3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, transcription
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
3UG0A 2PE6B 4MM3A 3V61A 1WM3A 1RMPA 4ZINA 2GBMA 2IY1B 4FN2A 3IHPC 4W6AA 3SVCA 3KCTA 1WZ3A 3QAQA 5JZEB 3PHXB 3N3KB 2WHUA 2LASA 3H1UA 1MYWA 3DCGA 1L2NA 3L54A 4EDOA 4W7CA 2DUFA 4TZGA 2D07B 4GDLA 2DYOA 2NPTB 2DHZA 1GC6A 5EJUA 3TBLD 3U8ZA 2N1WA 1EMEA 4AP4C 1Q1OA 4MDKE 2ZNVB 4MGIE 5FHVA 4MGZE 4W6CA 3AU4A 3ZDMC 2I1KA 1U4AA 2CR5A 1QYOA 2A54B 5DRFA 3GB3A 2BYVE 1KM7A 1EMMA 3DQVA 5CHWA 5D6JB 3OSQA 3DQ9A 2N9EB 2QLGA 4XC2A 4GU2A 5BO4B 1P9DU 4CHKA 1E8YA 3HM3A 2DENB 4ZDVA 3O78A 1YHHA 3DQOA 3RWTA 4FJVB 3ZKJC 2M4NA 3EVVA 4DK5A 1WI0A 3H7PA 1W7TA 3A9KA 5LTPA 3AI5A 2KZRA 4BDUA 2FCNA 5DPSA 3WAMA 3DQ6A 4GDKB 2DZKA 3SG2A 2DD9A 3DQ5A 2QU1A 3OGOA 2CU1A 4IK4A 3ZVVA 4WJPA 3BXBA 2NR2A 5DY6A 3MHSD 2MLBA 4H3NA 2CS4A 3EHVA 4EUTA 4W7FA 3ZIMA 2N7DA 2YVCA 2J0JA 2L00B 2WURA 2N9PC 2KFKA 4LJBA 3BX9A 1Q4EA 3LVCA 2FCQA 2IO0B 2KQ7A 4A3OA 4G0NB 2KD0A 3RZFA 2IY0B 4AUQC 3ZNID 1KYSA 2OOBB 4TUUA 4LJDA 2FCSA 4A3PA 5D7GA 3GJ2A 3OLMD 2POXA 2Z1OA 3A9JB 4I2YA 3ECIA 5AQBB 1KP5A 3M24A 1QY3A 4K7UA 2K39A 5DPJA 4BFRA 2KWCA 3EVPA 3VAWA 2OTBA 3CB9A 2G5ZB 2J7QB 5HZTA 2C7HA 1HCJA 5DRGA 1H4RA 3DQEA 1V2YA 2L0TA 4GF6B 3QARA 4BKSA 4ANUA 1EUVB 3TMRA 3CSFA 3HHMA 1ZW7A 4K81A 1MOUA 1RMMA 3UQAA 2K6QA 4LJDC 3U8CA 5CX3A 2H8QA 1Z2MA 2K6DB 4W75A 1KOTA 4FA6A 3DQMA 3QQ8B 2WYQA 2H5QA 5EB7A 2ARLA 5EBJA 3W1SA 2B3QA 2DDCA 2KANA 4XL5A 3V60A 3OAWA 1S3SG 4HK2A 3ZUFA 4EOYA 1YHIA 4N9F4 3DVNU 3UIOB 3CSTA 3H1RA 1CV7A 4OHSA 3QJZA 4EDSA 5D94A 2REXA 4BOSC 1CMXB 2GW3A 4IWQA 3KW5B 1OGWA 4HWIB 2JADA 3R7QA 2KDEB 3WCKA 5BT0A 3MGFA 3HM6X 4EZLA 4XVPA 2KJRA 1FXTB 2C9JA 2AWJA 2LVOA 2HJ8A 4W9DA 5FVIA 3VQIA 4JF9A 4FJZA 3BXCA 5TR5A 4MELA 2DAFA 2L76A 4W6TA 2Q57A 3BXAA 4IW0A 4RYWA 3SSLA 4EZJA 5AZFA 3APFA 3PRPB 5E6OA 3VH4B 3B1LX 4DXQA 3CFFA 1M94A 4GOBA 4HDOA 3TJPA 1RAXA 1YX6B 2NCNA 4JEOA 4JC2A 2ZZPB 4HXDA 3SDLC 2K25A 3U0MA 5EXBA 1EMLA 1SGHA 1WGRA 1ZUXA 1EO6A 3TL5A 3UQBA 3IBEA 5LK4A 4RM8A 2DZJA 2KK8A 3AKOA 2ZEQA 3ZUNA 2G3QB 4OVUA 5DPIA 3ML9A 5DQBA 3VICA 5FVGA 4W6OA 2MSED 3LJ3A 1WX7A 4MEMA 3PVLA 3RWAA 2GMIC 4JGHB 4W9EA 1KLVA 1XQMA 3PRZA 1YJ2A 2G16B 2KX3A 1ZGUB 2JWZA 2Z6ZA 1LM8B 5HZUA 3S2AA 2RH7A 2KFJA 3DPZA 5LTQA 1YHGA 3PHWB 4TKNA 2ZCCA 3ST0A 3LF4B 2WISA 3W1CA 2ZMUA 2CHWA 1C1YB 4WAAA 4IM3A 2G45B 3ALBA 4PYUA 3ONSA 1F09A 1K8RB 3RUIB 1F9JA 2L7RA 2Q6PA 3SVOA 4W6LA 1RFAA 4XGYA 3VHTB 2MBQA 4HCPB 4ASWC 1EF5A 4B95A 4R6DA 4Q7RA 2UYZB 2WDTB 3E5WA 4GDKA 1XD3B 2A50B 3ENEA 2N7EA 2ZVOA 1UD7A 2NVUI 3WALA 4TQ1A 3EFUA 2D3GA 1YFPA 3OSRA 1GL4A 3DQDA 3QX1A 4X57B 2AL3A 3AULA 1E5WA 2D10A 3EK7A 4IK5A 2KTRB 2G2SB 4W76A 2W9NA 1OEYJ 1JC1A 2FZUA 3PJBA 1WGHA 3UIPB 4U2VA 2BYFA 3ZNZB 2L0FA 1WR6E 4MSMB 1Q4BA 3U8PA 1S1QB 5DPTA 4K1RB 3PV1A 2QLHA 3RD2A 4A20A 2IB5A 4KF4A 4Q7UA 5DPRA 2OJRA 2DUEA 3CMMB 2C60A 3KUDB 4FBJB 4BKSD 3HK0A 1G7KA 1P98A 2ZO7A 4ZRJA 4L1IA 3WAPA 4PPKA 3CGLA 3L16A 1YZWA 4GN1A 1J8CA 2G4SA 1XMZA 3DDCB 3VUWA 3VHTC 4F7ZA 3L0WB 2MQJA 2UWQA 4DKMA 2PEAA 2IB6A 2MRPA 2MP2A 2WWZA 2YE1A 1R4MI 2GBRA 4AWJA 3SG7A 2N9XA 3PLVA 2BWFA 3R7RA 3PRMB 4I6PA 1KYPA 2HCGA 3A33B 1EMBA 2XK5B 4WWOA 2KFKB 1NBFC 2A47A 2JUOA 3EC8A 4I6LB 4DXOA 4KA9A 1F0BA 2LZ6A 2M8SA 4F8CB 4IC7B 3VVWB 2AWMA 1BT0A 2JY6A 2MBOA 3A1QA 3M63B 3QHTA 4W77A 4DDGD 4G11A 4PS7A 3A8SA 4IK3A 2QLIA 4W9LA 4EKUA 3K1KA 1MG8A 1C4FA 5BQLA 3TCAA 3M62B 4LJPB 1NDDA 4W9FA 3NZUA 4W6JA 2EMDA 3P2BA 2VVJA 5J18A 2A53B 4WWPA 3CD9A 4FLHA 4MGYE 3VDZA 3ZTDA 1WJ4A 1RLFA 2QLGB 3NEDA 2RSUA 2V4EB 3GEXA 2RD0A 3A4SC 2RR9A 2KJHB 5AZGA 3PPAA 3QCAA 3P8UA 1Z1QA 3ST3A 1QXTA 1YQBA 4KZ0A 5JHAA 4M8MA 4BKGA 2HRSA 3ZTFA 1J0GA 3PS6A 3PJ5A 3G9AA 4LDTB 2KWVB 4WQOB 2C9WB 2NPTA 2O29A 1GUAB 1VD2A 3SHQA 2Z0EB 4KAGA 1GFLA 4GESB 2FAZA 2OKYA 3DQFA 4FHKA 3KH0A 2FWQA 4HPMB 3NT9A 3I3TB 2H6VA 1EMFA 4EULA 2BYEA 3V62A 5HZSA 1Z5SB 4W6IA 2WSNA 3A9KB 3UINB 2DYMA 3WLDA 4L13A 4P76A 4W9GA 4RMAA 4JL9A 1JBYA 1ZGQA 4OQWA 2GBKA 2VADA 2KLGA 3LDZE 3BY4B 3DQCA 2XBBC 2LGDA 1Q4DA 4KW9A 3WANA 2B3PA 4FADA 3R66C 2A46A 2KX0A 5F9GA 5IA7A 2DDDA 4ZYNA 3KYDD 1LFDA 4W7AA 3SS0A 2FIFA 2Y0GA 5LLIA 3VUXA 4W6KA 1L7YA 4H47A 1JBZA 1OQYA 2V3SA 2EMTA 4W6MA 4Z4MA 4HVFA 2OKWA 1V6EA 3N30A 4ICVA 3IG3A 2HQKA 4PPJA 2DZIA 3DPXA 1HE8A 3VTVA 1I35A 2HTHA 4M8NA 1AARA 5FR6A 4URKA 1R4NI 4KF5C 2KWUB 2PE9A 3PT2B 4ZIOA 1G6JA 5DCNA 3L17A 2LRUA 5AEKB 3JVZX 3A9JA 4P1QA 1TGZB 2ZJDA 3DVGX 2BTJA 3DQIA 4WJOA 2BF8B 4Q9WA 3WIMA 5BTTB 4BVUC 3R3MA 2L05A 5HBDA 3VFKA 4ANJA 4J88A 4BBNF 3NZSA 1RRBA 2MBEA 2JZZA 2LD9A 2JT4B 3AU5A 5CHFA 1Y8RC 1KYRA 4HVBA 1WJ6A 1QYQA 2K1FA 3U8AA 1S6ZA 1OEYA 2KDFB 3DBLI 2VRRB 3NOBA 2XEWA 3ZLZA 1EMKA 4HDQA 2JXXA 2NBVB 2GW4B 2JRHA 3ZRCA 2LXAA 3SV5A 2KTFA 3MTNB 2C7MB 2KLCA 4XZ4A 3EECA 5EDSA 4W69A 5KHQA 4W6GA 4DXAB 2Z0DB 4W74A 1V5TA 2EKEC 1PQSA 3RT3B 2A48A 4OGSA 4KDIC 2GOWA 3H7SA 4LCDE 1TZ1A 1MOVA 2KMAA 2QZ0A 1X1MA 2LVQA 3DQ8A 2DZMA 3AI4A 4GSWA 3SSYA 3Q3JA 4HE4A 5H88A 3EK8A 4JRBA 5J2RA 3TMTA 2H5PA 5H89A 3ZRFA 1QYFA 5J2OA 5D2MB 3KYCD 3CFAA 2GBNA 5EXCI 4ZRIA 4UTSA 4FJYA 4KPIA 1Q4AA 4W7DA 3SG4A 4M0WB 2JRIB 2H5OA 1UELA 2MP2B 5L83A 4LJOB 4KSKC 3SVUA 2A56B 4NJ7A 3EKJA 4MH0E 1Z1PA 4W6RA 4GXBA 3O65B 1IPGA 4TV3A 2CKHB 4G50A 4G3XB 4MSQB 2YLMA 4NAWA 4KF5A 4EN1A 2GX0A 2QHOA 5DPWA 3RCZA 2B3AA 1WX8A 1EMGA 3SVEA 1YX5B 4DXNA 4EFOA 2G3DB 3NF0A 1J19A 4HJKA 2FNJB 2K8CA 5DTLA 3WLCA 1P0RA 3PZDA 4B5YA 3JW0X 2KDBA 5IAAC 1E8XA 3E5VA 3RZWC 2RPQA 4IK9A 4J8AA 5EB6A 2Z59B 3GOEA 3TMPB 1WY8A 3JSVB 2KTRA 2WHTA 2BWES 3D32A 3V6CB 4W7EA 2K8HA 4W6HA 3NHEB 4P7IA 2O24A 3W1SC 3U0LA 3OJ3A 3PJ7A 5LXHA 1GGXA 5H87A 1ZKHA 4KIKA 3DQ7A 2FCMA 4W6SA 2KDIA 2MA9B 4W9CA 1OTRB 4GIVA 1C3TA 4IUMB 1V81A 4L12A 4KW8A 3E5TA 5LXIB 4HQ8A 4PFEA 5CHVC 2YFPA 4IWPA 1OXEA 1OXDA 1V80A 4XOWA 4LQTA 4WWNA 3SG3A 2HPWA 3CBEA 3SSHA 2AEHA 4NY0A 3I19A 2IE2A 2BGFA 3BINA 4DXIA 4MGKE 4AOFA 3GL4A 4DHZE 2KMCA 4NJ6A 1WFYA 4IM0A 1Q4CA 3WA0A 2Y5BB 2HJOA 3KVFB 4FULA 3VH3B 2MCNB 1WE6A 3ED8A 1WMHA 2HGYA 3ADFA 4W7XA 4LQUA 1TTNA 4OVVA 2IO2B 3X0WA 4KGFA 1SIFA 1YJFA 1LQBA 3QC8B 2L8JA 1VCBA 4GGQA 4CO7A 2V4LA 3U0KA 1E90A 3APDA 2HD5B 2LI5A 2CHZA 5E6NA 1H8CA 2DX5B 4LW5A 2IO3B 2DUHA 3LS3A 4ZRKA 1WIAA 2JVCA 2KKCA 5G55A 1V86A 3ST4A 3N32A 3L13A 4NQKE 5EHUA 1OXFA 3A1QB 1GC7A 2LGYA 2OJKA 4Q7TA 4PS3A 3L08A 4RM9A 2J0KA 2DUIA 5G2NA 1QZEA 2KC2A 4W9IA 2V1YA 4B6WA 2AYOB 1XQQA 4ORNA 2M17A 2GX2A 3LVAA 3IP2A 4MJSA 2WSOA 4B30B 3ZO5B 2KXJA 3TIXA 2O6VD 3ZW3A 4ANXA 3H1OA 4BOZB 4ZBLA 2NBWB 2MBBB 3SU8X 2BKRB 1D3ZA 1H4UA 4BBNC 4TZAA 3KUCB 2ZVNA 2O6VB 2G3OA 2RGFA 4RTCA 3UGBB 2H9WA 3SSPA 1HUYA 4DDID 2KOXA 3M3JA 1E7UA 2C5LC 4KIKB 4NWSA 1UBQA 2ZPYA 2FUHB 3DQNA 4W6DA 1UGMA 3W1YA 4R6BA 3QIJA 2KNBA 3SVBA 4HQ9A 3SD5A 3DQ1A 3RULA 5HGEA 4TQ0A 1GG3A 4JGEA 2C9IA 3C0RB 2YDZA 4B30A 4B9KA 4W7RA 3HIZA 2MBHA 3IVFA 4W9JA 1A5RA 3U7DA 3L10B 2O2VA 3KUZA 1RRXA 2O2VB 1YJ1A 4K7SA 1UISA 3W1DA 2QLEA 2VVIA 2VAEA 3DQHA 4OJ0A 2MWSB 3K9OB 3O77A 5KHOA 2LVPA 2ZMWA 2GBJA 1E8ZA 1UZXB 1WF9A 1YIWA 2LXCA 4DWFA 4NAWB 3VXWA 1XT9B 3DBHI 3ZUJA 2NBUA 3KCSA 3CD1A 3SSVA 3M95A 5DTXA 2G6XA 2NS5A 3DQAA 4W9KA 3DVNV 3A4RA 3AXCA 4DBGA 2A52B 1IYFA 4LJCA 3CF6E 3LA1A 2EMSA 2CHXA 2JF5A 4WJNA 3H6NA 4ZF3A 2A4ZA 4N3DA 3S05A 3VHTA 2N4FA 2DYBA 4W9HA 4IWOA 3RYTA 4W6FA 1WXSA 1UBIA 3SVDA 4W6UA 3H9DA 3VTWA 3SRYA 4J89A 1BFPA 3VUYA 4E74A 3SSTA 4IK8A 2KVRA 3QA8A 2KHWB 2JPHA 4KSLC 1GNUA 5AZHA 1P3QU 3T9LA 4PYZA 5JHBA 4DXPA 4OY4A 5CTRC 2G6YA 1I42A 3SVNA 2QT2A 3PIBA 2I1JA 2LUEA 2IOVA 1WR1A 4BKTA 2ZPNA 1RM9A 2IYDB 4K7WA 5HW9A 2ZO6A 3DQ2A 2P4MA 3PGEA 1GJZA 5HKHA 4HPLB 2LJ5A 2PXSA 4E3CA 4JLCA 4DHJD 3ZDTA 1T0YA 3ST2A 4DXMA 3LVDA 5HZOA 4Q9XA 4ZF5A 4JQWC 3X23A 2Z6YA 3EKHA 2WIQA 2HFCA 4NPNA 1H6RA 5KTGA 1XAEA 5EXUA 4EZKA 1WMHB 4NNJB 2AH8A 5L95C 3VK1A 3PREA 4KGEA 3DQKA 2EMNA 3NY5A 4KDLB 2KC1A 2ZCBA 3UF8A 1WXMA 3NEZA 2HQZA 2FL1A 2PXWA 5JH5C 3K9PB 2AL6A 1XA9A 4AJWA 4AR7A 2ZNVC 1YD8U 4XX5A 3DPDA 2DAJA 4GOCA 4II3B 2HE7A 3B08A 3U0NA 2PJHA 3SVRA 3DQJA 4H3MA 4EEWA 2MW5A 3DQ3A 1EMCA 5FVFA 4YL8A 1LXDA 1WX9A 3EVRA 4KEXA 4ZFSA 4ANVA 5C1ZA 3PSEB 3UFZA 3M22A 1XSSA 2IZVB 1WH3A 1WRDB 4J6IA 2G6EA 2O6VA 1EF1A 3GJ1A 3SSKA 3ZULA 1P1AA 1WXVA 4IZNA 2KN5A 2R2QA 4HQCA 2H5RA 5E6PA 2R2OA 5LTRA 2WHSA 4HLEA 5DU0A 4FHJA 3DQLA 4PS8A 2A5UA 1UH6A 4PPLA 2WX1A 1WZ0A 4MJSB 1TBEA 1Q0WB 2JZ3B 3DBRI 2AWKA 4F1SA 1Q5WB 2Z6XA 5DTYA 4KW4A 3OJ4B 4Z4KA 4H48A 2G4DB 3IFWB 3MJWA 3DQUA 2LWPA 4IG7B 2OGRA 4ANWA 4IM2A 2AHAA 1RMOA 2BPSA 1W7UA 3PTFC 4AS8A 2PPHA 4ICUA 4DKNA 2KQSA 2N1VA 2MX2A 4H3LA 3NS8A 1ZGOA 4NQLB 4II2B 2KO3A 4GDLB 1WYWB 1EMAA 2ASQA 5T3IA 2M0XA 3APCA 3ZNHB 1V49A 3DPWA 2LGXA 1IP9A 3P28A 1B9CA 4CYEA 5DPGA 1WGYA 1SE9A 3VTUA 2QRFA 1JC0A 4W6BA 3SVSA 1ISNA 4XOVA 1E8WA 1WGDA 3ML8A 2DUGA 5GMVA 3LF3A 4ZB1A 4AJYB 2VVHA 2IBIB 3IR8A 2L3ZA 5J17A 4IK1A 4KV2A 4LDTD 1WJUA 4RYSA 3SG6A 2IO1B 4W6PA 3ZTCA 3NT3A 1WE7A 4KVGB 2BKFA 3DVGY 3QK0A 3WAOA 2WX0A 3DBSA 2EMOA 5DTZA 4JFGA 2V4EA 2O2BA 1ZGPA 2M1MA 4KZCA 5DPHA 1V9JA 3LSAA 4W6NA 2K8BA 3GZNI 3B0AA 4W72A 1WJNA 1WM2A 3H7PB 1KJTA 4JIOU 3V3DA 4GB9A 5C23A 2HGDA 4DHJB 1V5OA 4DHZB 4ZF4A 5DQMA 4WJQA 4E71A 2FIDA 3JSVA 4EMQA 2D11A 3V6EB 3EK4A 4GMVA 3T8MA 3EVUA 4W73A 2YE0A 2D2QA 3DQ4A 1W7SA 4HCNB 4I6NB 1E7VA 2V4EC 1WXAA 3U30A 1NI2A 3QWZB 1JRUA 2VZXA 2C7NB 1WGGA 3ZNGC 3DOWA 2AWTA 2J0MA 3PLUA 2XK5A 2ICRA 5BTTA 2OTEA 3Q3FA 2KJ6A 1Q73A 2LRWA 3SG5A 2DD7A 3JYUA 2AWLA 3CFHA
chains in the Genus database with same CATH superfamily
3UG0A 2PE6B 4MM3A 3V61A 1WM3A 4NZLB 1RMPA 4ZINA 2QMTA 2GBMA 2IY1B 3Q2AC 4WH4A 4FN2A 3IHPC 3E9SA 4W6AA 3SVCA 4D2KA 3KCTA 2TSSA 1WZ3A 1XXGA 3QAQA 2JXTA 1AN8A 5JZEB 3PHXB 4RH6A 3N3KB 4LNFA 2WHUA 2LASA 3H1UA 1MYWA 3DCGA 1L2NA 2GI9A 3L54A 1Y56A 4J3OD 4EDOA 1C4CA 4W7CA 2DUFA 4TZGA 2D07B 2AQ2B 1PGXA 1ZOYB 3ABVB 4M0WA 4GDLA 1TJEA 2DYOA 2NPTB 3ZXRA 2DHZA 3TUOA 4B0MA 1GC6A 5EJUA 3ZJUA 3TBLD 3U8ZA 2N1WA 1EMEA 4AP4C 1Q1OA 4MDKE 3R2TA 2ZNVB 4MGIE 5FHVA 4A55A 4MGZE 4W6CA 1P7EA 3AU4A 3ZDMC 1Q10A 2KYWA 2I1KA 1MI0A 1U4AA 1SE4A 3PZ7A 2CR5A 1QYOA 2WU5B 2A54B 1J7CA 1YJIA 5DRFA 3GB3A 1K51A 2BYVE 1KM7A 1EMMA 3DQVA 4XE0A 5CHWA 5D6JB 3OSQA 3DQ9A 2N9EB 2QLGA 2MEKA 4GU2A 4XC2A 1P9DU 5BO4B 1MG4A 2PTLA 4CHKA 1E8YA 3HM3A 2DENB 4ZDVA 3O78A 1XCQL 1YHHA 3DQOA 3RWTA 4FJVB 3VR9B 3ZKJC 2M4NA 3EVVA 4DK5A 1WI0A 3H7PA 4LNOA 3L4PA 1W7TA 1ROEA 1FPYA 4DQOC 2BBCA 3A9KA 3Q8CA 1CK1A 5LTPA 1SEBD 3AI5A 2KZRA 4BDUA 2FCNA 1QILA 5DPSA 3Q14C 2QDFA 3WAMA 3DQ6A 4GDKB 2DZKA 1RFKA 3SG2A 2DD9A 4YT0B 3DQ5A 1QOAA 2EKIA 2QU1A 3OGOA 1TS4A 2CU1A 1T6BX 1SXTA 4IK4A 1F77A 2BB6A 2BB5A 2WU2B 3ZVVA 4WJPA 3BXBA 2NR2A 5DY6A 3MHSD 2MLBA 4H3NA 2CS4A 3EHVA 2UU7A 4EUTA 3P1MA 4W7FA 4A6QA 3ZIMA 2N7DA 2YVCA 3T3NA 2J0JA 2YEPB 2L00B 1HTQA 1FXIA 2WURA 2N9PC 2KFKA 4LJBA 3BX9A 1Q4EA 3LVCA 4A90A 2FCQA 2IO0B 2KQ7A 4A3OA 3Q6BA 4G0NB 2KD0A 3RZFA 2IY0B 4LNKA 4AUQC 3ZNID 1KYSA 2OOBB 4TUUA 3TEZA 4LJDA 2FCSA 4A3PA 5D7GA 1YOVB 3GJ2A 3OLMD 2POXA 1JWMD 4ITKA 3AMZA 2BW2A 3ZJTA 2Z1OA 3A9JB 4I2YA 3ECIA 5AQBB 1KP5A 3M24A 1QY3A 4K7UA 4K3BA 2K39A 5DPJA 4BFRA 2KWCA 3EVPA 3AE2B 3VAWA 2OTBA 3CB9A 2G5ZB 2J7QB 5HZTA 2C7HA 1HCJA 5DRGA 1H4RA 2AX5A 3DQEA 1V2YA 4ZOHC 2L0TA 4GF6B 3QARA 4BKSA 4ANUA 1STEA 1EUVB 2Q5WD 3TMRA 2YEPF 3CSFA 1ZW7A 3HHMA 1MOUA 4K81A 2SAKA 1RMMA 3UQAA 2K6QA 4LJDC 2PVGC 3U8CA 5CX3A 3SFDB 4B0EA 2H8QA 3Q3OC 1Z2MA 1SB3C 2K6DB 1TY2A 4W75A 1KOTA 4FA6A 3DQMA 4M01A 4MH8A 3QQ8B 2WYQA 1FMAD 1DOXA 2H5QA 2DLBA 5EB7A 2ARLA 5EBJA 3DBLB 3W1SA 2B3QA 2DDCA 2KANA 4XL5A 3V60A 3OAWA 1S3SG 4HK2A 2RPVA 3ZUFA 2BVCA 4EOYA 3N20C 1YHIA 4N9F4 3ZYYX 3DVNU 4XYCA 1C77A 3CSTA 3O13A 3UIOB 3H1RA 1CV7A 4WQMA 4OHSA 3QJZA 4EDSA 5D94A 2REXA 4KGRA 1VLBA 4BOSC 3SR6A 1CMXB 1T5XD 2GW3A 4YTNB 4IWQA 3KW5B 1JWBD 1OGWA 4HWIB 2JADA 3KQ4A 3DHHC 3R7QA 5IKCM 2KDEB 1FCCC 3GE3C 4LTUA 1F1HA 3WCKA 5BT0A 2OJWA 3MGFA 3HM6X 1MFWA 4EZLA 4XVPA 2KJRA 1AYFA 1FXTB 2C9JA 1J7AA 2AWJA 2LVOA 3MC0B 4LNNA 1VZ8A 2HJ8A 4W9DA 5FVIA 1YMHE 4XWWA 3VQIA 4JF9A 3Q8AA 1WSPA 4FJZA 1HEZE 3BXCA 5TR5A 5C2TB 1F2RC 2WDQB 4MELA 2DAFA 2L76A 4N58A 4W6TA 3AE9B 4DXGA 2Q57A 3BXAA 4IW0A 4RYWA 3SSLA 4EZJA 5AZFA 3APFA 1KF6B 3PRPB 5E6OA 5TSSA 3VH4B 3FKYA 3B1LX 4DXQA 2ZW0A 3MJ5A 3CFFA 1M94A 4JX1C 4GOBA 4HDOA 3TJPA 4YXDB 5MPOA 1RAXA 1YX6B 2NCNA 1YJJA 3MC9A 4JEOA 4JC2A 2ZZPB 2WNMA 4HXDA 2WXHA 3SDLC 2K25A 3U0MA 5EXBA 1EMLA 2B76B 1SGHA 1WGRA 1ZUXA 4HROA 3U52E 1EO6A 2L52A 3EGRA 2GRIA 3TL5A 1PDXA 3UQBA 3IBEA 1I7HA 5LK4A 4RM8A 2DZJA 3P4RB 2KK8A 3AKOA 2ZEQA 3ZUNA 2G3QB 4OVUA 5DPIA 3ML9A 2VH2A 5DQBA 3VICA 5FVGA 4W6OA 2MSED 1ZXIA 2L1AA 3LJ3A 4KKIA 1WX7A 4MEMA 3PVLA 3RWAA 2GMIC 4JGHB 4W9EA 1KLVA 4C4VB 1XQMA 3NUHB 3EFCA 2FE8A 3PRZA 1YJ2A 2G16B 3RNFC 2W55A 2KX3A 1ZGUB 2JWZA 2Z6ZA 1LM8B 5HZUA 5G5GA 3S2AA 2BS2B 2RH7A 2KFJA 3BK2A 3DPZA 3TEWA 1I4GA 5LTQA 1YHGA 3PHWB 2V4IB 1ZDXA 3RMKC 4TKNA 2ZCCA 2WDVB 3ST0A 3LF4B 2WISA 3WCQA 3W1CA 2ZMUA 3VRBB 2CHWA 4NJCA 1C1YB 1MHHE 2N0SB 4WAAA 4H2AA 4IM3A 1J7BA 1XLNA 2G45B 3ALBA 4PYUA 3ONSA 2PLPA 3GP7A 3ZXVA 4US9A 1F09A 1K8RB 3RUIB 1F9JA 2L7RA 4RGMA 2Q6PA 2MJDA 3SVOA 4W6LA 1QQRA 1FO4A 1RFAA 4XGYA 3VHTB 2V9HA 2MBQA 4HCPB 4ASWC 1EF5A 4B95A 1F2RI 5HI1A 1OFFA 4R6DA 4Q7RA 2UYZB 2WDTB 3E5WA 4GDKA 1XD3B 2A50B 3ENEA 2N7EA 5IO9A 2ZVOA 1SE3A 1UD7A 2NVUI 3WALA 4TQ1A 3EFUA 2D3GA 1I4QA 5E6JA 1YFPA 3OSRA 1I4PA 1GL4A 3DQDA 1XEEA 4L1BA 3U4EG 1TS5A 1E10A 3QX1A 3DWMA 4X57B 2D3CA 4AQ7A 2AL3A 5HFYA 3AULA 1DOIA 1E5WA 2D10A 1XO3A 2K5PA 2Y5PA 3AEGB 1SE2A 3EK7A 4M00A 4IK5A 4YSZB 4OZBA 2KTRB 2G2SB 4W76A 3NVZA 2W9NA 1OEYJ 1JC1A 3BVGA 2FZUA 3FILB 1NI3A 3PJBA 3C19A 3H8HA 1WGHA 3UIPB 4U2VA 2BYFA 3ZNZB 2L0FA 1WR6E 4MSMB 4TSSA 4YSYB 4WAFA 1Q4BA 3U8PA 1S1QB 5DPTA 4XWTA 2MHJA 4K1RB 1V1PB 3PV1A 2QLHA 2J42A 3AV8A 3RD2A 4A20A 2IB5A 4KF4A 4Q7UA 5DPRA 2OJRA 4OW0A 2WS3B 2DUEA 1CJEA 1L6VA 3CMMB 2C60A 3KUDB 1JW9D 4FBJB 3BVMA 4BKSD 3HK0A 1G7KA 1P98A 2ZO7A 1JMLA 2OEDA 4ZRJA 4L1IA 3WAPA 4PPKA 3CGLA 3L16A 1YZWA 4GN1A 2R61A 1J8CA 2G4SA 1R7SA 1ET9A 1D6EC 1TKEA 1XMZA 3DDCB 3VUWA 1TS3A 2W54A 3VHTC 4F7ZA 3OG5A 1HA5A 1FNWA 3L0WB 2MQJA 3I9V1 1PGBA 2UWQA 4DKMA 2PEAA 1N61A 2IB6A 3Q3MC 2MRPA 2MP2A 4MM3B 1NYQA 2LHEA 2WWZA 2YE1A 4LNIA 2LUMA 1R4MI 2GBRA 4AWJA 3SG7A 2N9XA 3PLVA 1OQRA 2BWFA 3R7RA 3PRMB 4I6PA 1KYPA 4YTPB 1E6EB 2HCGA 3A33B 1EMBA 4L23A 2XK5B 1HZ6A 4WWOA 2KFKB 2K9XA 1NBFC 2G1EA 4LK0M 1VR9A 4P6VF 2A47A 2JUOA 3B9JA 3EC8A 2INDC 4DXOA 4I6LB 4KA9A 1F0BA 2LZ6A 2M8SA 1ET6A 4F8CB 1N5XA 2SEBD 4IC7B 3VVWB 1CZPA 1ZUD2 2WXJA 1SIJA 2AWMA 1BT0A 2JY6A 2MBOA 2QCZA 4C7ZA 5LNK1 3A1QA 3M63B 3QHTA 4W77A 2KDMA 4RGNA 4DDGD 2NTSA 2CJNA 2WXLA 4G11A 3A8SA 4PS7A 4IK3A 2QLIA 4O1NA 4W9LA 2CJOA 4EKUA 3K1KA 1MG8A 4WIPA 1C4FA 5BQLA 3TCAA 2XN9C 3M62B 4LJPB 1NDDA 4W9FA 3AE1B 4PT5A 3NZUA 5BMGA 4W6JA 2EMDA 2X38A 3P2BA 5AUIA 2VVJA 2LHDA 2I2YA 5J18A 3J9CA 2A53B 2VZKD 4WWPA 2WXNA 3CD9A 4FLHA 3BIID 4MGYE 5C3JB 3VDZA 3ZTDA 4QAYA 2JSVX 1WJ4A 1ESFA 1RLFA 2QLGB 3NEDA 2RSUA 2V4EB 3GEXA 2RD0A 1QT9A 3A4SC 4RCOA 2RR9A 1YN4A 2KJHB 5AZGA 3PPAA 3QCAA 4C00A 3P8UA 1Z1QA 3ST3A 3EA6A 1RM6C 1QXTA 1YQBA 4KZ0A 5JHAA 1FD6A 2PVOD 4M8MA 4BKGA 2HRSA 3ZTFA 1J0GA 3PS6A 3PJ5A 3G9AA 4LDTB 2KWVB 4WQOB 1JWSD 3AE3B 2C9WB 2NPTA 4JWUC 3NS1A 2O29A 3NZ3A 4BAXA 1GUAB 1VD2A 3SHQA 1L4DB 4AS1A 3TEXA 1C78A 2Z0EB 4KAGA 1GFLA 4GESB 2FAZA 2OKYA 3DQFA 4FHKA 3KH0A 3HUIA 2FWQA 4HPMB 2QSDA 3NT9A 3I3TB 4JPSA 2H6VA 2LFIA 1EMFA 4EULA 3HRDD 2BYEA 3V62A 1EM7A 5HZSA 1Z5SB 4W6IA 2WSNA 2MJ3A 3A9KB 3W5UB 2KVZA 4MT5A 3UINB 2DYMA 3WLDA 2W3SA 4L13A 4P76A 4W9GA 4RMAA 4XDCA 4JL9A 1JBYA 1ZGQA 4OQWA 1XLQA 2GBKA 2WXIA 2VADA 2KLGA 1LGRA 1RYJA 3B2GA 3LDZE 3BY4B 4P16A 4ZRPA 3DQCA 2XBBC 3N9YC 2LGDA 2WXFA 1Q4DA 4KW9A 2JZPA 2B3PA 3WANA 4FADA 3R66C 1K52A 4RNAA 1PUTA 2A46A 2GB1A 4IKGA 2KX0A 5F9GA 5IA7A 2DDDA 4ZYNA 3KYDD 2GLSA 1LFDA 4W7AA 3SS0A 1WRIA 2Y0GA 2FIFA 5LLIA 2AQ1B 1QKZA 3VUXA 4W6KA 1L7YA 1T0QC 2AQ3B 3ZJVA 3AM9A 4H47A 4N59A 1JBZA 1OQYA 2V3SA 2EMTA 4W6MA 4Z4MA 4HVFA 4XDDA 2OKWA 1V6EA 3N30A 4ICVA 4HEA1 3IG3A 3NG0A 2HQKA 4PPJA 2DZIA 1B1ZA 3DPXA 1HE8A 1RWSA 3KLSX 3VTVA 1I35A 3FAHA 2HTHA 2NTTA 1FXAA 4M8NA 1AARA 5FR6A 3KWVA 4URKA 1R4NI 4KF5C 1UWMA 2KWUB 2PE9A 2QEJC 3PT2B 4ZIOA 1NENB 1G6JA 1SJED 1TY0A 5DCNA 2QILA 3L17A 2LRUA 5AEKB 3JVZX 3A9JA 1IGDA 3BWUD 4P1QA 1TGZB 1SBBB 2BT6A 2ZJDA 2DNFA 3DVGX 3B2FA 2BTJA 3DQIA 4WJOA 3SEBA 4C7YA 2BYTA 2BF8B 1C9FA 4Q9WA 3WIMA 1FIQA 5BTTB 4BVUC 3R3MA 2QIEB 2L05A 3BVZA 2ICIA 4BZAA 3TSSA 5HBDA 4NAMA 3VFKA 2LGIA 4ANJA 4J88A 1JRPA 3P4PB 1R4MB 4BBNF 3NZSA 1RRBA 2KMMA 2BQQA 2JZZA 2LD9A 2MBEA 2JT4B 2V3PA 3U2SC 3AU5A 1Y8RC 5CHFA 1KYRA 3DHGC 4ARIA 5JXVA 4HVBA 1WJ6A 1QYQA 2K1FA 1N6ZA 3U8AA 1S6ZA 1OEYA 2KDFB 2PMVA 3DBLI 2VRRB 3FILA 1I4XA 3NOBA 2XEWA 1F0ZA 3ZLZA 1EMKA 3R2IA 4HDQA 2JXXA 3I5JC 2NBVB 2GW4B 2JRHA 3ZRCA 1IUEA 2LXAA 3Q8BA 3SV5A 2KTFA 3MTNB 1AWDA 1PYWD 2C7MB 4IOIE 2KLCA 4XZ4A 3EECA 1L6UA 5EDSA 3LYYA 4W69A 2G9HD 5IOIA 5KHQA 4C80A 1L0XB 4W6GA 3AECB 1GAQB 4DXAB 2Z0DB 4W74A 1V5TA 4ACFA 2EKEC 1PQSA 1E9MA 1SF0A 2A48A 3RT3B 1FFVA 4OGSA 4A8XC 2LGSA 4KDIC 2GOWA 2Y3AA 3H7SA 2INCC 4LCDE 1TZ1A 1MOVA 4KGSA 2KMAA 2QZ0A 1T0RC 1X1MA 5H92C 2Y5CA 4K3CA 2LVQA 3DQ8A 1N5WA 1DGJA 2DZMA 3AI4A 4FXCA 4GSWA 3SSYA 3Q3JA 5EE1A 4HE4A 5H88A 3EK8A 4JRBA 2BS4B 3I63C 5J2RA 3TMTA 2DWQA 3U7ZA 2H5PA 5H89A 3AH7A 1QYFA 3ZRFA 2LEKA 5J2OA 1YNTE 2M56B 5D2MB 3KYCD 3CFAA 2GBNA 5EXCI 4ZRIA 4UTSA 4FJYA 1GB4A 4KPIA 1Q4AA 4W7DA 3SG4A 4S17A 4M0WB 2JRIB 2H5OA 1FCLA 1UELA 2MP2B 2FUG1 4IDIA 5L83A 4LJOB 4KSKC 2IGHA 3SVUA 2A56B 4NJ7A 3TEYA 3EKJA 4OVZA 2HTME 4MH0E 1Z1PA 2KAJA 4C4VA 1MJDA 4XGAB 4W6RA 4GXBA 1DYQA 3O65B 1IPGA 2PIAA 4R3DA 1K53A 2J53A 2Z8LA 2L83A 1VZ7A 4TV3A 2CKHB 4G50A 4TMAB 4G3XB 3IAS1 2YLMA 4MSQB 4NAWA 2E3TA 4KF5A 4EN1A 4RGOS 2GX0A 2NMQA 1QF6A 1TKYA 2QHOA 4PK1A 5DPWA 1TT5B 3RCZA 2B3AA 2RDHA 1WX8A 1EMGA 3SVEA 1YN3A 4DXNA 1YX5B 4EFOA 2G3DB 1OQQA 3NF0A 4RF1A 2INPE 1J19A 4YSXB 4HJKA 2FNJB 1HXYD 2K8CA 3BYYB 5DTLA 2D5GA 3WLCA 1BMLC 1P0RA 3PZDA 4B5YA 3JW0X 1E0ZA 3DHIC 4ARCA 2KDBA 5IAAC 2WDRB 1E8XA 3E5VA 3RZWC 2RPQA 3P4SB 4IK9A 2RDGA 4J8AA 5EB6A 2W82A 2Z59B 3GOEA 1C4AA 3TMPB 2ZW1A 1WY8A 3JSVB 2KTRA 2WHTA 3GZNB 1D5MC 3DBRB 2BWES 3D32A 4GLSC 3V6CB 4W7EA 2K8HA 4W6HA 3NHEB 1JCKB 4P7IA 2O24A 3U0LA 3W1SC 3OJ3A 3PJ7A 3NVYA 1KTKA 5LXHA 1GGXA 2WXPA 5H87A 1I4HA 1ZKHA 4KIKA 4L2YA 1JROA 3DQ7A 5HHDG 2FCMA 4W6SA 2KDIA 2MA9B 1I4RA 3PZ8A 4W9CA 1OTRB 4GIVA 1C3TA 3W9CB 4IUMB 1V81A 3AEDB 1HQRD 4L12A 1TS2A 3NVVA 4KW8A 2WXMA 5GXGB 3E5TA 5LXIB 4JE3B 4HQ8A 1XLPA 1N62A 4PFEA 5CHVC 2DBYA 2YFPA 1V1OA 3T3OA 4IWPA 2E6XA 1OXEA 1OXDA 3AE4B 1V80A 4XOWA 4LQTA 4WWNA 3SG3A 2HPWA 3CBEA 3CIRB 3SSHA 2AEHA 4NY0A 3I19A 2IE2A 1VJKA 1XCTL 1EWCA 2BGFA 2FBWB 3IT6B 3BINA 1WGKA 1IGCA 4DXIA 4MGKE 1UWXA 3GL4A 1WXQA 4AOFA 4DHZE 3AEAB 1JWAD 2KMCA 1ZDVA 3P4QB 1V1PA 4NJ6A 1WFYA 4IM0A 2V3NA 5AUKA 1Q4CA 3N1YC 3N1XC 2WXOA 3WA0A 2Y5BB 2HJOA 3KVFB 4FULA 3VH3B 2MCNB 1WE6A 3ED8A 1N60A 1WMHA 2HGYA 4RFBA 3ADFA 4W7XA 4LQUA 1TTNA 4OVVA 2IO2B 1SIFA 4KGFA 1UGJA 3X0WA 1YJFA 3AE6B 1LQBA 2H88B 3QC8B 2L8JA 1VCBA 4GGQA 4S0RA 4CO7A 4USAA 3GS2A 2V4LA 2JYEA 3U0KA 1E90A 2MH7A 3APDA 2HD5B 2LI5A 5D3DA 2CHZA 5E6NA 1H8CA 2DX5B 3N1ZC 4LW5A 1KLUD 1M4VA 2IO3B 2DUHA 3AEFB 3LS3A 4ZRKA 1WIAA 2JVCA 2KKCA 5G55A 1V86A 2WXQA 2IDYA 3ST4A 3N32A 2EELA 3L13A 4NQKE 5EHUA 2V0GA 1OXFA 4RGTA 3A1QB 1GC7A 2LGYA 2OJKA 4Q7TA 4PS3A 4DXFA 4KX6B 3L08A 4RM9A 2J0KA 2DUIA 1QZEA 2KC2A 5G2NA 4W9IA 2V1YA 4B6WA 2AYOB 1XQQA 4ORNA 2M17A 2GX2A 3LVAA 3IP2A 4MJSA 1KH0A 2W3RA 3ZGZA 2WSOA 4B30B 1HTOA 2L32A 2KXJA 3ZO5B 3NRZA 3MP9A 3TIXA 5BYQA 5BYRA 2O6VD 5FR3A 3ZW3A 4ANXA 3LXFA 4C56C 3H1OA 4BOZB 4ZBLA 3RPFC 2NBWB 5EE3A 2MBBB 3SU8X 2BKRB 1D3ZA 1H4UA 4BBNC 2KACA 4ZRQA 5FKAC 2JX5A 4TZAA 3KUCB 2ZVNA 2O6VB 2G3OA 2RGFA 4JWSC 3C8YA 4A9AA 4RTCA 4US8A 3AN1A 3UGBB 2KQ4X 2H9WA 2JQRB 3SSPA 1HUYA 1MHXA 4DDID 2KOXA 3M3JA 5HG2A 1JWUD 4HKQA 1E7UA 2C5LC 4KIKB 4NWSA 2KT7A 2N7JA 3AE5B 1UBQA 2ZPYA 3GB1A 2FUHB 3DQNA 4W6DA 1UGMA 1C76A 3MHZA 1YQ4B 3MFGA 3W1YA 4R6BA 3RN9C 3QIJA 2KNBA 3SVBA 2LJIA 4HQ9A 1FFUA 3SD5A 3DQ1A 3LB8C 3P63A 3RULA 1PFDA 5HGEA 3DWGC 2CU3A 2J52A 1KFYB 2D3BA 1VZ6A 4TQ0A 1GG3A 4JGEA 3RI7C 2C9IA 3C0RB 2YDZA 3URYA 4B30A 3GE8C 3V3XA 4B9KA 4REZA 1ENFA 2OHFA 4P1CC 4W7RA 3HIZA 2MBHA 3IVFA 4W9JA 1A5RA 3U7DA 1SJHD 3L10B 3Q3NC 2O2VA 2XNAC 3KUZA 3EUB2 1RRXA 5EE0A 2O2VB 1YJ1A 4K7SA 4HRSA 1UISA 3W1DA 2QLEA 2VVIA 2VAEA 1P7FA 3DQHA 4OJ0A 2MWSB 3K9OB 3RFZB 3O77A 3Q69A 5KHOA 1T3QA 2LVPA 2WXGA 2ZMWA 2WXRA 1MPEA 2GBJA 2VH1A 1E8ZA 3W5VB 5IP4D 1UZXB 1WF9A 1YIWA 2LXCA 4DWFA 1BUIC 4NAWB 3AEEB 3RNAC 1XT9B 3DBHI 3VXWA 3ZUJA 5IN7A 3RNCC 2NBUA 3KCSA 3CD1A 3SSVA 3M95A 3NJTA 5DTXA 2G6XA 2NS5A 3DQAA 4W9KA 3DVNV 3A4RA 3AXCA 1FM0D 4DBGA 3ETRA 2A52B 5BYSA 2J4XA 1IYFA 4LJCA 1KLGD 3CF6E 3LA1A 2EMSA 4ZHPA 2CHXA 4WURA 2RDBC 2MJEA 2JF5A 4WJNA 2RMMA 3H6NA 2IJ0A 4ZF3A 2A4ZA 4N3DA 3S05A 3VHTA 2N4FA 3AE8B 2DYBA 4W9HA 4IWOA 3RYTA 5G5HA 4W6FA 2JU6X 1WXSA 3FC4A 4HKZE 1KRHA 1UBIA 3SVDA 2JYTA 4W6UA 1TIFA 3H9DA 3E56A 1L5PA 3SRYA 3VTWA 3W2DA 4J89A 2H89B 1WWTA 1BFPA 3VUYA 2WQYB 4E74A 3SSTA 4IK8A 2KVRA 3QA8A 2KHWB 2KWDA 2JPHA 4KSLC 3VRAB 1GNUA 1FRRA 3AB5A 3BYTB 2BTEA 5AZHA 1P3QU 3T9LA 4PYZA 5JHBA 4DXPA 4OY4A 5CTRC 5H8YE 2G6YA 3IT4B 1I42A 3SVNA 3AEBB 2QT2A 2X8XX 3NVWA 3PIBA 2I1JA 1TZOA 2IOVA 2LUEA 1WR1A 4BKTA 1EWYC 1UF0A 2ZPNA 1QOFA 1RM9A 2IYDB 4K7WA 5HW9A 2ZO6A 3DQ2A 3R8BA 2P4MA 3PGEA 1GJZA 5HKHA 4HPLB 2LJ5A 2PXSA 4E3CA 4JLCA 5FK9C 3ZDTA 4DHJD 3SFEB 1T0YA 3ST2A 4UDUC 4DXMA 3LVDA 5HZOA 1B9RA 4KKJA 1FEHA 1NYRA 4Q9XA 1GPXA 4ZF5A 4JQWC 1T0SC 1V97A 3X23A 2Z6YA 1QOBA 3EKHA 2WIQA 2HFCA 4NPNA 1H6RA 5KTGA 1XAEA 5EXUA 2WXKA 4EZKA 1WMHB 4NNJB 2K22A 2AH8A 3I57A 3RNBC 3DBHB 5L95C 3VK1A 3PREA 4KGEA 3DQKA 2EMNA 3NY5A 4KDLB 4YTMB 2KC1A 1A70A 2LMCA 2ZCBA 3UF8A 2PKOA 1WXMA 3NEZA 4ZHOA 2HQZA 2FL1A 2PXWA 5JH5C 1N63A 3K9PB 1QLBB 2AL6A 1XA9A 4AJWA 4AR7A 2ZNVC 1YD8U 4XX5A 3DPDA 2ONQA 1FNUA 4WWMA 2DAJA 2ON8A 2HE7A 4GOCA 4II3B 3B08A 4HJGE 1BXTA 3U0NA 2WP9B 2PJHA 3SVRA 1GB1A 3DQJA 1NEKB 4H3MA 4EEWA 1QOGA 1VDVA 1SSNA 2MW5A 3DQ3A 1EMCA 2ACZB 5FVFA 2I38A 4YL8A 1LXDA 1WX9A 3EVRA 4KEXA 4ZFSA 4ANVA 2N9KA 2IGDA 4YWGG 5C1ZA 1MVKA 3PSEB 3UFZA 3M22A 1XSSA 2IZVB 3IAM1 1VRAB 1WH3A 1WRDB 4OZAA 4J6IA 2G6EA 2O6VA 1EF1A 3GJ1A 1ZP0B 3SSKA 4EE2A 1HZ5A 2KN4A 3ZULA 1P1AA 1YQ3B 1WXVA 3HVDA 3HVZA 4IZNA 3RNEC 2KN5A 1C79A 4HQCA 2H5RA 1WYGA 2R2QA 5E6PA 2R2OA 5BMHA 5LTRA 2WHSA 4HLEA 1L0VB 5DU0A 4FHJA 3DQLA 4PS8A 2A5UA 1UH6A 3AE7B 4PPLA 1E7PB 4LLGM 2WX1A 1WZ0A 4MJSB 1TBEA 2WHIA 1Q0WB 2JZ3B 3DBRI 2AWKA 4F1SA 1ZXHA 1Q5WB 2Z6XA 1D5XC 5DTYA 4KW4A 3OJ4B 4Z4KA 5EE9A 4H48A 2G4DB 2BS3B 3IFWB 3MJWA 3DQUA 2LWPA 4IG7B 2OGRA 1TYGB 1ZE3D 4ANWA 4IM2A 2D3AA 2QJLA 2AHAA 1RMOA 2BPSA 1W7UA 3PTFC 4AS8A 2PPHA 4ICUA 4DKNA 3OWEB 2KQSA 2N1VA 2HJ1A 2MX2A 4H3LA 3NS8A 2HDEA 1ZGOA 4NQLB 3BZDB 4II2B 2KO3A 1XF5L 4GDLB 3VR8B 1WYWB 1C4PA 4P1BC 1EMAA 1CQVA 2ASQA 5T3IA 2M0XA 4M02A 3APCA 3ZNHB 1V49A 3IXSA 3DPWA 1JALA 2LGXA 2WGSA 1IP9A 3P28A 1EU3A 1B9CA 1K50A 3P42A 4CYEA 5DPGA 1WGYA 1SE9A 3VTUA 1JQ4A 2QRFA 4OHJA 4MACA 5BMIA 1V8CA 2IGGA 2WLBA 1JC0A 1F52A 4W6BA 3SVSA 1ISNA 4XOVA 1E8WA 1WGDA 3KWLA 2DUGA 3ML8A 5GMVA 3LF3A 4ZB1A 4AJYB 2VVHA 2IBIB 3IR8A 2L3ZA 3MC8A 5J17A 4IK1A 3BK1A 1L0YB 4KV2A 1R4NB 1L4ZB 4LDTD 1WJUA 4RYSA 2PW9A 2K0PA 3SG6A 2IO1B 4W6PA 3ZTCA 3NT3A 1WE7A 4KVGB 2BKFA 1UUPA 3DVGY 1D4BA 3QK0A 3WAOA 4OZCA 2WX0A 3DBSA 2EMOA 2VZKB 1FRDA 5DTZA 4JFGA 2V4EA 4HPPA 1YN5A 1IBXB 2O2BA 3RNGC 1ZGPA 2K3UA 2M1MA 4KZCA 5DPHA 4N6EB 1V9JA 1UNSA 2IPKD 3LSAA 4W6NA 2K8BA 3GZNI 1LO5D 3B0AA 4CQNA 1D5ZC 4W72A 3Q8FA 4Q2JA 1WJNA 1GOZA 1EU4A 3ZQ4A 1ACCA 1WM2A 2JWUA 3H7PB 1DOYA 1KJTA 4JIOU 3UI3A 3V3DA 4GB9A 5C23A 2HGDA 4DHJB 4ZYSA 1V5OA 4DHZB 3PO0A 4ZF4A 3CWIA 5DQMA 4WJQA 4E71A 2FIDA 5I4DA 3JSVA 4EMQA 2D11A 3V6EB 3EK4A 1IBXA 4GMVA 3T8MA 3EVUA 4W73A 2YE0A 2D2QA 2M0AA 3DQ4A 1W7SA 1XLOA 4HCNB 4I6NB 1E7VA 1TKGA 2QC8A 4RF0A 5D3IB 2V4EC 1NVID 1WXAA 2INNE 3U30A 1NI2A 3QWZB 1JRUA 2VZXA 2C7NB 2M19A 1WGGA 3ZNGC 3DOWA 2AWTA 2J0MA 3V05A 3PLUA 2XK5A 2ICRA 5BTTA 2N9LA 2OTEA 4KGTA 3Q3FA 2KJ6A 1Q73A 1FNVA 2LRWA 3SG5A 5T8IA 2DD7A 3JYUA 1AW7A 2AWLA 3CFHA 1PGAA 3Q8EA 1ZPSA
chains in the Genus database with same CATH topology
3UG0A 2PE6B 4MM3A 3V61A 1WM3A 1RMPA 4ZINA 2GBMA 2IY1B 4FN2A 3IHPC 4W6AA 3SVCA 3KCTA 1WZ3A 3QAQA 5JZEB 3PHXB 3N3KB 2WHUA 2LASA 3H1UA 1MYWA 3DCGA 1L2NA 3L54A 4EDOA 4W7CA 2DUFA 4TZGA 2D07B 4GDLA 2DYOA 2NPTB 2DHZA 1GC6A 5EJUA 3TBLD 3U8ZA 2N1WA 1EMEA 4AP4C 1Q1OA 4MDKE 2ZNVB 4MGIE 5FHVA 4MGZE 4W6CA 3AU4A 3ZDMC 2I1KA 1U4AA 2CR5A 1QYOA 2A54B 5DRFA 3GB3A 2BYVE 1KM7A 1EMMA 3DQVA 5CHWA 5D6JB 3OSQA 3DQ9A 2N9EB 2QLGA 4XC2A 4GU2A 5BO4B 1P9DU 4CHKA 1E8YA 3HM3A 2DENB 4ZDVA 3O78A 1YHHA 3DQOA 3RWTA 4FJVB 3ZKJC 2M4NA 3EVVA 4DK5A 1WI0A 3H7PA 1W7TA 3A9KA 5LTPA 3AI5A 2KZRA 4BDUA 2FCNA 5DPSA 3WAMA 3DQ6A 4GDKB 2DZKA 3SG2A 2DD9A 3DQ5A 2QU1A 3OGOA 2CU1A 4IK4A 3ZVVA 4WJPA 3BXBA 2NR2A 5DY6A 3MHSD 2MLBA 4H3NA 2CS4A 3EHVA 4EUTA 4W7FA 3ZIMA 2N7DA 2YVCA 2J0JA 2L00B 2WURA 2N9PC 2KFKA 4LJBA 3BX9A 1Q4EA 3LVCA 2FCQA 2IO0B 2KQ7A 4A3OA 4G0NB 2KD0A 3RZFA 2IY0B 4AUQC 3ZNID 1KYSA 2OOBB 4TUUA 4LJDA 2FCSA 4A3PA 5D7GA 3GJ2A 3OLMD 2POXA 2Z1OA 3A9JB 4I2YA 3ECIA 5AQBB 1KP5A 3M24A 1QY3A 4K7UA 2K39A 5DPJA 4BFRA 2KWCA 3EVPA 3VAWA 2OTBA 3CB9A 2G5ZB 2J7QB 5HZTA 2C7HA 1HCJA 5DRGA 1H4RA 3DQEA 1V2YA 2L0TA 4GF6B 3QARA 4BKSA 4ANUA 1EUVB 3TMRA 3CSFA 3HHMA 1ZW7A 4K81A 1MOUA 1RMMA 3UQAA 2K6QA 4LJDC 3U8CA 5CX3A 2H8QA 1Z2MA 2K6DB 4W75A 1KOTA 4FA6A 3DQMA 3QQ8B 2WYQA 2H5QA 5EB7A 2ARLA 5EBJA 3W1SA 2B3QA 2DDCA 2KANA 4XL5A 3V60A 3OAWA 1S3SG 4HK2A 3ZUFA 4EOYA 1YHIA 4N9F4 3DVNU 3UIOB 3CSTA 3H1RA 1CV7A 4OHSA 3QJZA 4EDSA 5D94A 2REXA 4BOSC 1CMXB 2GW3A 4IWQA 3KW5B 1OGWA 4HWIB 2JADA 3R7QA 2KDEB 3WCKA 5BT0A 3MGFA 3HM6X 4EZLA 4XVPA 2KJRA 1FXTB 2C9JA 2AWJA 2LVOA 2HJ8A 4W9DA 5FVIA 3VQIA 4JF9A 4FJZA 3BXCA 5TR5A 4MELA 2DAFA 2L76A 4W6TA 2Q57A 3BXAA 4IW0A 4RYWA 3SSLA 4EZJA 5AZFA 3APFA 3PRPB 5E6OA 3VH4B 3B1LX 4DXQA 3CFFA 1M94A 4GOBA 4HDOA 3TJPA 1RAXA 1YX6B 2NCNA 4JEOA 4JC2A 2ZZPB 4HXDA 3SDLC 2K25A 3U0MA 5EXBA 1EMLA 1SGHA 1WGRA 1ZUXA 1EO6A 3TL5A 3UQBA 3IBEA 5LK4A 4RM8A 2DZJA 2KK8A 3AKOA 2ZEQA 3ZUNA 2G3QB 4OVUA 5DPIA 3ML9A 5DQBA 3VICA 5FVGA 4W6OA 2MSED 3LJ3A 1WX7A 4MEMA 3PVLA 3RWAA 2GMIC 4JGHB 4W9EA 1KLVA 1XQMA 3PRZA 1YJ2A 2G16B 2KX3A 1ZGUB 2JWZA 2Z6ZA 1LM8B 5HZUA 3S2AA 2RH7A 2KFJA 3DPZA 5LTQA 1YHGA 3PHWB 4TKNA 2ZCCA 3ST0A 3LF4B 2WISA 3W1CA 2ZMUA 2CHWA 1C1YB 4WAAA 4IM3A 2G45B 3ALBA 4PYUA 3ONSA 1F09A 1K8RB 3RUIB 1F9JA 2L7RA 2Q6PA 3SVOA 4W6LA 1RFAA 4XGYA 3VHTB 2MBQA 4HCPB 4ASWC 1EF5A 4B95A 4R6DA 4Q7RA 2UYZB 2WDTB 3E5WA 4GDKA 1XD3B 2A50B 3ENEA 2N7EA 2ZVOA 1UD7A 2NVUI 3WALA 4TQ1A 3EFUA 2D3GA 1YFPA 3OSRA 1GL4A 3DQDA 3QX1A 4X57B 2AL3A 3AULA 1E5WA 2D10A 3EK7A 4IK5A 2KTRB 2G2SB 4W76A 2W9NA 1OEYJ 1JC1A 2FZUA 3PJBA 1WGHA 3UIPB 4U2VA 2BYFA 3ZNZB 2L0FA 1WR6E 4MSMB 1Q4BA 3U8PA 1S1QB 5DPTA 4K1RB 3PV1A 2QLHA 3RD2A 4A20A 2IB5A 4KF4A 4Q7UA 5DPRA 2OJRA 2DUEA 3CMMB 2C60A 3KUDB 4FBJB 4BKSD 3HK0A 1G7KA 1P98A 2ZO7A 4ZRJA 4L1IA 3WAPA 4PPKA 3CGLA 3L16A 1YZWA 4GN1A 1J8CA 2G4SA 1XMZA 3DDCB 3VUWA 3VHTC 4F7ZA 3L0WB 2MQJA 2UWQA 4DKMA 2PEAA 2IB6A 2MRPA 2MP2A 2WWZA 2YE1A 1R4MI 2GBRA 4AWJA 3SG7A 2N9XA 3PLVA 2BWFA 3R7RA 3PRMB 4I6PA 1KYPA 2HCGA 3A33B 1EMBA 2XK5B 4WWOA 2KFKB 1NBFC 2A47A 2JUOA 3EC8A 4I6LB 4DXOA 4KA9A 1F0BA 2LZ6A 2M8SA 4F8CB 4IC7B 3VVWB 2AWMA 1BT0A 2JY6A 2MBOA 3A1QA 3M63B 3QHTA 4W77A 4DDGD 4G11A 4PS7A 3A8SA 4IK3A 2QLIA 4W9LA 4EKUA 3K1KA 1MG8A 1C4FA 5BQLA 3TCAA 3M62B 4LJPB 1NDDA 4W9FA 3NZUA 4W6JA 2EMDA 3P2BA 2VVJA 5J18A 2A53B 4WWPA 3CD9A 4FLHA 4MGYE 3VDZA 3ZTDA 1WJ4A 1RLFA 2QLGB 3NEDA 2RSUA 2V4EB 3GEXA 2RD0A 3A4SC 2RR9A 2KJHB 5AZGA 3PPAA 3QCAA 3P8UA 1Z1QA 3ST3A 1QXTA 1YQBA 4KZ0A 5JHAA 4M8MA 4BKGA 2HRSA 3ZTFA 1J0GA 3PS6A 3PJ5A 3G9AA 4LDTB 2KWVB 4WQOB 2C9WB 2NPTA 2O29A 1GUAB 1VD2A 3SHQA 2Z0EB 4KAGA 1GFLA 4GESB 2FAZA 2OKYA 3DQFA 4FHKA 3KH0A 2FWQA 4HPMB 3NT9A 3I3TB 2H6VA 1EMFA 4EULA 2BYEA 3V62A 5HZSA 1Z5SB 4W6IA 2WSNA 3A9KB 3UINB 2DYMA 3WLDA 4L13A 4P76A 4W9GA 4RMAA 4JL9A 1JBYA 1ZGQA 4OQWA 2GBKA 2VADA 2KLGA 3LDZE 3BY4B 3DQCA 2XBBC 2LGDA 1Q4DA 4KW9A 3WANA 2B3PA 4FADA 3R66C 2A46A 2KX0A 5F9GA 5IA7A 2DDDA 4ZYNA 3KYDD 1LFDA 4W7AA 3SS0A 2FIFA 2Y0GA 5LLIA 3VUXA 4W6KA 1L7YA 4H47A 1JBZA 1OQYA 2V3SA 2EMTA 4W6MA 4Z4MA 4HVFA 2OKWA 1V6EA 3N30A 4ICVA 3IG3A 2HQKA 4PPJA 2DZIA 3DPXA 1HE8A 3VTVA 1I35A 2HTHA 4M8NA 1AARA 5FR6A 4URKA 1R4NI 4KF5C 2KWUB 2PE9A 3PT2B 4ZIOA 1G6JA 5DCNA 3L17A 2LRUA 5AEKB 3JVZX 3A9JA 4P1QA 1TGZB 2ZJDA 3DVGX 2BTJA 3DQIA 4WJOA 2BF8B 4Q9WA 3WIMA 5BTTB 4BVUC 3R3MA 2L05A 5HBDA 3VFKA 4ANJA 4J88A 4BBNF 3NZSA 1RRBA 2MBEA 2JZZA 2LD9A 2JT4B 3AU5A 5CHFA 1Y8RC 1KYRA 4HVBA 1WJ6A 1QYQA 2K1FA 3U8AA 1S6ZA 1OEYA 2KDFB 3DBLI 2VRRB 3NOBA 2XEWA 3ZLZA 1EMKA 4HDQA 2JXXA 2NBVB 2GW4B 2JRHA 3ZRCA 2LXAA 3SV5A 2KTFA 3MTNB 2C7MB 2KLCA 4XZ4A 3EECA 5EDSA 4W69A 5KHQA 4W6GA 4DXAB 2Z0DB 4W74A 1V5TA 2EKEC 1PQSA 3RT3B 2A48A 4OGSA 4KDIC 2GOWA 3H7SA 4LCDE 1TZ1A 1MOVA 2KMAA 2QZ0A 1X1MA 2LVQA 3DQ8A 2DZMA 3AI4A 4GSWA 3SSYA 3Q3JA 4HE4A 5H88A 3EK8A 4JRBA 5J2RA 3TMTA 2H5PA 5H89A 3ZRFA 1QYFA 5J2OA 5D2MB 3KYCD 3CFAA 2GBNA 5EXCI 4ZRIA 4UTSA 4FJYA 4KPIA 1Q4AA 4W7DA 3SG4A 4M0WB 2JRIB 2H5OA 1UELA 2MP2B 5L83A 4LJOB 4KSKC 3SVUA 2A56B 4NJ7A 3EKJA 4MH0E 1Z1PA 4W6RA 4GXBA 3O65B 1IPGA 4TV3A 2CKHB 4G50A 4G3XB 4MSQB 2YLMA 4NAWA 4KF5A 4EN1A 2GX0A 2QHOA 5DPWA 3RCZA 2B3AA 1WX8A 1EMGA 3SVEA 1YX5B 4DXNA 4EFOA 2G3DB 3NF0A 1J19A 4HJKA 2FNJB 2K8CA 5DTLA 3WLCA 1P0RA 3PZDA 4B5YA 3JW0X 2KDBA 5IAAC 1E8XA 3E5VA 3RZWC 2RPQA 4IK9A 4J8AA 5EB6A 2Z59B 3GOEA 3TMPB 1WY8A 3JSVB 2KTRA 2WHTA 2BWES 3D32A 3V6CB 4W7EA 2K8HA 4W6HA 3NHEB 4P7IA 2O24A 3W1SC 3U0LA 3OJ3A 3PJ7A 5LXHA 1GGXA 5H87A 1ZKHA 4KIKA 3DQ7A 2FCMA 4W6SA 2KDIA 2MA9B 4W9CA 1OTRB 4GIVA 1C3TA 4IUMB 1V81A 4L12A 4KW8A 3E5TA 5LXIB 4HQ8A 4PFEA 5CHVC 2YFPA 4IWPA 1OXEA 1OXDA 1V80A 4XOWA 4LQTA 4WWNA 3SG3A 2HPWA 3CBEA 3SSHA 2AEHA 4NY0A 3I19A 2IE2A 2BGFA 3BINA 4DXIA 4MGKE 4AOFA 3GL4A 4DHZE 2KMCA 4NJ6A 1WFYA 4IM0A 1Q4CA 3WA0A 2Y5BB 2HJOA 3KVFB 4FULA 3VH3B 2MCNB 1WE6A 3ED8A 1WMHA 2HGYA 3ADFA 4W7XA 4LQUA 1TTNA 4OVVA 2IO2B 3X0WA 4KGFA 1SIFA 1YJFA 1LQBA 3QC8B 2L8JA 1VCBA 4GGQA 4CO7A 2V4LA 3U0KA 1E90A 3APDA 2HD5B 2LI5A 2CHZA 5E6NA 1H8CA 2DX5B 4LW5A 2IO3B 2DUHA 3LS3A 4ZRKA 1WIAA 2JVCA 2KKCA 5G55A 1V86A 3ST4A 3N32A 3L13A 4NQKE 5EHUA 1OXFA 3A1QB 1GC7A 2LGYA 2OJKA 4Q7TA 4PS3A 3L08A 4RM9A 2J0KA 2DUIA 5G2NA 1QZEA 2KC2A 4W9IA 2V1YA 4B6WA 2AYOB 1XQQA 4ORNA 2M17A 2GX2A 3LVAA 3IP2A 4MJSA 2WSOA 4B30B 3ZO5B 2KXJA 3TIXA 2O6VD 3ZW3A 4ANXA 3H1OA 4BOZB 4ZBLA 2NBWB 2MBBB 3SU8X 2BKRB 1D3ZA 1H4UA 4BBNC 4TZAA 3KUCB 2ZVNA 2O6VB 2G3OA 2RGFA 4RTCA 3UGBB 2H9WA 3SSPA 1HUYA 4DDID 2KOXA 3M3JA 1E7UA 2C5LC 4KIKB 4NWSA 1UBQA 2ZPYA 2FUHB 3DQNA 4W6DA 1UGMA 3W1YA 4R6BA 3QIJA 2KNBA 3SVBA 4HQ9A 3SD5A 3DQ1A 3RULA 5HGEA 4TQ0A 1GG3A 4JGEA 2C9IA 3C0RB 2YDZA 4B30A 4B9KA 4W7RA 3HIZA 2MBHA 3IVFA 4W9JA 1A5RA 3U7DA 3L10B 2O2VA 3KUZA 1RRXA 2O2VB 1YJ1A 4K7SA 1UISA 3W1DA 2QLEA 2VVIA 2VAEA 3DQHA 4OJ0A 2MWSB 3K9OB 3O77A 5KHOA 2LVPA 2ZMWA 2GBJA 1E8ZA 1UZXB 1WF9A 1YIWA 2LXCA 4DWFA 4NAWB 3VXWA 1XT9B 3DBHI 3ZUJA 2NBUA 3KCSA 3CD1A 3SSVA 3M95A 5DTXA 2G6XA 2NS5A 3DQAA 4W9KA 3DVNV 3A4RA 3AXCA 4DBGA 2A52B 1IYFA 4LJCA 3CF6E 3LA1A 2EMSA 2CHXA 2JF5A 4WJNA 3H6NA 4ZF3A 2A4ZA 4N3DA 3S05A 3VHTA 2N4FA 2DYBA 4W9HA 4IWOA 3RYTA 4W6FA 1WXSA 1UBIA 3SVDA 4W6UA 3H9DA 3VTWA 3SRYA 4J89A 1BFPA 3VUYA 4E74A 3SSTA 4IK8A 2KVRA 3QA8A 2KHWB 2JPHA 4KSLC 1GNUA 5AZHA 1P3QU 3T9LA 4PYZA 5JHBA 4DXPA 4OY4A 5CTRC 2G6YA 1I42A 3SVNA 2QT2A 3PIBA 2I1JA 2LUEA 2IOVA 1WR1A 4BKTA 2ZPNA 1RM9A 2IYDB 4K7WA 5HW9A 2ZO6A 3DQ2A 2P4MA 3PGEA 1GJZA 5HKHA 4HPLB 2LJ5A 2PXSA 4E3CA 4JLCA 4DHJD 3ZDTA 1T0YA 3ST2A 4DXMA 3LVDA 5HZOA 4Q9XA 4ZF5A 4JQWC 3X23A 2Z6YA 3EKHA 2WIQA 2HFCA 4NPNA 1H6RA 5KTGA 1XAEA 5EXUA 4EZKA 1WMHB 4NNJB 2AH8A 5L95C 3VK1A 3PREA 4KGEA 3DQKA 2EMNA 3NY5A 4KDLB 2KC1A 2ZCBA 3UF8A 1WXMA 3NEZA 2HQZA 2FL1A 2PXWA 5JH5C 3K9PB 2AL6A 1XA9A 4AJWA 4AR7A 2ZNVC 1YD8U 4XX5A 3DPDA 2DAJA 4GOCA 4II3B 2HE7A 3B08A 3U0NA 2PJHA 3SVRA 3DQJA 4H3MA 4EEWA 2MW5A 3DQ3A 1EMCA 5FVFA 4YL8A 1LXDA 1WX9A 3EVRA 4KEXA 4ZFSA 4ANVA 5C1ZA 3PSEB 3UFZA 3M22A 1XSSA 2IZVB 1WH3A 1WRDB 4J6IA 2G6EA 2O6VA 1EF1A 3GJ1A 3SSKA 3ZULA 1P1AA 1WXVA 4IZNA 2KN5A 2R2QA 4HQCA 2H5RA 5E6PA 2R2OA 5LTRA 2WHSA 4HLEA 5DU0A 4FHJA 3DQLA 4PS8A 2A5UA 1UH6A 4PPLA 2WX1A 1WZ0A 4MJSB 1TBEA 1Q0WB 2JZ3B 3DBRI 2AWKA 4F1SA 1Q5WB 2Z6XA 5DTYA 4KW4A 3OJ4B 4Z4KA 4H48A 2G4DB 3IFWB 3MJWA 3DQUA 2LWPA 4IG7B 2OGRA 4ANWA 4IM2A 2AHAA 1RMOA 2BPSA 1W7UA 3PTFC 4AS8A 2PPHA 4ICUA 4DKNA 2KQSA 2N1VA 2MX2A 4H3LA 3NS8A 1ZGOA 4NQLB 4II2B 2KO3A 4GDLB 1WYWB 1EMAA 2ASQA 5T3IA 2M0XA 3APCA 3ZNHB 1V49A 3DPWA 2LGXA 1IP9A 3P28A 1B9CA 4CYEA 5DPGA 1WGYA 1SE9A 3VTUA 2QRFA 1JC0A 4W6BA 3SVSA 1ISNA 4XOVA 1E8WA 1WGDA 3ML8A 2DUGA 5GMVA 3LF3A 4ZB1A 4AJYB 2VVHA 2IBIB 3IR8A 2L3ZA 5J17A 4IK1A 4KV2A 4LDTD 1WJUA 4RYSA 3SG6A 2IO1B 4W6PA 3ZTCA 3NT3A 1WE7A 4KVGB 2BKFA 3DVGY 3QK0A 3WAOA 2WX0A 3DBSA 2EMOA 5DTZA 4JFGA 2V4EA 2O2BA 1ZGPA 2M1MA 4KZCA 5DPHA 1V9JA 3LSAA 4W6NA 2K8BA 3GZNI 3B0AA 4W72A 1WJNA 1WM2A 3H7PB 1KJTA 4JIOU 3V3DA 4GB9A 5C23A 2HGDA 4DHJB 1V5OA 4DHZB 4ZF4A 5DQMA 4WJQA 4E71A 2FIDA 3JSVA 4EMQA 2D11A 3V6EB 3EK4A 4GMVA 3T8MA 3EVUA 4W73A 2YE0A 2D2QA 3DQ4A 1W7SA 4HCNB 4I6NB 1E7VA 2V4EC 1WXAA 3U30A 1NI2A 3QWZB 1JRUA 2VZXA 2C7NB 1WGGA 3ZNGC 3DOWA 2AWTA 2J0MA 3PLUA 2XK5A 2ICRA 5BTTA 2OTEA 3Q3FA 2KJ6A 1Q73A 2LRWA 3SG5A 2DD7A 3JYUA 2AWLA 3CFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UG0 A;  2PE6 B;  4MM3 A;  3V61 A;  1WM3 A;  1RMP A;  4ZIN A;  2GBM A;  2IY1 B;  4FN2 A;  3IHP C;  4W6A A;  3SVC A;  3KCT A;  1WZ3 A;  3QAQ A;  5JZE B;  3PHX B;  3N3K B;  2WHU A;  2LAS A;  3H1U A;  1MYW A;  3DCG A;  1L2N A;  3L54 A;  4EDO A;  4W7C A;  2DUF A;  4TZG A;  2D07 B;  4GDL A;  2DYO A;  2NPT B;  2DHZ A;  1GC6 A;  5EJU A;  3TBL D;  3U8Z A;  2N1W A;  1EME A;  4AP4 C;  1Q1O A;  4MDK E;  2ZNV B;  4MGI E;  5FHV A;  4MGZ E;  4W6C A;  3AU4 A;  3ZDM C;  2I1K A;  1U4A A;  2CR5 A;  1QYO A;  2A54 B;  5DRF A;  3GB3 A;  2BYV E;  1KM7 A;  1EMM A;  3DQV A;  5CHW A;  5D6J B;  3OSQ A;  3DQ9 A;  2N9E B;  2QLG A;  4XC2 A;  4GU2 A;  5BO4 B;  1P9D U;  4CHK A;  1E8Y A;  3HM3 A;  2DEN B;  4ZDV A;  3O78 A;  1YHH A;  3DQO A;  3RWT A;  4FJV B;  3ZKJ C;  2M4N A;  3EVV A;  4DK5 A;  1WI0 A;  3H7P A;  1W7T A;  3A9K A;  5LTP A;  3AI5 A;  2KZR A;  4BDU A;  2FCN A;  5DPS A;  3WAM A;  3DQ6 A;  4GDK B;  2DZK A;  3SG2 A;  2DD9 A;  3DQ5 A;  2QU1 A;  3OGO A;  2CU1 A;  4IK4 A;  3ZVV A;  4WJP A;  3BXB A;  2NR2 A;  5DY6 A;  3MHS D;  2MLB A;  4H3N A;  2CS4 A;  3EHV A;  4EUT A;  4W7F A;  3ZIM A;  2N7D A;  2YVC A;  2J0J A;  2L00 B;  2WUR A;  2N9P C;  2KFK A;  4LJB A;  3BX9 A;  1Q4E A;  3LVC A;  2FCQ A;  2IO0 B;  2KQ7 A;  4A3O A;  4G0N B;  2KD0 A;  3RZF A;  2IY0 B;  4AUQ C;  3ZNI D;  1KYS A;  2OOB B;  4TUU A;  4LJD A;  2FCS A;  4A3P A;  5D7G A;  3GJ2 A;  3OLM D;  2POX A;  2Z1O A;  3A9J B;  4I2Y A;  3ECI A;  5AQB B;  1KP5 A;  3M24 A;  1QY3 A;  4K7U A;  2K39 A;  5DPJ A;  4BFR A;  2KWC A;  3EVP A;  3VAW A;  2OTB A;  3CB9 A;  2G5Z B;  2J7Q B;  5HZT A;  2C7H A;  1HCJ A;  5DRG A;  1H4R A;  3DQE A;  1V2Y A;  2L0T A;  4GF6 B;  3QAR A;  4BKS A;  4ANU A;  1EUV B;  3TMR A;  3CSF A;  3HHM A;  1ZW7 A;  4K81 A;  1MOU A;  1RMM A;  3UQA A;  2K6Q A;  4LJD C;  3U8C A;  5CX3 A;  2H8Q A;  1Z2M A;  2K6D B;  4W75 A;  1KOT A;  4FA6 A;  3DQM A;  3QQ8 B;  2WYQ A;  2H5Q A;  5EB7 A;  2ARL A;  5EBJ A;  3W1S A;  2B3Q A;  2DDC A;  2KAN A;  4XL5 A;  3V60 A;  3OAW A;  1S3S G;  4HK2 A;  3ZUF A;  4EOY A;  1YHI A;  4N9F 4;  3DVN U;  3UIO B;  3CST A;  3H1R A;  1CV7 A;  4OHS A;  3QJZ A;  4EDS A;  5D94 A;  2REX A;  4BOS C;  1CMX B;  2GW3 A;  4IWQ A;  3KW5 B;  1OGW A;  4HWI B;  2JAD A;  3R7Q A;  2KDE B;  3WCK A;  5BT0 A;  3MGF A;  3HM6 X;  4EZL A;  4XVP A;  2KJR A;  1FXT B;  2C9J A;  2AWJ A;  2LVO A;  2HJ8 A;  4W9D A;  5FVI A;  3VQI A;  4JF9 A;  4FJZ A;  3BXC A;  5TR5 A;  4MEL A;  2DAF A;  2L76 A;  4W6T A;  2Q57 A;  3BXA A;  4IW0 A;  4RYW A;  3SSL A;  4EZJ A;  5AZF A;  3APF A;  3PRP B;  5E6O A;  3VH4 B;  3B1L X;  4DXQ A;  3CFF A;  1M94 A;  4GOB A;  4HDO A;  3TJP A;  1RAX A;  1YX6 B;  2NCN A;  4JEO A;  4JC2 A;  2ZZP B;  4HXD A;  3SDL C;  2K25 A;  3U0M A;  5EXB A;  1EML A;  1SGH A;  1WGR A;  1ZUX A;  1EO6 A;  3TL5 A;  3UQB A;  3IBE A;  5LK4 A;  4RM8 A;  2DZJ A;  2KK8 A;  3AKO A;  2ZEQ A;  3ZUN A;  2G3Q B;  4OVU A;  5DPI A;  3ML9 A;  5DQB A;  3VIC A;  5FVG A;  4W6O A;  2MSE D;  3LJ3 A;  1WX7 A;  4MEM A;  3PVL A;  3RWA A;  2GMI C;  4JGH B;  4W9E A;  1KLV A;  1XQM A;  3PRZ A;  1YJ2 A;  2G16 B;  2KX3 A;  1ZGU B;  2JWZ A;  2Z6Z A;  1LM8 B;  5HZU A;  3S2A A;  2RH7 A;  2KFJ A;  3DPZ A;  5LTQ A;  1YHG A;  3PHW B;  4TKN A;  2ZCC A;  3ST0 A;  3LF4 B;  2WIS A;  3W1C A;  2ZMU A;  2CHW A;  1C1Y B;  4WAA A;  4IM3 A;  2G45 B;  3ALB A;  4PYU A;  3ONS A;  1F09 A;  1K8R B;  3RUI B;  1F9J A;  2L7R A;  2Q6P A;  3SVO A;  4W6L A;  1RFA A;  4XGY A;  3VHT B;  2MBQ A;  4HCP B;  4ASW C;  1EF5 A;  4B95 A;  4R6D A;  4Q7R A;  2UYZ B;  2WDT B;  3E5W A;  4GDK A;  1XD3 B;  2A50 B;  3ENE A;  2N7E A;  2ZVO A;  1UD7 A;  2NVU I;  3WAL A;  4TQ1 A;  3EFU A;  2D3G A;  1YFP A;  3OSR A;  1GL4 A;  3DQD A;  3QX1 A;  4X57 B;  2AL3 A;  3AUL A;  1E5W A;  2D10 A;  3EK7 A;  4IK5 A;  2KTR B;  2G2S B;  4W76 A;  2W9N A;  1OEY J;  1JC1 A;  2FZU A;  3PJB A;  1WGH A;  3UIP B;  4U2V A;  2BYF A;  3ZNZ B;  2L0F A;  1WR6 E;  4MSM B;  1Q4B A;  3U8P A;  1S1Q B;  5DPT A;  4K1R B;  3PV1 A;  2QLH A;  3RD2 A;  4A20 A;  2IB5 A;  4KF4 A;  4Q7U A;  5DPR A;  2OJR A;  2DUE A;  3CMM B;  2C60 A;  3KUD B;  4FBJ B;  4BKS D;  3HK0 A;  1G7K A;  1P98 A;  2ZO7 A;  4ZRJ A;  4L1I A;  3WAP A;  4PPK A;  3CGL A;  3L16 A;  1YZW A;  4GN1 A;  1J8C A;  2G4S A;  1XMZ A;  3DDC B;  3VUW A;  3VHT C;  4F7Z A;  3L0W B;  2MQJ A;  2UWQ A;  4DKM A;  2PEA A;  2IB6 A;  2MRP A;  2MP2 A;  2WWZ A;  2YE1 A;  1R4M I;  2GBR A;  4AWJ A;  3SG7 A;  2N9X A;  3PLV A;  2BWF A;  3R7R A;  3PRM B;  4I6P A;  1KYP A;  2HCG A;  3A33 B;  1EMB A;  2XK5 B;  4WWO A;  2KFK B;  1NBF C;  2A47 A;  2JUO A;  3EC8 A;  4I6L B;  4DXO A;  4KA9 A;  1F0B A;  2LZ6 A;  2M8S A;  4F8C B;  4IC7 B;  3VVW B;  2AWM A;  1BT0 A;  2JY6 A;  2MBO A;  3A1Q A;  3M63 B;  3QHT A;  4W77 A;  4DDG D;  4G11 A;  4PS7 A;  3A8S A;  4IK3 A;  2QLI A;  4W9L A;  4EKU A;  3K1K A;  1MG8 A;  1C4F A;  5BQL A;  3TCA A;  3M62 B;  4LJP B;  1NDD A;  4W9F A;  3NZU A;  4W6J A;  2EMD A;  3P2B A;  2VVJ A;  5J18 A;  2A53 B;  4WWP A;  3CD9 A;  4FLH A;  4MGY E;  3VDZ A;  3ZTD A;  1WJ4 A;  1RLF A;  2QLG B;  3NED A;  2RSU A;  2V4E B;  3GEX A;  2RD0 A;  3A4S C;  2RR9 A;  2KJH B;  5AZG A;  3PPA A;  3QCA A;  3P8U A;  1Z1Q A;  3ST3 A;  1QXT A;  1YQB A;  4KZ0 A;  5JHA A;  4M8M A;  4BKG A;  2HRS A;  3ZTF A;  1J0G A;  3PS6 A;  3PJ5 A;  3G9A A;  4LDT B;  2KWV B;  4WQO B;  2C9W B;  2NPT A;  2O29 A;  1GUA B;  1VD2 A;  3SHQ A;  2Z0E B;  4KAG A;  1GFL A;  4GES B;  2FAZ A;  2OKY A;  3DQF A;  4FHK A;  3KH0 A;  2FWQ A;  4HPM B;  3NT9 A;  3I3T B;  2H6V A;  1EMF A;  4EUL A;  2BYE A;  3V62 A;  5HZS A;  1Z5S B;  4W6I A;  2WSN A;  3A9K B;  3UIN B;  2DYM A;  3WLD A;  4L13 A;  4P76 A;  4W9G A;  4RMA A;  4JL9 A;  1JBY A;  1ZGQ A;  4OQW A;  2GBK A;  2VAD A;  2KLG A;  3LDZ E;  3BY4 B;  3DQC A;  2XBB C;  2LGD A;  1Q4D A;  4KW9 A;  3WAN A;  2B3P A;  4FAD A;  3R66 C;  2A46 A;  2KX0 A;  5F9G A;  5IA7 A;  2DDD A;  4ZYN A;  3KYD D;  1LFD A;  4W7A A;  3SS0 A;  2FIF A;  2Y0G A;  5LLI A;  3VUX A;  4W6K A;  1L7Y A;  4H47 A;  1JBZ A;  1OQY A;  2V3S A;  2EMT A;  4W6M A;  4Z4M A;  4HVF A;  2OKW A;  1V6E A;  3N30 A;  4ICV A;  3IG3 A;  2HQK A;  4PPJ A;  2DZI A;  3DPX A;  1HE8 A;  3VTV A;  1I35 A;  2HTH A;  4M8N A;  1AAR A;  5FR6 A;  4URK A;  1R4N I;  4KF5 C;  2KWU B;  2PE9 A;  3PT2 B;  4ZIO A;  1G6J A;  5DCN A;  3L17 A;  2LRU A;  5AEK B;  3JVZ X;  3A9J A;  4P1Q A;  1TGZ B;  2ZJD A;  3DVG X;  2BTJ A;  3DQI A;  4WJO A;  2BF8 B;  4Q9W A;  3WIM A;  5BTT B;  4BVU C;  3R3M A;  2L05 A;  5HBD A;  3VFK A;  4ANJ A;  4J88 A;  4BBN F;  3NZS A;  1RRB A;  2MBE A;  2JZZ A;  2LD9 A;  2JT4 B;  3AU5 A;  5CHF A;  1Y8R C;  1KYR A;  4HVB A;  1WJ6 A;  1QYQ A;  2K1F A;  3U8A A;  1S6Z A;  1OEY A;  2KDF B;  3DBL I;  2VRR B;  3NOB A;  2XEW A;  3ZLZ A;  1EMK A;  4HDQ A;  2JXX A;  2NBV B;  2GW4 B;  2JRH A;  3ZRC A;  2LXA A;  3SV5 A;  2KTF A;  3MTN B;  2C7M B;  2KLC A;  4XZ4 A;  3EEC A;  5EDS A;  4W69 A;  5KHQ A;  4W6G A;  4DXA B;  2Z0D B;  4W74 A;  1V5T A;  2EKE C;  1PQS A;  3RT3 B;  2A48 A;  4OGS A;  4KDI C;  2GOW A;  3H7S A;  4LCD E;  1TZ1 A;  1MOV A;  2KMA A;  2QZ0 A;  1X1M A;  2LVQ A;  3DQ8 A;  2DZM A;  3AI4 A;  4GSW A;  3SSY A;  3Q3J A;  4HE4 A;  5H88 A;  3EK8 A;  4JRB A;  5J2R A;  3TMT A;  2H5P A;  5H89 A;  3ZRF A;  1QYF A;  5J2O A;  5D2M B;  3KYC D;  3CFA A;  2GBN A;  5EXC I;  4ZRI A;  4UTS A;  4FJY A;  4KPI A;  1Q4A A;  4W7D A;  3SG4 A;  4M0W B;  2JRI B;  2H5O A;  1UEL A;  2MP2 B;  5L83 A;  4LJO B;  4KSK C;  3SVU A;  2A56 B;  4NJ7 A;  3EKJ A;  4MH0 E;  1Z1P A;  4W6R A;  4GXB A;  3O65 B;  1IPG A;  4TV3 A;  2CKH B;  4G50 A;  4G3X B;  4MSQ B;  2YLM A;  4NAW A;  4KF5 A;  4EN1 A;  2GX0 A;  2QHO A;  5DPW A;  3RCZ A;  2B3A A;  1WX8 A;  1EMG A;  3SVE A;  1YX5 B;  4DXN A;  4EFO A;  2G3D B;  3NF0 A;  1J19 A;  4HJK A;  2FNJ B;  2K8C A;  5DTL A;  3WLC A;  1P0R A;  3PZD A;  4B5Y A;  3JW0 X;  2KDB A;  5IAA C;  1E8X A;  3E5V A;  3RZW C;  2RPQ A;  4IK9 A;  4J8A A;  5EB6 A;  2Z59 B;  3GOE A;  3TMP B;  1WY8 A;  3JSV B;  2KTR A;  2WHT A;  2BWE S;  3D32 A;  3V6C B;  4W7E A;  2K8H A;  4W6H A;  3NHE B;  4P7I A;  2O24 A;  3W1S C;  3U0L A;  3OJ3 A;  3PJ7 A;  5LXH A;  1GGX A;  5H87 A;  1ZKH A;  4KIK A;  3DQ7 A;  2FCM A;  4W6S A;  2KDI A;  2MA9 B;  4W9C A;  1OTR B;  4GIV A;  1C3T A;  4IUM B;  1V81 A;  4L12 A;  4KW8 A;  3E5T A;  5LXI B;  4HQ8 A;  4PFE A;  5CHV C;  2YFP A;  4IWP A;  1OXE A;  1OXD A;  1V80 A;  4XOW A;  4LQT A;  4WWN A;  3SG3 A;  2HPW A;  3CBE A;  3SSH A;  2AEH A;  4NY0 A;  3I19 A;  2IE2 A;  2BGF A;  3BIN A;  4DXI A;  4MGK E;  4AOF A;  3GL4 A;  4DHZ E;  2KMC A;  4NJ6 A;  1WFY A;  4IM0 A;  1Q4C A;  3WA0 A;  2Y5B B;  2HJO A;  3KVF B;  4FUL A;  3VH3 B;  2MCN B;  1WE6 A;  3ED8 A;  1WMH A;  2HGY A;  3ADF A;  4W7X A;  4LQU A;  1TTN A;  4OVV A;  2IO2 B;  3X0W A;  4KGF A;  1SIF A;  1YJF A;  1LQB A;  3QC8 B;  2L8J A;  1VCB A;  4GGQ A;  4CO7 A;  2V4L A;  3U0K A;  1E90 A;  3APD A;  2HD5 B;  2LI5 A;  2CHZ A;  5E6N A;  1H8C A;  2DX5 B;  4LW5 A;  2IO3 B;  2DUH A;  3LS3 A;  4ZRK A;  1WIA A;  2JVC A;  2KKC A;  5G55 A;  1V86 A;  3ST4 A;  3N32 A;  3L13 A;  4NQK E;  5EHU A;  1OXF A;  3A1Q B;  1GC7 A;  2LGY A;  2OJK A;  4Q7T A;  4PS3 A;  3L08 A;  4RM9 A;  2J0K A;  2DUI A;  5G2N A;  1QZE A;  2KC2 A;  4W9I A;  2V1Y A;  4B6W A;  2AYO B;  1XQQ A;  4ORN A;  2M17 A;  2GX2 A;  3LVA A;  3IP2 A;  4MJS A;  2WSO A;  4B30 B;  3ZO5 B;  2KXJ A;  3TIX A;  2O6V D;  3ZW3 A;  4ANX A;  3H1O A;  4BOZ B;  4ZBL A;  2NBW B;  2MBB B;  3SU8 X;  2BKR B;  1D3Z A;  1H4U A;  4BBN C;  4TZA A;  3KUC B;  2ZVN A;  2O6V B;  2G3O A;  2RGF A;  4RTC A;  3UGB B;  2H9W A;  3SSP A;  1HUY A;  4DDI D;  2KOX A;  3M3J A;  1E7U A;  2C5L C;  4KIK B;  4NWS A;  1UBQ A;  2ZPY A;  2FUH B;  3DQN A;  4W6D A;  1UGM A;  3W1Y A;  4R6B A;  3QIJ A;  2KNB A;  3SVB A;  4HQ9 A;  3SD5 A;  3DQ1 A;  3RUL A;  5HGE A;  4TQ0 A;  1GG3 A;  4JGE A;  2C9I A;  3C0R B;  2YDZ A;  4B30 A;  4B9K A;  4W7R A;  3HIZ A;  2MBH A;  3IVF A;  4W9J A;  1A5R A;  3U7D A;  3L10 B;  2O2V A;  3KUZ A;  1RRX A;  2O2V B;  1YJ1 A;  4K7S A;  1UIS A;  3W1D A;  2QLE A;  2VVI A;  2VAE A;  3DQH A;  4OJ0 A;  2MWS B;  3K9O B;  3O77 A;  5KHO A;  2LVP A;  2ZMW A;  2GBJ A;  1E8Z A;  1UZX B;  1WF9 A;  1YIW A;  2LXC A;  4DWF A;  4NAW B;  3VXW A;  1XT9 B;  3DBH I;  3ZUJ A;  2NBU A;  3KCS A;  3CD1 A;  3SSV A;  3M95 A;  5DTX A;  2G6X A;  2NS5 A;  3DQA A;  4W9K A;  3DVN V;  3A4R A;  3AXC A;  4DBG A;  2A52 B;  1IYF A;  4LJC A;  3CF6 E;  3LA1 A;  2EMS A;  2CHX A;  2JF5 A;  4WJN A;  3H6N A;  4ZF3 A;  2A4Z A;  4N3D A;  3S05 A;  3VHT A;  2N4F A;  2DYB A;  4W9H A;  4IWO A;  3RYT A;  4W6F A;  1WXS A;  1UBI A;  3SVD A;  4W6U A;  3H9D A;  3VTW A;  3SRY A;  4J89 A;  1BFP A;  3VUY A;  4E74 A;  3SST A;  4IK8 A;  2KVR A;  3QA8 A;  2KHW B;  2JPH A;  4KSL C;  1GNU A;  5AZH A;  1P3Q U;  3T9L A;  4PYZ A;  5JHB A;  4DXP A;  4OY4 A;  5CTR C;  2G6Y A;  1I42 A;  3SVN A;  2QT2 A;  3PIB A;  2I1J A;  2LUE A;  2IOV A;  1WR1 A;  4BKT A;  2ZPN A;  1RM9 A;  2IYD B;  4K7W A;  5HW9 A;  2ZO6 A;  3DQ2 A;  2P4M A;  3PGE A;  1GJZ A;  5HKH A;  4HPL B;  2LJ5 A;  2PXS A;  4E3C A;  4JLC A;  4DHJ D;  3ZDT A;  1T0Y A;  3ST2 A;  4DXM A;  3LVD A;  5HZO A;  4Q9X A;  4ZF5 A;  4JQW C;  3X23 A;  2Z6Y A;  3EKH A;  2WIQ A;  2HFC A;  4NPN A;  1H6R A;  5KTG A;  1XAE A;  5EXU A;  4EZK A;  1WMH B;  4NNJ B;  2AH8 A;  5L95 C;  3VK1 A;  3PRE A;  4KGE A;  3DQK A;  2EMN A;  3NY5 A;  4KDL B;  2KC1 A;  2ZCB A;  3UF8 A;  1WXM A;  3NEZ A;  2HQZ A;  2FL1 A;  2PXW A;  5JH5 C;  3K9P B;  2AL6 A;  1XA9 A;  4AJW A;  4AR7 A;  2ZNV C;  1YD8 U;  4XX5 A;  3DPD A;  2DAJ A;  4GOC A;  4II3 B;  2HE7 A;  3B08 A;  3U0N A;  2PJH A;  3SVR A;  3DQJ A;  4H3M A;  4EEW A;  2MW5 A;  3DQ3 A;  1EMC A;  5FVF A;  4YL8 A;  1LXD A;  1WX9 A;  3EVR A;  4KEX A;  4ZFS A;  4ANV A;  5C1Z A;  3PSE B;  3UFZ A;  3M22 A;  1XSS A;  2IZV B;  1WH3 A;  1WRD B;  4J6I A;  2G6E A;  2O6V A;  1EF1 A;  3GJ1 A;  3SSK A;  3ZUL A;  1P1A A;  1WXV A;  4IZN A;  2KN5 A;  2R2Q A;  4HQC A;  2H5R A;  5E6P A;  2R2O A;  5LTR A;  2WHS A;  4HLE A;  5DU0 A;  4FHJ A;  3DQL A;  4PS8 A;  2A5U A;  1UH6 A;  4PPL A;  2WX1 A;  1WZ0 A;  4MJS B;  1TBE A;  1Q0W B;  2JZ3 B;  3DBR I;  2AWK A;  4F1S A;  1Q5W B;  2Z6X A;  5DTY A;  4KW4 A;  3OJ4 B;  4Z4K A;  4H48 A;  2G4D B;  3IFW B;  3MJW A;  3DQU A;  2LWP A;  4IG7 B;  2OGR A;  4ANW A;  4IM2 A;  2AHA A;  1RMO A;  2BPS A;  1W7U A;  3PTF C;  4AS8 A;  2PPH A;  4ICU A;  4DKN A;  2KQS A;  2N1V A;  2MX2 A;  4H3L A;  3NS8 A;  1ZGO A;  4NQL B;  4II2 B;  2KO3 A;  4GDL B;  1WYW B;  1EMA A;  2ASQ A;  5T3I A;  2M0X A;  3APC A;  3ZNH B;  1V49 A;  3DPW A;  2LGX A;  1IP9 A;  3P28 A;  1B9C A;  4CYE A;  5DPG A;  1WGY A;  1SE9 A;  3VTU A;  2QRF A;  1JC0 A;  4W6B A;  3SVS A;  1ISN A;  4XOV A;  1E8W A;  1WGD A;  3ML8 A;  2DUG A;  5GMV A;  3LF3 A;  4ZB1 A;  4AJY B;  2VVH A;  2IBI B;  3IR8 A;  2L3Z A;  5J17 A;  4IK1 A;  4KV2 A;  4LDT D;  1WJU A;  4RYS A;  3SG6 A;  2IO1 B;  4W6P A;  3ZTC A;  3NT3 A;  1WE7 A;  4KVG B;  2BKF A;  3DVG Y;  3QK0 A;  3WAO A;  2WX0 A;  3DBS A;  2EMO A;  5DTZ A;  4JFG A;  2V4E A;  2O2B A;  1ZGP A;  2M1M A;  4KZC A;  5DPH A;  1V9J A;  3LSA A;  4W6N A;  2K8B A;  3GZN I;  3B0A A;  4W72 A;  1WJN A;  1WM2 A;  3H7P B;  1KJT A;  4JIO U;  3V3D A;  4GB9 A;  5C23 A;  2HGD A;  4DHJ B;  1V5O A;  4DHZ B;  4ZF4 A;  5DQM A;  4WJQ A;  4E71 A;  2FID A;  3JSV A;  4EMQ A;  2D11 A;  3V6E B;  3EK4 A;  4GMV A;  3T8M A;  3EVU A;  4W73 A;  2YE0 A;  2D2Q A;  3DQ4 A;  1W7S A;  4HCN B;  4I6N B;  1E7V A;  2V4E C;  1WXA A;  3U30 A;  1NI2 A;  3QWZ B;  1JRU A;  2VZX A;  2C7N B;  1WGG A;  3ZNG C;  3DOW A;  2AWT A;  2J0M A;  3PLU A;  2XK5 A;  2ICR A;  5BTT A;  2OTE A;  3Q3F A;  2KJ6 A;  1Q73 A;  2LRW A;  3SG5 A;  2DD7 A;  3JYU A;  2AWL A;  3CFH A; 
#chains in the Genus database with same CATH topology
 3UG0 A;  2PE6 B;  4MM3 A;  3V61 A;  1WM3 A;  4NZL B;  1RMP A;  4ZIN A;  2QMT A;  2GBM A;  2IY1 B;  3Q2A C;  4WH4 A;  4FN2 A;  3IHP C;  3E9S A;  4W6A A;  3SVC A;  4D2K A;  3KCT A;  2TSS A;  1WZ3 A;  1XXG A;  3QAQ A;  2JXT A;  1AN8 A;  5JZE B;  3PHX B;  4RH6 A;  3N3K B;  4LNF A;  2WHU A;  2LAS A;  3H1U A;  1MYW A;  3DCG A;  1L2N A;  2GI9 A;  3L54 A;  1Y56 A;  4J3O D;  4EDO A;  1C4C A;  4W7C A;  2DUF A;  4TZG A;  2D07 B;  2AQ2 B;  1PGX A;  1ZOY B;  3ABV B;  4M0W A;  4GDL A;  1TJE A;  2DYO A;  2NPT B;  3ZXR A;  2DHZ A;  3TUO A;  4B0M A;  1GC6 A;  5EJU A;  3ZJU A;  3TBL D;  3U8Z A;  2N1W A;  1EME A;  4AP4 C;  1Q1O A;  4MDK E;  3R2T A;  2ZNV B;  4MGI E;  5FHV A;  4A55 A;  4MGZ E;  4W6C A;  1P7E A;  3AU4 A;  3ZDM C;  1Q10 A;  2KYW A;  2I1K A;  1MI0 A;  1U4A A;  1SE4 A;  3PZ7 A;  2CR5 A;  1QYO A;  2WU5 B;  2A54 B;  1J7C A;  1YJI A;  5DRF A;  3GB3 A;  1K51 A;  2BYV E;  1KM7 A;  1EMM A;  3DQV A;  4XE0 A;  5CHW A;  5D6J B;  3OSQ A;  3DQ9 A;  2N9E B;  2QLG A;  2MEK A;  4GU2 A;  4XC2 A;  1P9D U;  5BO4 B;  1MG4 A;  2PTL A;  4CHK A;  1E8Y A;  3HM3 A;  2DEN B;  4ZDV A;  3O78 A;  1XCQ L;  1YHH A;  3DQO A;  3RWT A;  4FJV B;  3VR9 B;  3ZKJ C;  2M4N A;  3EVV A;  4DK5 A;  1WI0 A;  3H7P A;  4LNO A;  3L4P A;  1W7T A;  1ROE A;  1FPY A;  4DQO C;  2BBC A;  3A9K A;  3Q8C A;  1CK1 A;  5LTP A;  1SEB D;  3AI5 A;  2KZR A;  4BDU A;  2FCN A;  1QIL A;  5DPS A;  3Q14 C;  2QDF A;  3WAM A;  3DQ6 A;  4GDK B;  2DZK A;  1RFK A;  3SG2 A;  2DD9 A;  4YT0 B;  3DQ5 A;  1QOA A;  2EKI A;  2QU1 A;  3OGO A;  1TS4 A;  2CU1 A;  1T6B X;  1SXT A;  4IK4 A;  1F77 A;  2BB6 A;  2BB5 A;  2WU2 B;  3ZVV A;  4WJP A;  3BXB A;  2NR2 A;  5DY6 A;  3MHS D;  2MLB A;  4H3N A;  2CS4 A;  3EHV A;  2UU7 A;  4EUT A;  3P1M A;  4W7F A;  4A6Q A;  3ZIM A;  2N7D A;  2YVC A;  3T3N A;  2J0J A;  2YEP B;  2L00 B;  1HTQ A;  1FXI A;  2WUR A;  2N9P C;  2KFK A;  4LJB A;  3BX9 A;  1Q4E A;  3LVC A;  4A90 A;  2FCQ A;  2IO0 B;  2KQ7 A;  4A3O A;  3Q6B A;  4G0N B;  2KD0 A;  3RZF A;  2IY0 B;  4LNK A;  4AUQ C;  3ZNI D;  1KYS A;  2OOB B;  4TUU A;  3TEZ A;  4LJD A;  2FCS A;  4A3P A;  5D7G A;  1YOV B;  3GJ2 A;  3OLM D;  2POX A;  1JWM D;  4ITK A;  3AMZ A;  2BW2 A;  3ZJT A;  2Z1O A;  3A9J B;  4I2Y A;  3ECI A;  5AQB B;  1KP5 A;  3M24 A;  1QY3 A;  4K7U A;  4K3B A;  2K39 A;  5DPJ A;  4BFR A;  2KWC A;  3EVP A;  3AE2 B;  3VAW A;  2OTB A;  3CB9 A;  2G5Z B;  2J7Q B;  5HZT A;  2C7H A;  1HCJ A;  5DRG A;  1H4R A;  2AX5 A;  3DQE A;  1V2Y A;  4ZOH C;  2L0T A;  4GF6 B;  3QAR A;  4BKS A;  4ANU A;  1STE A;  1EUV B;  2Q5W D;  3TMR A;  2YEP F;  3CSF A;  1ZW7 A;  3HHM A;  1MOU A;  4K81 A;  2SAK A;  1RMM A;  3UQA A;  2K6Q A;  4LJD C;  2PVG C;  3U8C A;  5CX3 A;  3SFD B;  4B0E A;  2H8Q A;  3Q3O C;  1Z2M A;  1SB3 C;  2K6D B;  1TY2 A;  4W75 A;  1KOT A;  4FA6 A;  3DQM A;  4M01 A;  4MH8 A;  3QQ8 B;  2WYQ A;  1FMA D;  1DOX A;  2H5Q A;  2DLB A;  5EB7 A;  2ARL A;  5EBJ A;  3DBL B;  3W1S A;  2B3Q A;  2DDC A;  2KAN A;  4XL5 A;  3V60 A;  3OAW A;  1S3S G;  4HK2 A;  2RPV A;  3ZUF A;  2BVC A;  4EOY A;  3N20 C;  1YHI A;  4N9F 4;  3ZYY X;  3DVN U;  4XYC A;  1C77 A;  3CST A;  3O13 A;  3UIO B;  3H1R A;  1CV7 A;  4WQM A;  4OHS A;  3QJZ A;  4EDS A;  5D94 A;  2REX A;  4KGR A;  1VLB A;  4BOS C;  3SR6 A;  1CMX B;  1T5X D;  2GW3 A;  4YTN B;  4IWQ A;  3KW5 B;  1JWB D;  1OGW A;  4HWI B;  2JAD A;  3KQ4 A;  3DHH C;  3R7Q A;  5IKC M;  2KDE B;  1FCC C;  3GE3 C;  4LTU A;  1F1H A;  3WCK A;  5BT0 A;  2OJW A;  3MGF A;  3HM6 X;  1MFW A;  4EZL A;  4XVP A;  2KJR A;  1AYF A;  1FXT B;  2C9J A;  1J7A A;  2AWJ A;  2LVO A;  3MC0 B;  4LNN A;  1VZ8 A;  2HJ8 A;  4W9D A;  5FVI A;  1YMH E;  4XWW A;  3VQI A;  4JF9 A;  3Q8A A;  1WSP A;  4FJZ A;  1HEZ E;  3BXC A;  5TR5 A;  5C2T B;  1F2R C;  2WDQ B;  4MEL A;  2DAF A;  2L76 A;  4N58 A;  4W6T A;  3AE9 B;  4DXG A;  2Q57 A;  3BXA A;  4IW0 A;  4RYW A;  3SSL A;  4EZJ A;  5AZF A;  3APF A;  1KF6 B;  3PRP B;  5E6O A;  5TSS A;  3VH4 B;  3FKY A;  3B1L X;  4DXQ A;  2ZW0 A;  3MJ5 A;  3CFF A;  1M94 A;  4JX1 C;  4GOB A;  4HDO A;  3TJP A;  4YXD B;  5MPO A;  1RAX A;  1YX6 B;  2NCN A;  1YJJ A;  3MC9 A;  4JEO A;  4JC2 A;  2ZZP B;  2WNM A;  4HXD A;  2WXH A;  3SDL C;  2K25 A;  3U0M A;  5EXB A;  1EML A;  2B76 B;  1SGH A;  1WGR A;  1ZUX A;  4HRO A;  3U52 E;  1EO6 A;  2L52 A;  3EGR A;  2GRI A;  3TL5 A;  1PDX A;  3UQB A;  3IBE A;  1I7H A;  5LK4 A;  4RM8 A;  2DZJ A;  3P4R B;  2KK8 A;  3AKO A;  2ZEQ A;  3ZUN A;  2G3Q B;  4OVU A;  5DPI A;  3ML9 A;  2VH2 A;  5DQB A;  3VIC A;  5FVG A;  4W6O A;  2MSE D;  1ZXI A;  2L1A A;  3LJ3 A;  4KKI A;  1WX7 A;  4MEM A;  3PVL A;  3RWA A;  2GMI C;  4JGH B;  4W9E A;  1KLV A;  4C4V B;  1XQM A;  3NUH B;  3EFC A;  2FE8 A;  3PRZ A;  1YJ2 A;  2G16 B;  3RNF C;  2W55 A;  2KX3 A;  1ZGU B;  2JWZ A;  2Z6Z A;  1LM8 B;  5HZU A;  5G5G A;  3S2A A;  2BS2 B;  2RH7 A;  2KFJ A;  3BK2 A;  3DPZ A;  3TEW A;  1I4G A;  5LTQ A;  1YHG A;  3PHW B;  2V4I B;  1ZDX A;  3RMK C;  4TKN A;  2ZCC A;  2WDV B;  3ST0 A;  3LF4 B;  2WIS A;  3WCQ A;  3W1C A;  2ZMU A;  3VRB B;  2CHW A;  4NJC A;  1C1Y B;  1MHH E;  2N0S B;  4WAA A;  4H2A A;  4IM3 A;  1J7B A;  1XLN A;  2G45 B;  3ALB A;  4PYU A;  3ONS A;  2PLP A;  3GP7 A;  3ZXV A;  4US9 A;  1F09 A;  1K8R B;  3RUI B;  1F9J A;  2L7R A;  4RGM A;  2Q6P A;  2MJD A;  3SVO A;  4W6L A;  1QQR A;  1FO4 A;  1RFA A;  4XGY A;  3VHT B;  2V9H A;  2MBQ A;  4HCP B;  4ASW C;  1EF5 A;  4B95 A;  1F2R I;  5HI1 A;  1OFF A;  4R6D A;  4Q7R A;  2UYZ B;  2WDT B;  3E5W A;  4GDK A;  1XD3 B;  2A50 B;  3ENE A;  2N7E A;  5IO9 A;  2ZVO A;  1SE3 A;  1UD7 A;  2NVU I;  3WAL A;  4TQ1 A;  3EFU A;  2D3G A;  1I4Q A;  5E6J A;  1YFP A;  3OSR A;  1I4P A;  1GL4 A;  3DQD A;  1XEE A;  4L1B A;  3U4E G;  1TS5 A;  1E10 A;  3QX1 A;  3DWM A;  4X57 B;  2D3C A;  4AQ7 A;  2AL3 A;  5HFY A;  3AUL A;  1DOI A;  1E5W A;  2D10 A;  1XO3 A;  2K5P A;  2Y5P A;  3AEG B;  1SE2 A;  3EK7 A;  4M00 A;  4IK5 A;  4YSZ B;  4OZB A;  2KTR B;  2G2S B;  4W76 A;  3NVZ A;  2W9N A;  1OEY J;  1JC1 A;  3BVG A;  2FZU A;  3FIL B;  1NI3 A;  3PJB A;  3C19 A;  3H8H A;  1WGH A;  3UIP B;  4U2V A;  2BYF A;  3ZNZ B;  2L0F A;  1WR6 E;  4MSM B;  4TSS A;  4YSY B;  4WAF A;  1Q4B A;  3U8P A;  1S1Q B;  5DPT A;  4XWT A;  2MHJ A;  4K1R B;  1V1P B;  3PV1 A;  2QLH A;  2J42 A;  3AV8 A;  3RD2 A;  4A20 A;  2IB5 A;  4KF4 A;  4Q7U A;  5DPR A;  2OJR A;  4OW0 A;  2WS3 B;  2DUE A;  1CJE A;  1L6V A;  3CMM B;  2C60 A;  3KUD B;  1JW9 D;  4FBJ B;  3BVM A;  4BKS D;  3HK0 A;  1G7K A;  1P98 A;  2ZO7 A;  1JML A;  2OED A;  4ZRJ A;  4L1I A;  3WAP A;  4PPK A;  3CGL A;  3L16 A;  1YZW A;  4GN1 A;  2R61 A;  1J8C A;  2G4S A;  1R7S A;  1ET9 A;  1D6E C;  1TKE A;  1XMZ A;  3DDC B;  3VUW A;  1TS3 A;  2W54 A;  3VHT C;  4F7Z A;  3OG5 A;  1HA5 A;  1FNW A;  3L0W B;  2MQJ A;  3I9V 1;  1PGB A;  2UWQ A;  4DKM A;  2PEA A;  1N61 A;  2IB6 A;  3Q3M C;  2MRP A;  2MP2 A;  4MM3 B;  1NYQ A;  2LHE A;  2WWZ A;  2YE1 A;  4LNI A;  2LUM A;  1R4M I;  2GBR A;  4AWJ A;  3SG7 A;  2N9X A;  3PLV A;  1OQR A;  2BWF A;  3R7R A;  3PRM B;  4I6P A;  1KYP A;  4YTP B;  1E6E B;  2HCG A;  3A33 B;  1EMB A;  4L23 A;  2XK5 B;  1HZ6 A;  4WWO A;  2KFK B;  2K9X A;  1NBF C;  2G1E A;  4LK0 M;  1VR9 A;  4P6V F;  2A47 A;  2JUO A;  3B9J A;  3EC8 A;  2IND C;  4DXO A;  4I6L B;  4KA9 A;  1F0B A;  2LZ6 A;  2M8S A;  1ET6 A;  4F8C B;  1N5X A;  2SEB D;  4IC7 B;  3VVW B;  1CZP A;  1ZUD 2;  2WXJ A;  1SIJ A;  2AWM A;  1BT0 A;  2JY6 A;  2MBO A;  2QCZ A;  4C7Z A;  5LNK 1;  3A1Q A;  3M63 B;  3QHT A;  4W77 A;  2KDM A;  4RGN A;  4DDG D;  2NTS A;  2CJN A;  2WXL A;  4G11 A;  3A8S A;  4PS7 A;  4IK3 A;  2QLI A;  4O1N A;  4W9L A;  2CJO A;  4EKU A;  3K1K A;  1MG8 A;  4WIP A;  1C4F A;  5BQL A;  3TCA A;  2XN9 C;  3M62 B;  4LJP B;  1NDD A;  4W9F A;  3AE1 B;  4PT5 A;  3NZU A;  5BMG A;  4W6J A;  2EMD A;  2X38 A;  3P2B A;  5AUI A;  2VVJ A;  2LHD A;  2I2Y A;  5J18 A;  3J9C A;  2A53 B;  2VZK D;  4WWP A;  2WXN A;  3CD9 A;  4FLH A;  3BII D;  4MGY E;  5C3J B;  3VDZ A;  3ZTD A;  4QAY A;  2JSV X;  1WJ4 A;  1ESF A;  1RLF A;  2QLG B;  3NED A;  2RSU A;  2V4E B;  3GEX A;  2RD0 A;  1QT9 A;  3A4S C;  4RCO A;  2RR9 A;  1YN4 A;  2KJH B;  5AZG A;  3PPA A;  3QCA A;  4C00 A;  3P8U A;  1Z1Q A;  3ST3 A;  3EA6 A;  1RM6 C;  1QXT A;  1YQB A;  4KZ0 A;  5JHA A;  1FD6 A;  2PVO D;  4M8M A;  4BKG A;  2HRS A;  3ZTF A;  1J0G A;  3PS6 A;  3PJ5 A;  3G9A A;  4LDT B;  2KWV B;  4WQO B;  1JWS D;  3AE3 B;  2C9W B;  2NPT A;  4JWU C;  3NS1 A;  2O29 A;  3NZ3 A;  4BAX A;  1GUA B;  1VD2 A;  3SHQ A;  1L4D B;  4AS1 A;  3TEX A;  1C78 A;  2Z0E B;  4KAG A;  1GFL A;  4GES B;  2FAZ A;  2OKY A;  3DQF A;  4FHK A;  3KH0 A;  3HUI A;  2FWQ A;  4HPM B;  2QSD A;  3NT9 A;  3I3T B;  4JPS A;  2H6V A;  2LFI A;  1EMF A;  4EUL A;  3HRD D;  2BYE A;  3V62 A;  1EM7 A;  5HZS A;  1Z5S B;  4W6I A;  2WSN A;  2MJ3 A;  3A9K B;  3W5U B;  2KVZ A;  4MT5 A;  3UIN B;  2DYM A;  3WLD A;  2W3S A;  4L13 A;  4P76 A;  4W9G A;  4RMA A;  4XDC A;  4JL9 A;  1JBY A;  1ZGQ A;  4OQW A;  1XLQ A;  2GBK A;  2WXI A;  2VAD A;  2KLG A;  1LGR A;  1RYJ A;  3B2G A;  3LDZ E;  3BY4 B;  4P16 A;  4ZRP A;  3DQC A;  2XBB C;  3N9Y C;  2LGD A;  2WXF A;  1Q4D A;  4KW9 A;  2JZP A;  2B3P A;  3WAN A;  4FAD A;  3R66 C;  1K52 A;  4RNA A;  1PUT A;  2A46 A;  2GB1 A;  4IKG A;  2KX0 A;  5F9G A;  5IA7 A;  2DDD A;  4ZYN A;  3KYD D;  2GLS A;  1LFD A;  4W7A A;  3SS0 A;  1WRI A;  2Y0G A;  2FIF A;  5LLI A;  2AQ1 B;  1QKZ A;  3VUX A;  4W6K A;  1L7Y A;  1T0Q C;  2AQ3 B;  3ZJV A;  3AM9 A;  4H47 A;  4N59 A;  1JBZ A;  1OQY A;  2V3S A;  2EMT A;  4W6M A;  4Z4M A;  4HVF A;  4XDD A;  2OKW A;  1V6E A;  3N30 A;  4ICV A;  4HEA 1;  3IG3 A;  3NG0 A;  2HQK A;  4PPJ A;  2DZI A;  1B1Z A;  3DPX A;  1HE8 A;  1RWS A;  3KLS X;  3VTV A;  1I35 A;  3FAH A;  2HTH A;  2NTT A;  1FXA A;  4M8N A;  1AAR A;  5FR6 A;  3KWV A;  4URK A;  1R4N I;  4KF5 C;  1UWM A;  2KWU B;  2PE9 A;  2QEJ C;  3PT2 B;  4ZIO A;  1NEN B;  1G6J A;  1SJE D;  1TY0 A;  5DCN A;  2QIL A;  3L17 A;  2LRU A;  5AEK B;  3JVZ X;  3A9J A;  1IGD A;  3BWU D;  4P1Q A;  1TGZ B;  1SBB B;  2BT6 A;  2ZJD A;  2DNF A;  3DVG X;  3B2F A;  2BTJ A;  3DQI A;  4WJO A;  3SEB A;  4C7Y A;  2BYT A;  2BF8 B;  1C9F A;  4Q9W A;  3WIM A;  1FIQ A;  5BTT B;  4BVU C;  3R3M A;  2QIE B;  2L05 A;  3BVZ A;  2ICI A;  4BZA A;  3TSS A;  5HBD A;  4NAM A;  3VFK A;  2LGI A;  4ANJ A;  4J88 A;  1JRP A;  3P4P B;  1R4M B;  4BBN F;  3NZS A;  1RRB A;  2KMM A;  2BQQ A;  2JZZ A;  2LD9 A;  2MBE A;  2JT4 B;  2V3P A;  3U2S C;  3AU5 A;  1Y8R C;  5CHF A;  1KYR A;  3DHG C;  4ARI A;  5JXV A;  4HVB A;  1WJ6 A;  1QYQ A;  2K1F A;  1N6Z A;  3U8A A;  1S6Z A;  1OEY A;  2KDF B;  2PMV A;  3DBL I;  2VRR B;  3FIL A;  1I4X A;  3NOB A;  2XEW A;  1F0Z A;  3ZLZ A;  1EMK A;  3R2I A;  4HDQ A;  2JXX A;  3I5J C;  2NBV B;  2GW4 B;  2JRH A;  3ZRC A;  1IUE A;  2LXA A;  3Q8B A;  3SV5 A;  2KTF A;  3MTN B;  1AWD A;  1PYW D;  2C7M B;  4IOI E;  2KLC A;  4XZ4 A;  3EEC A;  1L6U A;  5EDS A;  3LYY A;  4W69 A;  2G9H D;  5IOI A;  5KHQ A;  4C80 A;  1L0X B;  4W6G A;  3AEC B;  1GAQ B;  4DXA B;  2Z0D B;  4W74 A;  1V5T A;  4ACF A;  2EKE C;  1PQS A;  1E9M A;  1SF0 A;  2A48 A;  3RT3 B;  1FFV A;  4OGS A;  4A8X C;  2LGS A;  4KDI C;  2GOW A;  2Y3A A;  3H7S A;  2INC C;  4LCD E;  1TZ1 A;  1MOV A;  4KGS A;  2KMA A;  2QZ0 A;  1T0R C;  1X1M A;  5H92 C;  2Y5C A;  4K3C A;  2LVQ A;  3DQ8 A;  1N5W A;  1DGJ A;  2DZM A;  3AI4 A;  4FXC A;  4GSW A;  3SSY A;  3Q3J A;  5EE1 A;  4HE4 A;  5H88 A;  3EK8 A;  4JRB A;  2BS4 B;  3I63 C;  5J2R A;  3TMT A;  2DWQ A;  3U7Z A;  2H5P A;  5H89 A;  3AH7 A;  1QYF A;  3ZRF A;  2LEK A;  5J2O A;  1YNT E;  2M56 B;  5D2M B;  3KYC D;  3CFA A;  2GBN A;  5EXC I;  4ZRI A;  4UTS A;  4FJY A;  1GB4 A;  4KPI A;  1Q4A A;  4W7D A;  3SG4 A;  4S17 A;  4M0W B;  2JRI B;  2H5O A;  1FCL A;  1UEL A;  2MP2 B;  2FUG 1;  4IDI A;  5L83 A;  4LJO B;  4KSK C;  2IGH A;  3SVU A;  2A56 B;  4NJ7 A;  3TEY A;  3EKJ A;  4OVZ A;  2HTM E;  4MH0 E;  1Z1P A;  2KAJ A;  4C4V A;  1MJD A;  4XGA B;  4W6R A;  4GXB A;  1DYQ A;  3O65 B;  1IPG A;  2PIA A;  4R3D A;  1K53 A;  2J53 A;  2Z8L A;  2L83 A;  1VZ7 A;  4TV3 A;  2CKH B;  4G50 A;  4TMA B;  4G3X B;  3IAS 1;  2YLM A;  4MSQ B;  4NAW A;  2E3T A;  4KF5 A;  4EN1 A;  4RGO S;  2GX0 A;  2NMQ A;  1QF6 A;  1TKY A;  2QHO A;  4PK1 A;  5DPW A;  1TT5 B;  3RCZ A;  2B3A A;  2RDH A;  1WX8 A;  1EMG A;  3SVE A;  1YN3 A;  4DXN A;  1YX5 B;  4EFO A;  2G3D B;  1OQQ A;  3NF0 A;  4RF1 A;  2INP E;  1J19 A;  4YSX B;  4HJK A;  2FNJ B;  1HXY D;  2K8C A;  3BYY B;  5DTL A;  2D5G A;  3WLC A;  1BML C;  1P0R A;  3PZD A;  4B5Y A;  3JW0 X;  1E0Z A;  3DHI C;  4ARC A;  2KDB A;  5IAA C;  2WDR B;  1E8X A;  3E5V A;  3RZW C;  2RPQ A;  3P4S B;  4IK9 A;  2RDG A;  4J8A A;  5EB6 A;  2W82 A;  2Z59 B;  3GOE A;  1C4A A;  3TMP B;  2ZW1 A;  1WY8 A;  3JSV B;  2KTR A;  2WHT A;  3GZN B;  1D5M C;  3DBR B;  2BWE S;  3D32 A;  4GLS C;  3V6C B;  4W7E A;  2K8H A;  4W6H A;  3NHE B;  1JCK B;  4P7I A;  2O24 A;  3U0L A;  3W1S C;  3OJ3 A;  3PJ7 A;  3NVY A;  1KTK A;  5LXH A;  1GGX A;  2WXP A;  5H87 A;  1I4H A;  1ZKH A;  4KIK A;  4L2Y A;  1JRO A;  3DQ7 A;  5HHD G;  2FCM A;  4W6S A;  2KDI A;  2MA9 B;  1I4R A;  3PZ8 A;  4W9C A;  1OTR B;  4GIV A;  1C3T A;  3W9C B;  4IUM B;  1V81 A;  3AED B;  1HQR D;  4L12 A;  1TS2 A;  3NVV A;  4KW8 A;  2WXM A;  5GXG B;  3E5T A;  5LXI B;  4JE3 B;  4HQ8 A;  1XLP A;  1N62 A;  4PFE A;  5CHV C;  2DBY A;  2YFP A;  1V1O A;  3T3O A;  4IWP A;  2E6X A;  1OXE A;  1OXD A;  3AE4 B;  1V80 A;  4XOW A;  4LQT A;  4WWN A;  3SG3 A;  2HPW A;  3CBE A;  3CIR B;  3SSH A;  2AEH A;  4NY0 A;  3I19 A;  2IE2 A;  1VJK A;  1XCT L;  1EWC A;  2BGF A;  2FBW B;  3IT6 B;  3BIN A;  1WGK A;  1IGC A;  4DXI A;  4MGK E;  1UWX A;  3GL4 A;  1WXQ A;  4AOF A;  4DHZ E;  3AEA B;  1JWA D;  2KMC A;  1ZDV A;  3P4Q B;  1V1P A;  4NJ6 A;  1WFY A;  4IM0 A;  2V3N A;  5AUK A;  1Q4C A;  3N1Y C;  3N1X C;  2WXO A;  3WA0 A;  2Y5B B;  2HJO A;  3KVF B;  4FUL A;  3VH3 B;  2MCN B;  1WE6 A;  3ED8 A;  1N60 A;  1WMH A;  2HGY A;  4RFB A;  3ADF A;  4W7X A;  4LQU A;  1TTN A;  4OVV A;  2IO2 B;  1SIF A;  4KGF A;  1UGJ A;  3X0W A;  1YJF A;  3AE6 B;  1LQB A;  2H88 B;  3QC8 B;  2L8J A;  1VCB A;  4GGQ A;  4S0R A;  4CO7 A;  4USA A;  3GS2 A;  2V4L A;  2JYE A;  3U0K A;  1E90 A;  2MH7 A;  3APD A;  2HD5 B;  2LI5 A;  5D3D A;  2CHZ A;  5E6N A;  1H8C A;  2DX5 B;  3N1Z C;  4LW5 A;  1KLU D;  1M4V A;  2IO3 B;  2DUH A;  3AEF B;  3LS3 A;  4ZRK A;  1WIA A;  2JVC A;  2KKC A;  5G55 A;  1V86 A;  2WXQ A;  2IDY A;  3ST4 A;  3N32 A;  2EEL A;  3L13 A;  4NQK E;  5EHU A;  2V0G A;  1OXF A;  4RGT A;  3A1Q B;  1GC7 A;  2LGY A;  2OJK A;  4Q7T A;  4PS3 A;  4DXF A;  4KX6 B;  3L08 A;  4RM9 A;  2J0K A;  2DUI A;  1QZE A;  2KC2 A;  5G2N A;  4W9I A;  2V1Y A;  4B6W A;  2AYO B;  1XQQ A;  4ORN A;  2M17 A;  2GX2 A;  3LVA A;  3IP2 A;  4MJS A;  1KH0 A;  2W3R A;  3ZGZ A;  2WSO A;  4B30 B;  1HTO A;  2L32 A;  2KXJ A;  3ZO5 B;  3NRZ A;  3MP9 A;  3TIX A;  5BYQ A;  5BYR A;  2O6V D;  5FR3 A;  3ZW3 A;  4ANX A;  3LXF A;  4C56 C;  3H1O A;  4BOZ B;  4ZBL A;  3RPF C;  2NBW B;  5EE3 A;  2MBB B;  3SU8 X;  2BKR B;  1D3Z A;  1H4U A;  4BBN C;  2KAC A;  4ZRQ A;  5FKA C;  2JX5 A;  4TZA A;  3KUC B;  2ZVN A;  2O6V B;  2G3O A;  2RGF A;  4JWS C;  3C8Y A;  4A9A A;  4RTC A;  4US8 A;  3AN1 A;  3UGB B;  2KQ4 X;  2H9W A;  2JQR B;  3SSP A;  1HUY A;  1MHX A;  4DDI D;  2KOX A;  3M3J A;  5HG2 A;  1JWU D;  4HKQ A;  1E7U A;  2C5L C;  4KIK B;  4NWS A;  2KT7 A;  2N7J A;  3AE5 B;  1UBQ A;  2ZPY A;  3GB1 A;  2FUH B;  3DQN A;  4W6D A;  1UGM A;  1C76 A;  3MHZ A;  1YQ4 B;  3MFG A;  3W1Y A;  4R6B A;  3RN9 C;  3QIJ A;  2KNB A;  3SVB A;  2LJI A;  4HQ9 A;  1FFU A;  3SD5 A;  3DQ1 A;  3LB8 C;  3P63 A;  3RUL A;  1PFD A;  5HGE A;  3DWG C;  2CU3 A;  2J52 A;  1KFY B;  2D3B A;  1VZ6 A;  4TQ0 A;  1GG3 A;  4JGE A;  3RI7 C;  2C9I A;  3C0R B;  2YDZ A;  3URY A;  4B30 A;  3GE8 C;  3V3X A;  4B9K A;  4REZ A;  1ENF A;  2OHF A;  4P1C C;  4W7R A;  3HIZ A;  2MBH A;  3IVF A;  4W9J A;  1A5R A;  3U7D A;  1SJH D;  3L10 B;  3Q3N C;  2O2V A;  2XNA C;  3KUZ A;  3EUB 2;  1RRX A;  5EE0 A;  2O2V B;  1YJ1 A;  4K7S A;  4HRS A;  1UIS A;  3W1D A;  2QLE A;  2VVI A;  2VAE A;  1P7F A;  3DQH A;  4OJ0 A;  2MWS B;  3K9O B;  3RFZ B;  3O77 A;  3Q69 A;  5KHO A;  1T3Q A;  2LVP A;  2WXG A;  2ZMW A;  2WXR A;  1MPE A;  2GBJ A;  2VH1 A;  1E8Z A;  3W5V B;  5IP4 D;  1UZX B;  1WF9 A;  1YIW A;  2LXC A;  4DWF A;  1BUI C;  4NAW B;  3AEE B;  3RNA C;  1XT9 B;  3DBH I;  3VXW A;  3ZUJ A;  5IN7 A;  3RNC C;  2NBU A;  3KCS A;  3CD1 A;  3SSV A;  3M95 A;  3NJT A;  5DTX A;  2G6X A;  2NS5 A;  3DQA A;  4W9K A;  3DVN V;  3A4R A;  3AXC A;  1FM0 D;  4DBG A;  3ETR A;  2A52 B;  5BYS A;  2J4X A;  1IYF A;  4LJC A;  1KLG D;  3CF6 E;  3LA1 A;  2EMS A;  4ZHP A;  2CHX A;  4WUR A;  2RDB C;  2MJE A;  2JF5 A;  4WJN A;  2RMM A;  3H6N A;  2IJ0 A;  4ZF3 A;  2A4Z A;  4N3D A;  3S05 A;  3VHT A;  2N4F A;  3AE8 B;  2DYB A;  4W9H A;  4IWO A;  3RYT A;  5G5H A;  4W6F A;  2JU6 X;  1WXS A;  3FC4 A;  4HKZ E;  1KRH A;  1UBI A;  3SVD A;  2JYT A;  4W6U A;  1TIF A;  3H9D A;  3E56 A;  1L5P A;  3SRY A;  3VTW A;  3W2D A;  4J89 A;  2H89 B;  1WWT A;  1BFP A;  3VUY A;  2WQY B;  4E74 A;  3SST A;  4IK8 A;  2KVR A;  3QA8 A;  2KHW B;  2KWD A;  2JPH A;  4KSL C;  3VRA B;  1GNU A;  1FRR A;  3AB5 A;  3BYT B;  2BTE A;  5AZH A;  1P3Q U;  3T9L A;  4PYZ A;  5JHB A;  4DXP A;  4OY4 A;  5CTR C;  5H8Y E;  2G6Y A;  3IT4 B;  1I42 A;  3SVN A;  3AEB B;  2QT2 A;  2X8X X;  3NVW A;  3PIB A;  2I1J A;  1TZO A;  2IOV A;  2LUE A;  1WR1 A;  4BKT A;  1EWY C;  1UF0 A;  2ZPN A;  1QOF A;  1RM9 A;  2IYD B;  4K7W A;  5HW9 A;  2ZO6 A;  3DQ2 A;  3R8B A;  2P4M A;  3PGE A;  1GJZ A;  5HKH A;  4HPL B;  2LJ5 A;  2PXS A;  4E3C A;  4JLC A;  5FK9 C;  3ZDT A;  4DHJ D;  3SFE B;  1T0Y A;  3ST2 A;  4UDU C;  4DXM A;  3LVD A;  5HZO A;  1B9R A;  4KKJ A;  1FEH A;  1NYR A;  4Q9X A;  1GPX A;  4ZF5 A;  4JQW C;  1T0S C;  1V97 A;  3X23 A;  2Z6Y A;  1QOB A;  3EKH A;  2WIQ A;  2HFC A;  4NPN A;  1H6R A;  5KTG A;  1XAE A;  5EXU A;  2WXK A;  4EZK A;  1WMH B;  4NNJ B;  2K22 A;  2AH8 A;  3I57 A;  3RNB C;  3DBH B;  5L95 C;  3VK1 A;  3PRE A;  4KGE A;  3DQK A;  2EMN A;  3NY5 A;  4KDL B;  4YTM B;  2KC1 A;  1A70 A;  2LMC A;  2ZCB A;  3UF8 A;  2PKO A;  1WXM A;  3NEZ A;  4ZHO A;  2HQZ A;  2FL1 A;  2PXW A;  5JH5 C;  1N63 A;  3K9P B;  1QLB B;  2AL6 A;  1XA9 A;  4AJW A;  4AR7 A;  2ZNV C;  1YD8 U;  4XX5 A;  3DPD A;  2ONQ A;  1FNU A;  4WWM A;  2DAJ A;  2ON8 A;  2HE7 A;  4GOC A;  4II3 B;  3B08 A;  4HJG E;  1BXT A;  3U0N A;  2WP9 B;  2PJH A;  3SVR A;  1GB1 A;  3DQJ A;  1NEK B;  4H3M A;  4EEW A;  1QOG A;  1VDV A;  1SSN A;  2MW5 A;  3DQ3 A;  1EMC A;  2ACZ B;  5FVF A;  2I38 A;  4YL8 A;  1LXD A;  1WX9 A;  3EVR A;  4KEX A;  4ZFS A;  4ANV A;  2N9K A;  2IGD A;  4YWG G;  5C1Z A;  1MVK A;  3PSE B;  3UFZ A;  3M22 A;  1XSS A;  2IZV B;  3IAM 1;  1VRA B;  1WH3 A;  1WRD B;  4OZA A;  4J6I A;  2G6E A;  2O6V A;  1EF1 A;  3GJ1 A;  1ZP0 B;  3SSK A;  4EE2 A;  1HZ5 A;  2KN4 A;  3ZUL A;  1P1A A;  1YQ3 B;  1WXV A;  3HVD A;  3HVZ A;  4IZN A;  3RNE C;  2KN5 A;  1C79 A;  4HQC A;  2H5R A;  1WYG A;  2R2Q A;  5E6P A;  2R2O A;  5BMH A;  5LTR A;  2WHS A;  4HLE A;  1L0V B;  5DU0 A;  4FHJ A;  3DQL A;  4PS8 A;  2A5U A;  1UH6 A;  3AE7 B;  4PPL A;  1E7P B;  4LLG M;  2WX1 A;  1WZ0 A;  4MJS B;  1TBE A;  2WHI A;  1Q0W B;  2JZ3 B;  3DBR I;  2AWK A;  4F1S A;  1ZXH A;  1Q5W B;  2Z6X A;  1D5X C;  5DTY A;  4KW4 A;  3OJ4 B;  4Z4K A;  5EE9 A;  4H48 A;  2G4D B;  2BS3 B;  3IFW B;  3MJW A;  3DQU A;  2LWP A;  4IG7 B;  2OGR A;  1TYG B;  1ZE3 D;  4ANW A;  4IM2 A;  2D3A A;  2QJL A;  2AHA A;  1RMO A;  2BPS A;  1W7U A;  3PTF C;  4AS8 A;  2PPH A;  4ICU A;  4DKN A;  3OWE B;  2KQS A;  2N1V A;  2HJ1 A;  2MX2 A;  4H3L A;  3NS8 A;  2HDE A;  1ZGO A;  4NQL B;  3BZD B;  4II2 B;  2KO3 A;  1XF5 L;  4GDL B;  3VR8 B;  1WYW B;  1C4P A;  4P1B C;  1EMA A;  1CQV A;  2ASQ A;  5T3I A;  2M0X A;  4M02 A;  3APC A;  3ZNH B;  1V49 A;  3IXS A;  3DPW A;  1JAL A;  2LGX A;  2WGS A;  1IP9 A;  3P28 A;  1EU3 A;  1B9C A;  1K50 A;  3P42 A;  4CYE A;  5DPG A;  1WGY A;  1SE9 A;  3VTU A;  1JQ4 A;  2QRF A;  4OHJ A;  4MAC A;  5BMI A;  1V8C A;  2IGG A;  2WLB A;  1JC0 A;  1F52 A;  4W6B A;  3SVS A;  1ISN A;  4XOV A;  1E8W A;  1WGD A;  3KWL A;  2DUG A;  3ML8 A;  5GMV A;  3LF3 A;  4ZB1 A;  4AJY B;  2VVH A;  2IBI B;  3IR8 A;  2L3Z A;  3MC8 A;  5J17 A;  4IK1 A;  3BK1 A;  1L0Y B;  4KV2 A;  1R4N B;  1L4Z B;  4LDT D;  1WJU A;  4RYS A;  2PW9 A;  2K0P A;  3SG6 A;  2IO1 B;  4W6P A;  3ZTC A;  3NT3 A;  1WE7 A;  4KVG B;  2BKF A;  1UUP A;  3DVG Y;  1D4B A;  3QK0 A;  3WAO A;  4OZC A;  2WX0 A;  3DBS A;  2EMO A;  2VZK B;  1FRD A;  5DTZ A;  4JFG A;  2V4E A;  4HPP A;  1YN5 A;  1IBX B;  2O2B A;  3RNG C;  1ZGP A;  2K3U A;  2M1M A;  4KZC A;  5DPH A;  4N6E B;  1V9J A;  1UNS A;  2IPK D;  3LSA A;  4W6N A;  2K8B A;  3GZN I;  1LO5 D;  3B0A A;  4CQN A;  1D5Z C;  4W72 A;  3Q8F A;  4Q2J A;  1WJN A;  1GOZ A;  1EU4 A;  3ZQ4 A;  1ACC A;  1WM2 A;  2JWU A;  3H7P B;  1DOY A;  1KJT A;  4JIO U;  3UI3 A;  3V3D A;  4GB9 A;  5C23 A;  2HGD A;  4DHJ B;  4ZYS A;  1V5O A;  4DHZ B;  3PO0 A;  4ZF4 A;  3CWI A;  5DQM A;  4WJQ A;  4E71 A;  2FID A;  5I4D A;  3JSV A;  4EMQ A;  2D11 A;  3V6E B;  3EK4 A;  1IBX A;  4GMV A;  3T8M A;  3EVU A;  4W73 A;  2YE0 A;  2D2Q A;  2M0A A;  3DQ4 A;  1W7S A;  1XLO A;  4HCN B;  4I6N B;  1E7V A;  1TKG A;  2QC8 A;  4RF0 A;  5D3I B;  2V4E C;  1NVI D;  1WXA A;  2INN E;  3U30 A;  1NI2 A;  3QWZ B;  1JRU A;  2VZX A;  2C7N B;  2M19 A;  1WGG A;  3ZNG C;  3DOW A;  2AWT A;  2J0M A;  3V05 A;  3PLU A;  2XK5 A;  2ICR A;  5BTT A;  2N9L A;  2OTE A;  4KGT A;  3Q3F A;  2KJ6 A;  1Q73 A;  1FNV A;  2LRW A;  3SG5 A;  5T8I A;  2DD7 A;  3JYU A;  1AW7 A;  2AWL A;  3CFH A;  1PGA A;  3Q8E A;  1ZPS A; 
#chains in the Genus database with same CATH homology
 3UG0 A;  2PE6 B;  4MM3 A;  3V61 A;  1WM3 A;  1RMP A;  4ZIN A;  2GBM A;  2IY1 B;  4FN2 A;  3IHP C;  4W6A A;  3SVC A;  3KCT A;  1WZ3 A;  3QAQ A;  5JZE B;  3PHX B;  3N3K B;  2WHU A;  2LAS A;  3H1U A;  1MYW A;  3DCG A;  1L2N A;  3L54 A;  4EDO A;  4W7C A;  2DUF A;  4TZG A;  2D07 B;  4GDL A;  2DYO A;  2NPT B;  2DHZ A;  1GC6 A;  5EJU A;  3TBL D;  3U8Z A;  2N1W A;  1EME A;  4AP4 C;  1Q1O A;  4MDK E;  2ZNV B;  4MGI E;  5FHV A;  4MGZ E;  4W6C A;  3AU4 A;  3ZDM C;  2I1K A;  1U4A A;  2CR5 A;  1QYO A;  2A54 B;  5DRF A;  3GB3 A;  2BYV E;  1KM7 A;  1EMM A;  3DQV A;  5CHW A;  5D6J B;  3OSQ A;  3DQ9 A;  2N9E B;  2QLG A;  4XC2 A;  4GU2 A;  5BO4 B;  1P9D U;  4CHK A;  1E8Y A;  3HM3 A;  2DEN B;  4ZDV A;  3O78 A;  1YHH A;  3DQO A;  3RWT A;  4FJV B;  3ZKJ C;  2M4N A;  3EVV A;  4DK5 A;  1WI0 A;  3H7P A;  1W7T A;  3A9K A;  5LTP A;  3AI5 A;  2KZR A;  4BDU A;  2FCN A;  5DPS A;  3WAM A;  3DQ6 A;  4GDK B;  2DZK A;  3SG2 A;  2DD9 A;  3DQ5 A;  2QU1 A;  3OGO A;  2CU1 A;  4IK4 A;  3ZVV A;  4WJP A;  3BXB A;  2NR2 A;  5DY6 A;  3MHS D;  2MLB A;  4H3N A;  2CS4 A;  3EHV A;  4EUT A;  4W7F A;  3ZIM A;  2N7D A;  2YVC A;  2J0J A;  2L00 B;  2WUR A;  2N9P C;  2KFK A;  4LJB A;  3BX9 A;  1Q4E A;  3LVC A;  2FCQ A;  2IO0 B;  2KQ7 A;  4A3O A;  4G0N B;  2KD0 A;  3RZF A;  2IY0 B;  4AUQ C;  3ZNI D;  1KYS A;  2OOB B;  4TUU A;  4LJD A;  2FCS A;  4A3P A;  5D7G A;  3GJ2 A;  3OLM D;  2POX A;  2Z1O A;  3A9J B;  4I2Y A;  3ECI A;  5AQB B;  1KP5 A;  3M24 A;  1QY3 A;  4K7U A;  2K39 A;  5DPJ A;  4BFR A;  2KWC A;  3EVP A;  3VAW A;  2OTB A;  3CB9 A;  2G5Z B;  2J7Q B;  5HZT A;  2C7H A;  1HCJ A;  5DRG A;  1H4R A;  3DQE A;  1V2Y A;  2L0T A;  4GF6 B;  3QAR A;  4BKS A;  4ANU A;  1EUV B;  3TMR A;  3CSF A;  3HHM A;  1ZW7 A;  4K81 A;  1MOU A;  1RMM A;  3UQA A;  2K6Q A;  4LJD C;  3U8C A;  5CX3 A;  2H8Q A;  1Z2M A;  2K6D B;  4W75 A;  1KOT A;  4FA6 A;  3DQM A;  3QQ8 B;  2WYQ A;  2H5Q A;  5EB7 A;  2ARL A;  5EBJ A;  3W1S A;  2B3Q A;  2DDC A;  2KAN A;  4XL5 A;  3V60 A;  3OAW A;  1S3S G;  4HK2 A;  3ZUF A;  4EOY A;  1YHI A;  4N9F 4;  3DVN U;  3UIO B;  3CST A;  3H1R A;  1CV7 A;  4OHS A;  3QJZ A;  4EDS A;  5D94 A;  2REX A;  4BOS C;  1CMX B;  2GW3 A;  4IWQ A;  3KW5 B;  1OGW A;  4HWI B;  2JAD A;  3R7Q A;  2KDE B;  3WCK A;  5BT0 A;  3MGF A;  3HM6 X;  4EZL A;  4XVP A;  2KJR A;  1FXT B;  2C9J A;  2AWJ A;  2LVO A;  2HJ8 A;  4W9D A;  5FVI A;  3VQI A;  4JF9 A;  4FJZ A;  3BXC A;  5TR5 A;  4MEL A;  2DAF A;  2L76 A;  4W6T A;  2Q57 A;  3BXA A;  4IW0 A;  4RYW A;  3SSL A;  4EZJ A;  5AZF A;  3APF A;  3PRP B;  5E6O A;  3VH4 B;  3B1L X;  4DXQ A;  3CFF A;  1M94 A;  4GOB A;  4HDO A;  3TJP A;  1RAX A;  1YX6 B;  2NCN A;  4JEO A;  4JC2 A;  2ZZP B;  4HXD A;  3SDL C;  2K25 A;  3U0M A;  5EXB A;  1EML A;  1SGH A;  1WGR A;  1ZUX A;  1EO6 A;  3TL5 A;  3UQB A;  3IBE A;  5LK4 A;  4RM8 A;  2DZJ A;  2KK8 A;  3AKO A;  2ZEQ A;  3ZUN A;  2G3Q B;  4OVU A;  5DPI A;  3ML9 A;  5DQB A;  3VIC A;  5FVG A;  4W6O A;  2MSE D;  3LJ3 A;  1WX7 A;  4MEM A;  3PVL A;  3RWA A;  2GMI C;  4JGH B;  4W9E A;  1KLV A;  1XQM A;  3PRZ A;  1YJ2 A;  2G16 B;  2KX3 A;  1ZGU B;  2JWZ A;  2Z6Z A;  1LM8 B;  5HZU A;  3S2A A;  2RH7 A;  2KFJ A;  3DPZ A;  5LTQ A;  1YHG A;  3PHW B;  4TKN A;  2ZCC A;  3ST0 A;  3LF4 B;  2WIS A;  3W1C A;  2ZMU A;  2CHW A;  1C1Y B;  4WAA A;  4IM3 A;  2G45 B;  3ALB A;  4PYU A;  3ONS A;  1F09 A;  1K8R B;  3RUI B;  1F9J A;  2L7R A;  2Q6P A;  3SVO A;  4W6L A;  1RFA A;  4XGY A;  3VHT B;  2MBQ A;  4HCP B;  4ASW C;  1EF5 A;  4B95 A;  4R6D A;  4Q7R A;  2UYZ B;  2WDT B;  3E5W A;  4GDK A;  1XD3 B;  2A50 B;  3ENE A;  2N7E A;  2ZVO A;  1UD7 A;  2NVU I;  3WAL A;  4TQ1 A;  3EFU A;  2D3G A;  1YFP A;  3OSR A;  1GL4 A;  3DQD A;  3QX1 A;  4X57 B;  2AL3 A;  3AUL A;  1E5W A;  2D10 A;  3EK7 A;  4IK5 A;  2KTR B;  2G2S B;  4W76 A;  2W9N A;  1OEY J;  1JC1 A;  2FZU A;  3PJB A;  1WGH A;  3UIP B;  4U2V A;  2BYF A;  3ZNZ B;  2L0F A;  1WR6 E;  4MSM B;  1Q4B A;  3U8P A;  1S1Q B;  5DPT A;  4K1R B;  3PV1 A;  2QLH A;  3RD2 A;  4A20 A;  2IB5 A;  4KF4 A;  4Q7U A;  5DPR A;  2OJR A;  2DUE A;  3CMM B;  2C60 A;  3KUD B;  4FBJ B;  4BKS D;  3HK0 A;  1G7K A;  1P98 A;  2ZO7 A;  4ZRJ A;  4L1I A;  3WAP A;  4PPK A;  3CGL A;  3L16 A;  1YZW A;  4GN1 A;  1J8C A;  2G4S A;  1XMZ A;  3DDC B;  3VUW A;  3VHT C;  4F7Z A;  3L0W B;  2MQJ A;  2UWQ A;  4DKM A;  2PEA A;  2IB6 A;  2MRP A;  2MP2 A;  2WWZ A;  2YE1 A;  1R4M I;  2GBR A;  4AWJ A;  3SG7 A;  2N9X A;  3PLV A;  2BWF A;  3R7R A;  3PRM B;  4I6P A;  1KYP A;  2HCG A;  3A33 B;  1EMB A;  2XK5 B;  4WWO A;  2KFK B;  1NBF C;  2A47 A;  2JUO A;  3EC8 A;  4I6L B;  4DXO A;  4KA9 A;  1F0B A;  2LZ6 A;  2M8S A;  4F8C B;  4IC7 B;  3VVW B;  2AWM A;  1BT0 A;  2JY6 A;  2MBO A;  3A1Q A;  3M63 B;  3QHT A;  4W77 A;  4DDG D;  4G11 A;  4PS7 A;  3A8S A;  4IK3 A;  2QLI A;  4W9L A;  4EKU A;  3K1K A;  1MG8 A;  1C4F A;  5BQL A;  3TCA A;  3M62 B;  4LJP B;  1NDD A;  4W9F A;  3NZU A;  4W6J A;  2EMD A;  3P2B A;  2VVJ A;  5J18 A;  2A53 B;  4WWP A;  3CD9 A;  4FLH A;  4MGY E;  3VDZ A;  3ZTD A;  1WJ4 A;  1RLF A;  2QLG B;  3NED A;  2RSU A;  2V4E B;  3GEX A;  2RD0 A;  3A4S C;  2RR9 A;  2KJH B;  5AZG A;  3PPA A;  3QCA A;  3P8U A;  1Z1Q A;  3ST3 A;  1QXT A;  1YQB A;  4KZ0 A;  5JHA A;  4M8M A;  4BKG A;  2HRS A;  3ZTF A;  1J0G A;  3PS6 A;  3PJ5 A;  3G9A A;  4LDT B;  2KWV B;  4WQO B;  2C9W B;  2NPT A;  2O29 A;  1GUA B;  1VD2 A;  3SHQ A;  2Z0E B;  4KAG A;  1GFL A;  4GES B;  2FAZ A;  2OKY A;  3DQF A;  4FHK A;  3KH0 A;  2FWQ A;  4HPM B;  3NT9 A;  3I3T B;  2H6V A;  1EMF A;  4EUL A;  2BYE A;  3V62 A;  5HZS A;  1Z5S B;  4W6I A;  2WSN A;  3A9K B;  3UIN B;  2DYM A;  3WLD A;  4L13 A;  4P76 A;  4W9G A;  4RMA A;  4JL9 A;  1JBY A;  1ZGQ A;  4OQW A;  2GBK A;  2VAD A;  2KLG A;  3LDZ E;  3BY4 B;  3DQC A;  2XBB C;  2LGD A;  1Q4D A;  4KW9 A;  3WAN A;  2B3P A;  4FAD A;  3R66 C;  2A46 A;  2KX0 A;  5F9G A;  5IA7 A;  2DDD A;  4ZYN A;  3KYD D;  1LFD A;  4W7A A;  3SS0 A;  2FIF A;  2Y0G A;  5LLI A;  3VUX A;  4W6K A;  1L7Y A;  4H47 A;  1JBZ A;  1OQY A;  2V3S A;  2EMT A;  4W6M A;  4Z4M A;  4HVF A;  2OKW A;  1V6E A;  3N30 A;  4ICV A;  3IG3 A;  2HQK A;  4PPJ A;  2DZI A;  3DPX A;  1HE8 A;  3VTV A;  1I35 A;  2HTH A;  4M8N A;  1AAR A;  5FR6 A;  4URK A;  1R4N I;  4KF5 C;  2KWU B;  2PE9 A;  3PT2 B;  4ZIO A;  1G6J A;  5DCN A;  3L17 A;  2LRU A;  5AEK B;  3JVZ X;  3A9J A;  4P1Q A;  1TGZ B;  2ZJD A;  3DVG X;  2BTJ A;  3DQI A;  4WJO A;  2BF8 B;  4Q9W A;  3WIM A;  5BTT B;  4BVU C;  3R3M A;  2L05 A;  5HBD A;  3VFK A;  4ANJ A;  4J88 A;  4BBN F;  3NZS A;  1RRB A;  2MBE A;  2JZZ A;  2LD9 A;  2JT4 B;  3AU5 A;  5CHF A;  1Y8R C;  1KYR A;  4HVB A;  1WJ6 A;  1QYQ A;  2K1F A;  3U8A A;  1S6Z A;  1OEY A;  2KDF B;  3DBL I;  2VRR B;  3NOB A;  2XEW A;  3ZLZ A;  1EMK A;  4HDQ A;  2JXX A;  2NBV B;  2GW4 B;  2JRH A;  3ZRC A;  2LXA A;  3SV5 A;  2KTF A;  3MTN B;  2C7M B;  2KLC A;  4XZ4 A;  3EEC A;  5EDS A;  4W69 A;  5KHQ A;  4W6G A;  4DXA B;  2Z0D B;  4W74 A;  1V5T A;  2EKE C;  1PQS A;  3RT3 B;  2A48 A;  4OGS A;  4KDI C;  2GOW A;  3H7S A;  4LCD E;  1TZ1 A;  1MOV A;  2KMA A;  2QZ0 A;  1X1M A;  2LVQ A;  3DQ8 A;  2DZM A;  3AI4 A;  4GSW A;  3SSY A;  3Q3J A;  4HE4 A;  5H88 A;  3EK8 A;  4JRB A;  5J2R A;  3TMT A;  2H5P A;  5H89 A;  3ZRF A;  1QYF A;  5J2O A;  5D2M B;  3KYC D;  3CFA A;  2GBN A;  5EXC I;  4ZRI A;  4UTS A;  4FJY A;  4KPI A;  1Q4A A;  4W7D A;  3SG4 A;  4M0W B;  2JRI B;  2H5O A;  1UEL A;  2MP2 B;  5L83 A;  4LJO B;  4KSK C;  3SVU A;  2A56 B;  4NJ7 A;  3EKJ A;  4MH0 E;  1Z1P A;  4W6R A;  4GXB A;  3O65 B;  1IPG A;  4TV3 A;  2CKH B;  4G50 A;  4G3X B;  4MSQ B;  2YLM A;  4NAW A;  4KF5 A;  4EN1 A;  2GX0 A;  2QHO A;  5DPW A;  3RCZ A;  2B3A A;  1WX8 A;  1EMG A;  3SVE A;  1YX5 B;  4DXN A;  4EFO A;  2G3D B;  3NF0 A;  1J19 A;  4HJK A;  2FNJ B;  2K8C A;  5DTL A;  3WLC A;  1P0R A;  3PZD A;  4B5Y A;  3JW0 X;  2KDB A;  5IAA C;  1E8X A;  3E5V A;  3RZW C;  2RPQ A;  4IK9 A;  4J8A A;  5EB6 A;  2Z59 B;  3GOE A;  3TMP B;  1WY8 A;  3JSV B;  2KTR A;  2WHT A;  2BWE S;  3D32 A;  3V6C B;  4W7E A;  2K8H A;  4W6H A;  3NHE B;  4P7I A;  2O24 A;  3W1S C;  3U0L A;  3OJ3 A;  3PJ7 A;  5LXH A;  1GGX A;  5H87 A;  1ZKH A;  4KIK A;  3DQ7 A;  2FCM A;  4W6S A;  2KDI A;  2MA9 B;  4W9C A;  1OTR B;  4GIV A;  1C3T A;  4IUM B;  1V81 A;  4L12 A;  4KW8 A;  3E5T A;  5LXI B;  4HQ8 A;  4PFE A;  5CHV C;  2YFP A;  4IWP A;  1OXE A;  1OXD A;  1V80 A;  4XOW A;  4LQT A;  4WWN A;  3SG3 A;  2HPW A;  3CBE A;  3SSH A;  2AEH A;  4NY0 A;  3I19 A;  2IE2 A;  2BGF A;  3BIN A;  4DXI A;  4MGK E;  4AOF A;  3GL4 A;  4DHZ E;  2KMC A;  4NJ6 A;  1WFY A;  4IM0 A;  1Q4C A;  3WA0 A;  2Y5B B;  2HJO A;  3KVF B;  4FUL A;  3VH3 B;  2MCN B;  1WE6 A;  3ED8 A;  1WMH A;  2HGY A;  3ADF A;  4W7X A;  4LQU A;  1TTN A;  4OVV A;  2IO2 B;  3X0W A;  4KGF A;  1SIF A;  1YJF A;  1LQB A;  3QC8 B;  2L8J A;  1VCB A;  4GGQ A;  4CO7 A;  2V4L A;  3U0K A;  1E90 A;  3APD A;  2HD5 B;  2LI5 A;  2CHZ A;  5E6N A;  1H8C A;  2DX5 B;  4LW5 A;  2IO3 B;  2DUH A;  3LS3 A;  4ZRK A;  1WIA A;  2JVC A;  2KKC A;  5G55 A;  1V86 A;  3ST4 A;  3N32 A;  3L13 A;  4NQK E;  5EHU A;  1OXF A;  3A1Q B;  1GC7 A;  2LGY A;  2OJK A;  4Q7T A;  4PS3 A;  3L08 A;  4RM9 A;  2J0K A;  2DUI A;  5G2N A;  1QZE A;  2KC2 A;  4W9I A;  2V1Y A;  4B6W A;  2AYO B;  1XQQ A;  4ORN A;  2M17 A;  2GX2 A;  3LVA A;  3IP2 A;  4MJS A;  2WSO A;  4B30 B;  3ZO5 B;  2KXJ A;  3TIX A;  2O6V D;  3ZW3 A;  4ANX A;  3H1O A;  4BOZ B;  4ZBL A;  2NBW B;  2MBB B;  3SU8 X;  2BKR B;  1D3Z A;  1H4U A;  4BBN C;  4TZA A;  3KUC B;  2ZVN A;  2O6V B;  2G3O A;  2RGF A;  4RTC A;  3UGB B;  2H9W A;  3SSP A;  1HUY A;  4DDI D;  2KOX A;  3M3J A;  1E7U A;  2C5L C;  4KIK B;  4NWS A;  1UBQ A;  2ZPY A;  2FUH B;  3DQN A;  4W6D A;  1UGM A;  3W1Y A;  4R6B A;  3QIJ A;  2KNB A;  3SVB A;  4HQ9 A;  3SD5 A;  3DQ1 A;  3RUL A;  5HGE A;  4TQ0 A;  1GG3 A;  4JGE A;  2C9I A;  3C0R B;  2YDZ A;  4B30 A;  4B9K A;  4W7R A;  3HIZ A;  2MBH A;  3IVF A;  4W9J A;  1A5R A;  3U7D A;  3L10 B;  2O2V A;  3KUZ A;  1RRX A;  2O2V B;  1YJ1 A;  4K7S A;  1UIS A;  3W1D A;  2QLE A;  2VVI A;  2VAE A;  3DQH A;  4OJ0 A;  2MWS B;  3K9O B;  3O77 A;  5KHO A;  2LVP A;  2ZMW A;  2GBJ A;  1E8Z A;  1UZX B;  1WF9 A;  1YIW A;  2LXC A;  4DWF A;  4NAW B;  3VXW A;  1XT9 B;  3DBH I;  3ZUJ A;  2NBU A;  3KCS A;  3CD1 A;  3SSV A;  3M95 A;  5DTX A;  2G6X A;  2NS5 A;  3DQA A;  4W9K A;  3DVN V;  3A4R A;  3AXC A;  4DBG A;  2A52 B;  1IYF A;  4LJC A;  3CF6 E;  3LA1 A;  2EMS A;  2CHX A;  2JF5 A;  4WJN A;  3H6N A;  4ZF3 A;  2A4Z A;  4N3D A;  3S05 A;  3VHT A;  2N4F A;  2DYB A;  4W9H A;  4IWO A;  3RYT A;  4W6F A;  1WXS A;  1UBI A;  3SVD A;  4W6U A;  3H9D A;  3VTW A;  3SRY A;  4J89 A;  1BFP A;  3VUY A;  4E74 A;  3SST A;  4IK8 A;  2KVR A;  3QA8 A;  2KHW B;  2JPH A;  4KSL C;  1GNU A;  5AZH A;  1P3Q U;  3T9L A;  4PYZ A;  5JHB A;  4DXP A;  4OY4 A;  5CTR C;  2G6Y A;  1I42 A;  3SVN A;  2QT2 A;  3PIB A;  2I1J A;  2LUE A;  2IOV A;  1WR1 A;  4BKT A;  2ZPN A;  1RM9 A;  2IYD B;  4K7W A;  5HW9 A;  2ZO6 A;  3DQ2 A;  2P4M A;  3PGE A;  1GJZ A;  5HKH A;  4HPL B;  2LJ5 A;  2PXS A;  4E3C A;  4JLC A;  4DHJ D;  3ZDT A;  1T0Y A;  3ST2 A;  4DXM A;  3LVD A;  5HZO A;  4Q9X A;  4ZF5 A;  4JQW C;  3X23 A;  2Z6Y A;  3EKH A;  2WIQ A;  2HFC A;  4NPN A;  1H6R A;  5KTG A;  1XAE A;  5EXU A;  4EZK A;  1WMH B;  4NNJ B;  2AH8 A;  5L95 C;  3VK1 A;  3PRE A;  4KGE A;  3DQK A;  2EMN A;  3NY5 A;  4KDL B;  2KC1 A;  2ZCB A;  3UF8 A;  1WXM A;  3NEZ A;  2HQZ A;  2FL1 A;  2PXW A;  5JH5 C;  3K9P B;  2AL6 A;  1XA9 A;  4AJW A;  4AR7 A;  2ZNV C;  1YD8 U;  4XX5 A;  3DPD A;  2DAJ A;  4GOC A;  4II3 B;  2HE7 A;  3B08 A;  3U0N A;  2PJH A;  3SVR A;  3DQJ A;  4H3M A;  4EEW A;  2MW5 A;  3DQ3 A;  1EMC A;  5FVF A;  4YL8 A;  1LXD A;  1WX9 A;  3EVR A;  4KEX A;  4ZFS A;  4ANV A;  5C1Z A;  3PSE B;  3UFZ A;  3M22 A;  1XSS A;  2IZV B;  1WH3 A;  1WRD B;  4J6I A;  2G6E A;  2O6V A;  1EF1 A;  3GJ1 A;  3SSK A;  3ZUL A;  1P1A A;  1WXV A;  4IZN A;  2KN5 A;  2R2Q A;  4HQC A;  2H5R A;  5E6P A;  2R2O A;  5LTR A;  2WHS A;  4HLE A;  5DU0 A;  4FHJ A;  3DQL A;  4PS8 A;  2A5U A;  1UH6 A;  4PPL A;  2WX1 A;  1WZ0 A;  4MJS B;  1TBE A;  1Q0W B;  2JZ3 B;  3DBR I;  2AWK A;  4F1S A;  1Q5W B;  2Z6X A;  5DTY A;  4KW4 A;  3OJ4 B;  4Z4K A;  4H48 A;  2G4D B;  3IFW B;  3MJW A;  3DQU A;  2LWP A;  4IG7 B;  2OGR A;  4ANW A;  4IM2 A;  2AHA A;  1RMO A;  2BPS A;  1W7U A;  3PTF C;  4AS8 A;  2PPH A;  4ICU A;  4DKN A;  2KQS A;  2N1V A;  2MX2 A;  4H3L A;  3NS8 A;  1ZGO A;  4NQL B;  4II2 B;  2KO3 A;  4GDL B;  1WYW B;  1EMA A;  2ASQ A;  5T3I A;  2M0X A;  3APC A;  3ZNH B;  1V49 A;  3DPW A;  2LGX A;  1IP9 A;  3P28 A;  1B9C A;  4CYE A;  5DPG A;  1WGY A;  1SE9 A;  3VTU A;  2QRF A;  1JC0 A;  4W6B A;  3SVS A;  1ISN A;  4XOV A;  1E8W A;  1WGD A;  3ML8 A;  2DUG A;  5GMV A;  3LF3 A;  4ZB1 A;  4AJY B;  2VVH A;  2IBI B;  3IR8 A;  2L3Z A;  5J17 A;  4IK1 A;  4KV2 A;  4LDT D;  1WJU A;  4RYS A;  3SG6 A;  2IO1 B;  4W6P A;  3ZTC A;  3NT3 A;  1WE7 A;  4KVG B;  2BKF A;  3DVG Y;  3QK0 A;  3WAO A;  2WX0 A;  3DBS A;  2EMO A;  5DTZ A;  4JFG A;  2V4E A;  2O2B A;  1ZGP A;  2M1M A;  4KZC A;  5DPH A;  1V9J A;  3LSA A;  4W6N A;  2K8B A;  3GZN I;  3B0A A;  4W72 A;  1WJN A;  1WM2 A;  3H7P B;  1KJT A;  4JIO U;  3V3D A;  4GB9 A;  5C23 A;  2HGD A;  4DHJ B;  1V5O A;  4DHZ B;  4ZF4 A;  5DQM A;  4WJQ A;  4E71 A;  2FID A;  3JSV A;  4EMQ A;  2D11 A;  3V6E B;  3EK4 A;  4GMV A;  3T8M A;  3EVU A;  4W73 A;  2YE0 A;  2D2Q A;  3DQ4 A;  1W7S A;  4HCN B;  4I6N B;  1E7V A;  2V4E C;  1WXA A;  3U30 A;  1NI2 A;  3QWZ B;  1JRU A;  2VZX A;  2C7N B;  1WGG A;  3ZNG C;  3DOW A;  2AWT A;  2J0M A;  3PLU A;  2XK5 A;  2ICR A;  5BTT A;  2OTE A;  3Q3F A;  2KJ6 A;  1Q73 A;  2LRW A;  3SG5 A;  2DD7 A;  3JYU A;  2AWL A;  3CFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...