V A;  4G50 A;  4W7F A;  2QT2 A;  2VVH A;  2I1K A;  4EKU A;  2VZX A;  1OXF A;  4W6K A;  1E5W A;  3ZNG C;  5G55 A;  3DBH I;  3QIJ A;  5CX3 A;  2GBK A;  4YL8 A;  4PPK A;  2HGD A;  4KSK C;  1WGD A;  3N32 A;  3SVR A;  2FAZ A;  3PZD A;  1KM7 A;  2LGY A;  1WZ0 A;  3DPX A;  3VH3 B;  2ZNV B;  1NBF C;  4HDO A;  3AXC A;  2DUH A;  4WQO B;  3ADF A;  3CF6 E;  4W6S A;  3K9O B;  1Q4E A;  3DQ3 A;  3H9D A;  3JSV A;  1EF1 A;  2G5Z B;  3NZU A;  3IVF A;  5EB7 A;  4MSQ B;  3HHM A;  3H7P B;  1JC0 A;  2MBH A;  3OSQ A;  4EUL A;  1IPG A;  4ZB1 A;  2V4E B;  1WY8 A;  1YZW A;  1P98 A;  1WX8 A;  3SDL C;  4URK A;  3L0W B;  2QLI A;  1V2Y A;  1VD2 A;  5JHB A;  2PJH A;  1PQS A;  2RGF A;  4EDS A;  4NJ6 A;  5FVI A;  3L13 A;  1P3Q U;  1ZUX A;  2RPQ A;  3WAP A;  3A4R A;  5LTQ A;  3LSA A;  3EVV A;  3QA8 A;  3DBS A;  3HM6 X;  2HQK A;  4W9K A;  1L2N A;  1Z1Q A;  3SS0 A;  4OJ0 A;  1WJ4 A;  3VUY A;  1YJ1 A;  5GMV A;  5DPW A;  4PS3 A;  1XSS A;  2WX1 A;  4W6H A;  4W6I A;  3SSV A;  3KCS A;  2G6X A;  4G0N B;  3LS3 A;  3W1D A;  2Z0D B;  2JWZ A;  1CMX B;  5C23 A;  1MOV A;  2IO3 B;  1CV7 A;  2JY6 A;  3CMM B;  2MLB A;  3JSV B;  5KTG A;  4KA9 A;  4FLH A;  3SV5 A;  2WSO A;  4F7Z A;  2EMD A;  3ED8 A;  1UH6 A;  5D6J B;  1EMA A;  4NNJ B;  2CR5 A;  4CYE A;  1K8R B;  3PT2 B;  3R66 C;  4K1R B;  1RM9 A;  3KH0 A;  1HE8 A;  3RWA A;  4ZBL A;  3V60 A;  3SVD A;  5DQB A;  3U0K A;  4FHK A;  3ZUL A;  2CS4 A;  1JC1 A;  2O6V A;  2XK5 A;  4BKS A;  2JXX A;  5EXU A;  2D2Q A;  2ZPN A;  4WWN A;  4FN2 A;  3PV1 A;  3ZLZ A;  3B08 A;  1KJT A;  3SG5 A;  2AYO B;  3DQC A;  1EMB A;  2IO1 B;  3KUD B;  2LD9 A;  3UIO B;  4EZK A;  1E8W A;  3DVG X;  2YLM A;  3VVW B;  5AZH A;  3N3K B;  4W6M A;  4K7S A;  4I6L B;  4ICV A;  2W9N A;  3SVN A;  2N1W A;  3APD A;  2KO3 A;  1V49 A;  3NY5 A;  1YFP A;  2FCQ A;  3W1Y A;  4BFR A;  4Q7T A;  2DUE A;  1UBQ A;  4JGE A;  3S05 A;  2MP2 A;  2POX A;  5JZE B;  4H47 A;  4HE4 A;  4W9C A;  3UF8 A;  4TQ1 A;  3B1L X;  4W69 A;  4W74 A;  3ZO5 B;  3I19 A;  4ZF5 A;  2DZM A;  3UGB B;  4KSL C;  3L54 A;  3MJW A;  3ZNH B;  3BXB A;  4FHJ A;  3ZTC A;  4DKN A;  4ANV A;  2N4F A;  2XK5 B;  1Z5S B;  3ECI A;  1WJU A;  3H7S A;  1TBE A;  4P1Q A;  2PE9 A;  3MHS D;  3TCA A;  1WXA A;  1MOU A;  4H3M A;  2XBB C;  3U0L A;  1WH3 A;  2KAN A;  3EKH A;  3UIN B;  3SVB A;  2WHU A;  3I3T B;  1UEL A;  4JQW C;  4X57 B;  1XMZ A;  3PSE B;  5DY6 A;  3DQ2 A; 
#chains in the Genus database with same CATH topology
 2KDE B;  3SVO A;  3LJ3 A;  1N60 A;  2WNM A;  3ZXV A;  3BVG A;  2QU1 A;  4IK8 A;  1K51 A;  1P7F A;  1ZXI A;  4E71 A;  5HFY A;  1C77 A;  3RZF A;  3RNB C;  2KC2 A;  3U0M A;  2N7D A;  1K50 A;  4ITK A;  2Z1O A;  1HUY A;  1LXD A;  4OHS A;  3A1Q A;  1QOA A;  4CQN A;  1JBZ A;  2Y3A A;  2MP2 B;  3CFH A;  4O1N A;  1I4P A;  1XAE A;  2G9H D;  5EJU A;  2ZCC A;  3VH4 B;  3ZNI D;  5HZO A;  3AUL A;  2VAD A;  3ZNZ B;  2JZZ A;  4WJP A;  3CD1 A;  4LK0 M;  2RSU A;  4D2K A;  3PRZ A;  4PS8 A;  1KLG D;  1JBY A;  1BT0 A;  3NUH B;  1YHI A;  2Z6Z A;  3P63 A;  4RMA A;  3TBL D;  2YE0 A;  1WSP A;  1PGB A;  2D3G A;  2R61 A;  1YX5 B;  4JWS C;  2KT7 A;  2A4Z A;  2PKO A;  2CJN A;  2DAJ A;  1V5O A;  4NWS A;  1HTQ A;  3M62 B;  3W2D A;  4XDD A;  2JUO A;  2HJ1 A;  4IWQ A;  2HRS A;  4IG7 B;  4AUQ C;  2RDH A;  3SG2 A;  4PYU A;  1YMH E;  3G9A A;  3PTF C;  2Y5B B;  2ZVN A;  1EU4 A;  2I1J A;  3KYD D;  1EMC A;  2J0J A;  3DQ8 A;  5DCN A;  4C4V B;  1JAL A;  1GC6 A;  2AWL A;  1SF0 A;  3DPW A;  4FUL A;  2WWZ A;  1D3Z A;  1DOX A;  4YWG G;  3AE2 B;  1DOI A;  3T9L A;  1RM6 C;  5FKA C;  1MPE A;  1VJK A;  3VQI A;  3NVV A;  2K8B A;  4B5Y A;  4H3L A;  3A9J A;  2ZMU A;  3QX1 A;  5IAA C;  4DDG D;  3SFE B;  5I4D A;  4B95 A;  4HQ8 A;  4LNK A;  1E90 A;  4B30 A;  1NDD A;  3GJ1 A;  1C3T A;  4XOW A;  1L0V B;  3H1O A;  3IR8 A;  5D3D A;  1ZGU B;  1UNS A;  3VHT C;  1A5R A;  1ZUD 2;  2WQY B;  3CD9 A;  4GIV A;  3A1Q B;  2HJ8 A;  3Q8F A;  2KQS A;  2MA9 B;  2M1M A;  3IG3 A;  3RWT A;  3EK7 A;  1KLV A;  1YJ2 A;  4JIO U;  1WXM A;  2WXK A;  2KOX A;  4HK2 A;  4DBG A;  2GRI A;  1GPX A;  1XO3 A;  3PJ5 A;  3DVN V;  3RI7 C;  2HTM E;  1WJ6 A;  5HZT A;  2BGF A;  3ML8 A;  3H6N A;  1J8C A;  2KWV B;  4ZRJ A;  2K1F A;  1I42 A;  2ASQ A;  2QLE A;  4BOS C;  1AW7 A;  2KMA A;  3L10 B;  3ML9 A;  4RGN A;  3U8P A;  4H48 A;  2ONQ A;  4WWP A;  2LHE A;  2VAE A;  1ROE A;  1WXV A;  4W6B A;  5HZU A;  3R8B A;  2A46 A;  1YQ3 B;  2KN4 A;  1QIL A;  1NEN B;  1VDV A;  4RF1 A;  2H8Q A;  3C0R B;  2EMS A;  2N9K A;  4IWO A;  5DTL A;  5HBD A;  3GJ2 A;  3DQH A;  4DHJ B;  4BKG A;  4OZA A;  1KP5 A;  3VTW A;  1I35 A;  2IBI B;  3Q3N C;  3E5T A;  2EMT A;  1F2R I;  2JU6 X;  4CHK A;  4DXN A;  1G7K A;  2QZ0 A;  3RUL A;  3O78 A;  4C80 A;  3LF3 A;  5J2R A;  1WM2 A;  5LTP A;  3AV8 A;  3ZYY X;  3X0W A;  4P76 A;  4XVP A;  3ZVV A;  1EO6 A;  5DPG A;  5HW9 A;  3AE1 B;  3W5U B;  2OED A;  2IOV A;  3EVR A;  1DYQ A;  4XWW A;  2KTF A;  2LXC A;  4H2A A;  1WE6 A;  3A9J B;  3LB8 C;  4LJP B;  5HGE A;  4JRB A;  4JWU C;  4I6P A;  4M00 A;  2NTT A;  3PPA A;  3EC8 A;  1IGC A;  2FL1 A;  4W6L A;  1C4C A;  2RMM A;  4LTU A;  4PK1 A;  4KW8 A;  5AUK A;  5CHF A;  2TSS A;  4AOF A;  1GG3 A;  1V5T A;  3EK4 A;  2M0A A;  1T0Q C;  4W9I A;  1QLB B;  2M8S A;  3DQO A;  3PRM B;  3RFZ B;  1TKE A;  3CFA A;  4IK3 A;  4L2Y A;  2KXJ A;  1L5P A;  3N9Y C;  1PDX A;  2HTH A;  3GOE A;  4XX5 A;  4LNF A;  3W1S C;  4GOB A;  2QLG A;  3VRB B;  4TZA A;  3U8C A;  2GW3 A;  2FBW B;  2OJR A;  5E6N A;  2EEL A;  4W6P A;  1JWS D;  1K52 A;  4XC2 A;  1GFL A;  1WFY A;  5HI1 A;  5H92 C;  1C79 A;  1GNU A;  4PYZ A;  3U8A A;  4XYC A;  4AJW A;  2QRF A;  2B76 B;  3SVE A;  3DQD A;  4DXG A;  1L4Z B;  2O29 A;  1X1M A;  2LGS A;  4EUT A;  5BQL A;  2VRR B;  2AWT A;  2WHT A;  2YE1 A;  5DRF A;  4A6Q A;  4HXD A;  1V1O A;  1YHG A;  2OJW A;  2IO2 B;  1CK1 A;  3C19 A;  2V4L A;  3GS2 A;  2JXT A;  4PT5 A;  2GLS A;  3TMR A;  2J53 A;  3TJP A;  3U7D A;  4KZ0 A;  3AI4 A;  3EVP A;  4FAD A;  1XLN A;  3DQK A;  2DZI A;  2C7H A;  3PZ8 A;  2KWC A;  1WF9 A;  4IM0 A;  4B0M A;  4JGH B;  4GSW A;  5DPI A;  1WWT A;  1GB1 A;  1CZP A;  5G5G A;  3CB9 A;  3R3M A;  1ENF A;  1L0X B;  4HRS A;  2WXM A;  3BVM A;  2V3P A;  4FXC A;  3FKY A;  1UD7 A;  4J8A A;  4J3O D;  4N6E B;  5AZG A;  5TR5 A;  5FR3 A;  1V80 A;  4WIP A;  2MX2 A;  4ASW C;  2JYT A;  1I4X A;  1ZPS A;  2LMC A;  4MEM A;  4A3P A;  1JCK B;  3Q8B A;  2CHX A;  3ZW3 A;  1I4H A;  3EUB 2;  2AWM A;  2IYD B;  1CQV A;  1VZ6 A;  2FCN A;  2QLG B;  2HPW A;  3RT3 B;  2LEK A;  2ZW1 A;  2DX5 B;  4ANU A;  4DHJ D;  1GJZ A;  4HPL B;  4W73 A;  2LVP A;  2E3T A;  2JRI B;  4N9F 4;  4N3D A;  3P4R B;  5HHD G;  4ZOH C;  3RYT A;  2G2S B;  2BWE S;  4RF0 A;  1SJE D;  2RH7 A;  2DUG A;  1V1P A;  2AEH A;  3H1U A;  3SFD B;  2ZPY A;  4IKG A;  3TIX A;  2OKY A;  1WX7 A;  3PGE A;  3OLM D;  2KZR A;  3JW0 X;  4XWT A;  2M19 A;  4LQU A;  4YSY B;  3SD5 A;  4J89 A;  1UBI A;  4EE2 A;  2PPH A;  1V86 A;  2QIE B;  2C60 A;  4G11 A;  5AZF A;  5HG2 A;  3ZKJ C;  5D7G A;  1PYW D;  3BII D;  4HWI B;  1WZ3 A;  3GL4 A;  3RNF C;  1D5X C;  4WAF A;  3VUX A;  4C56 C;  2PEA A;  4KGS A;  3LVD A;  2L8J A;  2Z6X A;  3B2G A;  4OVV A;  4RGT A;  1QOF A;  2YVC A;  4MH8 A;  2GOW A;  3SHQ A;  2GB1 A;  2JZP A;  3ZTD A;  3TEX A;  1C4A A;  5JH5 C;  4RYS A;  2DZJ A;  2NS5 A;  2C9W B;  2H6V A;  2L05 A;  1UGM A;  1E7U A;  2WDQ B;  2KDB A;  1N6Z A;  3SSP A;  3GEX A;  2KD0 A;  2G16 B;  4ICU A;  1PFD A;  1R4M B;  1Q10 A;  4C7Z A;  5FHV A;  2A54 B;  4MT5 A;  3KWL A;  4W9E A;  2REX A;  3MC8 A;  5H89 A;  3UFZ A;  4LJB A;  4UTS A;  4KIK A;  5LK4 A;  2Z0E B;  1WYW B;  4W9J A;  5LXH A;  3H1R A;  1YIW A;  4ARC A;  2IO0 B;  1UUP A;  3HVD A;  2P4M A;  2K25 A;  4OZC A;  3BK2 A;  3ZIM A;  5D94 A;  1ZP0 B;  3VK1 A;  3PJ7 A;  5DPJ A;  1YN4 A;  2MW5 A;  4NY0 A;  2LJ5 A;  3EA6 A;  1MG8 A;  3AE5 B;  4IK5 A;  2KVR A;  2DYO A;  1MHX A;  4HKZ E;  4L12 A;  2AL3 A;  4BVU C;  2BPS A;  1V1P B;  2NBU A;  2LHD A;  4IUM B;  2KQ7 A;  2L7R A;  4DXQ A;  2QMT A;  3P4S B;  3BZD B;  2BYF A;  1PGA A;  1F52 A;  3DQE A;  1SE4 A;  4M8N A;  4ZYN A;  2ICR A;  4KF5 A;  3P2B A;  2BB6 A;  1JWB D;  4Q2J A;  4ZF3 A;  4ZYS A;  4W9G A;  4MGK E;  1KOT A;  3AKO A;  3ZRC A;  1WX9 A;  2C7M B;  2BS4 B;  3AE8 B;  3N1Z C;  4E74 A;  5H87 A;  2WHS A;  2EMN A;  2FE8 A;  3HVZ A;  4A9A A;  3LYY A;  3DWG C;  5DRG A;  2VH2 A;  2W54 A;  3OAW A;  3RNA C;  3DHG C;  5IA7 A;  5C3J B;  5H8Y E;  1Q5W B;  3PLU A;  4DXF A;  4MEL A;  1C4F A;  2PTL A;  2G4D B;  3PS6 A;  1H6R A;  1EMM A;  3AN1 A;  5HKH A;  1XA9 A;  1ZGQ A;  2ICI A;  4GU2 A;  4W6T A;  2W3S A;  4WJN A;  4M0W A;  4TQ0 A;  3VIC A;  4MDK E;  5LTR A;  1YN5 A;  4KIK B;  5E6P A;  1XEE A;  4MJS A;  1IUE A;  1WYG A;  4W6G A;  4DHZ E;  4DXM A;  3EK8 A;  4JX1 C;  1KLU D;  3M3J A;  5EHU A;  2WXL A;  1E9M A;  1VZ7 A;  1TGZ B;  2H89 B;  3SU8 X;  3RCZ A;  2OGR A;  3DQA A;  1V81 A;  4A8X C;  4AJY B;  3DBH B;  5BYQ A;  2RD0 A;  2FID A;  4LJD C;  1FRR A;  1VCB A;  3E5V A;  4KEX A;  1YX6 B;  3HRD D;  3NJT A;  5EE1 A;  4S0R A;  3PHX B;  4KGE A;  2CU3 A;  2IB5 A;  1QYF A;  2DDC A;  3NRZ A;  1TY0 A;  2LUM A;  5BTT A;  2FZU A;  1WGH A;  3BK1 A;  1SBB B;  3EVU A;  1EWC A;  2L83 A;  3LF4 B;  1L0Y B;  1FM0 D;  2A5U A;  2M4N A;  2A48 A;  1HCJ A;  2LRW A;  4KGF A;  1MJD A;  2L3Z A;  2L0F A;  2OTB A;  1YJI A;  2KLG A;  2MBO A;  2MJE A;  1Q4D A;  2I38 A;  2H5R A;  4U2V A;  4USA A;  4OQW A;  2IGD A;  3LVA A;  3ST0 A;  2KX3 A;  3DQ6 A;  4KGT A;  2D5G A;  3DBL I;  3ZGZ A;  1RLF A;  4EN1 A;  4XGY A;  1OQR A;  3BX9 A;  4ZFS A;  1L6V A;  2AQ3 B;  1WGY A;  3IP2 A;  2K6Q A;  3NVY A;  4LDT B;  1JQ4 A;  4W77 A;  2BYE A;  1U4A A;  3SG6 A;  3K9P B;  2ZCB A;  3VHT A;  4M0W B;  2N9E B;  1Y8R C;  1NVI D;  3WAL A;  2O24 A;  4GMV A;  3TUO A;  3RPF C;  3BYT B;  2A53 B;  1RMP A;  3KUZ A;  4WAA A;  3SSK A;  2H5O A;  2GW4 B;  2FWQ A;  4WJQ A;  3NZS A;  3DQ7 A;  1WR6 E;  1OFF A;  4MJS B;  2AQ2 B;  5KHO A;  4MM3 A;  4NZL B;  1B9C A;  3IHP C;  2KQ4 X;  1V6E A;  4LNN A;  3N1Y C;  2FCS A;  2VZK B;  4B9K A;  2Q57 A;  4RGO S;  4LQT A;  3ZJV A;  1R4N I;  3AE7 B;  3VXW A;  4W9H A;  1KYR A;  4BDU A;  4NJ7 A;  3CST A;  1JRU A;  3QAR A;  2MCN B;  2LI5 A;  4OZB A;  5DQM A;  2GBR A;  4OGS A;  1XD3 B;  2BW2 A;  1FPY A;  1MYW A;  1N63 A;  4REZ A;  3MJ5 A;  4HRO A;  3CIR B;  3L17 A;  3KW5 B;  4BBN C;  2VVI A;  1FCC C;  2IND C;  3AE6 B;  1IGD A;  1GL4 A;  3SVS A;  2AX5 A;  3N1X C;  5BTT B;  1YQ4 B;  1WIA A;  2KX0 A;  2K6D B;  4EMQ A;  1EU3 A;  2Z59 B;  4W7C A;  2D11 A;  1WJN A;  1KYP A;  4W76 A;  1Z1P A;  1MHH E;  2LXA A;  4R6B A;  2K8H A;  4ZDV A;  4DWF A;  3TSS A;  2H9W A;  2KTR A;  4J88 A;  3SSY A;  4RGM A;  2OKW A;  3Q6B A;  5EE3 A;  3VAW A;  2AL6 A;  2YFP A;  1H4R A;  1EF5 A;  1PGX A;  1RYJ A;  3APF A;  3VR9 B;  2K3U A;  2NBV B;  3EFU A;  2WIQ A;  3EGR A;  3QCA A;  3ST3 A;  3NT3 A;  3AEC B;  1RMO A;  1EM7 A;  5BYS A;  5H88 A;  3DQN A;  2KDM A;  2KJH B;  4ACF A;  3LVC A;  1IP9 A;  4KX6 B;  2DUF A;  3TEY A;  3VHT B;  1J19 A;  2AH8 A;  3RD2 A;  4DXA B;  5EE0 A;  4XZ4 A;  4M01 A;  2XNA C;  2H5Q A;  3GZN I;  3VRA B;  4BAX A;  4OVZ A;  4P1C C;  2LWP A;  3AU4 A;  4MM3 B;  4QAY A;  1TS5 A;  3Q3F A;  4XOV A;  2KNB A;  2BWF A;  2WU2 B;  1LO5 D;  3SVU A;  1NYQ A;  3AU5 A;  3AEG B;  3SEB A;  3W1S A;  4WJO A;  2KJR A;  1S1Q B;  2A47 A;  4YXD B;  4GOC A;  2BTJ A;  4RM9 A;  4HDQ A;  3EHV A;  4K7U A;  1AAR A;  1CJE A;  5IKC M;  2WXH A;  3IBE A;  3DVN U;  1N61 A;  2KC1 A;  2C9J A;  1LGR A;  2V3S A;  3DQ9 A;  2ZO6 A;  5DTY A;  3HIZ A;  1T6B X;  1ZE3 D;  4MGY E;  3HUI A;  2ZVO A;  5CTR C;  3MGF A;  3ALB A;  4GB9 A;  4KGR A;  2KTR B;  2ZMW A;  3DPZ A;  3CBE A;  2V1Y A;  2HE7 A;  1ZDV A;  4Z4K A;  3NHE B;  4K7W A;  3FIL A;  1XT9 B;  2R2O A;  4LDT D;  4ZRP A;  2KWU B;  4PFE A;  4FJZ A;  4HCP B;  1XQM A;  2E6X A;  1TYG B;  1J7C A;  2AHA A;  2IE2 A;  1MFW A;  1FXA A;  3NOB A;  4TZG A;  2Y0G A;  1E0Z A;  1ZW7 A;  2DEN B;  1XLP A;  2CU1 A;  5DPH A;  1QY3 A;  4PS7 A;  1ESF A;  3HK0 A;  3ZUN A;  3SVC A;  3WAM A;  4MGZ E;  2BBC A;  2UU7 A;  1E6E B;  3IT4 B;  2MHJ A;  1C76 A;  4IZN A;  3C8Y A;  2VZK D;  2FNJ B;  3NVZ A;  3M63 B;  3IAS 1;  2SAK A;  3AEB B;  4NQL B;  1T0Y A;  5GXG B;  2D10 A;  2GBN A;  5FR6 A;  4US9 A;  4EDO A;  2G45 B;  5CHW A;  5C2T B;  1YN3 A;  2WXR A;  3R7R A;  3NS8 A;  1GAQ B;  2FCM A;  2JT4 B;  3B9J A;  3W1C A;  2G3Q B;  2WDV B;  2O2V A;  2IB6 A;  3WLC A;  1UIS A;  1OQQ A;  3KLS X;  4EZL A;  5E6O A;  4LW5 A;  4MH0 E;  4F1S A;  4M8M A;  4W9D A;  1W7S A;  1XCQ L;  4OVU A;  1N5W A;  4ZRQ A;  4FJV B;  3DHH C;  1E8Y A;  3SG4 A;  2CJO A;  2D07 B;  3O65 B;  2INC C;  1B9R A;  1TZ1 A;  3DPD A;  4HLE A;  2EKI A;  2QLH A;  3DVG Y;  5TSS A;  1JWU D;  2KAC A;  4EFO A;  4W6D A;  3DQU A;  3PRP B;  4DXP A;  4KZC A;  1F0Z A;  2DHZ A;  4KDI C;  2D3B A;  1T0S C;  2WXJ A;  1MG4 A;  2DD9 A;  2N7E A;  3JYU A;  4LNO A;  3M95 A;  4TMA B;  4A20 A;  4GES B;  3FIL B;  3KVF B;  3Q3J A;  3U8Z A;  2B3A A;  3I57 A;  5JHA A;  4NQK E;  2GX2 A;  3W9C B;  1ISN A;  2LGD A;  2LGX A;  1OEY A;  1ZDX A;  4B6W A;  4K3C A;  3T8M A;  1TS2 A;  3MC9 A;  3RN9 C;  1BXT A;  1SIF A;  2KDI A;  2MSE D;  5BMI A;  2B3Q A;  2G4S A;  2WXF A;  1F1H A;  4JF9 A;  3L16 A;  4KDL B;  5EXB A;  3V6E B;  4XE0 A;  1V9J A;  2NPT A;  1JRP A;  1XCT L;  2BS3 B;  1RFA A;  2DYM A;  2KMM A;  4DXO A;  1C1Y B;  4BZA A;  1N5X A;  1TZO A;  2K8C A;  3URY A;  2O2V B;  4GLS C;  4GF6 B;  3WAO A;  1SEB D;  3T3N A;  4JFG A;  2MJ3 A;  2WU5 B;  1FEH A;  3QQ8 B;  4M02 A;  4JC2 A;  2G6Y A;  1RWS A;  1UWM A;  5DTZ A;  2GX0 A;  3UQB A;  3BXA A;  2NMQ A;  3TEZ A;  4W6N A;  5L95 C;  4KKI A;  1E7P B;  2JZ3 B;  3AE9 B;  1STE A;  1EML A;  4KW4 A;  4ZF4 A;  1OXD A;  3GZN B;  4W6C A;  3U4E G;  3ZUJ A;  2NTS A;  1WGG A;  3Q3O C;  5DPT A;  3UIP B;  2ZNV C;  2XN9 C;  2MWS B;  3P4P B;  1KTK A;  1KYS A;  4E3C A;  2YEP F;  3Q8C A;  3SST A;  2WLB A;  1SE2 A;  3DQF A;  3ST2 A;  1XF5 L;  3ZDM C;  2LZ6 A;  2OOB B;  4WUR A;  2DAF A;  3UG0 A;  3QC8 B;  3OJ4 B;  3NT9 A;  3V62 A;  4W72 A;  1AN8 A;  2K9X A;  2OTE A;  3NEZ A;  3U0N A;  4W7X A;  1SGH A;  4OY4 A;  4JEO A;  2J42 A;  3B0A A;  1QZE A;  1XLQ A;  2MEK A;  2L00 B;  4N59 A;  1LQB A;  3DQL A;  3DBR I;  3RMK C;  5C1Z A;  2KJ6 A;  1YQB A;  3V3D A;  2PMV A;  1KFY B;  3VFK A;  2WDT B;  1E8X A;  2NPT B;  2V4E C;  1I4R A;  1Q0W B;  2LJI A;  3ZUF A;  1ZKH A;  4Q7R A;  3IXS A;  3Q8A A;  1EMG A;  3LA1 A;  2WHI A;  2DDD A;  1BFP A;  3EKJ A;  4ANX A;  2IPK D;  3BY4 B;  2ON8 A;  1RAX A;  2CHW A;  4HQ9 A;  3DQ1 A;  2IZV B;  4AP4 C;  4DHZ B;  3SG3 A;  4II2 B;  2KLC A;  2PVG C;  2HGY A;  4ANJ A;  3R7Q A;  2MBE A;  2JSV X;  3EEC A;  1N62 A;  2DBY A;  1W7U A;  2GBJ A;  1RRB A;  5J2O A;  2JRH A;  3DQJ A;  1F0B A;  2QHO A;  2L52 A;  4LJD A;  3B2F A;  4PPJ A;  4DXI A;  3VTU A;  2MBB B;  5DPS A;  1I7H A;  3WIM A;  2G3O A;  3U7Z A;  1ET6 A;  2NCN A;  2KHW B;  3NVW A;  3TMP B;  2LFI A;  3GE3 C;  4W6A A;  2KKC A;  3R2T A;  4IC7 B;  5IOI A;  2YEP B;  1QYO A;  3HM3 A;  4BOZ B;  1QKZ A;  4ANW A;  4HKQ A;  5MPO A;  3WCK A;  2NVU I;  3E5W A;  1OGW A;  4IW0 A;  2VH1 A;  2PE6 B;  1SE3 A;  3KCT A;  1ZGP A;  4Z4M A;  2GMI C;  3AEE B;  3A8S A;  3S2A A;  3RNG C;  1AWD A;  4J6I A;  3M24 A;  1IYF A;  1S3S G;  2WUR A;  2M17 A;  2C5L C;  2BTE A;  4P6V F;  4C00 A;  4KW9 A;  1KRH A;  2DYB A;  1M4V A;  1XXG A;  4F8C B;  1DGJ A;  1K53 A;  4JL9 A;  4L1B A;  4TKN A;  4HVB A;  4W9L A;  5AQB B;  3SR6 A;  2W3R A;  3QJZ A;  4IM2 A;  4B0E A;  5LNK 1;  5EBJ A;  2JF5 A;  4MAC A;  3VTV A;  3P8U A;  4PPL A;  3DOW A;  4NAW A;  4NPN A;  1OXE A;  2D3A A;  4HEA 1;  2KN5 A;  1YD8 U;  4RYW A;  4W6J A;  1P7E A;  4LCD E;  2EMO A;  1J7B A;  1WRD B;  2J0K A;  1ZXH A;  1Q1O A;  2B3P A;  4I2Y A;  3MTN B;  3JVZ X;  1HA5 A;  2QDF A;  3ZQ4 A;  1HXY D;  1WE7 A;  2VVJ A;  1SJH D;  2HJO A;  4R6D A;  1FXT B;  4AS8 A;  1FNW A;  3P1M A;  3UI3 A;  1I4G A;  2FUH B;  3UQA A;  2FIF A;  2KAJ A;  3PVL A;  4ZIN A;  3WA0 A;  3O13 A;  2L0T A;  2WYQ A;  3DQI A;  1VLB A;  5D2M B;  1OTR B;  3ST4 A;  2ZZP B;  1C78 A;  1M94 A;  4I6N B;  5EDS A;  5FVF A;  4YTP B;  3VUW A;  1F09 A;  1C4P A;  5J18 A;  3ZRF A;  3GB3 A;  1KF6 B;  4BBN F;  3P28 A;  4XL5 A;  5T3I A;  1QOG A;  2Y5P A;  1D5Z C;  4IK9 A;  5CHV C;  3U2S C;  2KFK A;  4ORN A;  1OEY J;  1Q73 A;  3U30 A;  2IY1 B;  3E56 A;  4AQ7 A;  3AH7 A;  4HJK A;  1D6E C;  3U52 E;  4AWJ A;  2HFC A;  2QC8 A;  1UWX A;  3BWU D;  2WDR B;  2Q6P A;  4W9F A;  1QT9 A;  3WLD A;  3KUC B;  3OWE B;  1ACC A;  1P1A A;  2JQR B;  3V05 A;  5EB6 A;  2PXW A;  4HPM B;  2W82 A;  2BF8 B;  2O6V B;  2WXO A;  1QQR A;  3QAQ A;  4KF5 C;  3NZ3 A;  1T3Q A;  5T8I A;  4ZIO A;  2NBW B;  4JLC A;  3AEA B;  4NAW B;  3V61 A;  1TTN A;  3VR8 B;  4EZJ A;  5JXV A;  1P0R A;  2BVC A;  4XDC A;  4RTC A;  4W6O A;  2N9X A;  1EMF A;  3IFW B;  3VDZ A;  1FXI A;  1WXQ A;  3OSR A;  5L83 A;  1TKY A;  1YJJ A;  2HCG A;  1HTO A;  2JVC A;  2ZO7 A;  3ONS A;  5LXI B;  4EEW A;  3NG0 A;  5EE9 A;  2ZJD A;  3QHT A;  2KYW A;  2DUI A;  2KMC A;  4FBJ B;  3DQM A;  2V4I B;  2BQQ A;  3GE8 C;  4KPI A;  2K5P A;  2A52 B;  2INP E;  5FK9 C;  4YSX B;  4W6F A;  3AE3 B;  1GC7 A;  3DBR B;  1YJF A;  2IY0 B;  1OQY A;  2H5P A;  1UGJ A;  1Q4C A;  4ZRK A;  3PLV A;  4W7E A;  4AS1 A;  2H88 B;  3SRY A;  1S6Z A;  2WIS A;  3BXC A;  3CSF A;  2G6E A;  2J7Q B;  2KFK B;  5BO4 B;  2O2B A;  2K39 A;  2A50 B;  2WXP A;  3RUI B;  4A3O A;  3RZW C;  3TL5 A;  1UZX B;  2JPH A;  5J17 A;  2WXI A;  1V97 A;  2BYV E;  4HJG E;  5DPR A;  1WMH A;  1YHH A;  1ZGO A;  4HVF A;  1HEZ E;  4UDU C;  3I9V 1;  2OJK A;  5AEK B;  4TUU A;  5E6J A;  3DQV A;  4NAM A;  1C9F A;  4GGQ A;  3ENE A;  3BYY B;  1WI0 A;  3Q14 C;  4Q9W A;  4W75 A;  3KYC D;  2MQJ A;  1Q4B A;  3SSH A;  1NI2 A;  2KFJ A;  1TY2 A;  2QSD A;  3IT6 B;  4AR7 A;  2CKH B;  1ZOY B;  2HD5 B;  4GDL A;  4K81 A;  4W7D A;  4LJC A;  1EME A;  2DD7 A;  5F9G A;  2N0S B;  3DDC B;  2DZK A;  1XQQ A;  4IWP A;  1WR1 A;  4YT0 B;  3WCQ A;  2ZEQ A;  2WXQ A;  1FFU A;  4HCN B;  3LXF A;  1SE9 A;  2LVQ A;  4GDK A;  2WGS A;  2N9P C;  3A33 B;  2A56 B;  5IN7 A;  2J0M A;  2MRP A;  3A9K A;  3CWI A;  1Q4A A;  3APC A;  4C7Y A;  1G6J A;  4EOY A;  4WWO A;  2KK8 A;  1EUV B;  2LVO A;  2KWD A;  3J9C A;  4IK1 A;  3V6C B;  1QYQ A;  3SSL A;  2PXS A;  2QIL A;  3ABV B;  2KDF B;  1QXT A;  3LDZ E;  4RH6 A;  2LAS A;  3PRE A;  2G3D B;  1Z2M A;  2N1V A;  1Y56 A;  4LLG M;  4L1I A;  1D5M C;  2ZW0 A;  3L08 A;  2BYT A;  1F77 A;  5IP4 D;  4W7R A;  5EXC I;  2GBM A;  4RNA A;  4FJY A;  2M0X A;  1I4Q A;  4P16 A;  4GN1 A;  4TSS A;  2ACZ B;  2BKF A;  4HQC A;  4BKT A;  3QK0 A;  2Q5W D;  2RDB C;  4KVG B;  1L4D B;  4ARI A;  1T5X D;  1EMK A;  4RM8 A;  4GXB A;  4YTN B;  2O6V D;  1WMH B;  1NI3 A;  4II3 B;  1GGX A;  4IK4 A;  3NF0 A;  2AQ1 B;  4BKS D;  4FA6 A;  1RMM A;  1IBX A;  5AUI A;  2L32 A;  1L7Y A;  3X23 A;  5BYR A;  2V0G A;  1WXS A;  3N30 A;  3AI5 A;  3TMT A;  2MBQ A;  1RRX A;  4IOI E;  4ZRI A;  4LJO B;  4W6R A;  4IM3 A;  4GDL B;  4Q9X A;  5IO9 A;  1SXT A;  4G3X B;  4MSM B;  2L76 A;  2IDY A;  1WGR A;  1MI0 A;  1E8Z A;  3ZDT A;  5LLI A;  4MGI E;  1R4M I;  3P4Q B;  3K1K A;  1WGK A;  1LFD A;  3P42 A;  1J7A A;  2WSN A;  1SB3 C;  3PO0 A;  2WXN A;  4GDK B;  4ZHP A;  2LRU A;  3RNC C;  4DDI D;  2Z8L A;  1BUI C;  4P7I A;  3A9K B;  4TV3 A;  2BKR B;  2N9L A;  1WM3 A;  3SG7 A;  4W7A A;  1H8C A;  3D32 A;  5BMH A;  2M56 B;  2JAD A;  2C7N B;  3PZ7 A;  3DCG A;  4A55 A;  4A90 A;  3PJB A;  2UYZ B;  3ZJU A;  2DLB A;  2PW9 A;  4B30 B;  4R3D A;  2R2Q A;  3FC4 A;  3A4S C;  1TS4 A;  3O77 A;  1F9J A;  1MVK A;  2XEW A;  3DBL B;  4KV2 A;  3QWZ B;  2BB5 A;  4KAG A;  5KHQ A;  3CFF A;  3DQ4 A;  2D3C A;  4KKJ A;  2AWK A;  2RDG A;  1VR9 A;  1SSN A;  1FO4 A;  3IAM 1;  2ARL A;  5BT0 A;  3Q2A C;  3ZTF A;  1VZ8 A;  2NR2 A;  4KF4 A;  3OJ3 A;  2AWJ A;  2RR9 A;  1W7T A;  2WS3 B;  5HZS A;  4L13 A;  2IJ0 A;  3I63 C;  1LM8 B;  2IGG A;  4S17 A;  2CHZ A;  3PHW B;  1IBX B;  3NED A;  1XLO A;  1FIQ A;  4YTM B;  1V8C A;  3TEW A;  5FVG A;  1JWA D;  1R4N B;  2UWQ A;  1J0G A;  4H3N A;  2C9I A;  3WAN A;  1E10 A;  1UF0 A;  3H8H A;  3ZXR A;  3EFC A;  2BS2 B;  1P9D U;  3W5V B;  2Z6Y A;  4HPP A;  2K0P A;  5DU0 A;  1GUA B;  4Q7U A;  4WQM A;  3M22 A;  4RFB A;  3BIN A;  1TIF A;  5DTX A;  3DQ5 A;  4K3B A;  2BT6 A;  2WX0 A;  2EKE C;  4CO7 A;  4DK5 A;  1NYR A;  3H7P A;  1T0R C;  1H4U A;  2YDZ A;  2HQZ A;  2LUE A;  4W6U A;  5G2N A;  3CGL A;  3PIB A;  4DKM A;  3OGO A;  2V4E A;  1E7V A;  4G50 A;  3KWV A;  4W7F A;  3DWM A;  2QT2 A;  2VVH A;  2I1K A;  4EKU A;  2VZX A;  1OXF A;  4W6K A;  1FNV A;  2V9H A;  1E5W A;  3ZNG C;  5G55 A;  2PVO D;  3AMZ A;  1HZ6 A;  3DBH I;  3QIJ A;  3FAH A;  5CX3 A;  1BML C;  2GBK A;  4N58 A;  4YL8 A;  4PPK A;  3RNE C;  2HGD A;  4KSK C;  1WGD A;  3N32 A;  1WRI A;  2PLP A;  3SVR A;  2FAZ A;  3AB5 A;  4JPS A;  3PZD A;  3MC0 B;  1KM7 A;  2J52 A;  2LGY A;  1WZ0 A;  1TKG A;  3DPX A;  2W55 A;  3VH3 B;  2ZNV B;  1HZ5 A;  4L23 A;  1NBF C;  4HDO A;  3AXC A;  3AED B;  3MHZ A;  2DUH A;  4WQO B;  3ADF A;  3CF6 E;  3AEF B;  4W6S A;  3K9O B;  4JE3 B;  1Q4E A;  3DQ3 A;  3H9D A;  3JSV A;  1EF1 A;  2G5Z B;  1QOB A;  4DQO C;  3NZU A;  3Q69 A;  3IVF A;  5EB7 A;  5G5H A;  2INN E;  2RPV A;  4MSQ B;  2J4X A;  3HHM A;  3H7P B;  4RCO A;  1JC0 A;  2MBH A;  1FNU A;  3OSQ A;  4XGA B;  4EUL A;  3N20 C;  1YOV B;  3V3X A;  1IPG A;  4ZB1 A;  5D3I B;  2V4E B;  1WY8 A;  1YZW A;  1RFK A;  2OHF A;  1P98 A;  1WX8 A;  3SDL C;  4URK A;  3L0W B;  1PUT A;  2QLI A;  1V2Y A;  1VD2 A;  1NEK B;  5JHB A;  1TT5 B;  1PQS A;  2DNF A;  2PJH A;  2RGF A;  4EDS A;  2KVZ A;  3ZJT A;  4NJ6 A;  5FVI A;  3L13 A;  1P3Q U;  1FD6 A;  1ZUX A;  2RPQ A;  3WAP A;  4P1B C;  3A4R A;  3NS1 A;  1FMA D;  2FUG 1;  5LTQ A;  3LSA A;  3EVV A;  2PIA A;  3QA8 A;  3Q8E A;  3DBS A;  3HM6 X;  2HQK A;  4W9K A;  1L2N A;  1Z1Q A;  3SS0 A;  4OJ0 A;  4OW0 A;  1WJ4 A;  3GP7 A;  3VUY A;  1YJ1 A;  2G1E A;  1EWY C;  5GMV A;  5DPW A;  4PS3 A;  1XSS A;  2WX1 A;  4US8 A;  4W6H A;  4W6I A;  1YNT E;  3SSV A;  1ET9 A;  1F2R C;  3KCS A;  2G6X A;  4ZHO A;  2LGI A;  4G0N B;  3LS3 A;  3W1D A;  2K22 A;  2Z0D B;  3AM9 A;  2JWZ A;  1CMX B;  5C23 A;  1MOV A;  3DHI C;  2WXG A;  2IO3 B;  1CV7 A;  2JY6 A;  1A70 A;  3CMM B;  2QEJ C;  2Y5C A;  2MLB A;  3JSV B;  5KTG A;  4KA9 A;  4FLH A;  3SV5 A;  2WSO A;  3GB1 A;  4F7Z A;  1FFV A;  2EMD A;  1JW9 D;  2I2Y A;  3ED8 A;  1UH6 A;  1JML A;  5D6J B;  1EMA A;  4NNJ B;  2MH7 A;  1KH0 A;  2CR5 A;  4CYE A;  1HQR D;  1TJE A;  3AE4 B;  1K8R B;  3PT2 B;  3R66 C;  4K1R B;  1RM9 A;  3KH0 A;  1HE8 A;  3RWA A;  4ZBL A;  4WH4 A;  3V60 A;  3SVD A;  5DQB A;  3U0K A;  4FHK A;  3T3O A;  1DOY A;  3ZUL A;  2CS4 A;  1JC1 A;  3BVZ A;  1R7S A;  2O6V A;  2XK5 A;  3R2I A;  4BKS A;  2JXX A;  5EXU A;  2D2Q A;  3Q3M C;  3KQ4 A;  4LNI A;  2ZPN A;  4WWN A;  4FN2 A;  3PV1 A;  3ZLZ A;  3B08 A;  1KJT A;  3SG5 A;  2AYO B;  3DQC A;  1EMB A;  3ETR A;  2IO1 B;  4OHJ A;  3KUD B;  3I5J C;  5BMG A;  2HDE A;  2LD9 A;  3UIO B;  4EZK A;  1E8W A;  3DVG X;  2YLM A;  2WP9 B;  5AZH A;  3VVW B;  2V3N A;  3N3K B;  4W6M A;  4K7S A;  4I6L B;  2MJD A;  4ICV A;  2W9N A;  3SVN A;  2N1W A;  3APD A;  1QF6 A;  2KO3 A;  1V49 A;  1FRD A;  3NY5 A;  1YFP A;  2FCQ A;  3W1Y A;  4IDI A;  4BFR A;  4Q7T A;  2DUE A;  1UBQ A;  2JX5 A;  4JGE A;  3S05 A;  4WWM A;  2MP2 A;  2L1A A;  3MP9 A;  2POX A;  5JZE B;  2X38 A;  4H47 A;  4HE4 A;  2QJL A;  1SIJ A;  4W9C A;  3UF8 A;  1GB4 A;  4TQ1 A;  1JRO A;  3B1L X;  4W69 A;  1VRA B;  2DWQ A;  4W74 A;  4YSZ B;  1AYF A;  4NJC A;  3ZO5 B;  3I19 A;  4ZF5 A;  2DZM A;  3UGB B;  4KSL C;  3L54 A;  3MJW A;  2N7J A;  3ZNH B;  3BXB A;  4FHJ A;  1JWM D;  3ZTC A;  2X8X X;  4DKN A;  1TS3 A;  4ANV A;  2N4F A;  2XK5 B;  2IGH A;  1Z5S B;  3ECI A;  3L4P A;  2QCZ A;  1WJU A;  3H7S A;  1TBE A;  3OG5 A;  1D4B A;  4P1Q A;  2PE9 A;  3MHS D;  3TCA A;  3E9S A;  3MFG A;  1GOZ A;  1WXA A;  1MOU A;  4H3M A;  2JYE A;  2XBB C;  3U0L A;  2SEB D;  4C4V A;  1WH3 A;  2KAN A;  3EKH A;  3UIN B;  3SVB A;  2WHU A;  2GI9 A;  3I3T B;  1FCL A;  1UEL A;  4JQW C;  4X57 B;  1XMZ A;  1B1Z A;  3PSE B;  2JWU A;  5DY6 A;  1L6U A;  3DQ2 A; 
#chains in the Genus database with same CATH homology
 2KDE B;  3SVO A;  3LJ3 A;  2QU1 A;  4IK8 A;  4E71 A;  3RZF A;  2KC2 A;  3U0M A;  2N7D A;  2Z1O A;  1HUY A;  1LXD A;  4OHS A;  3A1Q A;  1JBZ A;  2MP2 B;  3CFH A;  1XAE A;  5EJU A;  2ZCC A;  3VH4 B;  3ZNI D;  5HZO A;  3AUL A;  2VAD A;  3ZNZ B;  2JZZ A;  4WJP A;  3CD1 A;  2RSU A;  3PRZ A;  4PS8 A;  1JBY A;  1BT0 A;  1YHI A;  2Z6Z A;  4RMA A;  3TBL D;  2YE0 A;  2D3G A;  1YX5 B;  2A4Z A;  2DAJ A;  1V5O A;  4NWS A;  3M62 B;  2JUO A;  4IWQ A;  2HRS A;  4IG7 B;  4AUQ C;  4PYU A;  3SG2 A;  3G9A A;  3PTF C;  2Y5B B;  2ZVN A;  2I1J A;  3KYD D;  1EMC A;  2J0J A;  3DQ8 A;  5DCN A;  1GC6 A;  2AWL A;  3DPW A;  4FUL A;  2WWZ A;  1D3Z A;  3T9L A;  3VQI A;  2K8B A;  4B5Y A;  4H3L A;  3A9J A;  2ZMU A;  3QX1 A;  5IAA C;  4DDG D;  4B95 A;  4HQ8 A;  1E90 A;  4B30 A;  1NDD A;  3GJ1 A;  1C3T A;  4XOW A;  3H1O A;  3IR8 A;  1ZGU B;  3VHT C;  1A5R A;  3CD9 A;  4GIV A;  3A1Q B;  2HJ8 A;  2KQS A;  2MA9 B;  2M1M A;  3IG3 A;  3RWT A;  3EK7 A;  1KLV A;  1YJ2 A;  4JIO U;  1WXM A;  2KOX A;  4HK2 A;  4DBG A;  3PJ5 A;  3DVN V;  1WJ6 A;  5HZT A;  2BGF A;  3ML8 A;  3H6N A;  1J8C A;  2KWV B;  4ZRJ A;  2K1F A;  1I42 A;  2ASQ A;  2QLE A;  4BOS C;  2KMA A;  3L10 B;  3ML9 A;  3U8P A;  4H48 A;  4WWP A;  2VAE A;  1WXV A;  4W6B A;  5HZU A;  2A46 A;  2H8Q A;  3C0R B;  2EMS A;  4IWO A;  5DTL A;  5HBD A;  3GJ2 A;  3DQH A;  4DHJ B;  4BKG A;  1KP5 A;  3VTW A;  1I35 A;  2IBI B;  3E5T A;  2EMT A;  4CHK A;  4DXN A;  1G7K A;  2QZ0 A;  3RUL A;  3O78 A;  3LF3 A;  5J2R A;  1WM2 A;  5LTP A;  3X0W A;  4P76 A;  4XVP A;  3ZVV A;  1EO6 A;  5DPG A;  5HW9 A;  2IOV A;  3EVR A;  2KTF A;  2LXC A;  1WE6 A;  3A9J B;  4LJP B;  5HGE A;  4JRB A;  4I6P A;  3PPA A;  3EC8 A;  2FL1 A;  4W6L A;  4KW8 A;  5CHF A;  4AOF A;  1GG3 A;  1V5T A;  3EK4 A;  4W9I A;  2M8S A;  3DQO A;  3PRM B;  3CFA A;  4IK3 A;  2KXJ A;  2HTH A;  3GOE A;  4XX5 A;  3W1S C;  4GOB A;  2QLG A;  4TZA A;  3U8C A;  2GW3 A;  2OJR A;  5E6N A;  4W6P A;  4XC2 A;  1GFL A;  1WFY A;  4PYZ A;  1GNU A;  3U8A A;  4AJW A;  2QRF A;  3SVE A;  3DQD A;  2O29 A;  1X1M A;  4EUT A;  5BQL A;  2VRR B;  2AWT A;  2WHT A;  2YE1 A;  5DRF A;  4HXD A;  1YHG A;  2IO2 B;  2V4L A;  3TMR A;  3TJP A;  3U7D A;  4KZ0 A;  3AI4 A;  3EVP A;  4FAD A;  3DQK A;  2DZI A;  2C7H A;  2KWC A;  1WF9 A;  4IM0 A;  4JGH B;  4GSW A;  5DPI A;  3CB9 A;  3R3M A;  1UD7 A;  4J8A A;  5AZG A;  5TR5 A;  1V80 A;  2MX2 A;  4ASW C;  4MEM A;  4A3P A;  2CHX A;  3ZW3 A;  2AWM A;  2IYD B;  2FCN A;  2QLG B;  2HPW A;  3RT3 B;  2DX5 B;  4ANU A;  4DHJ D;  1GJZ A;  4HPL B;  4W73 A;  2LVP A;  2JRI B;  4N9F 4;  4N3D A;  3RYT A;  2G2S B;  2BWE S;  2RH7 A;  2DUG A;  2AEH A;  3H1U A;  2ZPY A;  3TIX A;  2OKY A;  1WX7 A;  3PGE A;  3OLM D;  2KZR A;  3JW0 X;  4LQU A;  3SD5 A;  4J89 A;  1UBI A;  2PPH A;  1V86 A;  2C60 A;  4G11 A;  5AZF A;  3ZKJ C;  5D7G A;  4HWI B;  1WZ3 A;  3GL4 A;  3VUX A;  2PEA A;  3LVD A;  2L8J A;  2Z6X A;  4OVV A;  2YVC A;  2GOW A;  3SHQ A;  3ZTD A;  5JH5 C;  4RYS A;  2DZJ A;  2NS5 A;  2C9W B;  2H6V A;  2L05 A;  1UGM A;  1E7U A;  2KDB A;  3SSP A;  3GEX A;  2KD0 A;  2G16 B;  4ICU A;  5FHV A;  2A54 B;  4W9E A;  2REX A;  5H89 A;  3UFZ A;  4LJB A;  4UTS A;  4KIK A;  5LK4 A;  2Z0E B;  1WYW B;  4W9J A;  5LXH A;  3H1R A;  1YIW A;  2IO0 B;  2P4M A;  2K25 A;  3ZIM A;  5D94 A;  4NY0 A;  3VK1 A;  3PJ7 A;  5DPJ A;  2MW5 A;  2LJ5 A;  1MG8 A;  4IK5 A;  2KVR A;  2DYO A;  4L12 A;  2AL3 A;  4BVU C;  2BPS A;  2NBU A;  4IUM B;  2KQ7 A;  2L7R A;  4DXQ A;  2BYF A;  3DQE A;  4M8N A;  4ZYN A;  2ICR A;  4KF5 A;  3P2B A;  4ZF3 A;  4W9G A;  4MGK E;  1KOT A;  3AKO A;  3ZRC A;  1WX9 A;  2C7M B;  4E74 A;  5H87 A;  2WHS A;  2EMN A;  5DRG A;  3OAW A;  5IA7 A;  1Q5W B;  3PLU A;  4MEL A;  1C4F A;  2G4D B;  3PS6 A;  1H6R A;  1EMM A;  5HKH A;  1XA9 A;  1ZGQ A;  4GU2 A;  4W6T A;  4WJN A;  4TQ0 A;  3VIC A;  4MDK E;  5LTR A;  4KIK B;  5E6P A;  4MJS A;  4W6G A;  4DHZ E;  4DXM A;  3EK8 A;  3M3J A;  5EHU A;  1TGZ B;  3SU8 X;  3RCZ A;  2OGR A;  3DQA A;  1V81 A;  4AJY B;  2RD0 A;  2FID A;  4LJD C;  1VCB A;  3E5V A;  4KEX A;  1YX6 B;  3PHX B;  4KGE A;  2IB5 A;  1QYF A;  2DDC A;  5BTT A;  2FZU A;  1WGH A;  3EVU A;  3LF4 B;  2A5U A;  2M4N A;  2A48 A;  1HCJ A;  2LRW A;  4KGF A;  2L3Z A;  2L0F A;  2OTB A;  2KLG A;  2MBO A;  1Q4D A;  2H5R A;  4U2V A;  4OQW A;  3LVA A;  3ST0 A;  2KX3 A;  3DQ6 A;  3DBL I;  1RLF A;  4EN1 A;  4XGY A;  3BX9 A;  4ZFS A;  1WGY A;  3IP2 A;  2K6Q A;  4LDT B;  4W77 A;  2BYE A;  1U4A A;  3SG6 A;  3K9P B;  2ZCB A;  3VHT A;  4M0W B;  2N9E B;  1Y8R C;  3WAL A;  2O24 A;  4GMV A;  2A53 B;  1RMP A;  3KUZ A;  4WAA A;  3SSK A;  2H5O A;  2GW4 B;  2FWQ A;  4WJQ A;  3NZS A;  3DQ7 A;  1WR6 E;  4MJS B;  5KHO A;  4MM3 A;  1B9C A;  3IHP C;  1V6E A;  2FCS A;  4B9K A;  2Q57 A;  4LQT A;  1R4N I;  3VXW A;  4W9H A;  1KYR A;  4BDU A;  4NJ7 A;  3CST A;  1JRU A;  3QAR A;  2MCN B;  2LI5 A;  5DQM A;  2GBR A;  4OGS A;  1XD3 B;  1MYW A;  3L17 A;  3KW5 B;  4BBN C;  2VVI A;  1GL4 A;  3SVS A;  5BTT B;  1WIA A;  2KX0 A;  2K6D B;  4EMQ A;  2Z59 B;  4W7C A;  2D11 A;  1WJN A;  1KYP A;  4W76 A;  1Z1P A;  2LXA A;  4R6B A;  2K8H A;  4ZDV A;  4DWF A;  2H9W A;  2KTR A;  4J88 A;  3SSY A;  2OKW A;  3VAW A;  2AL6 A;  2YFP A;  1H4R A;  1EF5 A;  3APF A;  2NBV B;  3EFU A;  2WIQ A;  3QCA A;  3ST3 A;  3NT3 A;  1RMO A;  5H88 A;  3DQN A;  2KJH B;  3LVC A;  1IP9 A;  2DUF A;  3VHT B;  1J19 A;  2AH8 A;  3RD2 A;  4DXA B;  4XZ4 A;  2H5Q A;  3GZN I;  2LWP A;  3AU4 A;  3Q3F A;  4XOV A;  2KNB A;  2BWF A;  3SVU A;  3AU5 A;  3W1S A;  4WJO A;  2KJR A;  1S1Q B;  2A47 A;  4GOC A;  2BTJ A;  4RM9 A;  4HDQ A;  3EHV A;  4K7U A;  1AAR A;  3IBE A;  3DVN U;  2KC1 A;  2C9J A;  2V3S A;  3DQ9 A;  2ZO6 A;  5DTY A;  3HIZ A;  4MGY E;  2ZVO A;  5CTR C;  3MGF A;  3ALB A;  4GB9 A;  2KTR B;  2ZMW A;  3DPZ A;  3CBE A;  2V1Y A;  2HE7 A;  4Z4K A;  3NHE B;  4K7W A;  1XT9 B;  2R2O A;  4LDT D;  2KWU B;  4PFE A;  4FJZ A;  4HCP B;  1XQM A;  2AHA A;  2IE2 A;  3NOB A;  4TZG A;  2Y0G A;  1ZW7 A;  2DEN B;  2CU1 A;  5DPH A;  1QY3 A;  4PS7 A;  3HK0 A;  3ZUN A;  3SVC A;  3WAM A;  4MGZ E;  4IZN A;  2FNJ B;  3M63 B;  4NQL B;  1T0Y A;  2D10 A;  2GBN A;  5FR6 A;  4EDO A;  2G45 B;  5CHW A;  3R7R A;  3NS8 A;  2FCM A;  2JT4 B;  3W1C A;  2G3Q B;  2O2V A;  2IB6 A;  3WLC A;  1UIS A;  4EZL A;  5E6O A;  4LW5 A;  4MH0 E;  4F1S A;  4M8M A;  4W9D A;  1W7S A;  4OVU A;  4FJV B;  1E8Y A;  3SG4 A;  2D07 B;  3O65 B;  1TZ1 A;  3DPD A;  4HLE A;  2QLH A;  3DVG Y;  4EFO A;  4W6D A;  3DQU A;  3PRP B;  4DXP A;  4KZC A;  2DHZ A;  4KDI C;  2DD9 A;  2N7E A;  3JYU A;  3M95 A;  4A20 A;  4GES B;  3KVF B;  3Q3J A;  3U8Z A;  2B3A A;  5JHA A;  4NQK E;  2GX2 A;  1ISN A;  2LGD A;  2LGX A;  1OEY A;  4B6W A;  3T8M A;  1SIF A;  2KDI A;  2MSE D;  2B3Q A;  2G4S A;  4JF9 A;  3L16 A;  4KDL B;  5EXB A;  3V6E B;  1V9J A;  2NPT A;  1RFA A;  2DYM A;  4DXO A;  1C1Y B;  2K8C A;  2O2V B;  3WAO A;  4GF6 B;  4JFG A;  3QQ8 B;  4JC2 A;  2G6Y A;  5DTZ A;  2GX0 A;  3UQB A;  3BXA A;  4W6N A;  5L95 C;  2JZ3 B;  1EML A;  4KW4 A;  4ZF4 A;  1OXD A;  4W6C A;  3ZUJ A;  1WGG A;  5DPT A;  3UIP B;  2ZNV C;  2MWS B;  1KYS A;  4E3C A;  3SST A;  3DQF A;  3ST2 A;  3ZDM C;  2LZ6 A;  2OOB B;  2DAF A;  3UG0 A;  3QC8 B;  3OJ4 B;  3NT9 A;  3V62 A;  4W72 A;  2OTE A;  3NEZ A;  3U0N A;  4W7X A;  1SGH A;  4OY4 A;  4JEO A;  3B0A A;  1QZE A;  2L00 B;  1LQB A;  3DQL A;  3DBR I;  5C1Z A;  2KJ6 A;  1YQB A;  3V3D A;  3VFK A;  2WDT B;  1E8X A;  2NPT B;  2V4E C;  1Q0W B;  3ZUF A;  1ZKH A;  4Q7R A;  1EMG A;  3LA1 A;  2DDD A;  1BFP A;  3EKJ A;  4ANX A;  3BY4 B;  1RAX A;  2CHW A;  4HQ9 A;  3DQ1 A;  2IZV B;  4AP4 C;  4DHZ B;  3SG3 A;  4II2 B;  2KLC A;  2HGY A;  4ANJ A;  3R7Q A;  2MBE A;  3EEC A;  1W7U A;  2GBJ A;  1RRB A;  5J2O A;  2JRH A;  3DQJ A;  1F0B A;  2QHO A;  4LJD A;  4PPJ A;  4DXI A;  3VTU A;  2MBB B;  5DPS A;  3WIM A;  2G3O A;  2NCN A;  2KHW B;  3TMP B;  4W6A A;  2KKC A;  4IC7 B;  1QYO A;  3HM3 A;  4BOZ B;  4ANW A;  3WCK A;  2NVU I;  3E5W A;  1OGW A;  4IW0 A;  2PE6 B;  3KCT A;  1ZGP A;  4Z4M A;  2GMI C;  3A8S A;  3S2A A;  4J6I A;  3M24 A;  1IYF A;  1S3S G;  2WUR A;  2M17 A;  2C5L C;  4KW9 A;  2DYB A;  4F8C B;  4JL9 A;  4TKN A;  4HVB A;  4W9L A;  5AQB B;  3QJZ A;  4IM2 A;  5EBJ A;  2JF5 A;  3VTV A;  3P8U A;  4PPL A;  3DOW A;  4NAW A;  4NPN A;  1OXE A;  2KN5 A;  1YD8 U;  4RYW A;  4W6J A;  4LCD E;  2EMO A;  1WRD B;  2J0K A;  1Q1O A;  2B3P A;  4I2Y A;  3MTN B;  3JVZ X;  1WE7 A;  2VVJ A;  2HJO A;  4R6D A;  1FXT B;  4AS8 A;  2FUH B;  3UQA A;  2FIF A;  3PVL A;  4ZIN A;  3WA0 A;  2L0T A;  2WYQ A;  3DQI A;  5D2M B;  1OTR B;  3ST4 A;  2ZZP B;  1M94 A;  4I6N B;  5EDS A;  5FVF A;  3VUW A;  1F09 A;  5J18 A;  3ZRF A;  3GB3 A;  4BBN F;  3P28 A;  4XL5 A;  5T3I A;  4IK9 A;  5CHV C;  2KFK A;  4ORN A;  1OEY J;  1Q73 A;  3U30 A;  2IY1 B;  4HJK A;  4AWJ A;  2HFC A;  2Q6P A;  4W9F A;  3WLD A;  3KUC B;  1P1A A;  5EB6 A;  2PXW A;  4HPM B;  2BF8 B;  2O6V B;  3QAQ A;  4KF5 C;  4ZIO A;  2NBW B;  4JLC A;  4EZJ A;  4NAW B;  3V61 A;  1TTN A;  1P0R A;  4RTC A;  4W6O A;  2N9X A;  1EMF A;  3IFW B;  3VDZ A;  3OSR A;  5L83 A;  2HCG A;  2JVC A;  2ZO7 A;  3ONS A;  5LXI B;  4EEW A;  2ZJD A;  3QHT A;  2DUI A;  2KMC A;  4FBJ B;  3DQM A;  4KPI A;  2A52 B;  4W6F A;  1GC7 A;  1YJF A;  2IY0 B;  1OQY A;  2H5P A;  1Q4C A;  4ZRK A;  3PLV A;  4W7E A;  3SRY A;  1S6Z A;  2WIS A;  3BXC A;  3CSF A;  2G6E A;  2J7Q B;  2KFK B;  5BO4 B;  2O2B A;  2K39 A;  2A50 B;  4A3O A;  3RUI B;  3RZW C;  3TL5 A;  1UZX B;  2JPH A;  5J17 A;  2BYV E;  5DPR A;  1WMH A;  1YHH A;  1ZGO A;  4HVF A;  2OJK A;  5AEK B;  4TUU A;  3DQV A;  4GGQ A;  3ENE A;  1WI0 A;  4Q9W A;  4W75 A;  3KYC D;  2MQJ A;  1Q4B A;  3SSH A;  1NI2 A;  2KFJ A;  4AR7 A;  2CKH B;  2HD5 B;  4GDL A;  4K81 A;  4W7D A;  4LJC A;  1EME A;  2DD7 A;  5F9G A;  3DDC B;  2DZK A;  1XQQ A;  4IWP A;  1WR1 A;  2ZEQ A;  4HCN B;  1SE9 A;  2LVQ A;  4GDK A;  2N9P C;  3A33 B;  2A56 B;  2J0M A;  2MRP A;  3A9K A;  1Q4A A;  3APC A;  1G6J A;  4EOY A;  4WWO A;  2KK8 A;  1EUV B;  2LVO A;  4IK1 A;  3V6C B;  1QYQ A;  3SSL A;  2PXS A;  2KDF B;  1QXT A;  3LDZ E;  2LAS A;  3PRE A;  2G3D B;  1Z2M A;  2N1V A;  4L1I A;  3L08 A;  4W7R A;  5EXC I;  2GBM A;  4FJY A;  2M0X A;  4GN1 A;  2BKF A;  4HQC A;  4BKT A;  3QK0 A;  4KVG B;  1EMK A;  4RM8 A;  4GXB A;  2O6V D;  1WMH B;  4II3 B;  1GGX A;  4IK4 A;  3NF0 A;  4BKS D;  4FA6 A;  1RMM A;  1L7Y A;  3X23 A;  1WXS A;  3N30 A;  3AI5 A;  3TMT A;  2MBQ A;  1RRX A;  4ZRI A;  4LJO B;  4W6R A;  4IM3 A;  4GDL B;  4Q9X A;  4G3X B;  4MSM B;  2L76 A;  1WGR A;  3ZDT A;  1E8Z A;  5LLI A;  4MGI E;  1R4M I;  3K1K A;  1LFD A;  2WSN A;  4GDK B;  2LRU A;  4DDI D;  4P7I A;  3A9K B;  4TV3 A;  2BKR B;  1WM3 A;  3SG7 A;  4W7A A;  1H8C A;  3D32 A;  2JAD A;  2C7N B;  3DCG A;  3PJB A;  2UYZ B;  4B30 B;  2R2Q A;  3A4S C;  3O77 A;  1F9J A;  2XEW A;  4KV2 A;  3QWZ B;  4KAG A;  5KHQ A;  3CFF A;  3DQ4 A;  2AWK A;  2ARL A;  5BT0 A;  3ZTF A;  2NR2 A;  4KF4 A;  3OJ3 A;  2AWJ A;  2RR9 A;  1W7T A;  5HZS A;  4L13 A;  1LM8 B;  2CHZ A;  3PHW B;  3NED A;  5FVG A;  2UWQ A;  1J0G A;  4H3N A;  2C9I A;  3WAN A;  1P9D U;  2Z6Y A;  5DU0 A;  1GUA B;  4Q7U A;  3M22 A;  3BIN A;  5DTX A;  3DQ5 A;  2WX0 A;  2EKE C;  4CO7 A;  4DK5 A;  3H7P A;  1H4U A;  2YDZ A;  2HQZ A;  2LUE A;  4W6U A;  5G2N A;  3CGL A;  3PIB A;  4DKM A;  3OGO A;  2V4E A;  1E7V A;  4G50 A;  4W7F A;  2QT2 A;  2VVH A;  2I1K A;  4EKU A;  2VZX A;  1OXF A;  4W6K A;  1E5W A;  3ZNG C;  5G55 A;  3DBH I;  3QIJ A;  5CX3 A;  2GBK A;  4YL8 A;  4PPK A;  2HGD A;  4KSK C;  1WGD A;  3N32 A;  3SVR A;  2FAZ A;  3PZD A;  1KM7 A;  2LGY A;  1WZ0 A;  3DPX A;  3VH3 B;  2ZNV B;  1NBF C;  4HDO A;  3AXC A;  2DUH A;  4WQO B;  3ADF A;  3CF6 E;  4W6S A;  3K9O B;  1Q4E A;  3DQ3 A;  3H9D A;  3JSV A;  1EF1 A;  2G5Z B;  3NZU A;  3IVF A;  5EB7 A;  4MSQ B;  3HHM A;  3H7P B;  1JC0 A;  2MBH A;  3OSQ A;  4EUL A;  1IPG A;  4ZB1 A;  2V4E B;  1WY8 A;  1YZW A;  1P98 A;  1WX8 A;  3SDL C;  4URK A;  3L0W B;  2QLI A;  1V2Y A;  1VD2 A;  5JHB A;  2PJH A;  1PQS A;  2RGF A;  4EDS A;  4NJ6 A;  5FVI A;  3L13 A;  1P3Q U;  1ZUX A;  2RPQ A;  3WAP A;  3A4R A;  5LTQ A;  3LSA A;  3EVV A;  3QA8 A;  3DBS A;  3HM6 X;  2HQK A;  4W9K A;  1L2N A;  1Z1Q A;  3SS0 A;  4OJ0 A;  1WJ4 A;  3VUY A;  1YJ1 A;  5GMV A;  5DPW A;  4PS3 A;  1XSS A;  2WX1 A;  4W6H A;  4W6I A;  3SSV A;  3KCS A;  2G6X A;  4G0N B;  3LS3 A;  3W1D A;  2Z0D B;  2JWZ A;  1CMX B;  5C23 A;  1MOV A;  2IO3 B;  1CV7 A;  2JY6 A;  3CMM B;  2MLB A;  3JSV B;  5KTG A;  4KA9 A;  4FLH A;  3SV5 A;  2WSO A;  4F7Z A;  2EMD A;  3ED8 A;  1UH6 A;  5D6J B;  1EMA A;  4NNJ B;  2CR5 A;  4CYE A;  1K8R B;  3PT2 B;  3R66 C;  4K1R B;  1RM9 A;  3KH0 A;  1HE8 A;  3RWA A;  4ZBL A;  3V60 A;  3SVD A;  5DQB A;  3U0K A;  4FHK A;  3ZUL A;  2CS4 A;  1JC1 A;  2O6V A;  2XK5 A;  4BKS A;  2JXX A;  5EXU A;  2D2Q A;  2ZPN A;  4WWN A;  4FN2 A;  3PV1 A;  3ZLZ A;  3B08 A;  1KJT A;  3SG5 A;  2AYO B;  3DQC A;  1EMB A;  2IO1 B;  3KUD B;  2LD9 A;  3UIO B;  4EZK A;  1E8W A;  3DVG X;  2YLM A;  3VVW B;  5AZH A;  3N3K B;  4W6M A;  4K7S A;  4I6L B;  4ICV A;  2W9N A;  3SVN A;  2N1W A;  3APD A;  2KO3 A;  1V49 A;  3NY5 A;  1YFP A;  2FCQ A;  3W1Y A;  4BFR A;  4Q7T A;  2DUE A;  1UBQ A;  4JGE A;  3S05 A;  2MP2 A;  2POX A;  5JZE B;  4H47 A;  4HE4 A;  4W9C A;  3UF8 A;  4TQ1 A;  3B1L X;  4W69 A;  4W74 A;  3ZO5 B;  3I19 A;  4ZF5 A;  2DZM A;  3UGB B;  4KSL C;  3L54 A;  3MJW A;  3ZNH B;  3BXB A;  4FHJ A;  3ZTC A;  4DKN A;  4ANV A;  2N4F A;  2XK5 B;  1Z5S B;  3ECI A;  1WJU A;  3H7S A;  1TBE A;  4P1Q A;  2PE9 A;  3MHS D;  3TCA A;  1WXA A;  1MOU A;  4H3M A;  2XBB C;  3U0L A;  1WH3 A;  2KAN A;  3EKH A;  3UIN B;  3SVB A;  2WHU A;  3I3T B;  1UEL A;  4JQW C;  4X57 B;  1XMZ A;  3PSE B;  5DY6 A;  3DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...