3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, transcription
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
3RCZA 2J0MA 2MX2A 2KO3A 4FJYA 3N32A 4DK5A 2KJHB 2G16B 4IM2A 5DTLA 2JRHA 1RM9A 1WMHB 4DDID 2Z6XA 4AS8A 2FZUA 3SVNA 3G9AA 3PJ5A 3DQUA 1RMPA 3E5TA 2REXA 5EHUA 4W9IA 4W6KA 4W7CA 5H87A 4IUMB 1J0GA 3SVDA 2ZPNA 4EEWA 3U7DA 3WAOA 3WA0A 2Q57A 2YVCA 3LSAA 3QWZB 4IK1A 2VADA 5KTGA 4KZCA 4DXPA 3LS3A 3B08A 1WJ4A 4W7EA 3GB3A 2L7RA 4XGYA 1Q1OA 4I2YA 2LZ6A 2HQZA 1P3QU 2K1FA 3V6EB 2HD5B 3TMTA 2LRUA 1WGRA 4DXAB 5EXBA 2ZVNA 2QRFA 5EJUA 1JBZA 4J6IA 3ZTDA 1W7UA 3L13A 1EF1A 2KQSA 2DZKA 2LVPA 2ZMUA 5E6NA 5L83A 3ZNZB 4W6GA 2EKEC 4B9KA 3EKJA 3MJWA 4DXIA 2UWQA 2KDFB 3VHTC 2V4EA 3RZFA 2CR5A 2K8BA 4JGHB 2QLHA 1IPGA 2G6EA 3IR8A 1V5TA 1Z2MA 1X1MA 3ZIMA 3APDA 1QYOA 3K9PB 3GOEA 4NJ6A 3NY5A 2YE1A 3H7PA 3NF0A 4NAWB 5F9GA 5BTTB 2C9IA 4HK2A 2HJOA 2JF5A 2N4FA 4DXOA 1WGHA 4XL5A 2KC2A 3V61A 3QCAA 2XBBC 1MYWA 1QZEA 3EC8A 4MGIE 5EXCI 2KOXA 2A46A 4PS8A 5LXHA 4W6JA 3ZDTA 2DDDA 2RPQA 3ZNID 1UISA 5TR5A 2GW4B 2KWUB 4Z4KA 4H48A 5J2RA 3W1YA 1TGZB 3TJPA 3DQHA 2NBVB 3IVFA 4GDKB 1FXTB 4AJYB 2GX0A 3ST3A 4W9CA 1OXEA 4JF9A 3CB9A 2QLGA 3UF8A 1E8XA 3SRYA 5AQBB 3QJZA 3UIPB 1P0RA 5CHFA 3LVCA 5JHBA 4MJSB 3LVDA 3CSFA 4NJ7A 3AI5A 1TTNA 4BOSC 3N30A 5C23A 3JSVB 1WYWB 2FNJB 2VVHA 3RWTA 2VVJA 1S1QB 3RT3B 3CF6E 2CHZA 3DPZA 2G3OA 3PHXB 4CYEA 3LVAA 2ARLA 2V4EC 2DAJA 3JW0X 5J18A 4IZNA 3C0RB 3IFWB 3R3MA 3T9LA 3DQFA 3SVSA 1HE8A 3LF4B 3DOWA 1LXDA 3KCSA 3BINA 5IAAC 2G4DB 1LM8B 4MH0E 1YHGA 1YD8U 2JY6A 2YFPA 4ZFSA 3QK0A 3TIXA 1B9CA 1XD3B 4FN2A 2JPHA 3RD2A 3DPWA 3OAWA 2Z0EB 4WJQA 3A1QB 3H6NA 3U8AA 2IBIB 2FL1A 2VZXA 5J17A 1YJ1A 3DQDA 3WLDA 4W9GA 3QC8B 4W6SA 4GXBA 5E6PA 4I6NB 1UH6A 2IB6A 5AZGA 2M4NA 3SG3A 4W9LA 1WX8A 3PPAA 4TQ1A 2I1JA 1KYSA 2KFJA 4EZJA 3AXCA 2BWES 1WJ6A 5DPTA 5DRGA 3PSEB 3PGEA 1WR1A 2KHWB 3BXBA 3NT3A 4PS7A 2OTBA 4W6IA 4LDTB 2WIQA 2BKFA 1CMXB 2O2VB 3X23A 4BKSD 2PPHA 3OJ4B 3R7QA 2D2QA 1EMEA 4MELA 2AHAA 3E5WA 3KVFB 2JRIB 2LGXA 2N7DA 4IG7B 4K81A 3IP2A 3OJ3A 3B0AA 3GEXA 3M95A 4EOYA 2PXSA 3ZULA 4URKA 3VHTB 4LQUA 3CSTA 4HQCA 4ZF5A 1V9JA 1YIWA 1OEYA 2MWSB 3APFA 2H5OA 2QZ0A 3GL4A 3P8UA 4IK3A 5EDSA 1E8ZA 2L76A 4NWSA 4EULA 2AWJA 3H1OA 5DPGA 2KX0A 3TL5A 4LCDE 1P98A 3JYUA 2KJRA 4W72A 4MSQB 3TMPB 4KSLC 3ZTCA 3AKOA 4ORNA 1ISNA 2KMAA 1V80A 1Z1QA 3ST4A 2K6QA 3ONSA 3EK7A 4DKMA 3JVZX 4AUQC 1MOVA 5LTQA 4DXMA 3M3JA 2WHTA 3X0WA 5FR6A 1I42A 2FCMA 3HHMA 1RMMA 3PVLA 2V4EB 2FCQA 2MBEA 4RMAA 3U0NA 4B5YA 5L95C 3DBHI 4W6FA 1WI0A 2DZMA 5LLIA 4H3NA 5G55A 4LJOB 1AARA 4EZKA 1XMZA 4XVPA 1EO6A 2BWFA 2XEWA 3HM6X 2IO0B 3MGFA 1WXAA 5DPJA 4XOWA 1V2YA 4EN1A 5CX3A 3ZRFA 1LQBA 4WWOA 2C5LC 4EKUA 2W9NA 4OQWA 1R4MI 2AWKA 3ECIA 2HJ8A 3VUYA 4W74A 4ZF4A 3M63B 1SE9A 1L2NA 1UBQA 1OTRB 2MQJA 3AULA 4W6NA 1EMKA 4W6RA 3ENEA 4JGEA 2H9WA 3PJ7A 2ZZPB 2Y0GA 1M94A 3DQNA 3L16A 3VH3B 4W6OA 2MW5A 1XT9B 2DZIA 4N3DA 5DPSA 5DU0A 2WYQA 5AZHA 4ICVA 3PT2B 3L10B 5E6OA 1KOTA 5DCNA 3KW5B 4HDQA 2IO3B 4MDKE 2DHZA 4ZBLA 5KHQA 3NEDA 4ZB1A 2WX1A 3GZNI 3NZSA 5KHOA 4KF4A 4W76A 3L54A 4II2B 3LA1A 4WWPA 4A3OA 4IK4A 4WJNA 4LJDA 4ZYNA 1WRDB 1UD7A 2RR9A 2AL6A 3A4SC 2AWMA 3D32A 1F9JA 4PYUA 5FHVA 1G6JA 1Q0WB 3O77A 3B1LX 1QY3A 2C7HA 3SG7A 1WFYA 2N1VA 1F0BA 2JT4B 3A1QA 5FVGA 1EMMA 3WAPA 2OJKA 2O6VB 2MBHA 2ASQA 4WWNA 3ZO5B 2BPSA 3ZUFA 3VTVA 4BFRA 2AH8A 2BGFA 2KLCA 2P4MA 3ZUJA 2LD9A 4OVVA 1IYFA 4XOVA 1YFPA 2HCGA 3RZWC 2ZJDA 3VK1A 3SSTA 1MOUA 3QIJA 1YHHA 2D07B 4W9EA 2ZVOA 2UYZB 4JLCA 4AR7A 3EECA 2MSED 4PYZA 2ZMWA 1GJZA 2O24A 4EFOA 4U2VA 2O2VA 4BOZB 4NAWA 4FBJB 5D7GA 3OSRA 2OJRA 2IB5A 1UELA 5HZTA 1Z5SB 3U0KA 2ZO6A 4K7UA 3KYCD 3IBEA 4W6BA 1YX5B 2NVUI 2DD9A 4ANWA 2DUEA 3N3KB 1EMLA 2OKYA 2YDZA 4MSMB 2BYVE 3HK0A 4ANUA 4HPMB 3EK4A 3DCGA 3CMMB 3DPXA 3ALBA 2POXA 5DTXA 2WSOA 3TBLD 3VUWA 2K8HA 4W6LA 4NQKE 1SGHA 2FWQA 4ANJA 4DHJD 4W6HA 3M22A 1KM7A 2DUGA 3DQ6A 4KPIA 2A54B 4WJOA 1BT0A 1GFLA 5DPRA 4RM9A 2KTRB 3ZKJC 2D3GA 1OEYJ 1BFPA 2GBNA 4JL9A 3TMRA 4GDLA 1ZW7A 5JZEB 2K8CA 3KUZA 5CTRC 5JH5C 2L00B 1OGWA 1HCJA 4GGQA 4MGKE 2ZPYA 1W7TA 3I3TB 2DYOA 3SG4A 1WGYA 4OY4A 4HE4A 2A53B 3BXAA 2XK5B 3S05A 4HVBA 2NBWB 2Z59B 4KDLB 2O29A 1EMGA 3SVCA 4CHKA 2B3QA 3CGLA 5AEKB 3K9OB 4Q7UA 3EVUA 4DBGA 2BYFA 3R7RA 3ZNHB 5EB6A 1Q73A 1WX7A 1WGGA 3SSPA 5H89A 1ZGOA 4OGSA 3RULA 4ANXA 4IC7B 2HGYA 3T8MA 4PPJA 2O2BA 1GUAB 3L0WB 5D6JB 2C7NB 2DUFA 4JEOA 3EVRA 4E74A 5LK4A 2KK8A 5IA7A 3NEZA 4H47A 1P9DU 4ZF3A 1WJNA 4AJWA 3WANA 4IK5A 1F09A 4W6MA 4ZINA 2DYMA 1RLFA 2HPWA 3DQLA 1E7UA 5D94A 3AU5A 1C1YB 4BBNF 1NI2A 1QYFA 3W1SC 2JZ3B 4HLEA 2KVRA 3L17A 3I19A 4NPNA 1S6ZA 1WE7A 2PJHA 1Q4EA 5H88A 4J89A 4W75A 5HZOA 4P76A 3VAWA 1R4NI 2QT2A 3TCAA 2AEHA 3RYTA 4H3LA 2GW3A 4K7WA 3DQ3A 2M17A 3SVOA 4KIKB 4W69A 3H1UA 1TZ1A 3SSVA 5BT0A 1VCBA 5HZSA 4IW0A 4LJCA 4FLHA 2BTJA 4XZ4A 2LRWA 4W9JA 2L8JA 4W6TA 3RUIB 2FCNA 3WCKA 2A50B 2J7QB 1WY8A 4ZIOA 2EMOA 4F7ZA 2QHOA 3LJ3A 2IY0B 4KAGA 2D10A 3PTFC 3NZUA 2PE6B 2H6VA 2G3QB 4NQLB 4DWFA 3ZUNA 4PPLA 3L08A 2PXWA 1S3SG 2HTHA 3H7PB 2R2QA 3VQIA 4KVGB 5HW9A 2FIDA 4K1RB 1V5OA 4IK8A 1Q4CA 1JBYA 2KJ6A 2WX0A 2HRSA 5HKHA 4G3XB 3W1CA 4KSKC 2A48A 5HBDA 4ZDVA 1ZGQA 2LUEA 1WM2A 2GX2A 2NR2A 4M8NA 4MEMA 4OHSA 4DHZB 5BQLA 3UINB 4Q9WA 2A52B 1KP5A 4EZLA 4B95A 4DKNA 3VXWA 3ML9A 1JRUA 3ZLZA 1J8CA 1OXFA 5DPWA 3PV1A 4EUTA 1HUYA 3IG3A 2IE2A 1H4RA 3A4RA 1W7SA 3UG0A 1E8WA 2KX3A 3SSKA 1K8RB 4J8AA 1SIFA 3VICA 4W9HA 2BYEA 3BY4B 2MP2B 4HJKA 3H9DA 2KMCA 5T3IA 5DPHA 3DVNV 2IZVB 4BKTA 3WLCA 4R6BA 5EBJA 3QHTA 2Q6PA 3CFAA 2NBUA 2IY1B 2ZO7A 4XC2A 5DQMA 4RYSA 2OGRA 3KH0A 2DZJA 3A9KB 2BF8B 3ADFA 3SSHA 2N9PC 3BX9A 4KEXA 3V3DA 4TZAA 2HE7A 2FIFA 2MBBB 3IHPC 4PS3A 3PJBA 4LQTA 4NNJB 2YE0A 3PZDA 5HZUA 3ZTFA 4W6DA 4W7XA 2GBMA 4L12A 2RSUA 1XSSA 2QLGB 4GIVA 4Q7RA 3LF3A 4GMVA 1TBEA 4GDLB 3EK8A 4GDKA 3CFHA 2IO1B 3JSVA 2B3PA 2DD7A 1KYRA 2D11A 5J2OA 4MM3A 4BVUC 1V81A 4W6CA 1RMOA 4WQOB 2AWTA 4JRBA 2WHUA 1WH3A 3KUDB 2K6DB 4TQ0A 2EMTA 1WZ0A 3SG2A 2Z6YA 3ST0A 4IM0A 3KCTA 2G3DB 1YHIA 1YJFA 4ZRIA 3DQVA 3V60A 4G50A 3UQBA 3QQ8B 2CHWA 4DHZE 4HVFA 4DXNA 4W6AA 4CO7A 2C9WB 2KQ7A 4GESB 3U0LA 1WIAA 4LJBA 2RD0A 5D2MB 1KJTA 2YLMA 3SD5A 3EVPA 2LGDA 4N9F4 4DHJB 1YJ2A 1ZGUB 2WISA 2WSNA 2CHXA 1RRXA 2A4ZA 3U8PA 5HGEA 4RTCA 1OQYA 1EMFA 2HGDA 3EFUA 1YZWA 2EMDA 2L0FA 3P28A 5EXUA 4RM8A 3DQ1A 4KDIC 2Z1OA 3R66C 3A9JA 4TUUA 3W1SA 4WAAA 2KWVB 4JQWC 4A20A 3VUXA 3DBRI 5FVFA 2IO2B 4W9DA 5LTRA 4FHKA 2LWPA 3H7SA 2AYOB 2KD0A 2J0JA 2IYDB 3SVUA 3DVGX 3OGOA 1QXTA 4W6PA 2BKRB 2AWLA 4F8CB 2KKCA 1E8YA 5DTZA 4W7RA 2G6XA 4P7IA 2N1WA 1ZGPA 3A8SA 2H5PA 1Q4BA 3OLMD 2EMNA 4MGYE 4DXQA 1V49A 1WM3A 4JFGA 2EMSA 1G7KA 4KIKA 1EMBA 2ICRA 4H3MA 4HWIB 2DYBA 4ANVA 1WR6E 3PHWB 2H5QA 5CHVC 3DQOA 2ZCBA 4EDOA 2H8QA 3DQKA 1WGDA 4W77A 2LVOA 5EB7A 2MP2A 4W6UA 1XQQA 3VH4B 1WE6A 1EUVB 2NPTA 2KN5A 2HQKA 2MCNB 3DQJA 4EDSA 2MRPA 4BBNC 2DUHA 2O6VD 1UZXB 2Z0DB 2CKHB 2KZRA 3P2BA 1L7YA 4HCPB 1WJUA 4EMQA 3DQAA 2ZNVC 1VD2A 4X57B 1LFDA 2WURA 3NS8A 1J19A 3A33B 2ZNVB 4TKNA 4F1SA 1GC7A 1H6RA 2DX5B 4PPKA 3SU8X 1C4FA 4KGEA 2A5UA 4WJPA 4BDUA 2LJ5A 2NCNA 2O6VA 4KGFA 1A5RA 3EVVA 2KFKB 1OXDA 3DDCB 3AI4A 1E7VA 3QAQA 1EF5A 2JVCA 4FJVB 4HDOA 4HQ9A 2XK5A 4RYWA 4FULA 2V3SA 3AU4A 4I6PA 2RH7A 2KANA 3BXCA 2R2OA 4Q9XA 2GBKA 2OTEA 2A47A 4L13A 3VTUA 2G4SA 3EHVA 3O65B 5AZFA 2PE9A 4MGZE 2NS5A 2KLGA 2PEAA 4DDGD 4XX5A 2GMIC 3DQMA 5BTTA 1Q5WB 1ZKHA 3CFFA 3O78A 3SV5A 1YQBA 2K39A 2RGFA 4W9KA 3DQCA 3DQ7A 2C9JA 2LI5A 2VVIA 2M0XA 4KW4A 4AP4C 2L3ZA 3DQ5A 1GNUA 5JHAA 4HPLB 5C1ZA 2KC1A 3SG5A 3SSYA 1D3ZA 2LXAA 2JXXA 2OOBB 1JC0A 3RWAA 3PS6A 3VHTA 3ZW3A 4E71A 3U0MA 3PRMB 4W9FA 3UFZA 4P1QA 5FVIA 3UGBB 2AL3A 3QARA 1XQMA 4W7FA 4G0NB 2DAFA 3ZVVA 2ZCCA 2KDEB 1P1AA 4KZ0A 3QX1A 3PLUA 2LVQA 4HQ8A 3ZNGC 4FHJA 4KW8A 4W7AA 1NBFC 3DBLI 4OVUA 3VFKA 2V1YA 4UTSA 2NPTB 4R6DA 4W7DA 2KTRA 3SSLA 3SS0A 3SDLC 2KFKA 2V4LA 2JADA 5DPIA 3ED8A 2N9XA 1ZUXA 2KDIA 3UQAA 3WAMA 3E5VA 1GC6A 2QLEA 2M1MA 4G11A 1Z1PA 3V6CB 4HCNB 2C60A 3K1KA 4HXDA 3LDZE 5DTYA 4GSWA 3PREA 3PIBA 2KWCA 2KTFA 2KNBA 4GOCA 4M0WB 3U8CA 4LJDC 3PLVA 2DENB 2VAEA 1YX6B 3NT9A 2LASA 5DY6A 2MBQA 2KXJA 4J88A 4KA9A 3A9JB 3SVBA 1V6EA 1Q4AA 3HIZA 1I35A 5LXIB 4JC2A 2Z6ZA 3ZDMC 5DRFA 4KF5A 3QA8A 3OSQA 1WXVA 1KLVA 1XA9A 4II3B 1C3TA 1E5WA 2G2SB 1Q4DA 3M62B 3HM3A 2FCSA 4FJZA 2VRRB 4Q7TA 3VDZA 2Y5BB 3DQ8A 1WX9A 5G2NA 1GG3A 1WXMA 3SVEA 1UBIA 3KYDD 3GJ2A 1WF9A 1EMCA 4B30A 3CD1A 1RAXA 3ZRCA 1H8CA 1KYPA 2QU1A 3EKHA 4L1IA 2G45B 2DDCA 3Q3FA 4LJPB 1CV7A 4K7SA 1T0YA 4BKSA 2JUOA 2DUIA 2GOWA 3NOBA 1NDDA 2N7EA 2G5ZB 2QLIA 1RRBA 4AWJA 4FA6A 3U30A 1XAEA 1WXSA 3SVRA 1RFAA 4MJSA 3H1RA 1JC1A 2OKWA 4LW5A 2GBJA 4A3PA 5LTPA 1UGMA 3DQ9A 3KUCB 1EMAA 4NY0A 2HFCA 4AOFA 4GF6B 2N9EB 4JIOU 3U8ZA 1GL4A 4PFEA 3VVWB 4OJ0A 3WIMA 2KDBA 3DBSA 1U4AA 3V62A 4GU2A 3DQ4A 2JWZA 4W73A 2L0TA 4IWOA 3MTNB 2B3AA 2M8SA 1QYQA 2JZZA 2H5RA 4ZRKA 3NHEB 4E3CA 1V86A 3GJ1A 4YL8A 4GN1A 3MHSD 4LDTD 3DVGY 4ICUA 5BO4B 3WALA 3PRPB 1GGXA 4KW9A 2C7MB 3CBEA 2CU1A 4IWQA 2MLBA 3CD9A 3UIOB 2LXCA 4IM3A 3S2AA 2L05A 4IWPA 1H4UA 4TZGA 2CS4A 3M24A 3ML8A 3DQIA 4IK9A 2IOVA 4Z4MA 2G6YA 4TV3A 4M8MA 2A56B 2K25A 3PRZA 1IP9A 3SHQA 2WWZA 2I1KA 1MG8A 4I6LB 3W1DA 1PQSA 4KV2A 3DPDA 2FAZA 4B6WA 4FADA 5CHWA 5DQBA 4BKGA 3A9KA 2MBOA 2ZEQA 3APCA 4ASWC 1Y8RC 2J0KA 4ZRJA 1WMHA 4KF5C 3DQ2A 3VTWA 4GOBA 2GBRA 2WHSA 2MA9B 3DQEA 4B30B 3ST2A 3SG6A 4GB9A 5GMVA 2LGYA 1WZ3A 1E90A 3Q3JA 3DVNU 2WDTB 2FUHB
chains in the Genus database with same CATH superfamily
3RCZA 2J0MA 2MX2A 2KO3A 4FJYA 3N32A 1R7SA 4DK5A 2KJHB 1R4MB 2G16B 4IM2A 1RYJA 5DTLA 2JRHA 3T3NA 1RM9A 2M19A 1J7CA 1WMHB 4DDID 2L52A 2Z6XA 4AS8A 2FZUA 3SVNA 2JYEA 4H2AA 4A6QA 3G9AA 3PJ5A 3DQUA 1RMPA 3E5TA 2REXA 5EHUA 4RCOA 4W9IA 4W6KA 4W7CA 5H87A 3FAHA 4RH6A 4IUMB 1J0GA 3SVDA 2ZPNA 4EEWA 2WXIA 1ZDVA 3TEXA 3U7DA 3WAOA 1FMAD 3WA0A 2Q57A 1N60A 3N9YC 2YVCA 3LSAA 3QWZB 4LNFA 4IK1A 2VADA 1C78A 5KTGA 3Q6BA 4KZCA 3AMZA 4DXPA 3DWMA 2MJDA 3LS3A 1B1ZA 3B08A 1WJ4A 4W7EA 3GB3A 2WQYB 1DOYA 2L7RA 1V1OA 4XGYA 1Q1OA 4I2YA 3NS1A 2JQRB 2LZ6A 4YSXB 2HQZA 1P3QU 2BS2B 3HUIA 3U2SC 2OEDA 4P16A 2K1FA 3V6EB 2DLBA 3C19A 1JWAD 4L1BA 2HD5B 3TMTA 4OZCA 1T0QC 2LRUA 1WGRA 4DXAB 5EXBA 2ZVNA 2QRFA 5EJUA 1JBZA 1SF0A 4J6IA 3ZTDA 3FC4A 1W7UA 4ARIA 3L13A 1IUEA 1EF1A 2KQSA 2DZKA 2LVPA 2UU7A 4GLSC 2ZMUA 5E6NA 5L83A 2V4IB 3ZNZB 1AW7A 4W6GA 2EKEC 4B9KA 3EKJA 3MJWA 4DXIA 2UWQA 2KDFB 3VHTC 2V4EA 3RZFA 1KTKA 2K8BA 2CR5A 4JGHB 2QLHA 1IPGA 2G6EA 3SR6A 3TUOA 3IR8A 2BQQA 2RMMA 3I5JC 1V5TA 1Z2MA 1X1MA 3ZIMA 3APDA 1QYOA 4M0WA 3K9PB 1YQ4B 2WXPA 3GOEA 4NJ6A 3NY5A 2YE1A 3H7PA 3NF0A 3RMKC 1M4VA 4KKIA 5F9GA 5BTTB 4NAWB 2C9IA 4HK2A 2HJOA 2JF5A 2N4FA 4DXOA 1WGHA 1JQ4A 1IGDA 4XL5A 2KC2A 4UDUC 3V61A 1SE2A 3QCAA 4XWWA 3B2GA 2XBBC 1L6UA 1MYWA 1QZEA 3EC8A 4MGIE 5EXCI 2KOXA 2VZKB 2A46A 4PS8A 5LXHA 4W6JA 1I4XA 2HTME 3ZDTA 2RPQA 2DDDA 2BT6A 3ZNID 1UISA 5TR5A 2GW4B 2KWUB 4Z4KA 5G5GA 2DNFA 4H48A 2KDMA 5J2RA 2E3TA 3AE8B 3W1YA 1TGZB 3RNAC 3TJPA 3DQHA 3P4SB 2NBVB 1NYQA 3IVFA 4GDKB 1E7PB 1FXTB 4AJYB 2LMCA 2GX0A 3ST3A 4W9CA 1C4AA 1OXEA 4JF9A 3CB9A 2QLGA 3UF8A 1E8XA 1MHHE 1MVKA 3SRYA 5AQBB 3QJZA 3UIPB 4EE2A 2WXKA 1P0RA 3IXSA 5CHFA 3LVCA 5JHBA 4MJSB 3LVDA 3CSFA 4NJ7A 2WXOA 2WNMA 3AI5A 1TTNA 3AE6B 4DXFA 1K50A 4BOSC 3N30A 2IPKD 5C23A 3JSVB 1WYWB 2FNJB 2VVHA 3RWTA 2VVJA 1S1QB 3RT3B 3CF6E 2CHZA 2J53A 3DPZA 2PIAA 2WXHA 1FRRA 1FNUA 4P1BC 2G3OA 3PHXB 4CYEA 3LVAA 2ARLA 1V8CA 4C80A 4LNKA 2V4EC 2DAJA 3JW0X 4YXDB 5J18A 4IZNA 3C0RB 3IFWB 1T0SC 3AECB 3DQFA 3R3MA 3SVSA 3MC9A 3T9LA 1HE8A 3LF4B 1T6BX 3DOWA 1LXDA 1CK1A 1TY0A 3KCSA 3BINA 5IAAC 2G4DB 3AE5B 3Q8AA 1LM8B 2LEKA 3HRDD 4MH0E 1TS4A 4NZLB 1YHGA 3VRBB 1YD8U 4JX1C 2YEPF 3N1YC 2JY6A 2YFPA 4ZFSA 2WU5B 3QK0A 3TIXA 1B9CA 1XD3B 4FN2A 4LNIA 2JPHA 4LTUA 3I9V1 3RD2A 4B0MA 3DPWA 3OAWA 2Z0EB 4WJQA 3A1QB 3H6NA 3W9CB 3U8AA 3BYYB 3W5UB 1QOBA 2IBIB 2FL1A 2VZXA 5J17A 1YJ1A 3DQDA 2M56B 3WLDA 4W9GA 3QC8B 4W6SA 2K9XA 4GXBA 5E6PA 4I6NB 1UH6A 1FNWA 2IB6A 5AZGA 2M0AA 2M4NA 3SG3A 3NUHB 4W9LA 1WX8A 2L1AA 4YSZB 3PPAA 4TQ1A 1FXAA 1VJKA 2I1JA 1KYSA 2KFJA 4EZJA 3AXCA 2BWES 1RWSA 3BWUD 1WJ6A 1AYFA 1MFWA 1FNVA 1WSPA 2H89B 5DPTA 4ZHOA 5DRGA 1CJEA 4A9AA 2NTSA 3PGEA 1WR1A 3PSEB 2KHWB 3BXBA 3NT3A 4PS7A 2OTBA 4W6IA 4XWTA 4S17A 4LDTB 4MH8A 2WIQA 2BKFA 1CMXB 3LB8C 2O2VB 3X23A 3Q8EA 4BKSD 4TSSA 1F52A 4ZYSA 1NENB 4BAXA 2PPHA 2BW2A 3OJ4B 3R7QA 2D2QA 1FIQA 1EMEA 2AHAA 4MELA 3E5WA 3KVFB 2JRIB 3RNGC 3IAS1 2LGXA 4M00A 1Y56A 1TIFA 2N7DA 4IG7B 4KGSA 4K81A 2CJNA 3IP2A 3OJ3A 3B0AA 3GEXA 3M95A 4EOYA 2PXSA 3ZULA 4URKA 3VHTB 4IKGA 4LQUA 3CSTA 4HQCA 4ZF5A 1V9JA 1YIWA 1NYRA 1OEYA 2MWSB 3APFA 2H5OA 5EE0A 2QZ0A 3GL4A 3P8UA 4IK3A 2INCC 5EDSA 2QMTA 1E8ZA 2L76A 1XLPA 1EM7A 4NWSA 4EULA 2V9HA 2AWJA 3H1OA 5DPGA 5H8YE 2KX0A 3TL5A 4LCDE 4LK0M 1P98A 3JYUA 1T0RC 2JU6X 2KJRA 4ITKA 4W72A 4MSQB 5EE3A 3TMPB 4KSLC 2ZW0A 3ZTCA 3AKOA 4ORNA 1ISNA 3Q3OC 5BYSA 2KMAA 1V80A 1Z1QA 3GE3C 1A70A 1C77A 3ST4A 2WXFA 2K6QA 3ONSA 3EK7A 4DKMA 3JVZX 4AUQC 1MOVA 5LTQA 4DXMA 4LLGM 1KLUD 3M3JA 2WHTA 1QF6A 3BVMA 4Q2JA 4ZRPA 5FR6A 3X0WA 3MC8A 1I42A 2FCMA 3HHMA 2B76B 1BUIC 1RMMA 2IDYA 3PVLA 2LHEA 2V4EB 2FCQA 1V97A 2MBEA 4RMAA 3U0NA 4B5YA 2W54A 2QCZA 3AN1A 4LNNA 5L95C 3DBHI 5MPOA 3EFCA 4W6FA 4LNOA 3SFEB 1WI0A 2LHDA 4ZRQA 2DWQA 1C4PA 2DZMA 5LLIA 4XYCA 4A90A 1PGBA 4H3NA 3AE3B 5G55A 4LJOB 4JPSA 1ZE3D 1AARA 4EZKA 1XMZA 2KACA 4HKQA 4XVPA 1EO6A 2BWFA 2XEWA 2GB1A 3HM6X 1PUTA 2IO0B 3MGFA 1GB4A 1WXAA 5DPJA 4XOWA 1V2YA 3RNFC 4EN1A 4HEA1 4JWSC 5CX3A 3ZRFA 1LQBA 4WWOA 4AQ7A 2C5LC 2JYTA 3AE9B 4EKUA 2W9NA 4OQWA 1R4MI 2AWKA 3ECIA 2HJ8A 3VUYA 3AE1B 4W74A 4ZF4A 3M63B 1SE9A 4XDCA 1E6EB 2I2YA 1L2NA 1UBQA 1OTRB 2MQJA 2ONQA 3AULA 4W6NA 4K3BA 3ETRA 1EMKA 4W6RA 3ENEA 4JGEA 4RFBA 2H9WA 3PJ7A 1GPXA 1JROA 3DHIC 2ZZPB 4C4VA 2Y0GA 1VR9A 1M94A 1MI0A 3DQNA 3L16A 3VH3B 3ZXVA 4W6OA 1T5XD 2MW5A 1XT9B 1L0VB 2DZIA 3PZ7A 1ZP0B 4N3DA 3SFDB 5DPSA 5DU0A 2AQ2B 1ZDXA 2WYQA 5AZHA 4ICVA 2R61A 3PT2B 3L10B 5E6OA 1KOTA 5DCNA 3KW5B 3PZ8A 5BYQA 4HDQA 2IO3B 4MDKE 4MACA 3OG5A 2DHZA 4ZBLA 5KHQA 4ACFA 3N1ZC 3NEDA 4ZB1A 1J7AA 2WX1A 1FO4A 3GZNI 3NZSA 5KHOA 4KF4A 4W76A 3L54A 4MT5A 4II2B 3LA1A 4WWPA 4A3OA 4IK4A 4WJNA 4LJDA 1I4PA 4ZYNA 4L23A 1WRDB 4YSYB 1SXTA 1UD7A 2RR9A 2AL6A 3A4SC 2AWMA 4DQOC 3RPFC 3D32A 1F9JA 4PYUA 5FHVA 3IAM1 1G6JA 1YN3A 1Q0WB 3O77A 1I4HA 3B1LX 1QY3A 2C7HA 3SG7A 1WFYA 2N1VA 1F0BA 1TY2A 3P63A 2JT4B 2V3NA 4NJCA 2ACZB 3A1QA 5FVGA 3NRZA 1EMMA 3WAPA 2OJKA 2O6VB 2MBHA 2ASQA 4WWNA 1KF6B 3ZO5B 2BPSA 4RNAA 3ZUFA 3VTVA 4BFRA 4ZOHC 2CU3A 3H8HA 2AH8A 2BGFA 3AM9A 1V1PA 1QILA 2KLCA 2P4MA 1UNSA 3ZUJA 2LD9A 4OVVA 5IOIA 3BK2A 4HPPA 1IYFA 4XOVA 1YFPA 2HCGA 2L83A 3RZWC 2ZJDA 3VK1A 3MHZA 2V3PA 3SSTA 1MOUA 3QIJA 1YHHA 2D07B 1QLBB 4W9EA 2ZVOA 2UYZB 3L4PA 5HHDG 4JLCA 4AR7A 3EECA 1N5WA 2MSED 4PYZA 2ZMWA 1GJZA 2O24A 4EFOA 1TS5A 4U2VA 2O2VA 4BOZB 4NAWA 3RNCC 4FBJB 4PT5A 5D7GA 3LXFA 3OSRA 2OJRA 4ARCA 4IOIE 3EUB2 2IB5A 1UELA 1YJJA 3MC0B 5HZTA 1Z5SB 4OZAA 1VZ7A 3U0KA 1E0ZA 2ZO6A 4K7UA 3KYCD 3IBEA 1D5MC 4W6BA 2IGGA 1YX5B 2KWDA 3J9CA 1UF0A 1PGAA 2NVUI 2DD9A 4ANWA 2DUEA 2PVGC 1N5XA 3DBLB 3N3KB 1EMLA 3Q3NC 4YWGG 1OQQA 1WRIA 2OKYA 2YDZA 4JWUC 4J3OD 4MSMB 2BYVE 4R3DA 3HK0A 4ANUA 3KWVA 4HPMB 3EK4A 3DCGA 3CMMB 1TKGA 3DPXA 2WXRA 3ALBA 2POXA 4KGTA 5DTXA 2WSOA 5IN7A 3TBLD 3VUWA 2K8HA 4W6LA 2BB5A 3V3XA 4KKJA 4NQKE 3AEFB 1SGHA 2FWQA 4ANJA 4DHJD 4W6HA 3M22A 3AE2B 4C56C 1KM7A 2DUGA 4C7ZA 1FD6A 3DQ6A 4KPIA 2A54B 4HKZE 4WJOA 1C9FA 1OFFA 1BT0A 3FILB 1L0XB 1XLOA 2H88B 4NAMA 1GFLA 5DPRA 4RM9A 2KTRB 3ZKJC 2D3GA 1CQVA 1OEYJ 1BFPA 1JMLA 2GBNA 4JL9A 3TMRA 2V0GA 4GDLA 1ZW7A 2BVCA 3FKYA 5IO9A 5JZEB 2K8CA 3KUZA 5CTRC 4OW0A 1P7FA 5JH5C 4AS1A 2L00B 1OGWA 1V1PB 3R2IA 1HCJA 5G5HA 4GGQA 2Y5CA 3O13A 4MGKE 1NVID 2ZPYA 1W7TA 3I3TB 3IT6B 2DYOA 3CIRB 3SG4A 4CQNA 1WGYA 4OY4A 4HE4A 2A53B 3BXAA 2XK5B 3S05A 2Y5PA 4HVBA 2RPVA 2NBWB 2Z59B 4KDLB 2O29A 1EMGA 3SVCA 4CHKA 2B3QA 3CGLA 1L0YB 5AEKB 3K9OB 4Q7UA 3EVUA 4DBGA 2BYFA 3R7RA 2J52A 3ZNHB 5EB6A 2LGIA 1Q73A 4JE3B 1HA5A 2JX5A 1EU4A 1WX7A 3IT4B 1WGGA 1ZPSA 3SSPA 5H89A 3E9SA 2W3RA 1ZGOA 4OGSA 3RULA 1YMHE 4ANXA 2IGHA 2HGYA 2YEPB 4IC7B 4PPJA 3T8MA 2O2BA 1GUAB 3L0WB 1SE4A 5D6JB 3AEBB 1HEZE 2C7NB 2DUFA 2VH1A 4JEOA 3EVRA 4E74A 4US8A 2JXTA 3LYYA 5LK4A 1C76A 2KK8A 2WP9B 1ESFA 5IA7A 3NEZA 4H47A 1P9DU 4ZF3A 1WJNA 4AJWA 5TSSA 1XCTL 3WANA 4IK5A 1F09A 4W6MA 2DYMA 4ZINA 1RLFA 2HPWA 3DQLA 1E7UA 5D94A 2MH7A 3AU5A 3Q8FA 1C1YB 1OQRA 1XLQA 2W82A 4BBNF 1NI2A 1QYFA 3W1SC 2JZ3B 4HLEA 2KVRA 3L17A 2LFIA 3U52E 3I19A 1VZ6A 4NPNA 1S6ZA 2KQ4X 1WE7A 1K53A 2PJHA 1Q4EA 3MP9A 5H88A 5C3JB 4J89A 4W75A 5HZOA 2GI9A 4P76A 3VAWA 2FUG1 1R4NI 1SB3C 3N1XC 2QT2A 3TCAA 2AEHA 3RYTA 2Z8LA 4H3LA 2GW3A 4K7WA 3DQ3A 2PTLA 2M17A 3SVOA 1TKYA 4KIKB 4W69A 3H1UA 1TZ1A 3SSVA 2W55A 5BT0A 1VCBA 1WWTA 1C4CA 5HZSA 4IW0A 4LJCA 3BVZA 4FLHA 1VLBA 2BTJA 1VDVA 4XZ4A 2LRWA 2JWUA 4W9JA 3AEAB 2L8JA 4W6TA 3RUIB 2FCNA 1KFYB 3WCKA 1QKZA 2A50B 1KRHA 2J7QB 1PFDA 1WY8A 4ZIOA 2EMOA 2PLPA 4F7ZA 2QHOA 3LJ3A 2IY0B 4KAGA 2D10A 4HJGE 3PTFC 3NZUA 2PE6B 2H6VA 2G3QB 4RGNA 4NQLB 4DWFA 3ZUNA 4PPLA 3L08A 2PXWA 2RDGA 1I7HA 1S3SG 4C7YA 1FPYA 1PYWD 2HTHA 4K3CA 3H7PB 2R2QA 1DOXA 3VQIA 4KVGB 5HW9A 2FIDA 4K1RB 1V5OA 4IK8A 1Q4CA 1JBYA 1LGRA 2KJ6A 2WX0A 1CZPA 2HRSA 5HKHA 2GLSA 2K5PA 4G3XB 3W1CA 4KSKC 1QQRA 2A48A 5HBDA 2BS4B 4ZDVA 2QIEB 1ZGQA 2LUEA 1WM2A 4N6EB 2GX2A 2NR2A 1KLGD 3U4EG 4M8NA 4MEMA 4OHSA 3P4PB 4DHZB 1T3QA 5BQLA 2BYTA 1TT5B 3UINB 4Q9WA 3KLSX 1SBBB 2A52B 1KP5A 4EZLA 4B95A 4DKNA 3VXWA 1N6ZA 3ML9A 1JRUA 3ZLZA 3AB5A 1J8CA 1OXFA 5DPWA 3PV1A 1TS2A 4M01A 2D5GA 3B2FA 3MFGA 4EUTA 4KX6B 3E56A 1ENFA 1STEA 1HUYA 3IG3A 2IE2A 1H4RA 3A4RA 1W7SA 3UG0A 1E8WA 1JWMD 2KX3A 3SSKA 1F1HA 1K8RB 1D6EC 4J8AA 3ZJTA 1SIFA 2WXGA 3VICA 4W9HA 2BYEA 3BY4B 5EE1A 2MP2B 4HJKA 1E10A 3H9DA 2KMCA 5T3IA 3EGRA 2Q5WD 5DPHA 2D3CA 3DVNV 3RN9C 2IZVB 4BKTA 2J4XA 3WLCA 4R6BA 1D5ZC 5EBJA 5AUIA 2DBYA 3QHTA 4YTPB 2Q6PA 3CFAA 2NBUA 2IY1B 2ZO7A 2EELA 4XC2A 5DQMA 4RYSA 2OGRA 3KH0A 4KGRA 2DZJA 3A9KB 2BF8B 3DBRB 3ADFA 3SSHA 1D4BA 2N9PC 3BX9A 4KEXA 3V3DA 4TZAA 2HE7A 2FIFA 2MBBB 3IHPC 4N59A 4PS3A 3PJBA 4LQTA 3DHHC 2YE0A 3PZDA 4NNJB 5HZUA 3ZTFA 2RDBC 4W6DA 2L32A 4W7XA 1NEKB 2GBMA 4L12A 1K52A 2WXLA 2CJOA 1UWXA 2RSUA 1XSSA 2QLGB 4GIVA 4Q7RA 3LF3A 4GMVA 1TBEA 2LJIA 3EK8A 4GDLB 4GDKA 3CFHA 2IO1B 3JSVA 4RF0A 2B3PA 2DD7A 1KYRA 2D11A 5J2OA 4MM3A 4BVUC 2INDC 1V81A 3C8YA 4W6CA 4MM3B 5BYRA 1RMOA 4WQOB 4S0RA 2IJ0A 2AWTA 4JRBA 4WQMA 1XO3A 2WHUA 3VR8B 4XDDA 1WH3A 1AN8A 1GOZA 3BZDB 3KUDB 2K6DB 4TQ0A 2EMTA 1WZ0A 3SG2A 3B9JA 1YQ3B 2Z6YA 3ST0A 4IM0A 1N61A 3KCTA 4C00A 2JZPA 2G3DB 1YHIA 1YJFA 4ZRIA 3DQVA 3V60A 1XLNA 4G50A 3UQBA 2BTEA 2BB6A 1HZ5A 3QQ8B 3NVZA 2CHWA 4DHZE 1IBXA 1RM6C 3OWEB 3AH7A 4HVFA 4DXNA 3WCQA 4RGMA 1QOGA 4YT0B 4W6AA 4CO7A 2C9WB 2KQ7A 4GESB 3U0LA 1MHXA 1WIAA 4LJBA 2RD0A 1JW9D 2WXNA 1KJTA 5D2MB 2YLMA 3BK1A 3SD5A 3EVPA 2LGDA 4N9F4 4DHJB 1YJ2A 1GAQB 1ZGUB 3ZJVA 2G1EA 2WISA 4P1CC 1N63A 2WSNA 2CHXA 1RRXA 3URYA 2A4ZA 3U8PA 5HGEA 4RTCA 1OQYA 1EMFA 2E6XA 2HGDA 4BZAA 3EFUA 1YZWA 2EMDA 2L0FA 1IBXB 5I4DA 3P28A 5EXUA 4RM8A 3DQ1A 4KDIC 2Z1OA 3GE8C 3R66C 3A9JA 1F0ZA 3U7ZA 4TUUA 4N58A 2FBWB 4YTNB 3W1SA 2G9HD 4WAAA 2KWVB 4YTMB 4JQWC 4A20A 3VUXA 3KQ4A 2JSVX 3DBRI 5FVFA 2IO2B 3Q2AC 4W9DA 5LTRA 4FHKA 2LWPA 1FM0D 3BIID 3H7SA 2AYOB 2KD0A 2J0JA 2IYDB 2WDQB 3SVUA 1ZXIA 3DVGX 3OGOA 1SE3A 3GS2A 1NI3A 1QXTA 4W6PA 2BKRB 2AWLA 1IGCA 4F8CB 4DXGA 5FR3A 2KKCA 1E8YA 3ZYYX 3I63C 5DTZA 3RFZB 4W7RA 2G6XA 4P7IA 1TYGB 2N1WA 2GRIA 1ZGPA 3A8SA 2H5PA 4RGTA 1Q4BA 3OLMD 1JWBD 2EMNA 4MGYE 5JXVA 4DXQA 1WM3A 1V49A 4JFGA 2QJLA 2EMSA 1G7KA 4KIKA 4XE0A 1EMBA 2ICRA 4H3MA 4HWIB 2DYBA 4ANVA 1WR6E 3PHWB 2H5QA 5CHVC 4OZBA 3DQOA 3T3OA 2ZCBA 2ICIA 5IP4D 4EDOA 2H8QA 3DQKA 2AX5A 3P4RB 1WGDA 1LO5D 4W77A 2LVOA 4M02A 1UGJA 2WS3B 5EB7A 5GXGB 2MP2A 4W6UA 2KAJA 1XQQA 3HVDA 1DYQA 1L6VA 3VH4B 3GP7A 3BVGA 1WE6A 3ZQ4A 1TZOA 1MJDA 1EUVB 2NPTA 2KN5A 2HQKA 2MCNB 3DQJA 4EDSA 2MRPA 4BBNC 2DUHA 1QOAA 2O6VD 4OVZA 1UZXB 2Z0DB 2CKHB 2N9LA 2KZRA 2KVZA 3P2BA 1L7YA 2SAKA 4HCPB 1WJUA 3P4QB 3V05A 1N62A 4EMQA 3DQAA 2J42A 2QC8A 2ZNVC 1VD2A 4X57B 1LFDA 3SEBA 2WURA 3P1MA 3NS8A 2NMQA 1J19A 3A33B 3PO0A 4WAFA 1SSNA 5AUKA 2ZNVB 4FXCA 4WH4A 2RDHA 4TKNA 4XGAB 2Y3AA 2WU2B 4F1SA 1GC7A 1H6RA 2DX5B 4PPKA 1ET6A 3SU8X 1C4FA 1FRDA 2WDVB 4KGEA 5T8IA 2LGSA 2A5UA 4WJPA 3NZ3A 4BDUA 2LJ5A 2NCNA 2O6VA 4KGFA 1XEEA 1A5RA 1ROEA 3EVVA 2KFKB 2QEJC 1OXDA 3DDCB 3AI4A 1E7VA 4P6VF 2HJ1A 3QAQA 2N9KA 1EF5A 2JVCA 3NVYA 1BMLC 4FJVB 4HDOA 2N0SB 4HQ9A 2AQ1B 2X38A 2XK5A 4WWMA 4RYWA 2EKIA 4FULA 1E9MA 2V3SA 3AU4A 2RH7A 4I6PA 2BS3B 1FCCC 2KANA 2W3SA 3Q8CA 2MJEA 3BXCA 4OHJA 2R2OA 4Q9XA 2GBKA 3AEGB 5FK9C 2OTEA 2A47A 4L13A 3VTUA 1FFVA 2WHIA 5BMIA 2G4SA 3DWGC 3EHVA 3O65B 1EU3A 1HZ6A 2INPE 3W5VB 5AZFA 2PE9A 4MGZE 2NS5A 2KLGA 1TS3A 2PEAA 1WGKA 4DDGD 2BBCA 2D3BA 2GMIC 4XX5A 3DQMA 5BTTA 1Q5WB 1XXGA 3CFFA 1ZKHA 3O78A 5D3IB 5E6JA 3SV5A 1B9RA 1YQBA 3DBHB 1GB1A 2K39A 2RGFA 1SEBD 4W9KA 2VH2A 5HG2A 3DQCA 3DQ7A 2C9JA 1UWMA 2LI5A 2PKOA 3AEDB 2VVIA 1MPEA 2M0XA 4WURA 4KW4A 2I38A 4AP4C 2L3ZA 3DQ5A 1VZ8A 2XNAC 1GNUA 5JHAA 4HPLB 4ZHPA 4A55A 5C1ZA 2KC1A 3SG5A 3SSYA 1D3ZA 4TMAB 3HVZA 2LXAA 1Q10A 2JXXA 2OOBB 1FXIA 3Q69A 1JC0A 3RWAA 3PS6A 3VHTA 2FE8A 3ZW3A 4E71A 4C4VB 3TEYA 3U0MA 3PRMB 4W9FA 1RFKA 2XN9C 3UFZA 4P1QA 5FVIA 3UGBB 2AL3A 1ET9A 4HROA 2SEBD 3QARA 1EWYC 1XQMA 4W7FA 1AWDA 4G0NB 2DAFA 3ZVVA 2ZCCA 2KDEB 1P1AA 2K22A 4KZ0A 3QX1A 1HTOA 3PLUA 2K3UA 2LVQA 4HQ8A 3ZNGC 4FHJA 4KW8A 5H92C 4W7AA 1NBFC 3TEWA 3DBLI 4OVUA 1ZXHA 3VFKA 4RF1A 2V1YA 4UTSA 2NPTB 4R6DA 4W7DA 2PVOD 2KTRA 3SSLA 5D3DA 3SS0A 1I4RA 3SDLC 2KFKA 3AEEB 2V4LA 2JADA 5DPIA 3ED8A 2IGDA 2N9XA 1ZUXA 2KDIA 4L2YA 3WAMA 3UQAA 3E5VA 1GC6A 2QLEA 2M1MA 4G11A 1Z1PA 3V6CB 2ON8A 2WXMA 4HCNB 2C60A 3K1KA 4HXDA 3ZXRA 3LDZE 1SJHD 3P42A 5DTYA 2MHJA 4GSWA 3PREA 2X8XX 1YJIA 3NVWA 3PIBA 2KWCA 3NJTA 2KTFA 1L4ZB 2KNBA 4GOCA 4M0WB 3U8CA 5EE9A 4LJDC 3PLVA 1JWUD 3RNEC 2DENB 1YN5A 2VAEA 1YX6B 3NT9A 2LASA 2OHFA 5DY6A 2LUMA 3KWLA 2MBQA 2KXJA 4J88A 4KA9A 3A9JB 3SVBA 1V6EA 1Q4AA 1F2RC 2QILA 3HIZA 3TSSA 1I35A 1EWCA 5LXIB 4JC2A 2WXJA 1WYGA 2Z6ZA 2KN4A 3ZDMC 3N20C 1HXYD 1QT9A 5DRFA 4KF5A 3AE7B 1MG4A 1ACCA 1R4NB 3QA8A 3OSQA 1WXVA 1KLVA 1XA9A 3RI7C 4REZA 4II3B 2PMVA 1C3TA 1E5WA 2G2SB 2QSDA 5C2TB 1XF5L 3W2DA 1FCLA 1Q4DA 3M62B 5HFYA 3HM3A 4PK1A 2FCSA 3R8BA 4A8XC 2ZW1A 4FJZA 1FFUA 2VRRB 4Q7TA 3VDZA 1L4DB 2Y5BB 3DQ8A 4IDIA 1WX9A 5G2NA 1GG3A 1D5XC 3SVEA 1UBIA 1WXMA 3GJ2A 3KYDD 4B0EA 1WF9A 3I57A 1EMCA 4O1NA 3ZJUA 1PGXA 4B30A 1P7EA 3CD1A 1RAXA 4USAA 3ZRCA 1H8CA 4RGOS 1KYPA 2QU1A 3EKHA 2WLBA 4L1IA 2G45B 1FEHA 2DDCA 3Q3FA 2MJ3A 4LJPB 4D2KA 1CV7A 4K7SA 1T0YA 4BKSA 2JUOA 3VR9B 3ABVB 3ZGZA 2DUIA 2GOWA 3NOBA 3AE4B 1NDDA 2N7EA 1VRAB 2PW9A 2G5ZB 2QLIA 3Q8BA 1RRBA 4AWJA 4FA6A 3U30A 1XAEA 1BXTA 1WXSA 3SVRA 1RFAA 4MJSA 3H1RA 1JC1A 2OKWA 4LW5A 2GBJA 2K0PA 4A3PA 3GZNB 5LTPA 1UGMA 3DQ9A 1HQRD 3KUCB 1EMAA 1J7BA 4NY0A 1C79A 3RNBC 2HFCA 4AOFA 4GF6B 2N9EB 4JIOU 3U8ZA 5LNK1 1QOFA 1GL4A 4PFEA 3VVWB 4OJ0A 5IKCM 1YN4A 3WIMA 2KDBA 1HTQA 2N7JA 3DBSA 2MEKA 1U4AA 3V62A 4US9A 1ZOYB 3BYTB 4HRSA 2WGSA 5HI1A 4GU2A 3UI3A 3DQ4A 2AQ3B 1SIJA 4W73A 2JWZA 2L0TA 3MTNB 4IWOA 2TSSA 2B3AA 2M8SA 1QYQA 2JZZA 4WIPA 2H5RA 4ZRKA 1YNTE 3NHEB 1JCKB 4E3CA 3NG0A 1SJED 1V86A 1JALA 1XCQL 3GJ1A 1UUPA 4YL8A 1WXQA 4GN1A 1L5PA 3MHSD 3VRAB 4LDTD 3DVGY 3Q3MC 4ICUA 2WXQA 5BO4B 3WALA 2INNE 3PRPB 1GGXA 2C7MB 4KW9A 3AV8A 3CBEA 2CU1A 4IWQA 2MLBA 3CD9A 3UIOB 3MJ5A 2LXCA 4IM3A 1F77A 3S2AA 5BMGA 2L05A 1K51A 2NTTA 4IWPA 1KH0A 1H4UA 5FKAC 4TZGA 1I4GA 2CS4A 3EA6A 3M24A 1DGJA 1F2RI 3ML8A 3DQIA 3R2TA 4IK9A 2KYWA 2IOVA 4Z4MA 2G6YA 4TV3A 4M8MA 2A56B 2K25A 3PRZA 1IP9A 4QAYA 3SHQA 2WWZA 2I1KA 1MG8A 3TEZA 4I6LB 3W1DA 1PQSA 4KV2A 2VZKD 2HDEA 2WDRB 3DPDA 2FAZA 4B6WA 4FADA 5CHWA 5DQBA 4BKGA 3A9KA 2MBOA 1TJEA 1JWSD 1YOVB 2ZEQA 1TKEA 2KT7A 1ZUD2 3APCA 4ASWC 1Y8RC 2J0KA 4ZRJA 3NVVA 3GB1A 2QDFA 1WMHA 4KF5C 3DQ2A 1DOIA 3DHGC 3VTWA 2KMMA 5BMHA 2D3AA 4GOBA 2GBRA 2WHSA 2MA9B 3DQEA 3FILA 4B30B 3ST2A 3CWIA 3SG6A 4GB9A 5GMVA 2LGYA 1I4QA 1WZ3A 1E90A 3Q14C 3Q3JA 1JRPA 3DVNU 1PDXA 2OJWA 2FUHB 2WDTB
chains in the Genus database with same CATH topology
3RCZA 2J0MA 2MX2A 2KO3A 4FJYA 3N32A 4DK5A 2KJHB 2G16B 4IM2A 5DTLA 2JRHA 1RM9A 1WMHB 4DDID 2Z6XA 4AS8A 2FZUA 3SVNA 3G9AA 3PJ5A 3DQUA 1RMPA 3E5TA 2REXA 5EHUA 4W9IA 4W6KA 4W7CA 5H87A 4IUMB 1J0GA 3SVDA 2ZPNA 4EEWA 3U7DA 3WAOA 3WA0A 2Q57A 2YVCA 3LSAA 3QWZB 4IK1A 2VADA 5KTGA 4KZCA 4DXPA 3LS3A 3B08A 1WJ4A 4W7EA 3GB3A 2L7RA 4XGYA 1Q1OA 4I2YA 2LZ6A 2HQZA 1P3QU 2K1FA 3V6EB 2HD5B 3TMTA 2LRUA 1WGRA 4DXAB 5EXBA 2ZVNA 2QRFA 5EJUA 1JBZA 4J6IA 3ZTDA 1W7UA 3L13A 1EF1A 2KQSA 2DZKA 2LVPA 2ZMUA 5E6NA 5L83A 3ZNZB 4W6GA 2EKEC 4B9KA 3EKJA 3MJWA 4DXIA 2UWQA 2KDFB 3VHTC 2V4EA 3RZFA 2CR5A 2K8BA 4JGHB 2QLHA 1IPGA 2G6EA 3IR8A 1V5TA 1Z2MA 1X1MA 3ZIMA 3APDA 1QYOA 3K9PB 3GOEA 4NJ6A 3NY5A 2YE1A 3H7PA 3NF0A 4NAWB 5F9GA 5BTTB 2C9IA 4HK2A 2HJOA 2JF5A 2N4FA 4DXOA 1WGHA 4XL5A 2KC2A 3V61A 3QCAA 2XBBC 1MYWA 1QZEA 3EC8A 4MGIE 5EXCI 2KOXA 2A46A 4PS8A 5LXHA 4W6JA 3ZDTA 2DDDA 2RPQA 3ZNID 1UISA 5TR5A 2GW4B 2KWUB 4Z4KA 4H48A 5J2RA 3W1YA 1TGZB 3TJPA 3DQHA 2NBVB 3IVFA 4GDKB 1FXTB 4AJYB 2GX0A 3ST3A 4W9CA 1OXEA 4JF9A 3CB9A 2QLGA 3UF8A 1E8XA 3SRYA 5AQBB 3QJZA 3UIPB 1P0RA 5CHFA 3LVCA 5JHBA 4MJSB 3LVDA 3CSFA 4NJ7A 3AI5A 1TTNA 4BOSC 3N30A 5C23A 3JSVB 1WYWB 2FNJB 2VVHA 3RWTA 2VVJA 1S1QB 3RT3B 3CF6E 2CHZA 3DPZA 2G3OA 3PHXB 4CYEA 3LVAA 2ARLA 2V4EC 2DAJA 3JW0X 5J18A 4IZNA 3C0RB 3IFWB 3R3MA 3T9LA 3DQFA 3SVSA 1HE8A 3LF4B 3DOWA 1LXDA 3KCSA 3BINA 5IAAC 2G4DB 1LM8B 4MH0E 1YHGA 1YD8U 2JY6A 2YFPA 4ZFSA 3QK0A 3TIXA 1B9CA 1XD3B 4FN2A 2JPHA 3RD2A 3DPWA 3OAWA 2Z0EB 4WJQA 3A1QB 3H6NA 3U8AA 2IBIB 2FL1A 2VZXA 5J17A 1YJ1A 3DQDA 3WLDA 4W9GA 3QC8B 4W6SA 4GXBA 5E6PA 4I6NB 1UH6A 2IB6A 5AZGA 2M4NA 3SG3A 4W9LA 1WX8A 3PPAA 4TQ1A 2I1JA 1KYSA 2KFJA 4EZJA 3AXCA 2BWES 1WJ6A 5DPTA 5DRGA 3PSEB 3PGEA 1WR1A 2KHWB 3BXBA 3NT3A 4PS7A 2OTBA 4W6IA 4LDTB 2WIQA 2BKFA 1CMXB 2O2VB 3X23A 4BKSD 2PPHA 3OJ4B 3R7QA 2D2QA 1EMEA 4MELA 2AHAA 3E5WA 3KVFB 2JRIB 2LGXA 2N7DA 4IG7B 4K81A 3IP2A 3OJ3A 3B0AA 3GEXA 3M95A 4EOYA 2PXSA 3ZULA 4URKA 3VHTB 4LQUA 3CSTA 4HQCA 4ZF5A 1V9JA 1YIWA 1OEYA 2MWSB 3APFA 2H5OA 2QZ0A 3GL4A 3P8UA 4IK3A 5EDSA 1E8ZA 2L76A 4NWSA 4EULA 2AWJA 3H1OA 5DPGA 2KX0A 3TL5A 4LCDE 1P98A 3JYUA 2KJRA 4W72A 4MSQB 3TMPB 4KSLC 3ZTCA 3AKOA 4ORNA 1ISNA 2KMAA 1V80A 1Z1QA 3ST4A 2K6QA 3ONSA 3EK7A 4DKMA 3JVZX 4AUQC 1MOVA 5LTQA 4DXMA 3M3JA 2WHTA 3X0WA 5FR6A 1I42A 2FCMA 3HHMA 1RMMA 3PVLA 2V4EB 2FCQA 2MBEA 4RMAA 3U0NA 4B5YA 5L95C 3DBHI 4W6FA 1WI0A 2DZMA 5LLIA 4H3NA 5G55A 4LJOB 1AARA 4EZKA 1XMZA 4XVPA 1EO6A 2BWFA 2XEWA 3HM6X 2IO0B 3MGFA 1WXAA 5DPJA 4XOWA 1V2YA 4EN1A 5CX3A 3ZRFA 1LQBA 4WWOA 2C5LC 4EKUA 2W9NA 4OQWA 1R4MI 2AWKA 3ECIA 2HJ8A 3VUYA 4W74A 4ZF4A 3M63B 1SE9A 1L2NA 1UBQA 1OTRB 2MQJA 3AULA 4W6NA 1EMKA 4W6RA 3ENEA 4JGEA 2H9WA 3PJ7A 2ZZPB 2Y0GA 1M94A 3DQNA 3L16A 3VH3B 4W6OA 2MW5A 1XT9B 2DZIA 4N3DA 5DPSA 5DU0A 2WYQA 5AZHA 4ICVA 3PT2B 3L10B 5E6OA 1KOTA 5DCNA 3KW5B 4HDQA 2IO3B 4MDKE 2DHZA 4ZBLA 5KHQA 3NEDA 4ZB1A 2WX1A 3GZNI 3NZSA 5KHOA 4KF4A 4W76A 3L54A 4II2B 3LA1A 4WWPA 4A3OA 4IK4A 4WJNA 4LJDA 4ZYNA 1WRDB 1UD7A 2RR9A 2AL6A 3A4SC 2AWMA 3D32A 1F9JA 4PYUA 5FHVA 1G6JA 1Q0WB 3O77A 3B1LX 1QY3A 2C7HA 3SG7A 1WFYA 2N1VA 1F0BA 2JT4B 3A1QA 5FVGA 1EMMA 3WAPA 2OJKA 2O6VB 2MBHA 2ASQA 4WWNA 3ZO5B 2BPSA 3ZUFA 3VTVA 4BFRA 2AH8A 2BGFA 2KLCA 2P4MA 3ZUJA 2LD9A 4OVVA 1IYFA 4XOVA 1YFPA 2HCGA 3RZWC 2ZJDA 3VK1A 3SSTA 1MOUA 3QIJA 1YHHA 2D07B 4W9EA 2ZVOA 2UYZB 4JLCA 4AR7A 3EECA 2MSED 4PYZA 2ZMWA 1GJZA 2O24A 4EFOA 4U2VA 2O2VA 4BOZB 4NAWA 4FBJB 5D7GA 3OSRA 2OJRA 2IB5A 1UELA 5HZTA 1Z5SB 3U0KA 2ZO6A 4K7UA 3KYCD 3IBEA 4W6BA 1YX5B 2NVUI 2DD9A 4ANWA 2DUEA 3N3KB 1EMLA 2OKYA 2YDZA 4MSMB 2BYVE 3HK0A 4ANUA 4HPMB 3EK4A 3DCGA 3CMMB 3DPXA 3ALBA 2POXA 5DTXA 2WSOA 3TBLD 3VUWA 2K8HA 4W6LA 4NQKE 1SGHA 2FWQA 4ANJA 4DHJD 4W6HA 3M22A 1KM7A 2DUGA 3DQ6A 4KPIA 2A54B 4WJOA 1BT0A 1GFLA 5DPRA 4RM9A 2KTRB 3ZKJC 2D3GA 1OEYJ 1BFPA 2GBNA 4JL9A 3TMRA 4GDLA 1ZW7A 5JZEB 2K8CA 3KUZA 5CTRC 5JH5C 2L00B 1OGWA 1HCJA 4GGQA 4MGKE 2ZPYA 1W7TA 3I3TB 2DYOA 3SG4A 1WGYA 4OY4A 4HE4A 2A53B 3BXAA 2XK5B 3S05A 4HVBA 2NBWB 2Z59B 4KDLB 2O29A 1EMGA 3SVCA 4CHKA 2B3QA 3CGLA 5AEKB 3K9OB 4Q7UA 3EVUA 4DBGA 2BYFA 3R7RA 3ZNHB 5EB6A 1Q73A 1WX7A 1WGGA 3SSPA 5H89A 1ZGOA 4OGSA 3RULA 4ANXA 4IC7B 2HGYA 3T8MA 4PPJA 2O2BA 1GUAB 3L0WB 5D6JB 2C7NB 2DUFA 4JEOA 3EVRA 4E74A 5LK4A 2KK8A 5IA7A 3NEZA 4H47A 1P9DU 4ZF3A 1WJNA 4AJWA 3WANA 4IK5A 1F09A 4W6MA 4ZINA 2DYMA 1RLFA 2HPWA 3DQLA 1E7UA 5D94A 3AU5A 1C1YB 4BBNF 1NI2A 1QYFA 3W1SC 2JZ3B 4HLEA 2KVRA 3L17A 3I19A 4NPNA 1S6ZA 1WE7A 2PJHA 1Q4EA 5H88A 4J89A 4W75A 5HZOA 4P76A 3VAWA 1R4NI 2QT2A 3TCAA 2AEHA 3RYTA 4H3LA 2GW3A 4K7WA 3DQ3A 2M17A 3SVOA 4KIKB 4W69A 3H1UA 1TZ1A 3SSVA 5BT0A 1VCBA 5HZSA 4IW0A 4LJCA 4FLHA 2BTJA 4XZ4A 2LRWA 4W9JA 2L8JA 4W6TA 3RUIB 2FCNA 3WCKA 2A50B 2J7QB 1WY8A 4ZIOA 2EMOA 4F7ZA 2QHOA 3LJ3A 2IY0B 4KAGA 2D10A 3PTFC 3NZUA 2PE6B 2H6VA 2G3QB 4NQLB 4DWFA 3ZUNA 4PPLA 3L08A 2PXWA 1S3SG 2HTHA 3H7PB 2R2QA 3VQIA 4KVGB 5HW9A 2FIDA 4K1RB 1V5OA 4IK8A 1Q4CA 1JBYA 2KJ6A 2WX0A 2HRSA 5HKHA 4G3XB 3W1CA 4KSKC 2A48A 5HBDA 4ZDVA 1ZGQA 2LUEA 1WM2A 2GX2A 2NR2A 4M8NA 4MEMA 4OHSA 4DHZB 5BQLA 3UINB 4Q9WA 2A52B 1KP5A 4EZLA 4B95A 4DKNA 3VXWA 3ML9A 1JRUA 3ZLZA 1J8CA 1OXFA 5DPWA 3PV1A 4EUTA 1HUYA 3IG3A 2IE2A 1H4RA 3A4RA 1W7SA 3UG0A 1E8WA 2KX3A 3SSKA 1K8RB 4J8AA 1SIFA 3VICA 4W9HA 2BYEA 3BY4B 2MP2B 4HJKA 3H9DA 2KMCA 5T3IA 5DPHA 3DVNV 2IZVB 4BKTA 3WLCA 4R6BA 5EBJA 3QHTA 2Q6PA 3CFAA 2NBUA 2IY1B 2ZO7A 4XC2A 5DQMA 4RYSA 2OGRA 3KH0A 2DZJA 3A9KB 2BF8B 3ADFA 3SSHA 2N9PC 3BX9A 4KEXA 3V3DA 4TZAA 2HE7A 2FIFA 2MBBB 3IHPC 4PS3A 3PJBA 4LQTA 4NNJB 2YE0A 3PZDA 5HZUA 3ZTFA 4W6DA 4W7XA 2GBMA 4L12A 2RSUA 1XSSA 2QLGB 4GIVA 4Q7RA 3LF3A 4GMVA 1TBEA 4GDLB 3EK8A 4GDKA 3CFHA 2IO1B 3JSVA 2B3PA 2DD7A 1KYRA 2D11A 5J2OA 4MM3A 4BVUC 1V81A 4W6CA 1RMOA 4WQOB 2AWTA 4JRBA 2WHUA 1WH3A 3KUDB 2K6DB 4TQ0A 2EMTA 1WZ0A 3SG2A 2Z6YA 3ST0A 4IM0A 3KCTA 2G3DB 1YHIA 1YJFA 4ZRIA 3DQVA 3V60A 4G50A 3UQBA 3QQ8B 2CHWA 4DHZE 4HVFA 4DXNA 4W6AA 4CO7A 2C9WB 2KQ7A 4GESB 3U0LA 1WIAA 4LJBA 2RD0A 5D2MB 1KJTA 2YLMA 3SD5A 3EVPA 2LGDA 4N9F4 4DHJB 1YJ2A 1ZGUB 2WISA 2WSNA 2CHXA 1RRXA 2A4ZA 3U8PA 5HGEA 4RTCA 1OQYA 1EMFA 2HGDA 3EFUA 1YZWA 2EMDA 2L0FA 3P28A 5EXUA 4RM8A 3DQ1A 4KDIC 2Z1OA 3R66C 3A9JA 4TUUA 3W1SA 4WAAA 2KWVB 4JQWC 4A20A 3VUXA 3DBRI 5FVFA 2IO2B 4W9DA 5LTRA 4FHKA 2LWPA 3H7SA 2AYOB 2KD0A 2J0JA 2IYDB 3SVUA 3DVGX 3OGOA 1QXTA 4W6PA 2BKRB 2AWLA 4F8CB 2KKCA 1E8YA 5DTZA 4W7RA 2G6XA 4P7IA 2N1WA 1ZGPA 3A8SA 2H5PA 1Q4BA 3OLMD 2EMNA 4MGYE 4DXQA 1V49A 1WM3A 4JFGA 2EMSA 1G7KA 4KIKA 1EMBA 2ICRA 4H3MA 4HWIB 2DYBA 4ANVA 1WR6E 3PHWB 2H5QA 5CHVC 3DQOA 2ZCBA 4EDOA 2H8QA 3DQKA 1WGDA 4W77A 2LVOA 5EB7A 2MP2A 4W6UA 1XQQA 3VH4B 1WE6A 1EUVB 2NPTA 2KN5A 2HQKA 2MCNB 3DQJA 4EDSA 2MRPA 4BBNC 2DUHA 2O6VD 1UZXB 2Z0DB 2CKHB 2KZRA 3P2BA 1L7YA 4HCPB 1WJUA 4EMQA 3DQAA 2ZNVC 1VD2A 4X57B 1LFDA 2WURA 3NS8A 1J19A 3A33B 2ZNVB 4TKNA 4F1SA 1GC7A 1H6RA 2DX5B 4PPKA 3SU8X 1C4FA 4KGEA 2A5UA 4WJPA 4BDUA 2LJ5A 2NCNA 2O6VA 4KGFA 1A5RA 3EVVA 2KFKB 1OXDA 3DDCB 3AI4A 1E7VA 3QAQA 1EF5A 2JVCA 4FJVB 4HDOA 4HQ9A 2XK5A 4RYWA 4FULA 2V3SA 3AU4A 4I6PA 2RH7A 2KANA 3BXCA 2R2OA 4Q9XA 2GBKA 2OTEA 2A47A 4L13A 3VTUA 2G4SA 3EHVA 3O65B 5AZFA 2PE9A 4MGZE 2NS5A 2KLGA 2PEAA 4DDGD 4XX5A 2GMIC 3DQMA 5BTTA 1Q5WB 1ZKHA 3CFFA 3O78A 3SV5A 1YQBA 2K39A 2RGFA 4W9KA 3DQCA 3DQ7A 2C9JA 2LI5A 2VVIA 2M0XA 4KW4A 4AP4C 2L3ZA 3DQ5A 1GNUA 5JHAA 4HPLB 5C1ZA 2KC1A 3SG5A 3SSYA 1D3ZA 2LXAA 2JXXA 2OOBB 1JC0A 3RWAA 3PS6A 3VHTA 3ZW3A 4E71A 3U0MA 3PRMB 4W9FA 3UFZA 4P1QA 5FVIA 3UGBB 2AL3A 3QARA 1XQMA 4W7FA 4G0NB 2DAFA 3ZVVA 2ZCCA 2KDEB 1P1AA 4KZ0A 3QX1A 3PLUA 2LVQA 4HQ8A 3ZNGC 4FHJA 4KW8A 4W7AA 1NBFC 3DBLI 4OVUA 3VFKA 2V1YA 4UTSA 2NPTB 4R6DA 4W7DA 2KTRA 3SSLA 3SS0A 3SDLC 2KFKA 2V4LA 2JADA 5DPIA 3ED8A 2N9XA 1ZUXA 2KDIA 3UQAA 3WAMA 3E5VA 1GC6A 2QLEA 2M1MA 4G11A 1Z1PA 3V6CB 4HCNB 2C60A 3K1KA 4HXDA 3LDZE 5DTYA 4GSWA 3PREA 3PIBA 2KWCA 2KTFA 2KNBA 4GOCA 4M0WB 3U8CA 4LJDC 3PLVA 2DENB 2VAEA 1YX6B 3NT9A 2LASA 5DY6A 2MBQA 2KXJA 4J88A 4KA9A 3A9JB 3SVBA 1V6EA 1Q4AA 3HIZA 1I35A 5LXIB 4JC2A 2Z6ZA 3ZDMC 5DRFA 4KF5A 3QA8A 3OSQA 1WXVA 1KLVA 1XA9A 4II3B 1C3TA 1E5WA 2G2SB 1Q4DA 3M62B 3HM3A 2FCSA 4FJZA 2VRRB 4Q7TA 3VDZA 2Y5BB 3DQ8A 1WX9A 5G2NA 1GG3A 1WXMA 3SVEA 1UBIA 3KYDD 3GJ2A 1WF9A 1EMCA 4B30A 3CD1A 1RAXA 3ZRCA 1H8CA 1KYPA 2QU1A 3EKHA 4L1IA 2G45B 2DDCA 3Q3FA 4LJPB 1CV7A 4K7SA 1T0YA 4BKSA 2JUOA 2DUIA 2GOWA 3NOBA 1NDDA 2N7EA 2G5ZB 2QLIA 1RRBA 4AWJA 4FA6A 3U30A 1XAEA 1WXSA 3SVRA 1RFAA 4MJSA 3H1RA 1JC1A 2OKWA 4LW5A 2GBJA 4A3PA 5LTPA 1UGMA 3DQ9A 3KUCB 1EMAA 4NY0A 2HFCA 4AOFA 4GF6B 2N9EB 4JIOU 3U8ZA 1GL4A 4PFEA 3VVWB 4OJ0A 3WIMA 2KDBA 3DBSA 1U4AA 3V62A 4GU2A 3DQ4A 2JWZA 4W73A 2L0TA 4IWOA 3MTNB 2B3AA 2M8SA 1QYQA 2JZZA 2H5RA 4ZRKA 3NHEB 4E3CA 1V86A 3GJ1A 4YL8A 4GN1A 3MHSD 4LDTD 3DVGY 4ICUA 5BO4B 3WALA 3PRPB 1GGXA 4KW9A 2C7MB 3CBEA 2CU1A 4IWQA 2MLBA 3CD9A 3UIOB 2LXCA 4IM3A 3S2AA 2L05A 4IWPA 1H4UA 4TZGA 2CS4A 3M24A 3ML8A 3DQIA 4IK9A 2IOVA 4Z4MA 2G6YA 4TV3A 4M8MA 2A56B 2K25A 3PRZA 1IP9A 3SHQA 2WWZA 2I1KA 1MG8A 4I6LB 3W1DA 1PQSA 4KV2A 3DPDA 2FAZA 4B6WA 4FADA 5CHWA 5DQBA 4BKGA 3A9KA 2MBOA 2ZEQA 3APCA 4ASWC 1Y8RC 2J0KA 4ZRJA 1WMHA 4KF5C 3DQ2A 3VTWA 4GOBA 2GBRA 2WHSA 2MA9B 3DQEA 4B30B 3ST2A 3SG6A 4GB9A 5GMVA 2LGYA 1WZ3A 1E90A 3Q3JA 3DVNU 2WDTB 2FUHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RCZ A;  2J0M A;  2MX2 A;  2KO3 A;  4FJY A;  3N32 A;  4DK5 A;  2KJH B;  2G16 B;  4IM2 A;  5DTL A;  2JRH A;  1RM9 A;  1WMH B;  4DDI D;  2Z6X A;  4AS8 A;  2FZU A;  3SVN A;  3G9A A;  3PJ5 A;  3DQU A;  1RMP A;  3E5T A;  2REX A;  5EHU A;  4W9I A;  4W6K A;  4W7C A;  5H87 A;  4IUM B;  1J0G A;  3SVD A;  2ZPN A;  4EEW A;  3U7D A;  3WAO A;  3WA0 A;  2Q57 A;  2YVC A;  3LSA A;  3QWZ B;  4IK1 A;  2VAD A;  5KTG A;  4KZC A;  4DXP A;  3LS3 A;  3B08 A;  1WJ4 A;  4W7E A;  3GB3 A;  2L7R A;  4XGY A;  1Q1O A;  4I2Y A;  2LZ6 A;  2HQZ A;  1P3Q U;  2K1F A;  3V6E B;  2HD5 B;  3TMT A;  2LRU A;  1WGR A;  4DXA B;  5EXB A;  2ZVN A;  2QRF A;  5EJU A;  1JBZ A;  4J6I A;  3ZTD A;  1W7U A;  3L13 A;  1EF1 A;  2KQS A;  2DZK A;  2LVP A;  2ZMU A;  5E6N A;  5L83 A;  3ZNZ B;  4W6G A;  2EKE C;  4B9K A;  3EKJ A;  3MJW A;  4DXI A;  2UWQ A;  2KDF B;  3VHT C;  2V4E A;  3RZF A;  2CR5 A;  2K8B A;  4JGH B;  2QLH A;  1IPG A;  2G6E A;  3IR8 A;  1V5T A;  1Z2M A;  1X1M A;  3ZIM A;  3APD A;  1QYO A;  3K9P B;  3GOE A;  4NJ6 A;  3NY5 A;  2YE1 A;  3H7P A;  3NF0 A;  4NAW B;  5F9G A;  5BTT B;  2C9I A;  4HK2 A;  2HJO A;  2JF5 A;  2N4F A;  4DXO A;  1WGH A;  4XL5 A;  2KC2 A;  3V61 A;  3QCA A;  2XBB C;  1MYW A;  1QZE A;  3EC8 A;  4MGI E;  5EXC I;  2KOX A;  2A46 A;  4PS8 A;  5LXH A;  4W6J A;  3ZDT A;  2DDD A;  2RPQ A;  3ZNI D;  1UIS A;  5TR5 A;  2GW4 B;  2KWU B;  4Z4K A;  4H48 A;  5J2R A;  3W1Y A;  1TGZ B;  3TJP A;  3DQH A;  2NBV B;  3IVF A;  4GDK B;  1FXT B;  4AJY B;  2GX0 A;  3ST3 A;  4W9C A;  1OXE A;  4JF9 A;  3CB9 A;  2QLG A;  3UF8 A;  1E8X A;  3SRY A;  5AQB B;  3QJZ A;  3UIP B;  1P0R A;  5CHF A;  3LVC A;  5JHB A;  4MJS B;  3LVD A;  3CSF A;  4NJ7 A;  3AI5 A;  1TTN A;  4BOS C;  3N30 A;  5C23 A;  3JSV B;  1WYW B;  2FNJ B;  2VVH A;  3RWT A;  2VVJ A;  1S1Q B;  3RT3 B;  3CF6 E;  2CHZ A;  3DPZ A;  2G3O A;  3PHX B;  4CYE A;  3LVA A;  2ARL A;  2V4E C;  2DAJ A;  3JW0 X;  5J18 A;  4IZN A;  3C0R B;  3IFW B;  3R3M A;  3T9L A;  3DQF A;  3SVS A;  1HE8 A;  3LF4 B;  3DOW A;  1LXD A;  3KCS A;  3BIN A;  5IAA C;  2G4D B;  1LM8 B;  4MH0 E;  1YHG A;  1YD8 U;  2JY6 A;  2YFP A;  4ZFS A;  3QK0 A;  3TIX A;  1B9C A;  1XD3 B;  4FN2 A;  2JPH A;  3RD2 A;  3DPW A;  3OAW A;  2Z0E B;  4WJQ A;  3A1Q B;  3H6N A;  3U8A A;  2IBI B;  2FL1 A;  2VZX A;  5J17 A;  1YJ1 A;  3DQD A;  3WLD A;  4W9G A;  3QC8 B;  4W6S A;  4GXB A;  5E6P A;  4I6N B;  1UH6 A;  2IB6 A;  5AZG A;  2M4N A;  3SG3 A;  4W9L A;  1WX8 A;  3PPA A;  4TQ1 A;  2I1J A;  1KYS A;  2KFJ A;  4EZJ A;  3AXC A;  2BWE S;  1WJ6 A;  5DPT A;  5DRG A;  3PSE B;  3PGE A;  1WR1 A;  2KHW B;  3BXB A;  3NT3 A;  4PS7 A;  2OTB A;  4W6I A;  4LDT B;  2WIQ A;  2BKF A;  1CMX B;  2O2V B;  3X23 A;  4BKS D;  2PPH A;  3OJ4 B;  3R7Q A;  2D2Q A;  1EME A;  4MEL A;  2AHA A;  3E5W A;  3KVF B;  2JRI B;  2LGX A;  2N7D A;  4IG7 B;  4K81 A;  3IP2 A;  3OJ3 A;  3B0A A;  3GEX A;  3M95 A;  4EOY A;  2PXS A;  3ZUL A;  4URK A;  3VHT B;  4LQU A;  3CST A;  4HQC A;  4ZF5 A;  1V9J A;  1YIW A;  1OEY A;  2MWS B;  3APF A;  2H5O A;  2QZ0 A;  3GL4 A;  3P8U A;  4IK3 A;  5EDS A;  1E8Z A;  2L76 A;  4NWS A;  4EUL A;  2AWJ A;  3H1O A;  5DPG A;  2KX0 A;  3TL5 A;  4LCD E;  1P98 A;  3JYU A;  2KJR A;  4W72 A;  4MSQ B;  3TMP B;  4KSL C;  3ZTC A;  3AKO A;  4ORN A;  1ISN A;  2KMA A;  1V80 A;  1Z1Q A;  3ST4 A;  2K6Q A;  3ONS A;  3EK7 A;  4DKM A;  3JVZ X;  4AUQ C;  1MOV A;  5LTQ A;  4DXM A;  3M3J A;  2WHT A;  3X0W A;  5FR6 A;  1I42 A;  2FCM A;  3HHM A;  1RMM A;  3PVL A;  2V4E B;  2FCQ A;  2MBE A;  4RMA A;  3U0N A;  4B5Y A;  5L95 C;  3DBH I;  4W6F A;  1WI0 A;  2DZM A;  5LLI A;  4H3N A;  5G55 A;  4LJO B;  1AAR A;  4EZK A;  1XMZ A;  4XVP A;  1EO6 A;  2BWF A;  2XEW A;  3HM6 X;  2IO0 B;  3MGF A;  1WXA A;  5DPJ A;  4XOW A;  1V2Y A;  4EN1 A;  5CX3 A;  3ZRF A;  1LQB A;  4WWO A;  2C5L C;  4EKU A;  2W9N A;  4OQW A;  1R4M I;  2AWK A;  3ECI A;  2HJ8 A;  3VUY A;  4W74 A;  4ZF4 A;  3M63 B;  1SE9 A;  1L2N A;  1UBQ A;  1OTR B;  2MQJ A;  3AUL A;  4W6N A;  1EMK A;  4W6R A;  3ENE A;  4JGE A;  2H9W A;  3PJ7 A;  2ZZP B;  2Y0G A;  1M94 A;  3DQN A;  3L16 A;  3VH3 B;  4W6O A;  2MW5 A;  1XT9 B;  2DZI A;  4N3D A;  5DPS A;  5DU0 A;  2WYQ A;  5AZH A;  4ICV A;  3PT2 B;  3L10 B;  5E6O A;  1KOT A;  5DCN A;  3KW5 B;  4HDQ A;  2IO3 B;  4MDK E;  2DHZ A;  4ZBL A;  5KHQ A;  3NED A;  4ZB1 A;  2WX1 A;  3GZN I;  3NZS A;  5KHO A;  4KF4 A;  4W76 A;  3L54 A;  4II2 B;  3LA1 A;  4WWP A;  4A3O A;  4IK4 A;  4WJN A;  4LJD A;  4ZYN A;  1WRD B;  1UD7 A;  2RR9 A;  2AL6 A;  3A4S C;  2AWM A;  3D32 A;  1F9J A;  4PYU A;  5FHV A;  1G6J A;  1Q0W B;  3O77 A;  3B1L X;  1QY3 A;  2C7H A;  3SG7 A;  1WFY A;  2N1V A;  1F0B A;  2JT4 B;  3A1Q A;  5FVG A;  1EMM A;  3WAP A;  2OJK A;  2O6V B;  2MBH A;  2ASQ A;  4WWN A;  3ZO5 B;  2BPS A;  3ZUF A;  3VTV A;  4BFR A;  2AH8 A;  2BGF A;  2KLC A;  2P4M A;  3ZUJ A;  2LD9 A;  4OVV A;  1IYF A;  4XOV A;  1YFP A;  2HCG A;  3RZW C;  2ZJD A;  3VK1 A;  3SST A;  1MOU A;  3QIJ A;  1YHH A;  2D07 B;  4W9E A;  2ZVO A;  2UYZ B;  4JLC A;  4AR7 A;  3EEC A;  2MSE D;  4PYZ A;  2ZMW A;  1GJZ A;  2O24 A;  4EFO A;  4U2V A;  2O2V A;  4BOZ B;  4NAW A;  4FBJ B;  5D7G A;  3OSR A;  2OJR A;  2IB5 A;  1UEL A;  5HZT A;  1Z5S B;  3U0K A;  2ZO6 A;  4K7U A;  3KYC D;  3IBE A;  4W6B A;  1YX5 B;  2NVU I;  2DD9 A;  4ANW A;  2DUE A;  3N3K B;  1EML A;  2OKY A;  2YDZ A;  4MSM B;  2BYV E;  3HK0 A;  4ANU A;  4HPM B;  3EK4 A;  3DCG A;  3CMM B;  3DPX A;  3ALB A;  2POX A;  5DTX A;  2WSO A;  3TBL D;  3VUW A;  2K8H A;  4W6L A;  4NQK E;  1SGH A;  2FWQ A;  4ANJ A;  4DHJ D;  4W6H A;  3M22 A;  1KM7 A;  2DUG A;  3DQ6 A;  4KPI A;  2A54 B;  4WJO A;  1BT0 A;  1GFL A;  5DPR A;  4RM9 A;  2KTR B;  3ZKJ C;  2D3G A;  1OEY J;  1BFP A;  2GBN A;  4JL9 A;  3TMR A;  4GDL A;  1ZW7 A;  5JZE B;  2K8C A;  3KUZ A;  5CTR C;  5JH5 C;  2L00 B;  1OGW A;  1HCJ A;  4GGQ A;  4MGK E;  2ZPY A;  1W7T A;  3I3T B;  2DYO A;  3SG4 A;  1WGY A;  4OY4 A;  4HE4 A;  2A53 B;  3BXA A;  2XK5 B;  3S05 A;  4HVB A;  2NBW B;  2Z59 B;  4KDL B;  2O29 A;  1EMG A;  3SVC A;  4CHK A;  2B3Q A;  3CGL A;  5AEK B;  3K9O B;  4Q7U A;  3EVU A;  4DBG A;  2BYF A;  3R7R A;  3ZNH B;  5EB6 A;  1Q73 A;  1WX7 A;  1WGG A;  3SSP A;  5H89 A;  1ZGO A;  4OGS A;  3RUL A;  4ANX A;  4IC7 B;  2HGY A;  3T8M A;  4PPJ A;  2O2B A;  1GUA B;  3L0W B;  5D6J B;  2C7N B;  2DUF A;  4JEO A;  3EVR A;  4E74 A;  5LK4 A;  2KK8 A;  5IA7 A;  3NEZ A;  4H47 A;  1P9D U;  4ZF3 A;  1WJN A;  4AJW A;  3WAN A;  4IK5 A;  1F09 A;  4W6M A;  4ZIN A;  2DYM A;  1RLF A;  2HPW A;  3DQL A;  1E7U A;  5D94 A;  3AU5 A;  1C1Y B;  4BBN F;  1NI2 A;  1QYF A;  3W1S C;  2JZ3 B;  4HLE A;  2KVR A;  3L17 A;  3I19 A;  4NPN A;  1S6Z A;  1WE7 A;  2PJH A;  1Q4E A;  5H88 A;  4J89 A;  4W75 A;  5HZO A;  4P76 A;  3VAW A;  1R4N I;  2QT2 A;  3TCA A;  2AEH A;  3RYT A;  4H3L A;  2GW3 A;  4K7W A;  3DQ3 A;  2M17 A;  3SVO A;  4KIK B;  4W69 A;  3H1U A;  1TZ1 A;  3SSV A;  5BT0 A;  1VCB A;  5HZS A;  4IW0 A;  4LJC A;  4FLH A;  2BTJ A;  4XZ4 A;  2LRW A;  4W9J A;  2L8J A;  4W6T A;  3RUI B;  2FCN A;  3WCK A;  2A50 B;  2J7Q B;  1WY8 A;  4ZIO A;  2EMO A;  4F7Z A;  2QHO A;  3LJ3 A;  2IY0 B;  4KAG A;  2D10 A;  3PTF C;  3NZU A;  2PE6 B;  2H6V A;  2G3Q B;  4NQL B;  4DWF A;  3ZUN A;  4PPL A;  3L08 A;  2PXW A;  1S3S G;  2HTH A;  3H7P B;  2R2Q A;  3VQI A;  4KVG B;  5HW9 A;  2FID A;  4K1R B;  1V5O A;  4IK8 A;  1Q4C A;  1JBY A;  2KJ6 A;  2WX0 A;  2HRS A;  5HKH A;  4G3X B;  3W1C A;  4KSK C;  2A48 A;  5HBD A;  4ZDV A;  1ZGQ A;  2LUE A;  1WM2 A;  2GX2 A;  2NR2 A;  4M8N A;  4MEM A;  4OHS A;  4DHZ B;  5BQL A;  3UIN B;  4Q9W A;  2A52 B;  1KP5 A;  4EZL A;  4B95 A;  4DKN A;  3VXW A;  3ML9 A;  1JRU A;  3ZLZ A;  1J8C A;  1OXF A;  5DPW A;  3PV1 A;  4EUT A;  1HUY A;  3IG3 A;  2IE2 A;  1H4R A;  3A4R A;  1W7S A;  3UG0 A;  1E8W A;  2KX3 A;  3SSK A;  1K8R B;  4J8A A;  1SIF A;  3VIC A;  4W9H A;  2BYE A;  3BY4 B;  2MP2 B;  4HJK A;  3H9D A;  2KMC A;  5T3I A;  5DPH A;  3DVN V;  2IZV B;  4BKT A;  3WLC A;  4R6B A;  5EBJ A;  3QHT A;  2Q6P A;  3CFA A;  2NBU A;  2IY1 B;  2ZO7 A;  4XC2 A;  5DQM A;  4RYS A;  2OGR A;  3KH0 A;  2DZJ A;  3A9K B;  2BF8 B;  3ADF A;  3SSH A;  2N9P C;  3BX9 A;  4KEX A;  3V3D A;  4TZA A;  2HE7 A;  2FIF A;  2MBB B;  3IHP C;  4PS3 A;  3PJB A;  4LQT A;  4NNJ B;  2YE0 A;  3PZD A;  5HZU A;  3ZTF A;  4W6D A;  4W7X A;  2GBM A;  4L12 A;  2RSU A;  1XSS A;  2QLG B;  4GIV A;  4Q7R A;  3LF3 A;  4GMV A;  1TBE A;  4GDL B;  3EK8 A;  4GDK A;  3CFH A;  2IO1 B;  3JSV A;  2B3P A;  2DD7 A;  1KYR A;  2D11 A;  5J2O A;  4MM3 A;  4BVU C;  1V81 A;  4W6C A;  1RMO A;  4WQO B;  2AWT A;  4JRB A;  2WHU A;  1WH3 A;  3KUD B;  2K6D B;  4TQ0 A;  2EMT A;  1WZ0 A;  3SG2 A;  2Z6Y A;  3ST0 A;  4IM0 A;  3KCT A;  2G3D B;  1YHI A;  1YJF A;  4ZRI A;  3DQV A;  3V60 A;  4G50 A;  3UQB A;  3QQ8 B;  2CHW A;  4DHZ E;  4HVF A;  4DXN A;  4W6A A;  4CO7 A;  2C9W B;  2KQ7 A;  4GES B;  3U0L A;  1WIA A;  4LJB A;  2RD0 A;  5D2M B;  1KJT A;  2YLM A;  3SD5 A;  3EVP A;  2LGD A;  4N9F 4;  4DHJ B;  1YJ2 A;  1ZGU B;  2WIS A;  2WSN A;  2CHX A;  1RRX A;  2A4Z A;  3U8P A;  5HGE A;  4RTC A;  1OQY A;  1EMF A;  2HGD A;  3EFU A;  1YZW A;  2EMD A;  2L0F A;  3P28 A;  5EXU A;  4RM8 A;  3DQ1 A;  4KDI C;  2Z1O A;  3R66 C;  3A9J A;  4TUU A;  3W1S A;  4WAA A;  2KWV B;  4JQW C;  4A20 A;  3VUX A;  3DBR I;  5FVF A;  2IO2 B;  4W9D A;  5LTR A;  4FHK A;  2LWP A;  3H7S A;  2AYO B;  2KD0 A;  2J0J A;  2IYD B;  3SVU A;  3DVG X;  3OGO A;  1QXT A;  4W6P A;  2BKR B;  2AWL A;  4F8C B;  2KKC A;  1E8Y A;  5DTZ A;  4W7R A;  2G6X A;  4P7I A;  2N1W A;  1ZGP A;  3A8S A;  2H5P A;  1Q4B A;  3OLM D;  2EMN A;  4MGY E;  4DXQ A;  1V49 A;  1WM3 A;  4JFG A;  2EMS A;  1G7K A;  4KIK A;  1EMB A;  2ICR A;  4H3M A;  4HWI B;  2DYB A;  4ANV A;  1WR6 E;  3PHW B;  2H5Q A;  5CHV C;  3DQO A;  2ZCB A;  4EDO A;  2H8Q A;  3DQK A;  1WGD A;  4W77 A;  2LVO A;  5EB7 A;  2MP2 A;  4W6U A;  1XQQ A;  3VH4 B;  1WE6 A;  1EUV B;  2NPT A;  2KN5 A;  2HQK A;  2MCN B;  3DQJ A;  4EDS A;  2MRP A;  4BBN C;  2DUH A;  2O6V D;  1UZX B;  2Z0D B;  2CKH B;  2KZR A;  3P2B A;  1L7Y A;  4HCP B;  1WJU A;  4EMQ A;  3DQA A;  2ZNV C;  1VD2 A;  4X57 B;  1LFD A;  2WUR A;  3NS8 A;  1J19 A;  3A33 B;  2ZNV B;  4TKN A;  4F1S A;  1GC7 A;  1H6R A;  2DX5 B;  4PPK A;  3SU8 X;  1C4F A;  4KGE A;  2A5U A;  4WJP A;  4BDU A;  2LJ5 A;  2NCN A;  2O6V A;  4KGF A;  1A5R A;  3EVV A;  2KFK B;  1OXD A;  3DDC B;  3AI4 A;  1E7V A;  3QAQ A;  1EF5 A;  2JVC A;  4FJV B;  4HDO A;  4HQ9 A;  2XK5 A;  4RYW A;  4FUL A;  2V3S A;  3AU4 A;  4I6P A;  2RH7 A;  2KAN A;  3BXC A;  2R2O A;  4Q9X A;  2GBK A;  2OTE A;  2A47 A;  4L13 A;  3VTU A;  2G4S A;  3EHV A;  3O65 B;  5AZF A;  2PE9 A;  4MGZ E;  2NS5 A;  2KLG A;  2PEA A;  4DDG D;  4XX5 A;  2GMI C;  3DQM A;  5BTT A;  1Q5W B;  1ZKH A;  3CFF A;  3O78 A;  3SV5 A;  1YQB A;  2K39 A;  2RGF A;  4W9K A;  3DQC A;  3DQ7 A;  2C9J A;  2LI5 A;  2VVI A;  2M0X A;  4KW4 A;  4AP4 C;  2L3Z A;  3DQ5 A;  1GNU A;  5JHA A;  4HPL B;  5C1Z A;  2KC1 A;  3SG5 A;  3SSY A;  1D3Z A;  2LXA A;  2JXX A;  2OOB B;  1JC0 A;  3RWA A;  3PS6 A;  3VHT A;  3ZW3 A;  4E71 A;  3U0M A;  3PRM B;  4W9F A;  3UFZ A;  4P1Q A;  5FVI A;  3UGB B;  2AL3 A;  3QAR A;  1XQM A;  4W7F A;  4G0N B;  2DAF A;  3ZVV A;  2ZCC A;  2KDE B;  1P1A A;  4KZ0 A;  3QX1 A;  3PLU A;  2LVQ A;  4HQ8 A;  3ZNG C;  4FHJ A;  4KW8 A;  4W7A A;  1NBF C;  3DBL I;  4OVU A;  3VFK A;  2V1Y A;  4UTS A;  2NPT B;  4R6D A;  4W7D A;  2KTR A;  3SSL A;  3SS0 A;  3SDL C;  2KFK A;  2V4L A;  2JAD A;  5DPI A;  3ED8 A;  2N9X A;  1ZUX A;  2KDI A;  3UQA A;  3WAM A;  3E5V A;  1GC6 A;  2QLE A;  2M1M A;  4G11 A;  1Z1P A;  3V6C B;  4HCN B;  2C60 A;  3K1K A;  4HXD A;  3LDZ E;  5DTY A;  4GSW A;  3PRE A;  3PIB A;  2KWC A;  2KTF A;  2KNB A;  4GOC A;  4M0W B;  3U8C A;  4LJD C;  3PLV A;  2DEN B;  2VAE A;  1YX6 B;  3NT9 A;  2LAS A;  5DY6 A;  2MBQ A;  2KXJ A;  4J88 A;  4KA9 A;  3A9J B;  3SVB A;  1V6E A;  1Q4A A;  3HIZ A;  1I35 A;  5LXI B;  4JC2 A;  2Z6Z A;  3ZDM C;  5DRF A;  4KF5 A;  3QA8 A;  3OSQ A;  1WXV A;  1KLV A;  1XA9 A;  4II3 B;  1C3T A;  1E5W A;  2G2S B;  1Q4D A;  3M62 B;  3HM3 A;  2FCS A;  4FJZ A;  2VRR B;  4Q7T A;  3VDZ A;  2Y5B B;  3DQ8 A;  1WX9 A;  5G2N A;  1GG3 A;  1WXM A;  3SVE A;  1UBI A;  3KYD D;  3GJ2 A;  1WF9 A;  1EMC A;  4B30 A;  3CD1 A;  1RAX A;  3ZRC A;  1H8C A;  1KYP A;  2QU1 A;  3EKH A;  4L1I A;  2G45 B;  2DDC A;  3Q3F A;  4LJP B;  1CV7 A;  4K7S A;  1T0Y A;  4BKS A;  2JUO A;  2DUI A;  2GOW A;  3NOB A;  1NDD A;  2N7E A;  2G5Z B;  2QLI A;  1RRB A;  4AWJ A;  4FA6 A;  3U30 A;  1XAE A;  1WXS A;  3SVR A;  1RFA A;  4MJS A;  3H1R A;  1JC1 A;  2OKW A;  4LW5 A;  2GBJ A;  4A3P A;  5LTP A;  1UGM A;  3DQ9 A;  3KUC B;  1EMA A;  4NY0 A;  2HFC A;  4AOF A;  4GF6 B;  2N9E B;  4JIO U;  3U8Z A;  1GL4 A;  4PFE A;  3VVW B;  4OJ0 A;  3WIM A;  2KDB A;  3DBS A;  1U4A A;  3V62 A;  4GU2 A;  3DQ4 A;  2JWZ A;  4W73 A;  2L0T A;  4IWO A;  3MTN B;  2B3A A;  2M8S A;  1QYQ A;  2JZZ A;  2H5R A;  4ZRK A;  3NHE B;  4E3C A;  1V86 A;  3GJ1 A;  4YL8 A;  4GN1 A;  3MHS D;  4LDT D;  3DVG Y;  4ICU A;  5BO4 B;  3WAL A;  3PRP B;  1GGX A;  4KW9 A;  2C7M B;  3CBE A;  2CU1 A;  4IWQ A;  2MLB A;  3CD9 A;  3UIO B;  2LXC A;  4IM3 A;  3S2A A;  2L05 A;  4IWP A;  1H4U A;  4TZG A;  2CS4 A;  3M24 A;  3ML8 A;  3DQI A;  4IK9 A;  2IOV A;  4Z4M A;  2G6Y A;  4TV3 A;  4M8M A;  2A56 B;  2K25 A;  3PRZ A;  1IP9 A;  3SHQ A;  2WWZ A;  2I1K A;  1MG8 A;  4I6L B;  3W1D A;  1PQS A;  4KV2 A;  3DPD A;  2FAZ A;  4B6W A;  4FAD A;  5CHW A;  5DQB A;  4BKG A;  3A9K A;  2MBO A;  2ZEQ A;  3APC A;  4ASW C;  1Y8R C;  2J0K A;  4ZRJ A;  1WMH A;  4KF5 C;  3DQ2 A;  3VTW A;  4GOB A;  2GBR A;  2WHS A;  2MA9 B;  3DQE A;  4B30 B;  3ST2 A;  3SG6 A;  4GB9 A;  5GMV A;  2LGY A;  1WZ3 A;  1E90 A;  3Q3J A;  3DVN U;  2WDT B;  2FUH B; 
#chains in the Genus database with same CATH topology
 3RCZ A;  2J0M A;  2MX2 A;  2KO3 A;  4FJY A;  3N32 A;  1R7S A;  4DK5 A;  2KJH B;  1R4M B;  2G16 B;  4IM2 A;  1RYJ A;  5DTL A;  2JRH A;  3T3N A;  1RM9 A;  2M19 A;  1J7C A;  1WMH B;  4DDI D;  2L52 A;  2Z6X A;  4AS8 A;  2FZU A;  3SVN A;  2JYE A;  4H2A A;  4A6Q A;  3G9A A;  3PJ5 A;  3DQU A;  1RMP A;  3E5T A;  2REX A;  5EHU A;  4RCO A;  4W9I A;  4W6K A;  4W7C A;  5H87 A;  3FAH A;  4RH6 A;  4IUM B;  1J0G A;  3SVD A;  2ZPN A;  4EEW A;  2WXI A;  1ZDV A;  3TEX A;  3U7D A;  3WAO A;  1FMA D;  3WA0 A;  2Q57 A;  1N60 A;  3N9Y C;  2YVC A;  3LSA A;  3QWZ B;  4LNF A;  4IK1 A;  2VAD A;  1C78 A;  5KTG A;  3Q6B A;  4KZC A;  3AMZ A;  4DXP A;  3DWM A;  2MJD A;  3LS3 A;  1B1Z A;  3B08 A;  1WJ4 A;  4W7E A;  3GB3 A;  2WQY B;  1DOY A;  2L7R A;  1V1O A;  4XGY A;  1Q1O A;  4I2Y A;  3NS1 A;  2JQR B;  2LZ6 A;  4YSX B;  2HQZ A;  1P3Q U;  2BS2 B;  3HUI A;  3U2S C;  2OED A;  4P16 A;  2K1F A;  3V6E B;  2DLB A;  3C19 A;  1JWA D;  4L1B A;  2HD5 B;  3TMT A;  4OZC A;  1T0Q C;  2LRU A;  1WGR A;  4DXA B;  5EXB A;  2ZVN A;  2QRF A;  5EJU A;  1JBZ A;  1SF0 A;  4J6I A;  3ZTD A;  3FC4 A;  1W7U A;  4ARI A;  3L13 A;  1IUE A;  1EF1 A;  2KQS A;  2DZK A;  2LVP A;  2UU7 A;  4GLS C;  2ZMU A;  5E6N A;  5L83 A;  2V4I B;  3ZNZ B;  1AW7 A;  4W6G A;  2EKE C;  4B9K A;  3EKJ A;  3MJW A;  4DXI A;  2UWQ A;  2KDF B;  3VHT C;  2V4E A;  3RZF A;  1KTK A;  2K8B A;  2CR5 A;  4JGH B;  2QLH A;  1IPG A;  2G6E A;  3SR6 A;  3TUO A;  3IR8 A;  2BQQ A;  2RMM A;  3I5J C;  1V5T A;  1Z2M A;  1X1M A;  3ZIM A;  3APD A;  1QYO A;  4M0W A;  3K9P B;  1YQ4 B;  2WXP A;  3GOE A;  4NJ6 A;  3NY5 A;  2YE1 A;  3H7P A;  3NF0 A;  3RMK C;  1M4V A;  4KKI A;  5F9G A;  5BTT B;  4NAW B;  2C9I A;  4HK2 A;  2HJO A;  2JF5 A;  2N4F A;  4DXO A;  1WGH A;  1JQ4 A;  1IGD A;  4XL5 A;  2KC2 A;  4UDU C;  3V61 A;  1SE2 A;  3QCA A;  4XWW A;  3B2G A;  2XBB C;  1L6U A;  1MYW A;  1QZE A;  3EC8 A;  4MGI E;  5EXC I;  2KOX A;  2VZK B;  2A46 A;  4PS8 A;  5LXH A;  4W6J A;  1I4X A;  2HTM E;  3ZDT A;  2RPQ A;  2DDD A;  2BT6 A;  3ZNI D;  1UIS A;  5TR5 A;  2GW4 B;  2KWU B;  4Z4K A;  5G5G A;  2DNF A;  4H48 A;  2KDM A;  5J2R A;  2E3T A;  3AE8 B;  3W1Y A;  1TGZ B;  3RNA C;  3TJP A;  3DQH A;  3P4S B;  2NBV B;  1NYQ A;  3IVF A;  4GDK B;  1E7P B;  1FXT B;  4AJY B;  2LMC A;  2GX0 A;  3ST3 A;  4W9C A;  1C4A A;  1OXE A;  4JF9 A;  3CB9 A;  2QLG A;  3UF8 A;  1E8X A;  1MHH E;  1MVK A;  3SRY A;  5AQB B;  3QJZ A;  3UIP B;  4EE2 A;  2WXK A;  1P0R A;  3IXS A;  5CHF A;  3LVC A;  5JHB A;  4MJS B;  3LVD A;  3CSF A;  4NJ7 A;  2WXO A;  2WNM A;  3AI5 A;  1TTN A;  3AE6 B;  4DXF A;  1K50 A;  4BOS C;  3N30 A;  2IPK D;  5C23 A;  3JSV B;  1WYW B;  2FNJ B;  2VVH A;  3RWT A;  2VVJ A;  1S1Q B;  3RT3 B;  3CF6 E;  2CHZ A;  2J53 A;  3DPZ A;  2PIA A;  2WXH A;  1FRR A;  1FNU A;  4P1B C;  2G3O A;  3PHX B;  4CYE A;  3LVA A;  2ARL A;  1V8C A;  4C80 A;  4LNK A;  2V4E C;  2DAJ A;  3JW0 X;  4YXD B;  5J18 A;  4IZN A;  3C0R B;  3IFW B;  1T0S C;  3AEC B;  3DQF A;  3R3M A;  3SVS A;  3MC9 A;  3T9L A;  1HE8 A;  3LF4 B;  1T6B X;  3DOW A;  1LXD A;  1CK1 A;  1TY0 A;  3KCS A;  3BIN A;  5IAA C;  2G4D B;  3AE5 B;  3Q8A A;  1LM8 B;  2LEK A;  3HRD D;  4MH0 E;  1TS4 A;  4NZL B;  1YHG A;  3VRB B;  1YD8 U;  4JX1 C;  2YEP F;  3N1Y C;  2JY6 A;  2YFP A;  4ZFS A;  2WU5 B;  3QK0 A;  3TIX A;  1B9C A;  1XD3 B;  4FN2 A;  4LNI A;  2JPH A;  4LTU A;  3I9V 1;  3RD2 A;  4B0M A;  3DPW A;  3OAW A;  2Z0E B;  4WJQ A;  3A1Q B;  3H6N A;  3W9C B;  3U8A A;  3BYY B;  3W5U B;  1QOB A;  2IBI B;  2FL1 A;  2VZX A;  5J17 A;  1YJ1 A;  3DQD A;  2M56 B;  3WLD A;  4W9G A;  3QC8 B;  4W6S A;  2K9X A;  4GXB A;  5E6P A;  4I6N B;  1UH6 A;  1FNW A;  2IB6 A;  5AZG A;  2M0A A;  2M4N A;  3SG3 A;  3NUH B;  4W9L A;  1WX8 A;  2L1A A;  4YSZ B;  3PPA A;  4TQ1 A;  1FXA A;  1VJK A;  2I1J A;  1KYS A;  2KFJ A;  4EZJ A;  3AXC A;  2BWE S;  1RWS A;  3BWU D;  1WJ6 A;  1AYF A;  1MFW A;  1FNV A;  1WSP A;  2H89 B;  5DPT A;  4ZHO A;  5DRG A;  1CJE A;  4A9A A;  2NTS A;  3PGE A;  1WR1 A;  3PSE B;  2KHW B;  3BXB A;  3NT3 A;  4PS7 A;  2OTB A;  4W6I A;  4XWT A;  4S17 A;  4LDT B;  4MH8 A;  2WIQ A;  2BKF A;  1CMX B;  3LB8 C;  2O2V B;  3X23 A;  3Q8E A;  4BKS D;  4TSS A;  1F52 A;  4ZYS A;  1NEN B;  4BAX A;  2PPH A;  2BW2 A;  3OJ4 B;  3R7Q A;  2D2Q A;  1FIQ A;  1EME A;  2AHA A;  4MEL A;  3E5W A;  3KVF B;  2JRI B;  3RNG C;  3IAS 1;  2LGX A;  4M00 A;  1Y56 A;  1TIF A;  2N7D A;  4IG7 B;  4KGS A;  4K81 A;  2CJN A;  3IP2 A;  3OJ3 A;  3B0A A;  3GEX A;  3M95 A;  4EOY A;  2PXS A;  3ZUL A;  4URK A;  3VHT B;  4IKG A;  4LQU A;  3CST A;  4HQC A;  4ZF5 A;  1V9J A;  1YIW A;  1NYR A;  1OEY A;  2MWS B;  3APF A;  2H5O A;  5EE0 A;  2QZ0 A;  3GL4 A;  3P8U A;  4IK3 A;  2INC C;  5EDS A;  2QMT A;  1E8Z A;  2L76 A;  1XLP A;  1EM7 A;  4NWS A;  4EUL A;  2V9H A;  2AWJ A;  3H1O A;  5DPG A;  5H8Y E;  2KX0 A;  3TL5 A;  4LCD E;  4LK0 M;  1P98 A;  3JYU A;  1T0R C;  2JU6 X;  2KJR A;  4ITK A;  4W72 A;  4MSQ B;  5EE3 A;  3TMP B;  4KSL C;  2ZW0 A;  3ZTC A;  3AKO A;  4ORN A;  1ISN A;  3Q3O C;  5BYS A;  2KMA A;  1V80 A;  1Z1Q A;  3GE3 C;  1A70 A;  1C77 A;  3ST4 A;  2WXF A;  2K6Q A;  3ONS A;  3EK7 A;  4DKM A;  3JVZ X;  4AUQ C;  1MOV A;  5LTQ A;  4DXM A;  4LLG M;  1KLU D;  3M3J A;  2WHT A;  1QF6 A;  3BVM A;  4Q2J A;  4ZRP A;  5FR6 A;  3X0W A;  3MC8 A;  1I42 A;  2FCM A;  3HHM A;  2B76 B;  1BUI C;  1RMM A;  2IDY A;  3PVL A;  2LHE A;  2V4E B;  2FCQ A;  1V97 A;  2MBE A;  4RMA A;  3U0N A;  4B5Y A;  2W54 A;  2QCZ A;  3AN1 A;  4LNN A;  5L95 C;  3DBH I;  5MPO A;  3EFC A;  4W6F A;  4LNO A;  3SFE B;  1WI0 A;  2LHD A;  4ZRQ A;  2DWQ A;  1C4P A;  2DZM A;  5LLI A;  4XYC A;  4A90 A;  1PGB A;  4H3N A;  3AE3 B;  5G55 A;  4LJO B;  4JPS A;  1ZE3 D;  1AAR A;  4EZK A;  1XMZ A;  2KAC A;  4HKQ A;  4XVP A;  1EO6 A;  2BWF A;  2XEW A;  2GB1 A;  3HM6 X;  1PUT A;  2IO0 B;  3MGF A;  1GB4 A;  1WXA A;  5DPJ A;  4XOW A;  1V2Y A;  3RNF C;  4EN1 A;  4HEA 1;  4JWS C;  5CX3 A;  3ZRF A;  1LQB A;  4WWO A;  4AQ7 A;  2C5L C;  2JYT A;  3AE9 B;  4EKU A;  2W9N A;  4OQW A;  1R4M I;  2AWK A;  3ECI A;  2HJ8 A;  3VUY A;  3AE1 B;  4W74 A;  4ZF4 A;  3M63 B;  1SE9 A;  4XDC A;  1E6E B;  2I2Y A;  1L2N A;  1UBQ A;  1OTR B;  2MQJ A;  2ONQ A;  3AUL A;  4W6N A;  4K3B A;  3ETR A;  1EMK A;  4W6R A;  3ENE A;  4JGE A;  4RFB A;  2H9W A;  3PJ7 A;  1GPX A;  1JRO A;  3DHI C;  2ZZP B;  4C4V A;  2Y0G A;  1VR9 A;  1M94 A;  1MI0 A;  3DQN A;  3L16 A;  3VH3 B;  3ZXV A;  4W6O A;  1T5X D;  2MW5 A;  1XT9 B;  1L0V B;  2DZI A;  3PZ7 A;  1ZP0 B;  4N3D A;  3SFD B;  5DPS A;  5DU0 A;  2AQ2 B;  1ZDX A;  2WYQ A;  5AZH A;  4ICV A;  2R61 A;  3PT2 B;  3L10 B;  5E6O A;  1KOT A;  5DCN A;  3KW5 B;  3PZ8 A;  5BYQ A;  4HDQ A;  2IO3 B;  4MDK E;  4MAC A;  3OG5 A;  2DHZ A;  4ZBL A;  5KHQ A;  4ACF A;  3N1Z C;  3NED A;  4ZB1 A;  1J7A A;  2WX1 A;  1FO4 A;  3GZN I;  3NZS A;  5KHO A;  4KF4 A;  4W76 A;  3L54 A;  4MT5 A;  4II2 B;  3LA1 A;  4WWP A;  4A3O A;  4IK4 A;  4WJN A;  4LJD A;  1I4P A;  4ZYN A;  4L23 A;  1WRD B;  4YSY B;  1SXT A;  1UD7 A;  2RR9 A;  2AL6 A;  3A4S C;  2AWM A;  4DQO C;  3RPF C;  3D32 A;  1F9J A;  4PYU A;  5FHV A;  3IAM 1;  1G6J A;  1YN3 A;  1Q0W B;  3O77 A;  1I4H A;  3B1L X;  1QY3 A;  2C7H A;  3SG7 A;  1WFY A;  2N1V A;  1F0B A;  1TY2 A;  3P63 A;  2JT4 B;  2V3N A;  4NJC A;  2ACZ B;  3A1Q A;  5FVG A;  3NRZ A;  1EMM A;  3WAP A;  2OJK A;  2O6V B;  2MBH A;  2ASQ A;  4WWN A;  1KF6 B;  3ZO5 B;  2BPS A;  4RNA A;  3ZUF A;  3VTV A;  4BFR A;  4ZOH C;  2CU3 A;  3H8H A;  2AH8 A;  2BGF A;  3AM9 A;  1V1P A;  1QIL A;  2KLC A;  2P4M A;  1UNS A;  3ZUJ A;  2LD9 A;  4OVV A;  5IOI A;  3BK2 A;  4HPP A;  1IYF A;  4XOV A;  1YFP A;  2HCG A;  2L83 A;  3RZW C;  2ZJD A;  3VK1 A;  3MHZ A;  2V3P A;  3SST A;  1MOU A;  3QIJ A;  1YHH A;  2D07 B;  1QLB B;  4W9E A;  2ZVO A;  2UYZ B;  3L4P A;  5HHD G;  4JLC A;  4AR7 A;  3EEC A;  1N5W A;  2MSE D;  4PYZ A;  2ZMW A;  1GJZ A;  2O24 A;  4EFO A;  1TS5 A;  4U2V A;  2O2V A;  4BOZ B;  4NAW A;  3RNC C;  4FBJ B;  4PT5 A;  5D7G A;  3LXF A;  3OSR A;  2OJR A;  4ARC A;  4IOI E;  3EUB 2;  2IB5 A;  1UEL A;  1YJJ A;  3MC0 B;  5HZT A;  1Z5S B;  4OZA A;  1VZ7 A;  3U0K A;  1E0Z A;  2ZO6 A;  4K7U A;  3KYC D;  3IBE A;  1D5M C;  4W6B A;  2IGG A;  1YX5 B;  2KWD A;  3J9C A;  1UF0 A;  1PGA A;  2NVU I;  2DD9 A;  4ANW A;  2DUE A;  2PVG C;  1N5X A;  3DBL B;  3N3K B;  1EML A;  3Q3N C;  4YWG G;  1OQQ A;  1WRI A;  2OKY A;  2YDZ A;  4JWU C;  4J3O D;  4MSM B;  2BYV E;  4R3D A;  3HK0 A;  4ANU A;  3KWV A;  4HPM B;  3EK4 A;  3DCG A;  3CMM B;  1TKG A;  3DPX A;  2WXR A;  3ALB A;  2POX A;  4KGT A;  5DTX A;  2WSO A;  5IN7 A;  3TBL D;  3VUW A;  2K8H A;  4W6L A;  2BB5 A;  3V3X A;  4KKJ A;  4NQK E;  3AEF B;  1SGH A;  2FWQ A;  4ANJ A;  4DHJ D;  4W6H A;  3M22 A;  3AE2 B;  4C56 C;  1KM7 A;  2DUG A;  4C7Z A;  1FD6 A;  3DQ6 A;  4KPI A;  2A54 B;  4HKZ E;  4WJO A;  1C9F A;  1OFF A;  1BT0 A;  3FIL B;  1L0X B;  1XLO A;  2H88 B;  4NAM A;  1GFL A;  5DPR A;  4RM9 A;  2KTR B;  3ZKJ C;  2D3G A;  1CQV A;  1OEY J;  1BFP A;  1JML A;  2GBN A;  4JL9 A;  3TMR A;  2V0G A;  4GDL A;  1ZW7 A;  2BVC A;  3FKY A;  5IO9 A;  5JZE B;  2K8C A;  3KUZ A;  5CTR C;  4OW0 A;  1P7F A;  5JH5 C;  4AS1 A;  2L00 B;  1OGW A;  1V1P B;  3R2I A;  1HCJ A;  5G5H A;  4GGQ A;  2Y5C A;  3O13 A;  4MGK E;  1NVI D;  2ZPY A;  1W7T A;  3I3T B;  3IT6 B;  2DYO A;  3CIR B;  3SG4 A;  4CQN A;  1WGY A;  4OY4 A;  4HE4 A;  2A53 B;  3BXA A;  2XK5 B;  3S05 A;  2Y5P A;  4HVB A;  2RPV A;  2NBW B;  2Z59 B;  4KDL B;  2O29 A;  1EMG A;  3SVC A;  4CHK A;  2B3Q A;  3CGL A;  1L0Y B;  5AEK B;  3K9O B;  4Q7U A;  3EVU A;  4DBG A;  2BYF A;  3R7R A;  2J52 A;  3ZNH B;  5EB6 A;  2LGI A;  1Q73 A;  4JE3 B;  1HA5 A;  2JX5 A;  1EU4 A;  1WX7 A;  3IT4 B;  1WGG A;  1ZPS A;  3SSP A;  5H89 A;  3E9S A;  2W3R A;  1ZGO A;  4OGS A;  3RUL A;  1YMH E;  4ANX A;  2IGH A;  2HGY A;  2YEP B;  4IC7 B;  4PPJ A;  3T8M A;  2O2B A;  1GUA B;  3L0W B;  1SE4 A;  5D6J B;  3AEB B;  1HEZ E;  2C7N B;  2DUF A;  2VH1 A;  4JEO A;  3EVR A;  4E74 A;  4US8 A;  2JXT A;  3LYY A;  5LK4 A;  1C76 A;  2KK8 A;  2WP9 B;  1ESF A;  5IA7 A;  3NEZ A;  4H47 A;  1P9D U;  4ZF3 A;  1WJN A;  4AJW A;  5TSS A;  1XCT L;  3WAN A;  4IK5 A;  1F09 A;  4W6M A;  2DYM A;  4ZIN A;  1RLF A;  2HPW A;  3DQL A;  1E7U A;  5D94 A;  2MH7 A;  3AU5 A;  3Q8F A;  1C1Y B;  1OQR A;  1XLQ A;  2W82 A;  4BBN F;  1NI2 A;  1QYF A;  3W1S C;  2JZ3 B;  4HLE A;  2KVR A;  3L17 A;  2LFI A;  3U52 E;  3I19 A;  1VZ6 A;  4NPN A;  1S6Z A;  2KQ4 X;  1WE7 A;  1K53 A;  2PJH A;  1Q4E A;  3MP9 A;  5H88 A;  5C3J B;  4J89 A;  4W75 A;  5HZO A;  2GI9 A;  4P76 A;  3VAW A;  2FUG 1;  1R4N I;  1SB3 C;  3N1X C;  2QT2 A;  3TCA A;  2AEH A;  3RYT A;  2Z8L A;  4H3L A;  2GW3 A;  4K7W A;  3DQ3 A;  2PTL A;  2M17 A;  3SVO A;  1TKY A;  4KIK B;  4W69 A;  3H1U A;  1TZ1 A;  3SSV A;  2W55 A;  5BT0 A;  1VCB A;  1WWT A;  1C4C A;  5HZS A;  4IW0 A;  4LJC A;  3BVZ A;  4FLH A;  1VLB A;  2BTJ A;  1VDV A;  4XZ4 A;  2LRW A;  2JWU A;  4W9J A;  3AEA B;  2L8J A;  4W6T A;  3RUI B;  2FCN A;  1KFY B;  3WCK A;  1QKZ A;  2A50 B;  1KRH A;  2J7Q B;  1PFD A;  1WY8 A;  4ZIO A;  2EMO A;  2PLP A;  4F7Z A;  2QHO A;  3LJ3 A;  2IY0 B;  4KAG A;  2D10 A;  4HJG E;  3PTF C;  3NZU A;  2PE6 B;  2H6V A;  2G3Q B;  4RGN A;  4NQL B;  4DWF A;  3ZUN A;  4PPL A;  3L08 A;  2PXW A;  2RDG A;  1I7H A;  1S3S G;  4C7Y A;  1FPY A;  1PYW D;  2HTH A;  4K3C A;  3H7P B;  2R2Q A;  1DOX A;  3VQI A;  4KVG B;  5HW9 A;  2FID A;  4K1R B;  1V5O A;  4IK8 A;  1Q4C A;  1JBY A;  1LGR A;  2KJ6 A;  2WX0 A;  1CZP A;  2HRS A;  5HKH A;  2GLS A;  2K5P A;  4G3X B;  3W1C A;  4KSK C;  1QQR A;  2A48 A;  5HBD A;  2BS4 B;  4ZDV A;  2QIE B;  1ZGQ A;  2LUE A;  1WM2 A;  4N6E B;  2GX2 A;  2NR2 A;  1KLG D;  3U4E G;  4M8N A;  4MEM A;  4OHS A;  3P4P B;  4DHZ B;  1T3Q A;  5BQL A;  2BYT A;  1TT5 B;  3UIN B;  4Q9W A;  3KLS X;  1SBB B;  2A52 B;  1KP5 A;  4EZL A;  4B95 A;  4DKN A;  3VXW A;  1N6Z A;  3ML9 A;  1JRU A;  3ZLZ A;  3AB5 A;  1J8C A;  1OXF A;  5DPW A;  3PV1 A;  1TS2 A;  4M01 A;  2D5G A;  3B2F A;  3MFG A;  4EUT A;  4KX6 B;  3E56 A;  1ENF A;  1STE A;  1HUY A;  3IG3 A;  2IE2 A;  1H4R A;  3A4R A;  1W7S A;  3UG0 A;  1E8W A;  1JWM D;  2KX3 A;  3SSK A;  1F1H A;  1K8R B;  1D6E C;  4J8A A;  3ZJT A;  1SIF A;  2WXG A;  3VIC A;  4W9H A;  2BYE A;  3BY4 B;  5EE1 A;  2MP2 B;  4HJK A;  1E10 A;  3H9D A;  2KMC A;  5T3I A;  3EGR A;  2Q5W D;  5DPH A;  2D3C A;  3DVN V;  3RN9 C;  2IZV B;  4BKT A;  2J4X A;  3WLC A;  4R6B A;  1D5Z C;  5EBJ A;  5AUI A;  2DBY A;  3QHT A;  4YTP B;  2Q6P A;  3CFA A;  2NBU A;  2IY1 B;  2ZO7 A;  2EEL A;  4XC2 A;  5DQM A;  4RYS A;  2OGR A;  3KH0 A;  4KGR A;  2DZJ A;  3A9K B;  2BF8 B;  3DBR B;  3ADF A;  3SSH A;  1D4B A;  2N9P C;  3BX9 A;  4KEX A;  3V3D A;  4TZA A;  2HE7 A;  2FIF A;  2MBB B;  3IHP C;  4N59 A;  4PS3 A;  3PJB A;  4LQT A;  3DHH C;  2YE0 A;  3PZD A;  4NNJ B;  5HZU A;  3ZTF A;  2RDB C;  4W6D A;  2L32 A;  4W7X A;  1NEK B;  2GBM A;  4L12 A;  1K52 A;  2WXL A;  2CJO A;  1UWX A;  2RSU A;  1XSS A;  2QLG B;  4GIV A;  4Q7R A;  3LF3 A;  4GMV A;  1TBE A;  2LJI A;  3EK8 A;  4GDL B;  4GDK A;  3CFH A;  2IO1 B;  3JSV A;  4RF0 A;  2B3P A;  2DD7 A;  1KYR A;  2D11 A;  5J2O A;  4MM3 A;  4BVU C;  2IND C;  1V81 A;  3C8Y A;  4W6C A;  4MM3 B;  5BYR A;  1RMO A;  4WQO B;  4S0R A;  2IJ0 A;  2AWT A;  4JRB A;  4WQM A;  1XO3 A;  2WHU A;  3VR8 B;  4XDD A;  1WH3 A;  1AN8 A;  1GOZ A;  3BZD B;  3KUD B;  2K6D B;  4TQ0 A;  2EMT A;  1WZ0 A;  3SG2 A;  3B9J A;  1YQ3 B;  2Z6Y A;  3ST0 A;  4IM0 A;  1N61 A;  3KCT A;  4C00 A;  2JZP A;  2G3D B;  1YHI A;  1YJF A;  4ZRI A;  3DQV A;  3V60 A;  1XLN A;  4G50 A;  3UQB A;  2BTE A;  2BB6 A;  1HZ5 A;  3QQ8 B;  3NVZ A;  2CHW A;  4DHZ E;  1IBX A;  1RM6 C;  3OWE B;  3AH7 A;  4HVF A;  4DXN A;  3WCQ A;  4RGM A;  1QOG A;  4YT0 B;  4W6A A;  4CO7 A;  2C9W B;  2KQ7 A;  4GES B;  3U0L A;  1MHX A;  1WIA A;  4LJB A;  2RD0 A;  1JW9 D;  2WXN A;  1KJT A;  5D2M B;  2YLM A;  3BK1 A;  3SD5 A;  3EVP A;  2LGD A;  4N9F 4;  4DHJ B;  1YJ2 A;  1GAQ B;  1ZGU B;  3ZJV A;  2G1E A;  2WIS A;  4P1C C;  1N63 A;  2WSN A;  2CHX A;  1RRX A;  3URY A;  2A4Z A;  3U8P A;  5HGE A;  4RTC A;  1OQY A;  1EMF A;  2E6X A;  2HGD A;  4BZA A;  3EFU A;  1YZW A;  2EMD A;  2L0F A;  1IBX B;  5I4D A;  3P28 A;  5EXU A;  4RM8 A;  3DQ1 A;  4KDI C;  2Z1O A;  3GE8 C;  3R66 C;  3A9J A;  1F0Z A;  3U7Z A;  4TUU A;  4N58 A;  2FBW B;  4YTN B;  3W1S A;  2G9H D;  4WAA A;  2KWV B;  4YTM B;  4JQW C;  4A20 A;  3VUX A;  3KQ4 A;  2JSV X;  3DBR I;  5FVF A;  2IO2 B;  3Q2A C;  4W9D A;  5LTR A;  4FHK A;  2LWP A;  1FM0 D;  3BII D;  3H7S A;  2AYO B;  2KD0 A;  2J0J A;  2IYD B;  2WDQ B;  3SVU A;  1ZXI A;  3DVG X;  3OGO A;  1SE3 A;  3GS2 A;  1NI3 A;  1QXT A;  4W6P A;  2BKR B;  2AWL A;  1IGC A;  4F8C B;  4DXG A;  5FR3 A;  2KKC A;  1E8Y A;  3ZYY X;  3I63 C;  5DTZ A;  3RFZ B;  4W7R A;  2G6X A;  4P7I A;  1TYG B;  2N1W A;  2GRI A;  1ZGP A;  3A8S A;  2H5P A;  4RGT A;  1Q4B A;  3OLM D;  1JWB D;  2EMN A;  4MGY E;  5JXV A;  4DXQ A;  1WM3 A;  1V49 A;  4JFG A;  2QJL A;  2EMS A;  1G7K A;  4KIK A;  4XE0 A;  1EMB A;  2ICR A;  4H3M A;  4HWI B;  2DYB A;  4ANV A;  1WR6 E;  3PHW B;  2H5Q A;  5CHV C;  4OZB A;  3DQO A;  3T3O A;  2ZCB A;  2ICI A;  5IP4 D;  4EDO A;  2H8Q A;  3DQK A;  2AX5 A;  3P4R B;  1WGD A;  1LO5 D;  4W77 A;  2LVO A;  4M02 A;  1UGJ A;  2WS3 B;  5EB7 A;  5GXG B;  2MP2 A;  4W6U A;  2KAJ A;  1XQQ A;  3HVD A;  1DYQ A;  1L6V A;  3VH4 B;  3GP7 A;  3BVG A;  1WE6 A;  3ZQ4 A;  1TZO A;  1MJD A;  1EUV B;  2NPT A;  2KN5 A;  2HQK A;  2MCN B;  3DQJ A;  4EDS A;  2MRP A;  4BBN C;  2DUH A;  1QOA A;  2O6V D;  4OVZ A;  1UZX B;  2Z0D B;  2CKH B;  2N9L A;  2KZR A;  2KVZ A;  3P2B A;  1L7Y A;  2SAK A;  4HCP B;  1WJU A;  3P4Q B;  3V05 A;  1N62 A;  4EMQ A;  3DQA A;  2J42 A;  2QC8 A;  2ZNV C;  1VD2 A;  4X57 B;  1LFD A;  3SEB A;  2WUR A;  3P1M A;  3NS8 A;  2NMQ A;  1J19 A;  3A33 B;  3PO0 A;  4WAF A;  1SSN A;  5AUK A;  2ZNV B;  4FXC A;  4WH4 A;  2RDH A;  4TKN A;  4XGA B;  2Y3A A;  2WU2 B;  4F1S A;  1GC7 A;  1H6R A;  2DX5 B;  4PPK A;  1ET6 A;  3SU8 X;  1C4F A;  1FRD A;  2WDV B;  4KGE A;  5T8I A;  2LGS A;  2A5U A;  4WJP A;  3NZ3 A;  4BDU A;  2LJ5 A;  2NCN A;  2O6V A;  4KGF A;  1XEE A;  1A5R A;  1ROE A;  3EVV A;  2KFK B;  2QEJ C;  1OXD A;  3DDC B;  3AI4 A;  1E7V A;  4P6V F;  2HJ1 A;  3QAQ A;  2N9K A;  1EF5 A;  2JVC A;  3NVY A;  1BML C;  4FJV B;  4HDO A;  2N0S B;  4HQ9 A;  2AQ1 B;  2X38 A;  2XK5 A;  4WWM A;  4RYW A;  2EKI A;  4FUL A;  1E9M A;  2V3S A;  3AU4 A;  2RH7 A;  4I6P A;  2BS3 B;  1FCC C;  2KAN A;  2W3S A;  3Q8C A;  2MJE A;  3BXC A;  4OHJ A;  2R2O A;  4Q9X A;  2GBK A;  3AEG B;  5FK9 C;  2OTE A;  2A47 A;  4L13 A;  3VTU A;  1FFV A;  2WHI A;  5BMI A;  2G4S A;  3DWG C;  3EHV A;  3O65 B;  1EU3 A;  1HZ6 A;  2INP E;  3W5V B;  5AZF A;  2PE9 A;  4MGZ E;  2NS5 A;  2KLG A;  1TS3 A;  2PEA A;  1WGK A;  4DDG D;  2BBC A;  2D3B A;  2GMI C;  4XX5 A;  3DQM A;  5BTT A;  1Q5W B;  1XXG A;  3CFF A;  1ZKH A;  3O78 A;  5D3I B;  5E6J A;  3SV5 A;  1B9R A;  1YQB A;  3DBH B;  1GB1 A;  2K39 A;  2RGF A;  1SEB D;  4W9K A;  2VH2 A;  5HG2 A;  3DQC A;  3DQ7 A;  2C9J A;  1UWM A;  2LI5 A;  2PKO A;  3AED B;  2VVI A;  1MPE A;  2M0X A;  4WUR A;  4KW4 A;  2I38 A;  4AP4 C;  2L3Z A;  3DQ5 A;  1VZ8 A;  2XNA C;  1GNU A;  5JHA A;  4HPL B;  4ZHP A;  4A55 A;  5C1Z A;  2KC1 A;  3SG5 A;  3SSY A;  1D3Z A;  4TMA B;  3HVZ A;  2LXA A;  1Q10 A;  2JXX A;  2OOB B;  1FXI A;  3Q69 A;  1JC0 A;  3RWA A;  3PS6 A;  3VHT A;  2FE8 A;  3ZW3 A;  4E71 A;  4C4V B;  3TEY A;  3U0M A;  3PRM B;  4W9F A;  1RFK A;  2XN9 C;  3UFZ A;  4P1Q A;  5FVI A;  3UGB B;  2AL3 A;  1ET9 A;  4HRO A;  2SEB D;  3QAR A;  1EWY C;  1XQM A;  4W7F A;  1AWD A;  4G0N B;  2DAF A;  3ZVV A;  2ZCC A;  2KDE B;  1P1A A;  2K22 A;  4KZ0 A;  3QX1 A;  1HTO A;  3PLU A;  2K3U A;  2LVQ A;  4HQ8 A;  3ZNG C;  4FHJ A;  4KW8 A;  5H92 C;  4W7A A;  1NBF C;  3TEW A;  3DBL I;  4OVU A;  1ZXH A;  3VFK A;  4RF1 A;  2V1Y A;  4UTS A;  2NPT B;  4R6D A;  4W7D A;  2PVO D;  2KTR A;  3SSL A;  5D3D A;  3SS0 A;  1I4R A;  3SDL C;  2KFK A;  3AEE B;  2V4L A;  2JAD A;  5DPI A;  3ED8 A;  2IGD A;  2N9X A;  1ZUX A;  2KDI A;  4L2Y A;  3WAM A;  3UQA A;  3E5V A;  1GC6 A;  2QLE A;  2M1M A;  4G11 A;  1Z1P A;  3V6C B;  2ON8 A;  2WXM A;  4HCN B;  2C60 A;  3K1K A;  4HXD A;  3ZXR A;  3LDZ E;  1SJH D;  3P42 A;  5DTY A;  2MHJ A;  4GSW A;  3PRE A;  2X8X X;  1YJI A;  3NVW A;  3PIB A;  2KWC A;  3NJT A;  2KTF A;  1L4Z B;  2KNB A;  4GOC A;  4M0W B;  3U8C A;  5EE9 A;  4LJD C;  3PLV A;  1JWU D;  3RNE C;  2DEN B;  1YN5 A;  2VAE A;  1YX6 B;  3NT9 A;  2LAS A;  2OHF A;  5DY6 A;  2LUM A;  3KWL A;  2MBQ A;  2KXJ A;  4J88 A;  4KA9 A;  3A9J B;  3SVB A;  1V6E A;  1Q4A A;  1F2R C;  2QIL A;  3HIZ A;  3TSS A;  1I35 A;  1EWC A;  5LXI B;  4JC2 A;  2WXJ A;  1WYG A;  2Z6Z A;  2KN4 A;  3ZDM C;  3N20 C;  1HXY D;  1QT9 A;  5DRF A;  4KF5 A;  3AE7 B;  1MG4 A;  1ACC A;  1R4N B;  3QA8 A;  3OSQ A;  1WXV A;  1KLV A;  1XA9 A;  3RI7 C;  4REZ A;  4II3 B;  2PMV A;  1C3T A;  1E5W A;  2G2S B;  2QSD A;  5C2T B;  1XF5 L;  3W2D A;  1FCL A;  1Q4D A;  3M62 B;  5HFY A;  3HM3 A;  4PK1 A;  2FCS A;  3R8B A;  4A8X C;  2ZW1 A;  4FJZ A;  1FFU A;  2VRR B;  4Q7T A;  3VDZ A;  1L4D B;  2Y5B B;  3DQ8 A;  4IDI A;  1WX9 A;  5G2N A;  1GG3 A;  1D5X C;  3SVE A;  1UBI A;  1WXM A;  3GJ2 A;  3KYD D;  4B0E A;  1WF9 A;  3I57 A;  1EMC A;  4O1N A;  3ZJU A;  1PGX A;  4B30 A;  1P7E A;  3CD1 A;  1RAX A;  4USA A;  3ZRC A;  1H8C A;  4RGO S;  1KYP A;  2QU1 A;  3EKH A;  2WLB A;  4L1I A;  2G45 B;  1FEH A;  2DDC A;  3Q3F A;  2MJ3 A;  4LJP B;  4D2K A;  1CV7 A;  4K7S A;  1T0Y A;  4BKS A;  2JUO A;  3VR9 B;  3ABV B;  3ZGZ A;  2DUI A;  2GOW A;  3NOB A;  3AE4 B;  1NDD A;  2N7E A;  1VRA B;  2PW9 A;  2G5Z B;  2QLI A;  3Q8B A;  1RRB A;  4AWJ A;  4FA6 A;  3U30 A;  1XAE A;  1BXT A;  1WXS A;  3SVR A;  1RFA A;  4MJS A;  3H1R A;  1JC1 A;  2OKW A;  4LW5 A;  2GBJ A;  2K0P A;  4A3P A;  3GZN B;  5LTP A;  1UGM A;  3DQ9 A;  1HQR D;  3KUC B;  1EMA A;  1J7B A;  4NY0 A;  1C79 A;  3RNB C;  2HFC A;  4AOF A;  4GF6 B;  2N9E B;  4JIO U;  3U8Z A;  5LNK 1;  1QOF A;  1GL4 A;  4PFE A;  3VVW B;  4OJ0 A;  5IKC M;  1YN4 A;  3WIM A;  2KDB A;  1HTQ A;  2N7J A;  3DBS A;  2MEK A;  1U4A A;  3V62 A;  4US9 A;  1ZOY B;  3BYT B;  4HRS A;  2WGS A;  5HI1 A;  4GU2 A;  3UI3 A;  3DQ4 A;  2AQ3 B;  1SIJ A;  4W73 A;  2JWZ A;  2L0T A;  3MTN B;  4IWO A;  2TSS A;  2B3A A;  2M8S A;  1QYQ A;  2JZZ A;  4WIP A;  2H5R A;  4ZRK A;  1YNT E;  3NHE B;  1JCK B;  4E3C A;  3NG0 A;  1SJE D;  1V86 A;  1JAL A;  1XCQ L;  3GJ1 A;  1UUP A;  4YL8 A;  1WXQ A;  4GN1 A;  1L5P A;  3MHS D;  3VRA B;  4LDT D;  3DVG Y;  3Q3M C;  4ICU A;  2WXQ A;  5BO4 B;  3WAL A;  2INN E;  3PRP B;  1GGX A;  2C7M B;  4KW9 A;  3AV8 A;  3CBE A;  2CU1 A;  4IWQ A;  2MLB A;  3CD9 A;  3UIO B;  3MJ5 A;  2LXC A;  4IM3 A;  1F77 A;  3S2A A;  5BMG A;  2L05 A;  1K51 A;  2NTT A;  4IWP A;  1KH0 A;  1H4U A;  5FKA C;  4TZG A;  1I4G A;  2CS4 A;  3EA6 A;  3M24 A;  1DGJ A;  1F2R I;  3ML8 A;  3DQI A;  3R2T A;  4IK9 A;  2KYW A;  2IOV A;  4Z4M A;  2G6Y A;  4TV3 A;  4M8M A;  2A56 B;  2K25 A;  3PRZ A;  1IP9 A;  4QAY A;  3SHQ A;  2WWZ A;  2I1K A;  1MG8 A;  3TEZ A;  4I6L B;  3W1D A;  1PQS A;  4KV2 A;  2VZK D;  2HDE A;  2WDR B;  3DPD A;  2FAZ A;  4B6W A;  4FAD A;  5CHW A;  5DQB A;  4BKG A;  3A9K A;  2MBO A;  1TJE A;  1JWS D;  1YOV B;  2ZEQ A;  1TKE A;  2KT7 A;  1ZUD 2;  3APC A;  4ASW C;  1Y8R C;  2J0K A;  4ZRJ A;  3NVV A;  3GB1 A;  2QDF A;  1WMH A;  4KF5 C;  3DQ2 A;  1DOI A;  3DHG C;  3VTW A;  2KMM A;  5BMH A;  2D3A A;  4GOB A;  2GBR A;  2WHS A;  2MA9 B;  3DQE A;  3FIL A;  4B30 B;  3ST2 A;  3CWI A;  3SG6 A;  4GB9 A;  5GMV A;  2LGY A;  1I4Q A;  1WZ3 A;  1E90 A;  3Q14 C;  3Q3J A;  1JRP A;  3DVN U;  1PDX A;  2OJW A;  2FUH B;  2WDT B; 
#chains in the Genus database with same CATH homology
 3RCZ A;  2J0M A;  2MX2 A;  2KO3 A;  4FJY A;  3N32 A;  4DK5 A;  2KJH B;  2G16 B;  4IM2 A;  5DTL A;  2JRH A;  1RM9 A;  1WMH B;  4DDI D;  2Z6X A;  4AS8 A;  2FZU A;  3SVN A;  3G9A A;  3PJ5 A;  3DQU A;  1RMP A;  3E5T A;  2REX A;  5EHU A;  4W9I A;  4W6K A;  4W7C A;  5H87 A;  4IUM B;  1J0G A;  3SVD A;  2ZPN A;  4EEW A;  3U7D A;  3WAO A;  3WA0 A;  2Q57 A;  2YVC A;  3LSA A;  3QWZ B;  4IK1 A;  2VAD A;  5KTG A;  4KZC A;  4DXP A;  3LS3 A;  3B08 A;  1WJ4 A;  4W7E A;  3GB3 A;  2L7R A;  4XGY A;  1Q1O A;  4I2Y A;  2LZ6 A;  2HQZ A;  1P3Q U;  2K1F A;  3V6E B;  2HD5 B;  3TMT A;  2LRU A;  1WGR A;  4DXA B;  5EXB A;  2ZVN A;  2QRF A;  5EJU A;  1JBZ A;  4J6I A;  3ZTD A;  1W7U A;  3L13 A;  1EF1 A;  2KQS A;  2DZK A;  2LVP A;  2ZMU A;  5E6N A;  5L83 A;  3ZNZ B;  4W6G A;  2EKE C;  4B9K A;  3EKJ A;  3MJW A;  4DXI A;  2UWQ A;  2KDF B;  3VHT C;  2V4E A;  3RZF A;  2CR5 A;  2K8B A;  4JGH B;  2QLH A;  1IPG A;  2G6E A;  3IR8 A;  1V5T A;  1Z2M A;  1X1M A;  3ZIM A;  3APD A;  1QYO A;  3K9P B;  3GOE A;  4NJ6 A;  3NY5 A;  2YE1 A;  3H7P A;  3NF0 A;  4NAW B;  5F9G A;  5BTT B;  2C9I A;  4HK2 A;  2HJO A;  2JF5 A;  2N4F A;  4DXO A;  1WGH A;  4XL5 A;  2KC2 A;  3V61 A;  3QCA A;  2XBB C;  1MYW A;  1QZE A;  3EC8 A;  4MGI E;  5EXC I;  2KOX A;  2A46 A;  4PS8 A;  5LXH A;  4W6J A;  3ZDT A;  2DDD A;  2RPQ A;  3ZNI D;  1UIS A;  5TR5 A;  2GW4 B;  2KWU B;  4Z4K A;  4H48 A;  5J2R A;  3W1Y A;  1TGZ B;  3TJP A;  3DQH A;  2NBV B;  3IVF A;  4GDK B;  1FXT B;  4AJY B;  2GX0 A;  3ST3 A;  4W9C A;  1OXE A;  4JF9 A;  3CB9 A;  2QLG A;  3UF8 A;  1E8X A;  3SRY A;  5AQB B;  3QJZ A;  3UIP B;  1P0R A;  5CHF A;  3LVC A;  5JHB A;  4MJS B;  3LVD A;  3CSF A;  4NJ7 A;  3AI5 A;  1TTN A;  4BOS C;  3N30 A;  5C23 A;  3JSV B;  1WYW B;  2FNJ B;  2VVH A;  3RWT A;  2VVJ A;  1S1Q B;  3RT3 B;  3CF6 E;  2CHZ A;  3DPZ A;  2G3O A;  3PHX B;  4CYE A;  3LVA A;  2ARL A;  2V4E C;  2DAJ A;  3JW0 X;  5J18 A;  4IZN A;  3C0R B;  3IFW B;  3R3M A;  3T9L A;  3DQF A;  3SVS A;  1HE8 A;  3LF4 B;  3DOW A;  1LXD A;  3KCS A;  3BIN A;  5IAA C;  2G4D B;  1LM8 B;  4MH0 E;  1YHG A;  1YD8 U;  2JY6 A;  2YFP A;  4ZFS A;  3QK0 A;  3TIX A;  1B9C A;  1XD3 B;  4FN2 A;  2JPH A;  3RD2 A;  3DPW A;  3OAW A;  2Z0E B;  4WJQ A;  3A1Q B;  3H6N A;  3U8A A;  2IBI B;  2FL1 A;  2VZX A;  5J17 A;  1YJ1 A;  3DQD A;  3WLD A;  4W9G A;  3QC8 B;  4W6S A;  4GXB A;  5E6P A;  4I6N B;  1UH6 A;  2IB6 A;  5AZG A;  2M4N A;  3SG3 A;  4W9L A;  1WX8 A;  3PPA A;  4TQ1 A;  2I1J A;  1KYS A;  2KFJ A;  4EZJ A;  3AXC A;  2BWE S;  1WJ6 A;  5DPT A;  5DRG A;  3PSE B;  3PGE A;  1WR1 A;  2KHW B;  3BXB A;  3NT3 A;  4PS7 A;  2OTB A;  4W6I A;  4LDT B;  2WIQ A;  2BKF A;  1CMX B;  2O2V B;  3X23 A;  4BKS D;  2PPH A;  3OJ4 B;  3R7Q A;  2D2Q A;  1EME A;  4MEL A;  2AHA A;  3E5W A;  3KVF B;  2JRI B;  2LGX A;  2N7D A;  4IG7 B;  4K81 A;  3IP2 A;  3OJ3 A;  3B0A A;  3GEX A;  3M95 A;  4EOY A;  2PXS A;  3ZUL A;  4URK A;  3VHT B;  4LQU A;  3CST A;  4HQC A;  4ZF5 A;  1V9J A;  1YIW A;  1OEY A;  2MWS B;  3APF A;  2H5O A;  2QZ0 A;  3GL4 A;  3P8U A;  4IK3 A;  5EDS A;  1E8Z A;  2L76 A;  4NWS A;  4EUL A;  2AWJ A;  3H1O A;  5DPG A;  2KX0 A;  3TL5 A;  4LCD E;  1P98 A;  3JYU A;  2KJR A;  4W72 A;  4MSQ B;  3TMP B;  4KSL C;  3ZTC A;  3AKO A;  4ORN A;  1ISN A;  2KMA A;  1V80 A;  1Z1Q A;  3ST4 A;  2K6Q A;  3ONS A;  3EK7 A;  4DKM A;  3JVZ X;  4AUQ C;  1MOV A;  5LTQ A;  4DXM A;  3M3J A;  2WHT A;  3X0W A;  5FR6 A;  1I42 A;  2FCM A;  3HHM A;  1RMM A;  3PVL A;  2V4E B;  2FCQ A;  2MBE A;  4RMA A;  3U0N A;  4B5Y A;  5L95 C;  3DBH I;  4W6F A;  1WI0 A;  2DZM A;  5LLI A;  4H3N A;  5G55 A;  4LJO B;  1AAR A;  4EZK A;  1XMZ A;  4XVP A;  1EO6 A;  2BWF A;  2XEW A;  3HM6 X;  2IO0 B;  3MGF A;  1WXA A;  5DPJ A;  4XOW A;  1V2Y A;  4EN1 A;  5CX3 A;  3ZRF A;  1LQB A;  4WWO A;  2C5L C;  4EKU A;  2W9N A;  4OQW A;  1R4M I;  2AWK A;  3ECI A;  2HJ8 A;  3VUY A;  4W74 A;  4ZF4 A;  3M63 B;  1SE9 A;  1L2N A;  1UBQ A;  1OTR B;  2MQJ A;  3AUL A;  4W6N A;  1EMK A;  4W6R A;  3ENE A;  4JGE A;  2H9W A;  3PJ7 A;  2ZZP B;  2Y0G A;  1M94 A;  3DQN A;  3L16 A;  3VH3 B;  4W6O A;  2MW5 A;  1XT9 B;  2DZI A;  4N3D A;  5DPS A;  5DU0 A;  2WYQ A;  5AZH A;  4ICV A;  3PT2 B;  3L10 B;  5E6O A;  1KOT A;  5DCN A;  3KW5 B;  4HDQ A;  2IO3 B;  4MDK E;  2DHZ A;  4ZBL A;  5KHQ A;  3NED A;  4ZB1 A;  2WX1 A;  3GZN I;  3NZS A;  5KHO A;  4KF4 A;  4W76 A;  3L54 A;  4II2 B;  3LA1 A;  4WWP A;  4A3O A;  4IK4 A;  4WJN A;  4LJD A;  4ZYN A;  1WRD B;  1UD7 A;  2RR9 A;  2AL6 A;  3A4S C;  2AWM A;  3D32 A;  1F9J A;  4PYU A;  5FHV A;  1G6J A;  1Q0W B;  3O77 A;  3B1L X;  1QY3 A;  2C7H A;  3SG7 A;  1WFY A;  2N1V A;  1F0B A;  2JT4 B;  3A1Q A;  5FVG A;  1EMM A;  3WAP A;  2OJK A;  2O6V B;  2MBH A;  2ASQ A;  4WWN A;  3ZO5 B;  2BPS A;  3ZUF A;  3VTV A;  4BFR A;  2AH8 A;  2BGF A;  2KLC A;  2P4M A;  3ZUJ A;  2LD9 A;  4OVV A;  1IYF A;  4XOV A;  1YFP A;  2HCG A;  3RZW C;  2ZJD A;  3VK1 A;  3SST A;  1MOU A;  3QIJ A;  1YHH A;  2D07 B;  4W9E A;  2ZVO A;  2UYZ B;  4JLC A;  4AR7 A;  3EEC A;  2MSE D;  4PYZ A;  2ZMW A;  1GJZ A;  2O24 A;  4EFO A;  4U2V A;  2O2V A;  4BOZ B;  4NAW A;  4FBJ B;  5D7G A;  3OSR A;  2OJR A;  2IB5 A;  1UEL A;  5HZT A;  1Z5S B;  3U0K A;  2ZO6 A;  4K7U A;  3KYC D;  3IBE A;  4W6B A;  1YX5 B;  2NVU I;  2DD9 A;  4ANW A;  2DUE A;  3N3K B;  1EML A;  2OKY A;  2YDZ A;  4MSM B;  2BYV E;  3HK0 A;  4ANU A;  4HPM B;  3EK4 A;  3DCG A;  3CMM B;  3DPX A;  3ALB A;  2POX A;  5DTX A;  2WSO A;  3TBL D;  3VUW A;  2K8H A;  4W6L A;  4NQK E;  1SGH A;  2FWQ A;  4ANJ A;  4DHJ D;  4W6H A;  3M22 A;  1KM7 A;  2DUG A;  3DQ6 A;  4KPI A;  2A54 B;  4WJO A;  1BT0 A;  1GFL A;  5DPR A;  4RM9 A;  2KTR B;  3ZKJ C;  2D3G A;  1OEY J;  1BFP A;  2GBN A;  4JL9 A;  3TMR A;  4GDL A;  1ZW7 A;  5JZE B;  2K8C A;  3KUZ A;  5CTR C;  5JH5 C;  2L00 B;  1OGW A;  1HCJ A;  4GGQ A;  4MGK E;  2ZPY A;  1W7T A;  3I3T B;  2DYO A;  3SG4 A;  1WGY A;  4OY4 A;  4HE4 A;  2A53 B;  3BXA A;  2XK5 B;  3S05 A;  4HVB A;  2NBW B;  2Z59 B;  4KDL B;  2O29 A;  1EMG A;  3SVC A;  4CHK A;  2B3Q A;  3CGL A;  5AEK B;  3K9O B;  4Q7U A;  3EVU A;  4DBG A;  2BYF A;  3R7R A;  3ZNH B;  5EB6 A;  1Q73 A;  1WX7 A;  1WGG A;  3SSP A;  5H89 A;  1ZGO A;  4OGS A;  3RUL A;  4ANX A;  4IC7 B;  2HGY A;  3T8M A;  4PPJ A;  2O2B A;  1GUA B;  3L0W B;  5D6J B;  2C7N B;  2DUF A;  4JEO A;  3EVR A;  4E74 A;  5LK4 A;  2KK8 A;  5IA7 A;  3NEZ A;  4H47 A;  1P9D U;  4ZF3 A;  1WJN A;  4AJW A;  3WAN A;  4IK5 A;  1F09 A;  4W6M A;  4ZIN A;  2DYM A;  1RLF A;  2HPW A;  3DQL A;  1E7U A;  5D94 A;  3AU5 A;  1C1Y B;  4BBN F;  1NI2 A;  1QYF A;  3W1S C;  2JZ3 B;  4HLE A;  2KVR A;  3L17 A;  3I19 A;  4NPN A;  1S6Z A;  1WE7 A;  2PJH A;  1Q4E A;  5H88 A;  4J89 A;  4W75 A;  5HZO A;  4P76 A;  3VAW A;  1R4N I;  2QT2 A;  3TCA A;  2AEH A;  3RYT A;  4H3L A;  2GW3 A;  4K7W A;  3DQ3 A;  2M17 A;  3SVO A;  4KIK B;  4W69 A;  3H1U A;  1TZ1 A;  3SSV A;  5BT0 A;  1VCB A;  5HZS A;  4IW0 A;  4LJC A;  4FLH A;  2BTJ A;  4XZ4 A;  2LRW A;  4W9J A;  2L8J A;  4W6T A;  3RUI B;  2FCN A;  3WCK A;  2A50 B;  2J7Q B;  1WY8 A;  4ZIO A;  2EMO A;  4F7Z A;  2QHO A;  3LJ3 A;  2IY0 B;  4KAG A;  2D10 A;  3PTF C;  3NZU A;  2PE6 B;  2H6V A;  2G3Q B;  4NQL B;  4DWF A;  3ZUN A;  4PPL A;  3L08 A;  2PXW A;  1S3S G;  2HTH A;  3H7P B;  2R2Q A;  3VQI A;  4KVG B;  5HW9 A;  2FID A;  4K1R B;  1V5O A;  4IK8 A;  1Q4C A;  1JBY A;  2KJ6 A;  2WX0 A;  2HRS A;  5HKH A;  4G3X B;  3W1C A;  4KSK C;  2A48 A;  5HBD A;  4ZDV A;  1ZGQ A;  2LUE A;  1WM2 A;  2GX2 A;  2NR2 A;  4M8N A;  4MEM A;  4OHS A;  4DHZ B;  5BQL A;  3UIN B;  4Q9W A;  2A52 B;  1KP5 A;  4EZL A;  4B95 A;  4DKN A;  3VXW A;  3ML9 A;  1JRU A;  3ZLZ A;  1J8C A;  1OXF A;  5DPW A;  3PV1 A;  4EUT A;  1HUY A;  3IG3 A;  2IE2 A;  1H4R A;  3A4R A;  1W7S A;  3UG0 A;  1E8W A;  2KX3 A;  3SSK A;  1K8R B;  4J8A A;  1SIF A;  3VIC A;  4W9H A;  2BYE A;  3BY4 B;  2MP2 B;  4HJK A;  3H9D A;  2KMC A;  5T3I A;  5DPH A;  3DVN V;  2IZV B;  4BKT A;  3WLC A;  4R6B A;  5EBJ A;  3QHT A;  2Q6P A;  3CFA A;  2NBU A;  2IY1 B;  2ZO7 A;  4XC2 A;  5DQM A;  4RYS A;  2OGR A;  3KH0 A;  2DZJ A;  3A9K B;  2BF8 B;  3ADF A;  3SSH A;  2N9P C;  3BX9 A;  4KEX A;  3V3D A;  4TZA A;  2HE7 A;  2FIF A;  2MBB B;  3IHP C;  4PS3 A;  3PJB A;  4LQT A;  4NNJ B;  2YE0 A;  3PZD A;  5HZU A;  3ZTF A;  4W6D A;  4W7X A;  2GBM A;  4L12 A;  2RSU A;  1XSS A;  2QLG B;  4GIV A;  4Q7R A;  3LF3 A;  4GMV A;  1TBE A;  4GDL B;  3EK8 A;  4GDK A;  3CFH A;  2IO1 B;  3JSV A;  2B3P A;  2DD7 A;  1KYR A;  2D11 A;  5J2O A;  4MM3 A;  4BVU C;  1V81 A;  4W6C A;  1RMO A;  4WQO B;  2AWT A;  4JRB A;  2WHU A;  1WH3 A;  3KUD B;  2K6D B;  4TQ0 A;  2EMT A;  1WZ0 A;  3SG2 A;  2Z6Y A;  3ST0 A;  4IM0 A;  3KCT A;  2G3D B;  1YHI A;  1YJF A;  4ZRI A;  3DQV A;  3V60 A;  4G50 A;  3UQB A;  3QQ8 B;  2CHW A;  4DHZ E;  4HVF A;  4DXN A;  4W6A A;  4CO7 A;  2C9W B;  2KQ7 A;  4GES B;  3U0L A;  1WIA A;  4LJB A;  2RD0 A;  5D2M B;  1KJT A;  2YLM A;  3SD5 A;  3EVP A;  2LGD A;  4N9F 4;  4DHJ B;  1YJ2 A;  1ZGU B;  2WIS A;  2WSN A;  2CHX A;  1RRX A;  2A4Z A;  3U8P A;  5HGE A;  4RTC A;  1OQY A;  1EMF A;  2HGD A;  3EFU A;  1YZW A;  2EMD A;  2L0F A;  3P28 A;  5EXU A;  4RM8 A;  3DQ1 A;  4KDI C;  2Z1O A;  3R66 C;  3A9J A;  4TUU A;  3W1S A;  4WAA A;  2KWV B;  4JQW C;  4A20 A;  3VUX A;  3DBR I;  5FVF A;  2IO2 B;  4W9D A;  5LTR A;  4FHK A;  2LWP A;  3H7S A;  2AYO B;  2KD0 A;  2J0J A;  2IYD B;  3SVU A;  3DVG X;  3OGO A;  1QXT A;  4W6P A;  2BKR B;  2AWL A;  4F8C B;  2KKC A;  1E8Y A;  5DTZ A;  4W7R A;  2G6X A;  4P7I A;  2N1W A;  1ZGP A;  3A8S A;  2H5P A;  1Q4B A;  3OLM D;  2EMN A;  4MGY E;  4DXQ A;  1V49 A;  1WM3 A;  4JFG A;  2EMS A;  1G7K A;  4KIK A;  1EMB A;  2ICR A;  4H3M A;  4HWI B;  2DYB A;  4ANV A;  1WR6 E;  3PHW B;  2H5Q A;  5CHV C;  3DQO A;  2ZCB A;  4EDO A;  2H8Q A;  3DQK A;  1WGD A;  4W77 A;  2LVO A;  5EB7 A;  2MP2 A;  4W6U A;  1XQQ A;  3VH4 B;  1WE6 A;  1EUV B;  2NPT A;  2KN5 A;  2HQK A;  2MCN B;  3DQJ A;  4EDS A;  2MRP A;  4BBN C;  2DUH A;  2O6V D;  1UZX B;  2Z0D B;  2CKH B;  2KZR A;  3P2B A;  1L7Y A;  4HCP B;  1WJU A;  4EMQ A;  3DQA A;  2ZNV C;  1VD2 A;  4X57 B;  1LFD A;  2WUR A;  3NS8 A;  1J19 A;  3A33 B;  2ZNV B;  4TKN A;  4F1S A;  1GC7 A;  1H6R A;  2DX5 B;  4PPK A;  3SU8 X;  1C4F A;  4KGE A;  2A5U A;  4WJP A;  4BDU A;  2LJ5 A;  2NCN A;  2O6V A;  4KGF A;  1A5R A;  3EVV A;  2KFK B;  1OXD A;  3DDC B;  3AI4 A;  1E7V A;  3QAQ A;  1EF5 A;  2JVC A;  4FJV B;  4HDO A;  4HQ9 A;  2XK5 A;  4RYW A;  4FUL A;  2V3S A;  3AU4 A;  4I6P A;  2RH7 A;  2KAN A;  3BXC A;  2R2O A;  4Q9X A;  2GBK A;  2OTE A;  2A47 A;  4L13 A;  3VTU A;  2G4S A;  3EHV A;  3O65 B;  5AZF A;  2PE9 A;  4MGZ E;  2NS5 A;  2KLG A;  2PEA A;  4DDG D;  4XX5 A;  2GMI C;  3DQM A;  5BTT A;  1Q5W B;  1ZKH A;  3CFF A;  3O78 A;  3SV5 A;  1YQB A;  2K39 A;  2RGF A;  4W9K A;  3DQC A;  3DQ7 A;  2C9J A;  2LI5 A;  2VVI A;  2M0X A;  4KW4 A;  4AP4 C;  2L3Z A;  3DQ5 A;  1GNU A;  5JHA A;  4HPL B;  5C1Z A;  2KC1 A;  3SG5 A;  3SSY A;  1D3Z A;  2LXA A;  2JXX A;  2OOB B;  1JC0 A;  3RWA A;  3PS6 A;  3VHT A;  3ZW3 A;  4E71 A;  3U0M A;  3PRM B;  4W9F A;  3UFZ A;  4P1Q A;  5FVI A;  3UGB B;  2AL3 A;  3QAR A;  1XQM A;  4W7F A;  4G0N B;  2DAF A;  3ZVV A;  2ZCC A;  2KDE B;  1P1A A;  4KZ0 A;  3QX1 A;  3PLU A;  2LVQ A;  4HQ8 A;  3ZNG C;  4FHJ A;  4KW8 A;  4W7A A;  1NBF C;  3DBL I;  4OVU A;  3VFK A;  2V1Y A;  4UTS A;  2NPT B;  4R6D A;  4W7D A;  2KTR A;  3SSL A;  3SS0 A;  3SDL C;  2KFK A;  2V4L A;  2JAD A;  5DPI A;  3ED8 A;  2N9X A;  1ZUX A;  2KDI A;  3UQA A;  3WAM A;  3E5V A;  1GC6 A;  2QLE A;  2M1M A;  4G11 A;  1Z1P A;  3V6C B;  4HCN B;  2C60 A;  3K1K A;  4HXD A;  3LDZ E;  5DTY A;  4GSW A;  3PRE A;  3PIB A;  2KWC A;  2KTF A;  2KNB A;  4GOC A;  4M0W B;  3U8C A;  4LJD C;  3PLV A;  2DEN B;  2VAE A;  1YX6 B;  3NT9 A;  2LAS A;  5DY6 A;  2MBQ A;  2KXJ A;  4J88 A;  4KA9 A;  3A9J B;  3SVB A;  1V6E A;  1Q4A A;  3HIZ A;  1I35 A;  5LXI B;  4JC2 A;  2Z6Z A;  3ZDM C;  5DRF A;  4KF5 A;  3QA8 A;  3OSQ A;  1WXV A;  1KLV A;  1XA9 A;  4II3 B;  1C3T A;  1E5W A;  2G2S B;  1Q4D A;  3M62 B;  3HM3 A;  2FCS A;  4FJZ A;  2VRR B;  4Q7T A;  3VDZ A;  2Y5B B;  3DQ8 A;  1WX9 A;  5G2N A;  1GG3 A;  1WXM A;  3SVE A;  1UBI A;  3KYD D;  3GJ2 A;  1WF9 A;  1EMC A;  4B30 A;  3CD1 A;  1RAX A;  3ZRC A;  1H8C A;  1KYP A;  2QU1 A;  3EKH A;  4L1I A;  2G45 B;  2DDC A;  3Q3F A;  4LJP B;  1CV7 A;  4K7S A;  1T0Y A;  4BKS A;  2JUO A;  2DUI A;  2GOW A;  3NOB A;  1NDD A;  2N7E A;  2G5Z B;  2QLI A;  1RRB A;  4AWJ A;  4FA6 A;  3U30 A;  1XAE A;  1WXS A;  3SVR A;  1RFA A;  4MJS A;  3H1R A;  1JC1 A;  2OKW A;  4LW5 A;  2GBJ A;  4A3P A;  5LTP A;  1UGM A;  3DQ9 A;  3KUC B;  1EMA A;  4NY0 A;  2HFC A;  4AOF A;  4GF6 B;  2N9E B;  4JIO U;  3U8Z A;  1GL4 A;  4PFE A;  3VVW B;  4OJ0 A;  3WIM A;  2KDB A;  3DBS A;  1U4A A;  3V62 A;  4GU2 A;  3DQ4 A;  2JWZ A;  4W73 A;  2L0T A;  4IWO A;  3MTN B;  2B3A A;  2M8S A;  1QYQ A;  2JZZ A;  2H5R A;  4ZRK A;  3NHE B;  4E3C A;  1V86 A;  3GJ1 A;  4YL8 A;  4GN1 A;  3MHS D;  4LDT D;  3DVG Y;  4ICU A;  5BO4 B;  3WAL A;  3PRP B;  1GGX A;  4KW9 A;  2C7M B;  3CBE A;  2CU1 A;  4IWQ A;  2MLB A;  3CD9 A;  3UIO B;  2LXC A;  4IM3 A;  3S2A A;  2L05 A;  4IWP A;  1H4U A;  4TZG A;  2CS4 A;  3M24 A;  3ML8 A;  3DQI A;  4IK9 A;  2IOV A;  4Z4M A;  2G6Y A;  4TV3 A;  4M8M A;  2A56 B;  2K25 A;  3PRZ A;  1IP9 A;  3SHQ A;  2WWZ A;  2I1K A;  1MG8 A;  4I6L B;  3W1D A;  1PQS A;  4KV2 A;  3DPD A;  2FAZ A;  4B6W A;  4FAD A;  5CHW A;  5DQB A;  4BKG A;  3A9K A;  2MBO A;  2ZEQ A;  3APC A;  4ASW C;  1Y8R C;  2J0K A;  4ZRJ A;  1WMH A;  4KF5 C;  3DQ2 A;  3VTW A;  4GOB A;  2GBR A;  2WHS A;  2MA9 B;  3DQE A;  4B30 B;  3ST2 A;  3SG6 A;  4GB9 A;  5GMV A;  2LGY A;  1WZ3 A;  1E90 A;  3Q3J A;  3DVN U;  2WDT B;  2FUH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...