3AI5A

Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
300
structure length
299
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of small proteins assisted by green fluorescent protein
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein, transcription
molecule keywords yeast enhanced green fluorescent protein,Ubiquitin
total genus 84
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ai5A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ai5A02
3OSQA 4E3CA 1XAEA 1OTRB 2XBBC 3GEXA 4W7XA 4FN2A 2D10A 2D07B 3ZTDA 4W75A 2L76A 4LJPB 2GW3A 4PYUA 2WHSA 2DD9A 2EMSA 3DVNU 3ZUJA 4GF6B 2FWQA 4ASWC 5DQMA 2MLBA 1WYWB 3EK8A 2C9WB 4MH0E 4FADA 2J0KA 3VH4B 4JLCA 3SVSA 2C7MB 3BXCA 1GNUA 4H3MA 1UISA 1LXDA 2CU1A 2BGFA 1Z1QA 3IR8A 1RFAA 4KW4A 3DQ3A 3MJWA 4MEMA 2GBNA 5KTGA 3DQ2A 4II3B 4X57B 3VK1A 4MGIE 1LQBA 3EKHA 2KQSA 3EVUA 1W7TA 3DQ8A 3X0WA 4JF9A 1V5OA 2D2QA 2NBUA 1TZ1A 3IBEA 2L05A 1OEYJ 2BPSA 2JZ3B 2KWUB 4BOSC 4NQKE 3R66C 4IUMB 4DXQA 3AULA 2OKWA 4EN1A 4NJ6A 4II2B 1ZUXA 5KHQA 4I6LB 3DBSA 2EMDA 2I1KA 2GBRA 3AU4A 3TMTA 4JGHB 2MWSB 4GESB 4CYEA 3H9DA 3BX9A 4K1RB 3SDLC 4EZLA 4LJCA 4W7RA 2MBBB 5FHVA 4GXBA 1RMOA 1X1MA 4IK3A 1HE8A 3AXCA 4RMAA 2KLGA 2EKEC 3ZIMA 2JPHA 1H6RA 1NDDA 2KFKB 5CTRC 3E5VA 4TV3A 4ZBLA 5EXBA 2JY6A 3L16A 3PGEA 2LZ6A 4K81A 5C23A 1E7UA 4MGYE 5DPHA 1JC1A 1QYFA 4P76A 1E8WA 1XQQA 3TL5A 2CR5A 2WIQA 1P3QU 3EK4A 3PLVA 5HZUA 4IC7B 2WURA 3CFAA 3QA8A 3W1DA 3DQOA 2DDDA 2ASQA 4NQLB 3B0AA 4BVUC 3ADFA 2G45B 2CHZA 2G2SB 2OOBB 2EMNA 5L83A 3R3MA 4EUTA 4TKNA 4E71A 1UH6A 1IP9A 5DTXA 1MG8A 2JZZA 2NCNA 2DZJA 1QYQA 4B5YA 3GL4A 1V2YA 2DUIA 5CHVC 4WWNA 3SVUA 4J6IA 2HPWA 3D32A 1M94A 3QIJA 4I6NB 2L0TA 3PSEB 4K7UA 1CMXB 2N1WA 3DQCA 3SVCA 3DQJA 4PPKA 2A56B 4I2YA 1KLVA 2O6VB 3ZUFA 1E8XA 5LTPA 1V86A 2PPHA 4W7EA 3IVFA 3W1SC 1EMAA 2NS5A 2HQZA 1Q0WB 3QHTA 2G3QB 1R4MI 3LVAA 2KHWB 3BXBA 1UZXB 4WJNA 3SRYA 4A20A 2B3AA 2ZNVC 3NT3A 3ST2A 4RM8A 4ANVA 2KN5A 5DY6A 2MP2A 2FCSA 3JW0X 1SE9A 3A1QB 1WZ0A 5DTLA 4WQOB 2DD7A 3PRMB 3PLUA 1Z5SB 3A33B 2LXAA 4HQCA 1WX8A 2O2VA 4A3PA 2ZCCA 4NNJB 2RGFA 4ZIOA 2DAFA 2Z1OA 1XSSA 2KVRA 3KH0A 3OLMD 3M24A 2C60A 3RWAA 2G4DB 2VVIA 2Q6PA 2IY0B 1TGZB 4H3NA 3ZW3A 4NY0A 5CHFA 2EMTA 1JC0A 4BDUA 3E5WA 3DQFA 5BTTB 3DCGA 3U0MA 4ANXA 2O24A 2JF5A 2G3OA 3ML8A 4KF5C 4ZF4A 3DQ6A 2GBJA 3DOWA 4LDTB 2R2QA 4HQ9A 1BFPA 4OGSA 1Z1PA 2O6VA 1JRUA 1GC7A 3TIXA 5BTTA 3RZWC 3VICA 3A9JA 5CX3A 4L13A 2ZPNA 4P1QA 2C9IA 4ZYNA 3SSYA 2YVCA 2FCNA 1E5WA 3EVVA 1OEYA 3QWZB 4MGKE 4A3OA 4W73A 4B6WA 2RD0A 4KVGB 2BKRB 2LGYA 3ECIA 2D11A 4F8CB 2O2VB 3EK7A 2HQKA 2M4NA 2DYMA 3AU5A 3KCTA 3MHSD 5DCNA 1R4NI 3M22A 2BYEA 3VXWA 1WX7A 1RAXA 4Q9XA 3PS6A 5D7GA 5DPGA 2A4ZA 1HCJA 2AEHA 3WIMA 2Z0DB 1WM2A 4W6OA 5FVGA 1GGXA 2N7EA 3N30A 2QLEA 1EMFA 3SS0A 4JC2A 2HCGA 4W9KA 1AARA 2G6EA 5AZHA 2OKYA 1L7YA 3P28A 4EULA 4AJWA 2H5QA 3OGOA 2WSNA 4WJQA 4HCNB 3LF3A 2LGXA 5EXUA 3UGBB 3GZNI 4TZAA 4KAGA 4WJPA 2G6YA 4DXMA 4BKGA 3PREA 1V5TA 3U0NA 4GB9A 4PS8A 4GOCA 3APDA 1E90A 2IB5A 3SSPA 4DK5A 1WRDB 5EB6A 4W6FA 5HZSA 3DQDA 1WZ3A 4BFRA 2KNBA 4W9FA 2XK5A 4XX5A 5FVFA 4KV2A 2DUHA 2KKCA 4W6UA 4RYSA 2C9JA 4DHJB 4HVFA 5G55A 1HUYA 4B30A 1FXTB 2V3SA 4PS3A 2NR2A 3LA1A 1C3TA 1YX6B 3H7SA 3DQLA 5E6OA 2IY1B 2AL3A 2OTEA 2DUEA 2QLGB 3GB3A 4FLHA 2H5RA 3MGFA 3CGLA 1I35A 2QRFA 5FR6A 3IFWB 2LXCA 2CHWA 2IO3B 2IO2B 4OHSA 4W9CA 4B9KA 5E6PA 2O6VD 1T0YA 2K1FA 3M3JA 2IO1B 4IZNA 3NS8A 1NBFC 1P9DU 2ZCBA 3ZRFA 4LDTD 1RM9A 4FHKA 2NPTA 3DBLI 3KYCD 2N9XA 2MRPA 2FIFA 1Y8RC 2FCMA 3TJPA 2DX5B 3VAWA 2L7RA 3SSLA 1Z2MA 3PPAA 2LJ5A 4KZ0A 2ARLA 4M8MA 3A1QA 3DVGX 4W69A 3SVNA 1LM8B 1K8RB 1Q73A 2L00B 3SVOA 1RRBA 4PPJA 5HKHA 3SSTA 4LJOB 3V61A 4FHJA 1QYOA 2AHAA 2VVJA 2ZPYA 2M17A 3WLDA 4L1IA 1NI2A 2PE9A 5J18A 4ZF3A 3BY4B 2KMCA 3PJBA 4HE4A 2DYOA 3VDZA 1TTNA 2XEWA 2O2BA 1EMGA 3RULA 2FUHB 1C4FA 4ZRJA 1OXEA 1I42A 3ENEA 3VH3B 2M1MA 2ZVNA 2K8HA 3MTNB 2H6VA 3I3TB 3C0RB 5CHWA 5HZOA 3DBRI 2OJRA 1GJZA 2M8SA 2PXWA 3DQKA 2KJ6A 2B3PA 4IK8A 5H89A 2B3QA 3A4RA 1WE7A 4JL9A 1YJFA 2KC1A 4Z4KA 4DXPA 4W6PA 3QAQA 4W72A 5AQBB 2ZZPB 3R7QA 1ZW7A 4XOWA 2AH8A 4ZF5A 3LS3A 3HHMA 2KDEB 3A4SC 1Q4BA 1WXSA 4JEOA 4NPNA 3Q3JA 5F9GA 4W6RA 1WM3A 4WWPA 4DHZB 2FIDA 1KM7A 5JHBA 4J88A 3W1YA 4GIVA 1UELA 3VFKA 1WR6E 2GBKA 2K25A 5J2RA 3PV1A 1YIWA 2JADA 3H1RA 2PE6B 1WXVA 2HD5B 3WAPA 3QARA 2W9NA 3ZNID 2YE1A 5DPSA 2MW5A 3IP2A 1GC6A 2QHOA 3DQNA 1L2NA 4W9DA 4W6BA 4W7CA 4J8AA 3U0KA 2N4FA 2AWJA 2GX2A 3DPXA 3H7PA 2AL6A 3L08A 3GOEA 4W9LA 4GDLA 3WANA 1UBIA 4HXDA 5TR5A 4BBNF 4EEWA 5DPWA 4ANWA 2K8CA 2KFKA 3KCSA 2VVHA 4Q7TA 2A46A 2CKHB 3EKJA 3VHTB 5LTQA 3QC8B 3LSAA 2BWES 3SG6A 3O78A 3QK0A 3H1OA 5HZTA 3N32A 5L95C 1EMCA 4ZINA 3VHTC 2RH7A 3I19A 4FA6A 4TQ0A 2VRRB 1P98A 3V6EB 3VTVA 5G2NA 3ZNZB 2DENB 4R6BA 2C7NB 4MJSA 4IWOA 4R6DA 1YD8U 4BKSA 4H3LA 3ST3A 4MGZE 4HPLB 1MYWA 3ED8A 2HRSA 4KZCA 1QZEA 5HGEA 3L13A 4FULA 1F09A 1WJNA 3A9KB 1WR1A 3ZVVA 4W6JA 4B30B 2OJKA 2DUGA 1Q4AA 5DPJA 2UWQA 3HM3A 2LUEA 3IHPC 1EMKA 3VTWA 2KO3A 2KTFA 1QY3A 3KW5B 2YLMA 3UG0A 3PRPB 1RMPA 3APCA 4W7DA 2IB6A 5D94A 2IZVB 1YFPA 3QCAA 3ST4A 3G9AA 4BOZB 5DQBA 1S3SG 2POXA 2A54B 4W6TA 3OJ4B 4GN1A 3U7DA 1XA9A 3SVBA 3IG3A 4MDKE 2KC2A 2KTRA 4ANJA 2FNJB 2V4LA 2J0JA 1QXTA 4M0WB 4AOFA 2HJ8A 2YFPA 4KEXA 3O65B 4IM3A 2ZVOA 3VQIA 1UD7A 2BYVE 2IO0B 3OJ3A 3ZTFA 1GFLA 1BT0A 1W7SA 3CF6E 4DBGA 1OGWA 4TQ1A 1PQSA 4ICUA 4W6KA 2KX0A 4OVUA 2ZMWA 3X23A 1EO6A 1XD3B 3CSFA 3SVRA 5J17A 2Y5BB 1VCBA 3LVDA 4W9HA 3SG5A 4NAWB 2KDIA 1ISNA 2IOVA 1WGHA 3S05A 2C7HA 3DQIA 1XQMA 3SSHA 4DWFA 4HVBA 3DQ9A 4EMQA 3CFFA 3N3KB 5DTYA 5DPIA 3CBEA 2I1JA 3U0LA 1W7UA 2MQJA 1RRXA 4KA9A 1J8CA 3RD2A 2IBIB 3SSKA 2HE7A 1S6ZA 3DDCB 1ZGPA 3ZDTA 2V4EA 3E5TA 2PJHA 2GX0A 2JXXA 3SVDA 3BXAA 4ZDVA 2KWCA 1OQYA 3PJ7A 4FJVB 4AUQC 2GBMA 4ZRKA 3UINB 2NVUI 1WMHB 3K1KA 4EDSA 4GGQA 5LXHA 4EFOA 2HJOA 3KYDD 4HWIB 2K6QA 5LLIA 2JRIB 2FL1A 2WSOA 3PTFC 4W6SA 4KIKB 4IM2A 4KDIC 2K39A 4N9F4 4W9EA 2HGDA 4AP4C 4ORNA 3SG4A 1YQBA 4JRBA 4DXOA 1E8ZA 2G4SA 2KXJA 2Z6ZA 4MM3A 2EMOA 2JT4B 2ICRA 2L3ZA 5HBDA 2KFJA 4DDGD 2Z0EB 4XL5A 2BF8B 4GDLB 3SVEA 2QU1A 1OXFA 3CFHA 3R7RA 5GMVA 1P1AA 4PFEA 2KOXA 3RYTA 1WJ6A 3WA0A 2JVCA 4W74A 4HDOA 3BINA 3VTUA 1WX9A 4W6IA 4HPMB 2A50B 3NEZA 5BT0A 2CHXA 2KZRA 5DPTA 2GW4B 5JHAA 1Q4CA 4MJSB 3NT9A 2AWMA 2G5ZB 2WISA 1XMZA 2IYDB 2FCQA 4IK5A 2YE0A 1GL4A 2FAZA 4M8NA 1F9JA 2R2OA 5EB7A 5H88A 3VUWA 1H8CA 4GDKB 2QLIA 3ZNHB 3DQEA 3ZRCA 4GSWA 3APFA 4TZGA 2JUOA 5FVIA 3NEDA 3KUDB 2MP2B 2G3DB 1EMEA 5KHOA 2ZO6A 4AWJA 2PEAA 3GJ2A 2M0XA 3EVPA 1YZWA 3T8MA 2PXSA 3H7PB 5LK4A 1Q5WB 4DKNA 2RR9A 4CHKA 2BWFA 2KMAA 4KF4A 2H5PA 4TUUA 3QQ8B 1WXAA 4ANUA 4IWQA 5DRGA 4EKUA 3U8ZA 4IG7B 4OY4A 4WAAA 2ZNVB 3PIBA 4EDOA 4PS7A 1KJTA 3NHEB 4CO7A 3DPWA 2A52B 3WAMA 2AWTA 2LI5A 2DZIA 2K6DB 2J7QB 2GMIC 3WCKA 4KF5A 3JYUA 4GDKA 2Y0GA 4DXAB 4RM9A 3SG2A 5EXCI 4XOVA 3UIPB 2BKFA 3QJZA 5IA7A 2KK8A 4PPLA 5HW9A 1EF1A 1EMBA 3DBHI 1TBEA 3DVGY 4DXNA 3EFUA 4JQWC 3M63B 2WDTB 3LVCA 3SD5A 1V81A 1U4AA 3DQ1A 4L12A 1A5RA 4W6AA 3DQUA 2D3GA 1SGHA 4W6LA 3ONSA 2VZXA 3U8PA 2N7DA 5LTRA 4KPIA 4F7ZA 5DU0A 1WF9A 4W7AA 1YHGA 3SSVA 3U8AA 3CSTA 1J0GA 3PZDA 1WGDA 4W9JA 5C1ZA 4XZ4A 2LD9A 3P2BA 2LVQA 4XC2A 3EECA 2KLCA 3V6CB 3P8UA 4W77A 2KJHB 2JWZA 4BBNC 2V4EC 3W1SA 1YJ1A 3B1LX 3PT2B 1JBZA 1XT9B 4GMVA 3A9JB 4LJDA 4NWSA 2Q57A 4BKSD 3U8CA 2V4EB 5H87A 3DVNV 3Q3FA 3O77A 1WGYA 1YJ2A 4W6NA 3KVFB 4K7SA 1WMHA 4Q7UA 3H6NA 1G7KA 2WHUA 3RUIB 3A9KA 3KUZA 4EOYA 1F0BA 3RWTA 2P4MA 3CB9A 5EJUA 4W6CA 3ZUNA 3S2AA 4WJOA 1WJ4A 2NBWB 2JRHA 4KGFA 2QLGA 1Q4DA 3CD1A 4W76A 4JFGA 3JSVA 3PVLA 4HQ8A 4Q7RA 2ZMUA 3DQ7A 3K9PB 1S1QB 3SV5A 4ZRIA 1D3ZA 2NBVB 3RT3B 4JGEA 2V1YA 1V6EA 4F1SA 1RMMA 1WI0A 4W7FA 4AS8A 2MCNB 3HIZA 4OVVA 1MOUA 1C1YB 2REXA 2N9EB 2A47A 4G50A 4KSLC 3L10B 3DQVA 2H9WA 4UTSA 4KW8A 2K8BA 2ZEQA 2RSUA 2QZ0A 3V3DA 2Z6XA 3ZTCA 4NAWA 3T9LA 2DDCA 4KIKA 5D2MB 2KX3A 1WH3A 2DZMA 4AR7A 4HJKA 4DDID 2L0FA 2HGYA 2MA9B 1E7VA 2LRWA 2AWKA 1VD2A 4MSMB 1H4UA 4LCDE 4PYZA 1WE6A 3EC8A 4RYWA 1KP5A 3NZUA 4DXIA 4B95A 5DRFA 3NZSA 2C5LC 2BYFA 2LASA 1H4RA 5JH5C 4G3XB 4W9IA 3V60A 1J19A 4DHJD 1EF5A 2WHTA 2G16B 3L54A 3ST0A 2VAEA 2L8JA 2HTHA 4URKA 4MELA 2MSED 2KDBA 2N1VA 4IW0A 1WFYA 3ZLZA 3WLCA 4H48A 3ZKJC 1OXDA 3CD9A 1RLFA 2MBQA 4EZJA 5T3IA 2AWLA 1GG3A 2MX2A 3PRZA 4ZFSA 4BKTA 2ZJDA 4I6PA 3H1UA 4Q9WA 2GOWA 2A48A 2QT2A 2A5UA 1KYRA 1V49A 3OAWA 4U2VA 1GUAB 3TBLD 2UYZB 3JVZX 3DQMA 5DPRA 3NF0A 3AI5A 4LQUA 1V80A 4OQWA 2DZKA 3DQHA 5BO4B 1ZGQA 3ML9A 4W6DA 4IM0A 2MBOA 3DQAA 2KWVB 2WYQA 4LQTA 3ALBA 2J0MA 3VUYA 5E6NA 1ZGUB 3DPDA 2HFCA 3ZO5B 1YX5B 2DHZA 4XVPA 2ZO7A 3RZFA 4W6GA 2OTBA 2LWPA 3UFZA 3DQ5A 4HLEA 3AKOA 5EHUA 1EMLA 4AJYB 4FBJB 2IE2A 3M95A 4Z4MA 4FJZA 2CS4A 2KTRB 4OJ0A 3ZDMC 2BTJA 4ICVA 1EMMA 2H5OA 4W6MA 4LJBA 3K9OB 3LDZE 5EBJA 2DYBA 1WY8A 3CMMB 3VVWB 2LVOA 2DAJA 5D6JB 2N9PC 3UIOB 4JIOU 4GOBA 1WJUA 5AEKB 3SG3A 3VHTA 4E74A 2KANA 5DTZA 2FZUA 3A8SA 2WX1A 4HK2A 1YHIA 5LXIB 1KYSA 3M62B 3TMPB 4FJYA 2YDZA 1YHHA 2MBHA 2RPQA 1UBQA 2G6XA 3PHWB 2WX0A 2KJRA 4N3DA 3TCAA 4IK4A 3JSVB 1Q1OA 3WAOA 4LJDC 3NOBA 1B9CA 3L0WB 2A53B 3TMRA 2XK5B 1IPGA 4W6HA 2DUFA 3GJ1A 3U30A 4K7WA 2OGRA 1Q4EA 1WIAA 2NPTB 3UQAA 2LVPA 3AI4A 1SIFA 1E8YA 4YL8A 3EHVA 4ZB1A 3HM6X 2MBEA 3NY5A 2Z59B 4RTCA 4DHZE 2LRUA 5BQLA 4GU2A 1UGMA 1JBYA 4G0NB 5IAAC 3WALA 3LJ3A 5EDSA 1ZKHA 4G11A 2Z6YA 5JZEB 3KUCB 3B08A 3LF4B 4DKMA 3PJ5A 4KDLB 3VUXA 4WWOA 2WWZA 1WGGA 3ZULA 2KDFB 3DPZA 3ZNGC 3PHXB 1P0RA 5J2OA 3DQ4A 3W1CA 4HDQA 2LGDA 1WXMA 1IYFA 4HCPB 1G6JA 4KGEA 2H8QA 2QLHA 3UQBA 4H47A 3OSRA 4EZKA 3EVRA 2O29A 1EUVB 4NJ7A 3V62A 1V9JA 4KSKC 5AZFA 1KYPA 1WGRA 4IK1A 3SG7A 4W9GA 3QX1A 4XGYA 3SHQA 2VADA 3HK0A 1CV7A 5AZGA 2KQ7A 3L17A 1LFDA 4KW9A 1KOTA 2AYOB 3RCZA 1ZGOA 4LW5A 2KD0A 4J89A 4IWPA 4P7IA 3SU8X 3UF8A 4IK9A 4MSQB 1MOVA
chains in the Genus database with same CATH superfamily
3OSQA 4E3CA 1XAEA 3TSSA 1OTRB 2XBBC 3OWEB 3GEXA 4W7XA 3DHHC 4FN2A 4MACA 3IT4B 1E0ZA 2QSDA 3FILB 2D10A 2D07B 3ZTDA 2LJIA 2KACA 4W75A 1ZOYB 2L76A 4LJPB 2GW3A 4PYUA 1V1OA 2WHSA 2DD9A 2EMSA 3DVNU 3ZUJA 3I5JC 4GF6B 3NRZA 2FWQA 4ASWC 1NVID 5DQMA 1FFUA 3T3OA 2MLBA 1WYWB 3EK8A 2BB5A 2C9WB 1FRDA 4MH0E 2RDHA 1EWYC 1OQRA 3EA6A 4FADA 2J0KA 3VH4B 1FD6A 4JLCA 3SVSA 2C7MB 3BXCA 1GNUA 4H3MA 1CQVA 4RF0A 1UISA 1LXDA 2CU1A 2BGFA 1Z1QA 3IR8A 1RFAA 2KDMA 4KW4A 3DQ3A 2VZKD 2WXHA 3MJWA 4RCOA 1GPXA 4MEMA 2GBNA 5KTGA 3DQ2A 4II3B 4X57B 4M01A 3VK1A 4MGIE 5H8YE 1LQBA 3EKHA 3P42A 2KQSA 3EVUA 1W7TA 3Q8CA 3DQ8A 3X0WA 4JF9A 1TY2A 1V5OA 2D2QA 2NBUA 1TZ1A 3KLSX 3ZJUA 3IBEA 2L05A 1OEYJ 2BPSA 2JZ3B 2KWUB 1SJED 4BOSC 1FXIA 4OZBA 4NQKE 4LK0M 3E9SA 3AMZA 3R66C 4IUMB 4DXQA 3AULA 3HVZA 3IXSA 2OKWA 4EN1A 2E3TA 1FO4A 4NJ6A 4II2B 2FUG1 1ZUXA 2KT7A 5BYRA 1TIFA 4JWUC 2WXLA 5KHQA 3H8HA 4AQ7A 4N58A 4I6LB 1JMLA 3DBSA 2EMDA 2I1KA 2GBRA 3AEEB 3W5VB 3AU4A 3TMTA 4JGHB 2MWSB 4GESB 4CYEA 3H9DA 3BX9A 4K1RB 3SDLC 3W5UB 4EZLA 4LJCA 4W7RA 2MBBB 5FHVA 4GXBA 1RMOA 1X1MA 2WU2B 4IK3A 1HE8A 1ZXIA 3AXCA 4RMAA 4YTPB 3CWIA 3PZ8A 3GZNB 1N5XA 2KLGA 1FM0D 2EKEC 3ZIMA 2JPHA 1H6RA 1NDDA 2KFKB 5CTRC 3E5VA 1ACCA 4NJCA 4TV3A 4ZBLA 2Z8LA 5EXBA 2JY6A 3L16A 3PGEA 1FEHA 1QILA 2LZ6A 4K81A 5C23A 2HTME 2WXGA 1E7UA 4MGYE 5DPHA 1JC1A 3MC0B 1QYFA 4P76A 1E8WA 1XQQA 4RH6A 3TL5A 4L23A 2CR5A 1OQQA 2WIQA 2JX5A 1P3QU 1FMAD 3EK4A 3PLVA 2K9XA 5HZUA 4IC7B 2WURA 3CFAA 2BBCA 3QA8A 3W1DA 3AE4B 3DQOA 2DDDA 2QEJC 2ASQA 4NQLB 1T0QC 2FE8A 3B0AA 4BVUC 1TKGA 2WXQA 2MHJA 1QF6A 3ADFA 2G45B 2ZW1A 4HKZE 4C56C 2CHZA 2G2SB 1NYQA 2OOBB 2EMNA 1YQ4B 5L83A 3R3MA 2JWUA 4EUTA 4TKNA 4E71A 2WXFA 2J4XA 1UH6A 3AV8A 1IP9A 5DTXA 1MG8A 2KQ4X 1E6EB 3AE8B 2JZZA 2NCNA 2DZJA 1QYQA 4B5YA 3GL4A 1VLBA 1V2YA 1EU3A 1ZXHA 1YN5A 2DUIA 5CHVC 5E6JA 4WWNA 3SVUA 4J6IA 2JYEA 5HFYA 2WXPA 2HPWA 3D32A 1SEBD 1M94A 4WURA 4H2AA 3QIJA 4I6NB 2L0TA 2JXTA 1L4DB 1L5PA 3PSEB 1VJKA 4K7UA 4NAMA 1CMXB 2N1WA 3VRAB 1L0XB 2KAJA 3DQCA 3P4SB 2JZPA 3SVCA 1WYGA 2K5PA 3DQJA 4PPKA 2A56B 4I2YA 1KLVA 2O6VB 3ZUFA 3RNGC 4DXGA 1E8XA 5LTPA 1I4QA 1V86A 2PPHA 2PIAA 4W7EA 1AN8A 3IVFA 3W1SC 4XDDA 1EMAA 2NS5A 2HQZA 1Q0WB 5BYSA 3QHTA 2G3QB 1R4MI 3LVAA 2KHWB 3BXBA 1UZXB 4WJNA 3TEZA 3SRYA 4A20A 1I4GA 2B3AA 2ZNVC 3NT3A 3ST2A 4RM8A 2QIEB 3B2GA 4ANVA 4JWSC 2KN5A 5DY6A 2MP2A 3B2FA 3O13A 2FCSA 3JW0X 1SE9A 3A1QB 3ZXVA 1WZ0A 5DTLA 4WQOB 2DD7A 4ZHPA 4XGAB 3PRMB 1F0ZA 1HA5A 3C19A 3Q3OC 3PLUA 1Z5SB 3A33B 4YSYB 2LXAA 1XLOA 1ZPSA 2YEPF 5H92C 4HQCA 1V97A 1WX8A 2O2VA 4A3PA 2ZCCA 4NNJB 1B9RA 2JU6X 3SFDB 2RGFA 4ZIOA 2DAFA 2Z1OA 3AEAB 2L32A 2VH2A 1XSSA 2KVRA 3KH0A 4ZHOA 3OLMD 3M24A 2C60A 3RWAA 1ZDXA 1L6UA 2ACZB 2G4DB 2VVIA 2IDYA 5GXGB 2Q6PA 2IY0B 1TGZB 4H3NA 1UUPA 3ZW3A 1RM6C 4NY0A 1D4BA 3GS2A 3MHZA 1I4XA 2XNAC 3RN9C 1VDVA 5CHFA 1IGDA 2EMTA 1JC0A 4BDUA 2K0PA 4LLGM 3E5WA 3DQFA 5BTTB 2R61A 3RNAC 5T8IA 3DCGA 3U0MA 4ANXA 2O24A 4JE3B 3RNEC 2JF5A 2G3OA 3ML8A 4KF5C 3DWGC 4ZF4A 3EUB2 3DQ6A 5JXVA 1JRPA 2GBJA 3DOWA 4LDTB 2R2QA 4HQ9A 1BFPA 2PW9A 4OGSA 4P16A 1Z1PA 2O6VA 1JRUA 1GC7A 3TIXA 5BTTA 2V4IB 3RZWC 3VICA 3A9JA 5CX3A 4L13A 1FXAA 4YXDB 3AH7A 2ZPNA 4P1QA 2C9IA 4ZYNA 3SSYA 1SSNA 2YVCA 2FCNA 1E5WA 1RFKA 1AWDA 3EVVA 1EU4A 1OEYA 2WDQB 3QWZB 4MGKE 4A3OA 1UNSA 3MP9A 4W73A 5AUKA 4B6WA 2RD0A 4KVGB 2BKRB 1TJEA 5HHDG 2LGYA 3ECIA 2D11A 4F8CB 2O2VB 3EK7A 4REZA 4AS1A 3AE3B 2HQKA 2M4NA 2DYMA 3AU5A 3KCTA 3MHSD 4OVZA 1N6ZA 1OFFA 1R4NI 5DCNA 1HQRD 3M22A 2BYEA 3VXWA 1WX7A 1RAXA 4Q9XA 3N1XC 3PS6A 3NVVA 5D7GA 5DPGA 2A4ZA 1HCJA 2AEHA 3WIMA 2Z0DB 1WM2A 4KX6B 4W6OA 5FVGA 1GGXA 2N7EA 3VRBB 1IBXB 3N30A 5EE1A 2HDEA 2QLEA 1EMFA 3SS0A 1SB3C 4JC2A 2HCGA 4W9KA 1IBXA 3ETRA 1AARA 2G6EA 1YN3A 5AZHA 2OKYA 1L7YA 3P28A 4EULA 1KH0A 1AW7A 2WNMA 3R2IA 4AJWA 2H5QA 3OGOA 2WSNA 4WJQA 4HCNB 3LF3A 1K50A 1A70A 5I4DA 2LGXA 5EXUA 1I4PA 3BWUD 3UGBB 3GZNI 4TZAA 3SR6A 4KAGA 1GOZA 4WJPA 2V3NA 2G6YA 4DXMA 4BKGA 1I7HA 3PREA 4US8A 1V5TA 3U0NA 4GB9A 4PS8A 1MVKA 4GOCA 3APDA 1E90A 1D5XC 3NVWA 2IB5A 3SSPA 1XLPA 4DK5A 1WRDB 5EB6A 4W6FA 5HZSA 3DQDA 1WZ3A 2D5GA 4BFRA 2KNBA 4W9FA 2WXMA 1TS2A 2XK5A 4XX5A 1R4NB 2LHEA 5FVFA 4KV2A 2DUHA 2KKCA 4W6UA 4RYSA 2I38A 2C9JA 1GB1A 4DHJB 2LGSA 4HVFA 5G55A 4KKIA 1HUYA 4B30A 1FXTB 2V3SA 2RDGA 4PS3A 2HJ1A 2NR2A 3LA1A 1C3TA 1YX6B 3H7SA 3DQLA 4LNKA 5E6OA 2IY1B 2AL3A 2OTEA 2DUEA 2QLGB 3GB3A 4FLHA 2H5RA 3MGFA 2WDRB 4WAFA 3CGLA 1WRIA 3P1MA 1I35A 2GB1A 2QRFA 5FR6A 3IFWB 2LXCA 2CHWA 2IO3B 1JWSD 2IO2B 4MM3B 4OHSA 1C4PA 4W9CA 3W9CB 4OW0A 4B9KA 2LFIA 3AM9A 5E6PA 2D3CA 2O6VD 1FRRA 1FFVA 1T0YA 1XLQA 2K1FA 3M3JA 2IO1B 4IZNA 1FPYA 1SIJA 3ZGZA 5IKCM 3Q69A 3NS8A 1NBFC 1P9DU 2ZCBA 2BT6A 3IT6B 3ZRFA 4LDTD 1RM9A 4FHKA 2NPTA 3DBLI 3KYCD 2N9XA 2MRPA 1PGAA 2FIFA 1Y8RC 3EFCA 2FCMA 3TJPA 2DX5B 1L0YB 3VAWA 2L7RA 3SSLA 2QDFA 1Z2MA 3PPAA 2LJ5A 4KZ0A 2ARLA 1L0VB 2KVZA 4M8MA 3A1QA 4YTNB 3DVGX 4W69A 1GB4A 1C9FA 4YSZB 2N9KA 2SEBD 3SVNA 1P7EA 1MHHE 4Q2JA 1LM8B 1VZ7A 4KGRA 4RGOS 1K8RB 1I4HA 1Q73A 2L00B 4USAA 4WH4A 3SVOA 1RRBA 2NMQA 3FAHA 4PPJA 5HKHA 2LHDA 1TKEA 2KYWA 1UF0A 3SSTA 4LJOB 4ACFA 3V61A 4FHJA 1QYOA 1KLUD 1NENB 2AHAA 2VVJA 4D2KA 4KKJA 2ZPYA 2M17A 3WLDA 2I2YA 4L1IA 3AEDB 1NI2A 3AE6B 2PE9A 5J18A 4ZF3A 3BY4B 1N63A 2KMCA 3PJBA 3Q3NC 4HE4A 2QJLA 2DYOA 3VDZA 1TTNA 2XEWA 4CQNA 2O2BA 4C80A 1EMGA 3RULA 2FUHB 1C4FA 4ZRJA 1OXEA 1N62A 1I42A 3DBLB 4K3CA 2BW2A 1YJJA 3ENEA 3VH3B 3NS1A 2M1MA 2ZVNA 3AE1B 1MFWA 3ZXRA 1TYGB 2K8HA 3MTNB 2MJDA 5G5HA 2H6VA 3I3TB 3C0RB 1QOBA 5HZOA 3DBRI 5CHWA 2SAKA 2OJRA 1GJZA 4TMAB 2M8SA 2FBWB 1E7PB 2PXWA 3WCQA 1C78A 3DQKA 2KJ6A 3RI7C 1QOGA 2B3PA 4IK8A 5H89A 2LEKA 3AE7B 2B3QA 3A4RA 5BYQA 1WE7A 4JL9A 3U2SC 1YJFA 2KC1A 4Z4KA 4DXPA 3R2TA 2DLBA 4ZRQA 4W6PA 3QAQA 4C4VA 4BAXA 4W72A 5AQBB 2ZZPB 3R7QA 5LNK1 2J42A 1ZW7A 4M00A 4XOWA 2AH8A 3HUIA 4ZF5A 3TEYA 3LS3A 1NYRA 4A55A 3UI3A 3MJ5A 1FCCC 3N1ZC 4MH8A 3HHMA 4HPPA 2KDEB 1LO5D 4J3OD 2RDBC 4UDUC 3A4SC 1Q4BA 3KWVA 1WXSA 4JEOA 2KWDA 4NPNA 1KTKA 3GE3C 3Q3JA 5F9GA 4ZRPA 1TS3A 4W6RA 1WM3A 4WWPA 1YJIA 4DHZB 1ENFA 2FIDA 2PVOD 1BUIC 1KM7A 2V3PA 4LNNA 5JHBA 2J52A 4J88A 3W1YA 4GIVA 1ET6A 1C4CA 2D3AA 4A8XC 1UELA 3VFKA 1WR6E 2GBKA 3DBRB 1C77A 2K25A 2M56B 5J2RA 3PV1A 1YIWA 2JADA 3H1RA 2PE6B 3J9CA 1WXVA 2HD5B 3DHIC 3WAPA 3QARA 2W9NA 1DOYA 3ZNID 3LB8C 1IGCA 2YE1A 4N6EB 1SJHD 1PYWD 5EE0A 5DPSA 2MW5A 3IP2A 1GC6A 2INDC 4RGTA 1V1PA 2QHOA 3DQNA 2AQ2B 1BXTA 2W3SA 4W9DA 3VR9B 1L2NA 4W6BA 2N4FA 4W7CA 4J8AA 3U0KA 1DYQA 2AWJA 3N9YC 4OHJA 4M02A 2GX2A 3DPXA 3H7PA 2AL6A 4A9AA 3L08A 3GOEA 4W9LA 4GDLA 3WANA 1UBIA 1PGXA 1JWMD 4HXDA 5TR5A 4BBNF 2W55A 4EEWA 3ZJTA 5DPWA 4ANWA 2K8CA 2KFKA 3KCSA 2VVHA 4Q7TA 2A46A 2CKHB 3EKJA 1TZOA 3VHTB 5LTQA 3QC8B 4IDIA 4A90A 3LSAA 2BWES 4A6QA 3SG6A 3GE8C 3O78A 3QK0A 3NZ3A 3H1OA 5HZTA 5IO9A 2KN4A 3N32A 3P4PB 5L95C 4L2YA 1EMCA 4ZINA 3VHTC 2RH7A 3I19A 1T6BX 4FA6A 4TQ0A 1KF6B 2VRRB 2WHIA 1P98A 3V6EB 3VTVA 5G2NA 1YN4A 3ZNZB 2DENB 1J7BA 4R6BA 2C7NB 4MJSA 2UU7A 4IWOA 2INCC 4TSSA 4R6DA 1N5WA 1YD8U 4BKSA 2LGIA 1GAQB 2JQRB 4H3LA 4B0MA 2M0AA 1JW9D 1EM7A 3ST3A 4MGZE 4HPLB 1MYWA 3ED8A 2HRSA 4KZCA 4OZCA 1QZEA 4WQMA 5HGEA 3L13A 4FULA 3NVZA 1F09A 1WJNA 1FIQA 3A9KB 1UWXA 1WR1A 3ZVVA 3KQ4A 1L6VA 4W6JA 4B30B 2OJKA 2DUGA 4XYCA 3BIID 1EWCA 1LGRA 1Q4AA 5DPJA 2UWQA 2W82A 5EE9A 2L1AA 3HM3A 2LUEA 2VH1A 3AEBB 3IHPC 1EMKA 1QT9A 3VTWA 2KO3A 2KTFA 1QY3A 3KW5B 2YLMA 3UG0A 3PRPB 4JPSA 1K51A 1RMPA 3APCA 4W7DA 2IB6A 5D94A 2IZVB 3C8YA 1YFPA 2IPKD 2LMCA 3SEBA 3QCAA 3ST4A 3G9AA 4BOZB 4ZYSA 5DQBA 2DBYA 1TKYA 1XEEA 1S3SG 1ROEA 3CIRB 1JWAD 2POXA 1HTQA 2A54B 2GLSA 4W6TA 3OJ4B 4GN1A 2J53A 3U7DA 1XA9A 3SVBA 1VZ6A 3IG3A 4MDKE 2KC2A 5EE3A 2KTRA 4ANJA 2FNJB 3Q2AC 2V4LA 2WP9B 2W3RA 2WDVB 1NEKB 4R3DA 2J0JA 1QXTA 1MI0A 1T0RC 4M0WB 4AOFA 2HJ8A 1Y56A 1V1PB 1E10A 2YFPA 1D5ZC 3Q8FA 4KEXA 2B76B 3O65B 4IM3A 2ZVOA 2IGDA 3VQIA 1UD7A 2BYVE 2IO0B 3OJ3A 3ZTFA 1GFLA 1BT0A 1C76A 1PUTA 1V8CA 1CJEA 4WWMA 1W7SA 3CF6E 4DBGA 1OGWA 1TS4A 4TQ1A 1PQSA 4ICUA 1PDXA 4W6KA 2KX0A 4OVUA 2ZMWA 3X23A 3TEWA 1EO6A 1XD3B 3CSFA 3SVRA 5J17A 3I57A 2Y5BB 4K3BA 1VCBA 2QILA 3LVDA 4XWTA 4W9HA 5D3DA 3SG5A 4NAWB 2KDIA 2BS4B 1ISNA 2IOVA 1WGHA 2AX5A 5IP4D 3S05A 2C7HA 3DQIA 4N59A 4RGNA 2JSVX 1XQMA 3SSHA 4DWFA 1VZ8A 4HVBA 3DQ9A 4EMQA 3CFFA 3Q14C 3N3KB 4YT0B 4HEA1 3BZDB 1ZUD2 1JROA 5DTYA 5DPIA 2WXRA 3CBEA 2I1JA 3LXFA 3AEGB 3U0LA 3MFGA 1W7UA 1IUEA 2MQJA 1RRXA 1JWBD 4KA9A 4MT5A 1J8CA 3RD2A 1PFDA 3ABVB 2IBIB 3SSKA 1HZ6A 3BVZA 1MG4A 3ZQ4A 2HE7A 1S6ZA 2Y5CA 1ZGPA 3DDCB 3ZDTA 2V4EA 3E5TA 2PJHA 3U4EG 2V9HA 2GX0A 2JXXA 3SVDA 3BXAA 4ZDVA 2KWCA 1WXQA 1HTOA 1OQYA 1QOAA 3PJ7A 4FJVB 3RPFC 4XWWA 4M0WA 4AUQC 2GBMA 2EELA 4ZRKA 3UINB 2NVUI 3Q3MC 1WMHB 3K1KA 2YEPB 4EDSA 4GGQA 3PO0A 4PT5A 5LXHA 4EFOA 2HJOA 3KYDD 4HWIB 2K6QA 5LLIA 2JRIB 2FL1A 2WSOA 3PTFC 4W6SA 4KIKB 4IM2A 4KDIC 2K39A 4N9F4 4RGMA 4W9EA 2HGDA 2TSSA 1KLGD 4AP4C 4ORNA 3SG4A 1YQBA 4JRBA 4DXOA 1E8ZA 2G4SA 2KXJA 2Z6ZA 4MM3A 2EMOA 1JCKB 2JT4B 2ICRA 2L3ZA 5HBDA 3IAM1 2KFJA 4BZAA 4DDGD 2Z0EB 4XL5A 2BF8B 3DWMA 5FR3A 2PTLA 2EKIA 4GDLB 3SVEA 2QU1A 1OXFA 3CFHA 1M4VA 3R7RA 1JALA 5GMVA 1JQ4A 1P1AA 4PFEA 2KOXA 2WS3B 3RYTA 1WJ6A 3WA0A 2JVCA 1TS5A 3EGRA 4W74A 4HDOA 3BINA 3VTUA 1WX9A 3FC4A 2K3UA 4W6IA 4HPMB 1SE3A 2A50B 3NEZA 1YQ3B 5BT0A 2CHXA 2KZRA 3BVGA 3P4QB 1CK1A 5DPTA 2GW4B 5JHAA 1Q4CA 3TUOA 4IKGA 4MJSB 2PLPA 3NT9A 2AWMA 2G5ZB 2WISA 2KMMA 2OJWA 1XMZA 1T3QA 2IYDB 2FCQA 2WXKA 4IK5A 2YE0A 4P6VF 1GL4A 4GLSC 2FAZA 3R8BA 5AUIA 4M8NA 1F9JA 2R2OA 1N61A 5EB7A 5H88A 3VUWA 1H8CA 4C00A 2GI9A 4GDKB 2QLIA 2Y3AA 3ZNHB 2CJNA 2G1EA 1VRAB 3IAS1 3DQEA 1MJDA 4US9A 3ZRCA 4GSWA 3APFA 3Q8EA 1E9MA 4TZGA 3KWLA 1WWTA 2JUOA 2IGHA 3DBHB 5FVIA 3NEDA 3KUDB 2MP2B 1D5MC 2G3DB 1EMEA 5KHOA 2ZO6A 4AWJA 2PEAA 3GJ2A 1F1HA 2M0XA 4O1NA 3EVPA 1YZWA 3T8MA 2PXSA 3H7PB 5LK4A 4RF1A 1Q5WB 4DKNA 2RR9A 4CHKA 1F2RI 2BWFA 2KMAA 4KF4A 3AN1A 2H5PA 4TUUA 3BK2A 3RNFC 3QQ8B 1RYJA 4DQOC 3P63A 1WXAA 3I9V1 2WU5B 4ANUA 4IWQA 1BMLC 2ICIA 2E6XA 5DRGA 4EKUA 2PMVA 2BYTA 1MHXA 3U8ZA 4IG7B 4OY4A 4WAAA 2ZNVB 3PIBA 2WGSA 4EDOA 1AYFA 2W54A 4PS7A 1KJTA 4RFBA 3BYTB 3AECB 3NHEB 4CO7A 3DPWA 2A52B 3WAMA 2AWTA 2LI5A 2DZIA 2K6DB 2J7QB 2GMIC 3WCKA 2BVCA 4KF5A 3JYUA 1VR9A 2Y0GA 4GDKA 4RM9A 4DXAB 2MEKA 3SG2A 5EXCI 4PK1A 4XOVA 3UIPB 2BKFA 3QJZA 5IA7A 2KK8A 2LUMA 4PPLA 5HW9A 1EF1A 1EMBA 2H89B 3DBHI 1TBEA 3DVGY 4DXNA 3EFUA 4JQWC 3M63B 2WDTB 3LVCA 4XE0A 3SD5A 1V81A 2M19A 4OZAA 1U4AA 3DQ1A 4L12A 2XN9C 1A5RA 4W6AA 3DQUA 3FKYA 3E56A 2D3GA 1SGHA 4W6LA 3ONSA 2VZXA 3U8PA 2N7DA 4YSXB 5LTRA 2AQ1B 3ZYYX 4KPIA 2AQ3B 2ONQA 3W2DA 4F7ZA 5DU0A 1WF9A 3SFEB 4W7AA 1KRHA 1XXGA 1YHGA 3SSVA 3U8AA 3CSTA 1SXTA 2BS3B 1J0GA 1DOIA 3PZDA 1WGDA 4W9JA 1SE4A 1FCLA 5C1ZA 4XZ4A 2LD9A 3P2BA 2LVQA 4XC2A 3EECA 2KLCA 3V6CB 3P8UA 5HI1A 4W77A 5IOIA 4LNFA 4HRSA 2KJHB 2JWZA 2MJEA 2V4EC 4BBNC 3W1SA 1YJ1A 3B1LX 1QOFA 3PT2B 1R7SA 2PKOA 1JBZA 1XT9B 3HRDD 4GMVA 3A9JB 4KGSA 4LJDA 4NWSA 2Q57A 4BKSD 3U8CA 2V4EB 5H87A 1C4AA 3DVNV 3LYYA 1F52A 2RMMA 3Q3FA 3O77A 1PGBA 5TSSA 1WGYA 3N20C 1YJ2A 4W6NA 3KVFB 4K7SA 1WMHA 4Q7UA 3H6NA 2WXOA 1G7KA 2WHUA 1UGJA 3A9KA 3KUZA 3RUIB 1F0BA 4EOYA 3RWTA 2P4MA 3CB9A 5EJUA 4W6CA 1CZPA 3S2AA 3ZUNA 4WJOA 1WJ4A 2NBWB 2JRHA 1XCQL 4KGFA 3NG0A 5MPOA 2QLGA 1Q4DA 3CD1A 4W76A 4JFGA 3JSVA 3BK1A 2N7JA 3PVLA 3VR8B 4HQ8A 4Q7RA 1JWUD 2L52A 2ZMUA 3DQ7A 3K9PB 1S1QB 3FILA 3SV5A 4ZRIA 1D3ZA 2BB6A 2NBVB 3RT3B 3RMKC 2JYTA 4JGEA 2V1YA 1V6EA 4F1SA 1RMMA 2IJ0A 1WI0A 4W7FA 4AS8A 2MCNB 3HIZA 2N0SB 2NTTA 2ON8A 2QMTA 1MOUA 2DWQA 4OVVA 4XDCA 1C1YB 3BVMA 2REXA 3BYYB 2N9EB 2A47A 4G50A 4KSLC 3L10B 3HVDA 3DQVA 2H9WA 4UTSA 5FKAC 4KW8A 2K8BA 3B9JA 1F77A 2ZEQA 2RSUA 2QZ0A 1YMHE 3V3DA 2Z6XA 3ZTCA 4NAWA 3T9LA 2DDCA 4KIKA 1QKZA 1TY0A 5D2MB 2KX3A 1WH3A 2DZMA 4AR7A 1ZP0B 4HJKA 4DDID 2L0FA 1SBBB 4P1CC 2INNE 2HGYA 2MA9B 1E7VA 2LRWA 2AWKA 1P7FA 4B0EA 1VD2A 3Q8BA 4MSMB 1J7AA 1H4UA 4LCDE 4PYZA 1WE6A 3AE2B 3EC8A 4RYWA 2DNFA 1KP5A 3NZUA 3RFZB 4DXIA 1F2RC 4B95A 2Q5WD 5DRFA 4HKQA 2Y5PA 3NZSA 2C5LC 2BYFA 2WXJA 3L4PA 2OEDA 2LASA 1HZ5A 1H4RA 2WQYB 5JH5C 4G3XB 4W9IA 3V60A 1J19A 4DHJD 1EF5A 2WHTA 2G16B 3L54A 4ITKA 4S17A 1I4RA 5HG2A 1UWMA 3ST0A 2VAEA 3NJTA 2L8JA 3AB5A 5G5GA 2HTHA 4URKA 4MELA 2MSED 2KDBA 2N1VA 4IW0A 1WFYA 3ZLZA 3WLCA 4H48A 3ZKJC 1OXDA 5C3JB 3CD9A 1FNVA 1NI3A 4ZOHC 1RLFA 2MBQA 4EZJA 5T3IA 2AWLA 1GG3A 2MX2A 3PRZA 4ZFSA 4BKTA 2ZJDA 4I6PA 3H1UA 2QCZA 4DXFA 4L1BA 4Q9WA 2GOWA 4NZLB 2A48A 2QT2A 2A5UA 1KYRA 1V49A 3MC8A 3OAWA 4U2VA 1GUAB 3TBLD 2UYZB 3JVZX 3I63C 3DQMA 5DPRA 3NF0A 3AI5A 4LQUA 1V80A 4OQWA 2DZKA 3U7ZA 3DQHA 5BO4B 1ZGQA 3ML9A 3Q6BA 4W6DA 4IM0A 2MBOA 3DQAA 2KWVB 1T5XD 3MC9A 2WYQA 4LQTA 3P4RB 4KGTA 2BTEA 1N60A 3ALBA 2J0MA 3VUYA 4IOIE 2BS2B 5E6NA 5BMGA 1ZGUB 3DPDA 2HFCA 3ZJVA 1HXYD 3ZO5B 1YX5B 2DHZA 1DOXA 1K52A 2BQQA 3AEFB 4XVPA 2ZO7A 5IN7A 1HEZE 3RZFA 4W6GA 2V0GA 2OTBA 2LWPA 3UFZA 1STEA 3DQ5A 1MPEA 4HLEA 4ARIA 3AKOA 5EHUA 1EMLA 4AJYB 4FBJB 2IE2A 1Q10A 3M95A 1ZDVA 4Z4MA 4FJZA 2CS4A 2KTRB 4OJ0A 3ZDMC 2BTJA 4ICVA 1EMMA 2H5OA 4W6MA 4LJBA 4HJGE 3K9OB 2G9HD 3LDZE 3NUHB 2RPVA 2H88B 5EBJA 1ESFA 1WSPA 2DYBA 3T3NA 3RNBC 1K53A 1WY8A 1WGKA 3CMMB 3VVWB 2LVOA 1T0SC 4FXCA 1XCTL 4C7ZA 4C7YA 2DAJA 2MJ3A 5D6JB 2N9PC 3UIOB 4EE2A 5BMHA 4YWGG 1D6EC 3GP7A 4JIOU 4GOBA 1WJUA 5AEKB 3SG3A 3VHTA 4E74A 1B1ZA 2KANA 5DTZA 4YTMB 1DGJA 2FZUA 3A8SA 2WX1A 4HK2A 1QLBB 1YHIA 4HROA 5LXIB 1KYSA 4LNIA 3M62B 3TMPB 3AE5B 4FJYA 2WXNA 2YDZA 1YHHA 4P1BC 2MBHA 2RPQA 1XLNA 1UBQA 2G6XA 3PHWB 2WX0A 5BMIA 2KJRA 4LNOA 2OHFA 4N3DA 3TCAA 4IK4A 3JSVB 1Q1OA 3WAOA 4LJDC 3NOBA 1C79A 1B9CA 3RNCC 3L0WB 2A53B 3TMRA 2XK5B 1IPGA 1SE2A 2X8XX 4W6HA 2DUFA 3GJ1A 3U30A 2WXIA 4K7WA 2WLBA 2OGRA 1Q4EA 1WIAA 2NPTB 3UQAA 2MH7A 5C2TB 2LVPA 3AI4A 1SIFA 1XO3A 4ARCA 2L83A 1E8YA 1SF0A 1L4ZB 4YL8A 5D3IB 2D3BA 3EHVA 4ZB1A 3HM6X 2ZW0A 3Q8AA 2GRIA 2MBEA 3NY5A 1RWSA 2Z59B 4RTCA 4DHZE 1KFYB 3GB1A 1XF5L 2LRUA 3V3XA 5BQLA 4GU2A 1UGMA 1JBYA 4G0NB 4WIPA 1FNWA 5IAAC 4JX1C 1J7CA 3WALA 3LJ3A 2X38A 4RNAA 3OG5A 5EDSA 1ZKHA 3V05A 4G11A 2Z6YA 5JZEB 3KUCB 4LTUA 3B08A 3LF4B 4DKMA 3PJ5A 4KDLB 3VUXA 4WWOA 2WWZA 1FNUA 1WGGA 3ZULA 2KDFB 3NVYA 3DPZA 3ZNGC 3PHXB 1P0RA 2CJOA 5J2OA 3DQ4A 1TT5B 3N1YC 3W1CA 4HDQA 2LGDA 1WXMA 4C4VB 4HCPB 1IYFA 1G6JA 4KGEA 2H8QA 2QLHA 3UQBA 2INPE 4H47A 2K22A 3OSRA 4EZKA 1ZE3D 4S0RA 1QQRA 3EVRA 2IGGA 2PVGC 3U52E 2O29A 1EUVB 4NJ7A 3V62A 1V9JA 1R4MB 1ET9A 2N9LA 4KSKC 2QC8A 3DHGC 5AZFA 1KYPA 1WGRA 4IK1A 3SG7A 4W9GA 3QX1A 1YOVB 4XGYA 3SHQA 2VADA 3HK0A 1CV7A 5AZGA 2KQ7A 3L17A 1LFDA 3TEXA 3AE9B 4KW9A 1KOTA 2AYOB 3RCZA 1ZGOA 2NTSA 4QAYA 1YNTE 3PZ7A 2VZKB 4LW5A 2KD0A 2CU3A 4J89A 3URYA 4IWPA 4P7IA 3SU8X 3UF8A 4IK9A 4MSQB 5FK9C 1MOVA
chains in the Genus database with same CATH topology
3OSQA 4E3CA 1XAEA 1OTRB 2XBBC 3GEXA 4W7XA 4FN2A 2D10A 2D07B 3ZTDA 4W75A 2L76A 4LJPB 2GW3A 4PYUA 2WHSA 2DD9A 2EMSA 3DVNU 3ZUJA 4GF6B 2FWQA 4ASWC 5DQMA 2MLBA 1WYWB 3EK8A 2C9WB 4MH0E 4FADA 2J0KA 3VH4B 4JLCA 3SVSA 2C7MB 3BXCA 1GNUA 4H3MA 1UISA 1LXDA 2CU1A 2BGFA 1Z1QA 3IR8A 1RFAA 4KW4A 3DQ3A 3MJWA 4MEMA 2GBNA 5KTGA 3DQ2A 4II3B 4X57B 3VK1A 4MGIE 1LQBA 3EKHA 2KQSA 3EVUA 1W7TA 3DQ8A 3X0WA 4JF9A 1V5OA 2D2QA 2NBUA 1TZ1A 3IBEA 2L05A 1OEYJ 2BPSA 2JZ3B 2KWUB 4BOSC 4NQKE 3R66C 4IUMB 4DXQA 3AULA 2OKWA 4EN1A 4NJ6A 4II2B 1ZUXA 5KHQA 4I6LB 3DBSA 2EMDA 2I1KA 2GBRA 3AU4A 3TMTA 4JGHB 2MWSB 4GESB 4CYEA 3H9DA 3BX9A 4K1RB 3SDLC 4EZLA 4LJCA 4W7RA 2MBBB 5FHVA 4GXBA 1RMOA 1X1MA 4IK3A 1HE8A 3AXCA 4RMAA 2KLGA 2EKEC 3ZIMA 2JPHA 1H6RA 1NDDA 2KFKB 5CTRC 3E5VA 4TV3A 4ZBLA 5EXBA 2JY6A 3L16A 3PGEA 2LZ6A 4K81A 5C23A 1E7UA 4MGYE 5DPHA 1JC1A 1QYFA 4P76A 1E8WA 1XQQA 3TL5A 2CR5A 2WIQA 1P3QU 3EK4A 3PLVA 5HZUA 4IC7B 2WURA 3CFAA 3QA8A 3W1DA 3DQOA 2DDDA 2ASQA 4NQLB 3B0AA 4BVUC 3ADFA 2G45B 2CHZA 2G2SB 2OOBB 2EMNA 5L83A 3R3MA 4EUTA 4TKNA 4E71A 1UH6A 1IP9A 5DTXA 1MG8A 2JZZA 2NCNA 2DZJA 1QYQA 4B5YA 3GL4A 1V2YA 2DUIA 5CHVC 4WWNA 3SVUA 4J6IA 2HPWA 3D32A 1M94A 3QIJA 4I6NB 2L0TA 3PSEB 4K7UA 1CMXB 2N1WA 3DQCA 3SVCA 3DQJA 4PPKA 2A56B 4I2YA 1KLVA 2O6VB 3ZUFA 1E8XA 5LTPA 1V86A 2PPHA 4W7EA 3IVFA 3W1SC 1EMAA 2NS5A 2HQZA 1Q0WB 3QHTA 2G3QB 1R4MI 3LVAA 2KHWB 3BXBA 1UZXB 4WJNA 3SRYA 4A20A 2B3AA 2ZNVC 3NT3A 3ST2A 4RM8A 4ANVA 2KN5A 5DY6A 2MP2A 2FCSA 3JW0X 1SE9A 3A1QB 1WZ0A 5DTLA 4WQOB 2DD7A 3PRMB 3PLUA 1Z5SB 3A33B 2LXAA 4HQCA 1WX8A 2O2VA 4A3PA 2ZCCA 4NNJB 2RGFA 4ZIOA 2DAFA 2Z1OA 1XSSA 2KVRA 3KH0A 3OLMD 3M24A 2C60A 3RWAA 2G4DB 2VVIA 2Q6PA 2IY0B 1TGZB 4H3NA 3ZW3A 4NY0A 5CHFA 2EMTA 1JC0A 4BDUA 3E5WA 3DQFA 5BTTB 3DCGA 3U0MA 4ANXA 2O24A 2JF5A 2G3OA 3ML8A 4KF5C 4ZF4A 3DQ6A 2GBJA 3DOWA 4LDTB 2R2QA 4HQ9A 1BFPA 4OGSA 1Z1PA 2O6VA 1JRUA 1GC7A 3TIXA 5BTTA 3RZWC 3VICA 3A9JA 5CX3A 4L13A 2ZPNA 4P1QA 2C9IA 4ZYNA 3SSYA 2YVCA 2FCNA 1E5WA 3EVVA 1OEYA 3QWZB 4MGKE 4A3OA 4W73A 4B6WA 2RD0A 4KVGB 2BKRB 2LGYA 3ECIA 2D11A 4F8CB 2O2VB 3EK7A 2HQKA 2M4NA 2DYMA 3AU5A 3KCTA 3MHSD 5DCNA 1R4NI 3M22A 2BYEA 3VXWA 1WX7A 1RAXA 4Q9XA 3PS6A 5D7GA 5DPGA 2A4ZA 1HCJA 2AEHA 3WIMA 2Z0DB 1WM2A 4W6OA 5FVGA 1GGXA 2N7EA 3N30A 2QLEA 1EMFA 3SS0A 4JC2A 2HCGA 4W9KA 1AARA 2G6EA 5AZHA 2OKYA 1L7YA 3P28A 4EULA 4AJWA 2H5QA 3OGOA 2WSNA 4WJQA 4HCNB 3LF3A 2LGXA 5EXUA 3UGBB 3GZNI 4TZAA 4KAGA 4WJPA 2G6YA 4DXMA 4BKGA 3PREA 1V5TA 3U0NA 4GB9A 4PS8A 4GOCA 3APDA 1E90A 2IB5A 3SSPA 4DK5A 1WRDB 5EB6A 4W6FA 5HZSA 3DQDA 1WZ3A 4BFRA 2KNBA 4W9FA 2XK5A 4XX5A 5FVFA 4KV2A 2DUHA 2KKCA 4W6UA 4RYSA 2C9JA 4DHJB 4HVFA 5G55A 1HUYA 4B30A 1FXTB 2V3SA 4PS3A 2NR2A 3LA1A 1C3TA 1YX6B 3H7SA 3DQLA 5E6OA 2IY1B 2AL3A 2OTEA 2DUEA 2QLGB 3GB3A 4FLHA 2H5RA 3MGFA 3CGLA 1I35A 2QRFA 5FR6A 3IFWB 2LXCA 2CHWA 2IO3B 2IO2B 4OHSA 4W9CA 4B9KA 5E6PA 2O6VD 1T0YA 2K1FA 3M3JA 2IO1B 4IZNA 3NS8A 1NBFC 1P9DU 2ZCBA 3ZRFA 4LDTD 1RM9A 4FHKA 2NPTA 3DBLI 3KYCD 2N9XA 2MRPA 2FIFA 1Y8RC 2FCMA 3TJPA 2DX5B 3VAWA 2L7RA 3SSLA 1Z2MA 3PPAA 2LJ5A 4KZ0A 2ARLA 4M8MA 3A1QA 3DVGX 4W69A 3SVNA 1LM8B 1K8RB 1Q73A 2L00B 3SVOA 1RRBA 4PPJA 5HKHA 3SSTA 4LJOB 3V61A 4FHJA 1QYOA 2AHAA 2VVJA 2ZPYA 2M17A 3WLDA 4L1IA 1NI2A 2PE9A 5J18A 4ZF3A 3BY4B 2KMCA 3PJBA 4HE4A 2DYOA 3VDZA 1TTNA 2XEWA 2O2BA 1EMGA 3RULA 2FUHB 1C4FA 4ZRJA 1OXEA 1I42A 3ENEA 3VH3B 2M1MA 2ZVNA 2K8HA 3MTNB 2H6VA 3I3TB 3C0RB 5CHWA 5HZOA 3DBRI 2OJRA 1GJZA 2M8SA 2PXWA 3DQKA 2KJ6A 2B3PA 4IK8A 5H89A 2B3QA 3A4RA 1WE7A 4JL9A 1YJFA 2KC1A 4Z4KA 4DXPA 4W6PA 3QAQA 4W72A 5AQBB 2ZZPB 3R7QA 1ZW7A 4XOWA 2AH8A 4ZF5A 3LS3A 3HHMA 2KDEB 3A4SC 1Q4BA 1WXSA 4JEOA 4NPNA 3Q3JA 5F9GA 4W6RA 1WM3A 4WWPA 4DHZB 2FIDA 1KM7A 5JHBA 4J88A 3W1YA 4GIVA 1UELA 3VFKA 1WR6E 2GBKA 2K25A 5J2RA 3PV1A 1YIWA 2JADA 3H1RA 2PE6B 1WXVA 2HD5B 3WAPA 3QARA 2W9NA 3ZNID 2YE1A 5DPSA 2MW5A 3IP2A 1GC6A 2QHOA 3DQNA 1L2NA 4W9DA 4W6BA 4W7CA 4J8AA 3U0KA 2N4FA 2AWJA 2GX2A 3DPXA 3H7PA 2AL6A 3L08A 3GOEA 4W9LA 4GDLA 3WANA 1UBIA 4HXDA 5TR5A 4BBNF 4EEWA 5DPWA 4ANWA 2K8CA 2KFKA 3KCSA 2VVHA 4Q7TA 2A46A 2CKHB 3EKJA 3VHTB 5LTQA 3QC8B 3LSAA 2BWES 3SG6A 3O78A 3QK0A 3H1OA 5HZTA 3N32A 5L95C 1EMCA 4ZINA 3VHTC 2RH7A 3I19A 4FA6A 4TQ0A 2VRRB 1P98A 3V6EB 3VTVA 5G2NA 3ZNZB 2DENB 4R6BA 2C7NB 4MJSA 4IWOA 4R6DA 1YD8U 4BKSA 4H3LA 3ST3A 4MGZE 4HPLB 1MYWA 3ED8A 2HRSA 4KZCA 1QZEA 5HGEA 3L13A 4FULA 1F09A 1WJNA 3A9KB 1WR1A 3ZVVA 4W6JA 4B30B 2OJKA 2DUGA 1Q4AA 5DPJA 2UWQA 3HM3A 2LUEA 3IHPC 1EMKA 3VTWA 2KO3A 2KTFA 1QY3A 3KW5B 2YLMA 3UG0A 3PRPB 1RMPA 3APCA 4W7DA 2IB6A 5D94A 2IZVB 1YFPA 3QCAA 3ST4A 3G9AA 4BOZB 5DQBA 1S3SG 2POXA 2A54B 4W6TA 3OJ4B 4GN1A 3U7DA 1XA9A 3SVBA 3IG3A 4MDKE 2KC2A 2KTRA 4ANJA 2FNJB 2V4LA 2J0JA 1QXTA 4M0WB 4AOFA 2HJ8A 2YFPA 4KEXA 3O65B 4IM3A 2ZVOA 3VQIA 1UD7A 2BYVE 2IO0B 3OJ3A 3ZTFA 1GFLA 1BT0A 1W7SA 3CF6E 4DBGA 1OGWA 4TQ1A 1PQSA 4ICUA 4W6KA 2KX0A 4OVUA 2ZMWA 3X23A 1EO6A 1XD3B 3CSFA 3SVRA 5J17A 2Y5BB 1VCBA 3LVDA 4W9HA 3SG5A 4NAWB 2KDIA 1ISNA 2IOVA 1WGHA 3S05A 2C7HA 3DQIA 1XQMA 3SSHA 4DWFA 4HVBA 3DQ9A 4EMQA 3CFFA 3N3KB 5DTYA 5DPIA 3CBEA 2I1JA 3U0LA 1W7UA 2MQJA 1RRXA 4KA9A 1J8CA 3RD2A 2IBIB 3SSKA 2HE7A 1S6ZA 3DDCB 1ZGPA 3ZDTA 2V4EA 3E5TA 2PJHA 2GX0A 2JXXA 3SVDA 3BXAA 4ZDVA 2KWCA 1OQYA 3PJ7A 4FJVB 4AUQC 2GBMA 4ZRKA 3UINB 2NVUI 1WMHB 3K1KA 4EDSA 4GGQA 5LXHA 4EFOA 2HJOA 3KYDD 4HWIB 2K6QA 5LLIA 2JRIB 2FL1A 2WSOA 3PTFC 4W6SA 4KIKB 4IM2A 4KDIC 2K39A 4N9F4 4W9EA 2HGDA 4AP4C 4ORNA 3SG4A 1YQBA 4JRBA 4DXOA 1E8ZA 2G4SA 2KXJA 2Z6ZA 4MM3A 2EMOA 2JT4B 2ICRA 2L3ZA 5HBDA 2KFJA 4DDGD 2Z0EB 4XL5A 2BF8B 4GDLB 3SVEA 2QU1A 1OXFA 3CFHA 3R7RA 5GMVA 1P1AA 4PFEA 2KOXA 3RYTA 1WJ6A 3WA0A 2JVCA 4W74A 4HDOA 3BINA 3VTUA 1WX9A 4W6IA 4HPMB 2A50B 3NEZA 5BT0A 2CHXA 2KZRA 5DPTA 2GW4B 5JHAA 1Q4CA 4MJSB 3NT9A 2AWMA 2G5ZB 2WISA 1XMZA 2IYDB 2FCQA 4IK5A 2YE0A 1GL4A 2FAZA 4M8NA 1F9JA 2R2OA 5EB7A 5H88A 3VUWA 1H8CA 4GDKB 2QLIA 3ZNHB 3DQEA 3ZRCA 4GSWA 3APFA 4TZGA 2JUOA 5FVIA 3NEDA 3KUDB 2MP2B 2G3DB 1EMEA 5KHOA 2ZO6A 4AWJA 2PEAA 3GJ2A 2M0XA 3EVPA 1YZWA 3T8MA 2PXSA 3H7PB 5LK4A 1Q5WB 4DKNA 2RR9A 4CHKA 2BWFA 2KMAA 4KF4A 2H5PA 4TUUA 3QQ8B 1WXAA 4ANUA 4IWQA 5DRGA 4EKUA 3U8ZA 4IG7B 4OY4A 4WAAA 2ZNVB 3PIBA 4EDOA 4PS7A 1KJTA 3NHEB 4CO7A 3DPWA 2A52B 3WAMA 2AWTA 2LI5A 2DZIA 2K6DB 2J7QB 2GMIC 3WCKA 4KF5A 3JYUA 4GDKA 2Y0GA 4DXAB 4RM9A 3SG2A 5EXCI 4XOVA 3UIPB 2BKFA 3QJZA 5IA7A 2KK8A 4PPLA 5HW9A 1EF1A 1EMBA 3DBHI 1TBEA 3DVGY 4DXNA 3EFUA 4JQWC 3M63B 2WDTB 3LVCA 3SD5A 1V81A 1U4AA 3DQ1A 4L12A 1A5RA 4W6AA 3DQUA 2D3GA 1SGHA 4W6LA 3ONSA 2VZXA 3U8PA 2N7DA 5LTRA 4KPIA 4F7ZA 5DU0A 1WF9A 4W7AA 1YHGA 3SSVA 3U8AA 3CSTA 1J0GA 3PZDA 1WGDA 4W9JA 5C1ZA 4XZ4A 2LD9A 3P2BA 2LVQA 4XC2A 3EECA 2KLCA 3V6CB 3P8UA 4W77A 2KJHB 2JWZA 4BBNC 2V4EC 3W1SA 1YJ1A 3B1LX 3PT2B 1JBZA 1XT9B 4GMVA 3A9JB 4LJDA 4NWSA 2Q57A 4BKSD 3U8CA 2V4EB 5H87A 3DVNV 3Q3FA 3O77A 1WGYA 1YJ2A 4W6NA 3KVFB 4K7SA 1WMHA 4Q7UA 3H6NA 1G7KA 2WHUA 3RUIB 3A9KA 3KUZA 4EOYA 1F0BA 3RWTA 2P4MA 3CB9A 5EJUA 4W6CA 3ZUNA 3S2AA 4WJOA 1WJ4A 2NBWB 2JRHA 4KGFA 2QLGA 1Q4DA 3CD1A 4W76A 4JFGA 3JSVA 3PVLA 4HQ8A 4Q7RA 2ZMUA 3DQ7A 3K9PB 1S1QB 3SV5A 4ZRIA 1D3ZA 2NBVB 3RT3B 4JGEA 2V1YA 1V6EA 4F1SA 1RMMA 1WI0A 4W7FA 4AS8A 2MCNB 3HIZA 4OVVA 1MOUA 1C1YB 2REXA 2N9EB 2A47A 4G50A 4KSLC 3L10B 3DQVA 2H9WA 4UTSA 4KW8A 2K8BA 2ZEQA 2RSUA 2QZ0A 3V3DA 2Z6XA 3ZTCA 4NAWA 3T9LA 2DDCA 4KIKA 5D2MB 2KX3A 1WH3A 2DZMA 4AR7A 4HJKA 4DDID 2L0FA 2HGYA 2MA9B 1E7VA 2LRWA 2AWKA 1VD2A 4MSMB 1H4UA 4LCDE 4PYZA 1WE6A 3EC8A 4RYWA 1KP5A 3NZUA 4DXIA 4B95A 5DRFA 3NZSA 2C5LC 2BYFA 2LASA 1H4RA 5JH5C 4G3XB 4W9IA 3V60A 1J19A 4DHJD 1EF5A 2WHTA 2G16B 3L54A 3ST0A 2VAEA 2L8JA 2HTHA 4URKA 4MELA 2MSED 2KDBA 2N1VA 4IW0A 1WFYA 3ZLZA 3WLCA 4H48A 3ZKJC 1OXDA 3CD9A 1RLFA 2MBQA 4EZJA 5T3IA 2AWLA 1GG3A 2MX2A 3PRZA 4ZFSA 4BKTA 2ZJDA 4I6PA 3H1UA 4Q9WA 2GOWA 2A48A 2QT2A 2A5UA 1KYRA 1V49A 3OAWA 4U2VA 1GUAB 3TBLD 2UYZB 3JVZX 3DQMA 5DPRA 3NF0A 3AI5A 4LQUA 1V80A 4OQWA 2DZKA 3DQHA 5BO4B 1ZGQA 3ML9A 4W6DA 4IM0A 2MBOA 3DQAA 2KWVB 2WYQA 4LQTA 3ALBA 2J0MA 3VUYA 5E6NA 1ZGUB 3DPDA 2HFCA 3ZO5B 1YX5B 2DHZA 4XVPA 2ZO7A 3RZFA 4W6GA 2OTBA 2LWPA 3UFZA 3DQ5A 4HLEA 3AKOA 5EHUA 1EMLA 4AJYB 4FBJB 2IE2A 3M95A 4Z4MA 4FJZA 2CS4A 2KTRB 4OJ0A 3ZDMC 2BTJA 4ICVA 1EMMA 2H5OA 4W6MA 4LJBA 3K9OB 3LDZE 5EBJA 2DYBA 1WY8A 3CMMB 3VVWB 2LVOA 2DAJA 5D6JB 2N9PC 3UIOB 4JIOU 4GOBA 1WJUA 5AEKB 3SG3A 3VHTA 4E74A 2KANA 5DTZA 2FZUA 3A8SA 2WX1A 4HK2A 1YHIA 5LXIB 1KYSA 3M62B 3TMPB 4FJYA 2YDZA 1YHHA 2MBHA 2RPQA 1UBQA 2G6XA 3PHWB 2WX0A 2KJRA 4N3DA 3TCAA 4IK4A 3JSVB 1Q1OA 3WAOA 4LJDC 3NOBA 1B9CA 3L0WB 2A53B 3TMRA 2XK5B 1IPGA 4W6HA 2DUFA 3GJ1A 3U30A 4K7WA 2OGRA 1Q4EA 1WIAA 2NPTB 3UQAA 2LVPA 3AI4A 1SIFA 1E8YA 4YL8A 3EHVA 4ZB1A 3HM6X 2MBEA 3NY5A 2Z59B 4RTCA 4DHZE 2LRUA 5BQLA 4GU2A 1UGMA 1JBYA 4G0NB 5IAAC 3WALA 3LJ3A 5EDSA 1ZKHA 4G11A 2Z6YA 5JZEB 3KUCB 3B08A 3LF4B 4DKMA 3PJ5A 4KDLB 3VUXA 4WWOA 2WWZA 1WGGA 3ZULA 2KDFB 3DPZA 3ZNGC 3PHXB 1P0RA 5J2OA 3DQ4A 3W1CA 4HDQA 2LGDA 1WXMA 1IYFA 4HCPB 1G6JA 4KGEA 2H8QA 2QLHA 3UQBA 4H47A 3OSRA 4EZKA 3EVRA 2O29A 1EUVB 4NJ7A 3V62A 1V9JA 4KSKC 5AZFA 1KYPA 1WGRA 4IK1A 3SG7A 4W9GA 3QX1A 4XGYA 3SHQA 2VADA 3HK0A 1CV7A 5AZGA 2KQ7A 3L17A 1LFDA 4KW9A 1KOTA 2AYOB 3RCZA 1ZGOA 4LW5A 2KD0A 4J89A 4IWPA 4P7IA 3SU8X 3UF8A 4IK9A 4MSQB 1MOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSQ A;  4E3C A;  1XAE A;  1OTR B;  2XBB C;  3GEX A;  4W7X A;  4FN2 A;  2D10 A;  2D07 B;  3ZTD A;  4W75 A;  2L76 A;  4LJP B;  2GW3 A;  4PYU A;  2WHS A;  2DD9 A;  2EMS A;  3DVN U;  3ZUJ A;  4GF6 B;  2FWQ A;  4ASW C;  5DQM A;  2MLB A;  1WYW B;  3EK8 A;  2C9W B;  4MH0 E;  4FAD A;  2J0K A;  3VH4 B;  4JLC A;  3SVS A;  2C7M B;  3BXC A;  1GNU A;  4H3M A;  1UIS A;  1LXD A;  2CU1 A;  2BGF A;  1Z1Q A;  3IR8 A;  1RFA A;  4KW4 A;  3DQ3 A;  3MJW A;  4MEM A;  2GBN A;  5KTG A;  3DQ2 A;  4II3 B;  4X57 B;  3VK1 A;  4MGI E;  1LQB A;  3EKH A;  2KQS A;  3EVU A;  1W7T A;  3DQ8 A;  3X0W A;  4JF9 A;  1V5O A;  2D2Q A;  2NBU A;  1TZ1 A;  3IBE A;  2L05 A;  1OEY J;  2BPS A;  2JZ3 B;  2KWU B;  4BOS C;  4NQK E;  3R66 C;  4IUM B;  4DXQ A;  3AUL A;  2OKW A;  4EN1 A;  4NJ6 A;  4II2 B;  1ZUX A;  5KHQ A;  4I6L B;  3DBS A;  2EMD A;  2I1K A;  2GBR A;  3AU4 A;  3TMT A;  4JGH B;  2MWS B;  4GES B;  4CYE A;  3H9D A;  3BX9 A;  4K1R B;  3SDL C;  4EZL A;  4LJC A;  4W7R A;  2MBB B;  5FHV A;  4GXB A;  1RMO A;  1X1M A;  4IK3 A;  1HE8 A;  3AXC A;  4RMA A;  2KLG A;  2EKE C;  3ZIM A;  2JPH A;  1H6R A;  1NDD A;  2KFK B;  5CTR C;  3E5V A;  4TV3 A;  4ZBL A;  5EXB A;  2JY6 A;  3L16 A;  3PGE A;  2LZ6 A;  4K81 A;  5C23 A;  1E7U A;  4MGY E;  5DPH A;  1JC1 A;  1QYF A;  4P76 A;  1E8W A;  1XQQ A;  3TL5 A;  2CR5 A;  2WIQ A;  1P3Q U;  3EK4 A;  3PLV A;  5HZU A;  4IC7 B;  2WUR A;  3CFA A;  3QA8 A;  3W1D A;  3DQO A;  2DDD A;  2ASQ A;  4NQL B;  3B0A A;  4BVU C;  3ADF A;  2G45 B;  2CHZ A;  2G2S B;  2OOB B;  2EMN A;  5L83 A;  3R3M A;  4EUT A;  4TKN A;  4E71 A;  1UH6 A;  1IP9 A;  5DTX A;  1MG8 A;  2JZZ A;  2NCN A;  2DZJ A;  1QYQ A;  4B5Y A;  3GL4 A;  1V2Y A;  2DUI A;  5CHV C;  4WWN A;  3SVU A;  4J6I A;  2HPW A;  3D32 A;  1M94 A;  3QIJ A;  4I6N B;  2L0T A;  3PSE B;  4K7U A;  1CMX B;  2N1W A;  3DQC A;  3SVC A;  3DQJ A;  4PPK A;  2A56 B;  4I2Y A;  1KLV A;  2O6V B;  3ZUF A;  1E8X A;  5LTP A;  1V86 A;  2PPH A;  4W7E A;  3IVF A;  3W1S C;  1EMA A;  2NS5 A;  2HQZ A;  1Q0W B;  3QHT A;  2G3Q B;  1R4M I;  3LVA A;  2KHW B;  3BXB A;  1UZX B;  4WJN A;  3SRY A;  4A20 A;  2B3A A;  2ZNV C;  3NT3 A;  3ST2 A;  4RM8 A;  4ANV A;  2KN5 A;  5DY6 A;  2MP2 A;  2FCS A;  3JW0 X;  1SE9 A;  3A1Q B;  1WZ0 A;  5DTL A;  4WQO B;  2DD7 A;  3PRM B;  3PLU A;  1Z5S B;  3A33 B;  2LXA A;  4HQC A;  1WX8 A;  2O2V A;  4A3P A;  2ZCC A;  4NNJ B;  2RGF A;  4ZIO A;  2DAF A;  2Z1O A;  1XSS A;  2KVR A;  3KH0 A;  3OLM D;  3M24 A;  2C60 A;  3RWA A;  2G4D B;  2VVI A;  2Q6P A;  2IY0 B;  1TGZ B;  4H3N A;  3ZW3 A;  4NY0 A;  5CHF A;  2EMT A;  1JC0 A;  4BDU A;  3E5W A;  3DQF A;  5BTT B;  3DCG A;  3U0M A;  4ANX A;  2O24 A;  2JF5 A;  2G3O A;  3ML8 A;  4KF5 C;  4ZF4 A;  3DQ6 A;  2GBJ A;  3DOW A;  4LDT B;  2R2Q A;  4HQ9 A;  1BFP A;  4OGS A;  1Z1P A;  2O6V A;  1JRU A;  1GC7 A;  3TIX A;  5BTT A;  3RZW C;  3VIC A;  3A9J A;  5CX3 A;  4L13 A;  2ZPN A;  4P1Q A;  2C9I A;  4ZYN A;  3SSY A;  2YVC A;  2FCN A;  1E5W A;  3EVV A;  1OEY A;  3QWZ B;  4MGK E;  4A3O A;  4W73 A;  4B6W A;  2RD0 A;  4KVG B;  2BKR B;  2LGY A;  3ECI A;  2D11 A;  4F8C B;  2O2V B;  3EK7 A;  2HQK A;  2M4N A;  2DYM A;  3AU5 A;  3KCT A;  3MHS D;  5DCN A;  1R4N I;  3M22 A;  2BYE A;  3VXW A;  1WX7 A;  1RAX A;  4Q9X A;  3PS6 A;  5D7G A;  5DPG A;  2A4Z A;  1HCJ A;  2AEH A;  3WIM A;  2Z0D B;  1WM2 A;  4W6O A;  5FVG A;  1GGX A;  2N7E A;  3N30 A;  2QLE A;  1EMF A;  3SS0 A;  4JC2 A;  2HCG A;  4W9K A;  1AAR A;  2G6E A;  5AZH A;  2OKY A;  1L7Y A;  3P28 A;  4EUL A;  4AJW A;  2H5Q A;  3OGO A;  2WSN A;  4WJQ A;  4HCN B;  3LF3 A;  2LGX A;  5EXU A;  3UGB B;  3GZN I;  4TZA A;  4KAG A;  4WJP A;  2G6Y A;  4DXM A;  4BKG A;  3PRE A;  1V5T A;  3U0N A;  4GB9 A;  4PS8 A;  4GOC A;  3APD A;  1E90 A;  2IB5 A;  3SSP A;  4DK5 A;  1WRD B;  5EB6 A;  4W6F A;  5HZS A;  3DQD A;  1WZ3 A;  4BFR A;  2KNB A;  4W9F A;  2XK5 A;  4XX5 A;  5FVF A;  4KV2 A;  2DUH A;  2KKC A;  4W6U A;  4RYS A;  2C9J A;  4DHJ B;  4HVF A;  5G55 A;  1HUY A;  4B30 A;  1FXT B;  2V3S A;  4PS3 A;  2NR2 A;  3LA1 A;  1C3T A;  1YX6 B;  3H7S A;  3DQL A;  5E6O A;  2IY1 B;  2AL3 A;  2OTE A;  2DUE A;  2QLG B;  3GB3 A;  4FLH A;  2H5R A;  3MGF A;  3CGL A;  1I35 A;  2QRF A;  5FR6 A;  3IFW B;  2LXC A;  2CHW A;  2IO3 B;  2IO2 B;  4OHS A;  4W9C A;  4B9K A;  5E6P A;  2O6V D;  1T0Y A;  2K1F A;  3M3J A;  2IO1 B;  4IZN A;  3NS8 A;  1NBF C;  1P9D U;  2ZCB A;  3ZRF A;  4LDT D;  1RM9 A;  4FHK A;  2NPT A;  3DBL I;  3KYC D;  2N9X A;  2MRP A;  2FIF A;  1Y8R C;  2FCM A;  3TJP A;  2DX5 B;  3VAW A;  2L7R A;  3SSL A;  1Z2M A;  3PPA A;  2LJ5 A;  4KZ0 A;  2ARL A;  4M8M A;  3A1Q A;  3DVG X;  4W69 A;  3SVN A;  1LM8 B;  1K8R B;  1Q73 A;  2L00 B;  3SVO A;  1RRB A;  4PPJ A;  5HKH A;  3SST A;  4LJO B;  3V61 A;  4FHJ A;  1QYO A;  2AHA A;  2VVJ A;  2ZPY A;  2M17 A;  3WLD A;  4L1I A;  1NI2 A;  2PE9 A;  5J18 A;  4ZF3 A;  3BY4 B;  2KMC A;  3PJB A;  4HE4 A;  2DYO A;  3VDZ A;  1TTN A;  2XEW A;  2O2B A;  1EMG A;  3RUL A;  2FUH B;  1C4F A;  4ZRJ A;  1OXE A;  1I42 A;  3ENE A;  3VH3 B;  2M1M A;  2ZVN A;  2K8H A;  3MTN B;  2H6V A;  3I3T B;  3C0R B;  5CHW A;  5HZO A;  3DBR I;  2OJR A;  1GJZ A;  2M8S A;  2PXW A;  3DQK A;  2KJ6 A;  2B3P A;  4IK8 A;  5H89 A;  2B3Q A;  3A4R A;  1WE7 A;  4JL9 A;  1YJF A;  2KC1 A;  4Z4K A;  4DXP A;  4W6P A;  3QAQ A;  4W72 A;  5AQB B;  2ZZP B;  3R7Q A;  1ZW7 A;  4XOW A;  2AH8 A;  4ZF5 A;  3LS3 A;  3HHM A;  2KDE B;  3A4S C;  1Q4B A;  1WXS A;  4JEO A;  4NPN A;  3Q3J A;  5F9G A;  4W6R A;  1WM3 A;  4WWP A;  4DHZ B;  2FID A;  1KM7 A;  5JHB A;  4J88 A;  3W1Y A;  4GIV A;  1UEL A;  3VFK A;  1WR6 E;  2GBK A;  2K25 A;  5J2R A;  3PV1 A;  1YIW A;  2JAD A;  3H1R A;  2PE6 B;  1WXV A;  2HD5 B;  3WAP A;  3QAR A;  2W9N A;  3ZNI D;  2YE1 A;  5DPS A;  2MW5 A;  3IP2 A;  1GC6 A;  2QHO A;  3DQN A;  1L2N A;  4W9D A;  4W6B A;  4W7C A;  4J8A A;  3U0K A;  2N4F A;  2AWJ A;  2GX2 A;  3DPX A;  3H7P A;  2AL6 A;  3L08 A;  3GOE A;  4W9L A;  4GDL A;  3WAN A;  1UBI A;  4HXD A;  5TR5 A;  4BBN F;  4EEW A;  5DPW A;  4ANW A;  2K8C A;  2KFK A;  3KCS A;  2VVH A;  4Q7T A;  2A46 A;  2CKH B;  3EKJ A;  3VHT B;  5LTQ A;  3QC8 B;  3LSA A;  2BWE S;  3SG6 A;  3O78 A;  3QK0 A;  3H1O A;  5HZT A;  3N32 A;  5L95 C;  1EMC A;  4ZIN A;  3VHT C;  2RH7 A;  3I19 A;  4FA6 A;  4TQ0 A;  2VRR B;  1P98 A;  3V6E B;  3VTV A;  5G2N A;  3ZNZ B;  2DEN B;  4R6B A;  2C7N B;  4MJS A;  4IWO A;  4R6D A;  1YD8 U;  4BKS A;  4H3L A;  3ST3 A;  4MGZ E;  4HPL B;  1MYW A;  3ED8 A;  2HRS A;  4KZC A;  1QZE A;  5HGE A;  3L13 A;  4FUL A;  1F09 A;  1WJN A;  3A9K B;  1WR1 A;  3ZVV A;  4W6J A;  4B30 B;  2OJK A;  2DUG A;  1Q4A A;  5DPJ A;  2UWQ A;  3HM3 A;  2LUE A;  3IHP C;  1EMK A;  3VTW A;  2KO3 A;  2KTF A;  1QY3 A;  3KW5 B;  2YLM A;  3UG0 A;  3PRP B;  1RMP A;  3APC A;  4W7D A;  2IB6 A;  5D94 A;  2IZV B;  1YFP A;  3QCA A;  3ST4 A;  3G9A A;  4BOZ B;  5DQB A;  1S3S G;  2POX A;  2A54 B;  4W6T A;  3OJ4 B;  4GN1 A;  3U7D A;  1XA9 A;  3SVB A;  3IG3 A;  4MDK E;  2KC2 A;  2KTR A;  4ANJ A;  2FNJ B;  2V4L A;  2J0J A;  1QXT A;  4M0W B;  4AOF A;  2HJ8 A;  2YFP A;  4KEX A;  3O65 B;  4IM3 A;  2ZVO A;  3VQI A;  1UD7 A;  2BYV E;  2IO0 B;  3OJ3 A;  3ZTF A;  1GFL A;  1BT0 A;  1W7S A;  3CF6 E;  4DBG A;  1OGW A;  4TQ1 A;  1PQS A;  4ICU A;  4W6K A;  2KX0 A;  4OVU A;  2ZMW A;  3X23 A;  1EO6 A;  1XD3 B;  3CSF A;  3SVR A;  5J17 A;  2Y5B B;  1VCB A;  3LVD A;  4W9H A;  3SG5 A;  4NAW B;  2KDI A;  1ISN A;  2IOV A;  1WGH A;  3S05 A;  2C7H A;  3DQI A;  1XQM A;  3SSH A;  4DWF A;  4HVB A;  3DQ9 A;  4EMQ A;  3CFF A;  3N3K B;  5DTY A;  5DPI A;  3CBE A;  2I1J A;  3U0L A;  1W7U A;  2MQJ A;  1RRX A;  4KA9 A;  1J8C A;  3RD2 A;  2IBI B;  3SSK A;  2HE7 A;  1S6Z A;  3DDC B;  1ZGP A;  3ZDT A;  2V4E A;  3E5T A;  2PJH A;  2GX0 A;  2JXX A;  3SVD A;  3BXA A;  4ZDV A;  2KWC A;  1OQY A;  3PJ7 A;  4FJV B;  4AUQ C;  2GBM A;  4ZRK A;  3UIN B;  2NVU I;  1WMH B;  3K1K A;  4EDS A;  4GGQ A;  5LXH A;  4EFO A;  2HJO A;  3KYD D;  4HWI B;  2K6Q A;  5LLI A;  2JRI B;  2FL1 A;  2WSO A;  3PTF C;  4W6S A;  4KIK B;  4IM2 A;  4KDI C;  2K39 A;  4N9F 4;  4W9E A;  2HGD A;  4AP4 C;  4ORN A;  3SG4 A;  1YQB A;  4JRB A;  4DXO A;  1E8Z A;  2G4S A;  2KXJ A;  2Z6Z A;  4MM3 A;  2EMO A;  2JT4 B;  2ICR A;  2L3Z A;  5HBD A;  2KFJ A;  4DDG D;  2Z0E B;  4XL5 A;  2BF8 B;  4GDL B;  3SVE A;  2QU1 A;  1OXF A;  3CFH A;  3R7R A;  5GMV A;  1P1A A;  4PFE A;  2KOX A;  3RYT A;  1WJ6 A;  3WA0 A;  2JVC A;  4W74 A;  4HDO A;  3BIN A;  3VTU A;  1WX9 A;  4W6I A;  4HPM B;  2A50 B;  3NEZ A;  5BT0 A;  2CHX A;  2KZR A;  5DPT A;  2GW4 B;  5JHA A;  1Q4C A;  4MJS B;  3NT9 A;  2AWM A;  2G5Z B;  2WIS A;  1XMZ A;  2IYD B;  2FCQ A;  4IK5 A;  2YE0 A;  1GL4 A;  2FAZ A;  4M8N A;  1F9J A;  2R2O A;  5EB7 A;  5H88 A;  3VUW A;  1H8C A;  4GDK B;  2QLI A;  3ZNH B;  3DQE A;  3ZRC A;  4GSW A;  3APF A;  4TZG A;  2JUO A;  5FVI A;  3NED A;  3KUD B;  2MP2 B;  2G3D B;  1EME A;  5KHO A;  2ZO6 A;  4AWJ A;  2PEA A;  3GJ2 A;  2M0X A;  3EVP A;  1YZW A;  3T8M A;  2PXS A;  3H7P B;  5LK4 A;  1Q5W B;  4DKN A;  2RR9 A;  4CHK A;  2BWF A;  2KMA A;  4KF4 A;  2H5P A;  4TUU A;  3QQ8 B;  1WXA A;  4ANU A;  4IWQ A;  5DRG A;  4EKU A;  3U8Z A;  4IG7 B;  4OY4 A;  4WAA A;  2ZNV B;  3PIB A;  4EDO A;  4PS7 A;  1KJT A;  3NHE B;  4CO7 A;  3DPW A;  2A52 B;  3WAM A;  2AWT A;  2LI5 A;  2DZI A;  2K6D B;  2J7Q B;  2GMI C;  3WCK A;  4KF5 A;  3JYU A;  4GDK A;  2Y0G A;  4DXA B;  4RM9 A;  3SG2 A;  5EXC I;  4XOV A;  3UIP B;  2BKF A;  3QJZ A;  5IA7 A;  2KK8 A;  4PPL A;  5HW9 A;  1EF1 A;  1EMB A;  3DBH I;  1TBE A;  3DVG Y;  4DXN A;  3EFU A;  4JQW C;  3M63 B;  2WDT B;  3LVC A;  3SD5 A;  1V81 A;  1U4A A;  3DQ1 A;  4L12 A;  1A5R A;  4W6A A;  3DQU A;  2D3G A;  1SGH A;  4W6L A;  3ONS A;  2VZX A;  3U8P A;  2N7D A;  5LTR A;  4KPI A;  4F7Z A;  5DU0 A;  1WF9 A;  4W7A A;  1YHG A;  3SSV A;  3U8A A;  3CST A;  1J0G A;  3PZD A;  1WGD A;  4W9J A;  5C1Z A;  4XZ4 A;  2LD9 A;  3P2B A;  2LVQ A;  4XC2 A;  3EEC A;  2KLC A;  3V6C B;  3P8U A;  4W77 A;  2KJH B;  2JWZ A;  4BBN C;  2V4E C;  3W1S A;  1YJ1 A;  3B1L X;  3PT2 B;  1JBZ A;  1XT9 B;  4GMV A;  3A9J B;  4LJD A;  4NWS A;  2Q57 A;  4BKS D;  3U8C A;  2V4E B;  5H87 A;  3DVN V;  3Q3F A;  3O77 A;  1WGY A;  1YJ2 A;  4W6N A;  3KVF B;  4K7S A;  1WMH A;  4Q7U A;  3H6N A;  1G7K A;  2WHU A;  3RUI B;  3A9K A;  3KUZ A;  4EOY A;  1F0B A;  3RWT A;  2P4M A;  3CB9 A;  5EJU A;  4W6C A;  3ZUN A;  3S2A A;  4WJO A;  1WJ4 A;  2NBW B;  2JRH A;  4KGF A;  2QLG A;  1Q4D A;  3CD1 A;  4W76 A;  4JFG A;  3JSV A;  3PVL A;  4HQ8 A;  4Q7R A;  2ZMU A;  3DQ7 A;  3K9P B;  1S1Q B;  3SV5 A;  4ZRI A;  1D3Z A;  2NBV B;  3RT3 B;  4JGE A;  2V1Y A;  1V6E A;  4F1S A;  1RMM A;  1WI0 A;  4W7F A;  4AS8 A;  2MCN B;  3HIZ A;  4OVV A;  1MOU A;  1C1Y B;  2REX A;  2N9E B;  2A47 A;  4G50 A;  4KSL C;  3L10 B;  3DQV A;  2H9W A;  4UTS A;  4KW8 A;  2K8B A;  2ZEQ A;  2RSU A;  2QZ0 A;  3V3D A;  2Z6X A;  3ZTC A;  4NAW A;  3T9L A;  2DDC A;  4KIK A;  5D2M B;  2KX3 A;  1WH3 A;  2DZM A;  4AR7 A;  4HJK A;  4DDI D;  2L0F A;  2HGY A;  2MA9 B;  1E7V A;  2LRW A;  2AWK A;  1VD2 A;  4MSM B;  1H4U A;  4LCD E;  4PYZ A;  1WE6 A;  3EC8 A;  4RYW A;  1KP5 A;  3NZU A;  4DXI A;  4B95 A;  5DRF A;  3NZS A;  2C5L C;  2BYF A;  2LAS A;  1H4R A;  5JH5 C;  4G3X B;  4W9I A;  3V60 A;  1J19 A;  4DHJ D;  1EF5 A;  2WHT A;  2G16 B;  3L54 A;  3ST0 A;  2VAE A;  2L8J A;  2HTH A;  4URK A;  4MEL A;  2MSE D;  2KDB A;  2N1V A;  4IW0 A;  1WFY A;  3ZLZ A;  3WLC A;  4H48 A;  3ZKJ C;  1OXD A;  3CD9 A;  1RLF A;  2MBQ A;  4EZJ A;  5T3I A;  2AWL A;  1GG3 A;  2MX2 A;  3PRZ A;  4ZFS A;  4BKT A;  2ZJD A;  4I6P A;  3H1U A;  4Q9W A;  2GOW A;  2A48 A;  2QT2 A;  2A5U A;  1KYR A;  1V49 A;  3OAW A;  4U2V A;  1GUA B;  3TBL D;  2UYZ B;  3JVZ X;  3DQM A;  5DPR A;  3NF0 A;  3AI5 A;  4LQU A;  1V80 A;  4OQW A;  2DZK A;  3DQH A;  5BO4 B;  1ZGQ A;  3ML9 A;  4W6D A;  4IM0 A;  2MBO A;  3DQA A;  2KWV B;  2WYQ A;  4LQT A;  3ALB A;  2J0M A;  3VUY A;  5E6N A;  1ZGU B;  3DPD A;  2HFC A;  3ZO5 B;  1YX5 B;  2DHZ A;  4XVP A;  2ZO7 A;  3RZF A;  4W6G A;  2OTB A;  2LWP A;  3UFZ A;  3DQ5 A;  4HLE A;  3AKO A;  5EHU A;  1EML A;  4AJY B;  4FBJ B;  2IE2 A;  3M95 A;  4Z4M A;  4FJZ A;  2CS4 A;  2KTR B;  4OJ0 A;  3ZDM C;  2BTJ A;  4ICV A;  1EMM A;  2H5O A;  4W6M A;  4LJB A;  3K9O B;  3LDZ E;  5EBJ A;  2DYB A;  1WY8 A;  3CMM B;  3VVW B;  2LVO A;  2DAJ A;  5D6J B;  2N9P C;  3UIO B;  4JIO U;  4GOB A;  1WJU A;  5AEK B;  3SG3 A;  3VHT A;  4E74 A;  2KAN A;  5DTZ A;  2FZU A;  3A8S A;  2WX1 A;  4HK2 A;  1YHI A;  5LXI B;  1KYS A;  3M62 B;  3TMP B;  4FJY A;  2YDZ A;  1YHH A;  2MBH A;  2RPQ A;  1UBQ A;  2G6X A;  3PHW B;  2WX0 A;  2KJR A;  4N3D A;  3TCA A;  4IK4 A;  3JSV B;  1Q1O A;  3WAO A;  4LJD C;  3NOB A;  1B9C A;  3L0W B;  2A53 B;  3TMR A;  2XK5 B;  1IPG A;  4W6H A;  2DUF A;  3GJ1 A;  3U30 A;  4K7W A;  2OGR A;  1Q4E A;  1WIA A;  2NPT B;  3UQA A;  2LVP A;  3AI4 A;  1SIF A;  1E8Y A;  4YL8 A;  3EHV A;  4ZB1 A;  3HM6 X;  2MBE A;  3NY5 A;  2Z59 B;  4RTC A;  4DHZ E;  2LRU A;  5BQL A;  4GU2 A;  1UGM A;  1JBY A;  4G0N B;  5IAA C;  3WAL A;  3LJ3 A;  5EDS A;  1ZKH A;  4G11 A;  2Z6Y A;  5JZE B;  3KUC B;  3B08 A;  3LF4 B;  4DKM A;  3PJ5 A;  4KDL B;  3VUX A;  4WWO A;  2WWZ A;  1WGG A;  3ZUL A;  2KDF B;  3DPZ A;  3ZNG C;  3PHX B;  1P0R A;  5J2O A;  3DQ4 A;  3W1C A;  4HDQ A;  2LGD A;  1WXM A;  1IYF A;  4HCP B;  1G6J A;  4KGE A;  2H8Q A;  2QLH A;  3UQB A;  4H47 A;  3OSR A;  4EZK A;  3EVR A;  2O29 A;  1EUV B;  4NJ7 A;  3V62 A;  1V9J A;  4KSK C;  5AZF A;  1KYP A;  1WGR A;  4IK1 A;  3SG7 A;  4W9G A;  3QX1 A;  4XGY A;  3SHQ A;  2VAD A;  3HK0 A;  1CV7 A;  5AZG A;  2KQ7 A;  3L17 A;  1LFD A;  4KW9 A;  1KOT A;  2AYO B;  3RCZ A;  1ZGO A;  4LW5 A;  2KD0 A;  4J89 A;  4IWP A;  4P7I A;  3SU8 X;  3UF8 A;  4IK9 A;  4MSQ B;  1MOV A; 
#chains in the Genus database with same CATH topology
 3OSQ A;  4E3C A;  1XAE A;  3TSS A;  1OTR B;  2XBB C;  3OWE B;  3GEX A;  4W7X A;  3DHH C;  4FN2 A;  4MAC A;  3IT4 B;  1E0Z A;  2QSD A;  3FIL B;  2D10 A;  2D07 B;  3ZTD A;  2LJI A;  2KAC A;  4W75 A;  1ZOY B;  2L76 A;  4LJP B;  2GW3 A;  4PYU A;  1V1O A;  2WHS A;  2DD9 A;  2EMS A;  3DVN U;  3ZUJ A;  3I5J C;  4GF6 B;  3NRZ A;  2FWQ A;  4ASW C;  1NVI D;  5DQM A;  1FFU A;  3T3O A;  2MLB A;  1WYW B;  3EK8 A;  2BB5 A;  2C9W B;  1FRD A;  4MH0 E;  2RDH A;  1EWY C;  1OQR A;  3EA6 A;  4FAD A;  2J0K A;  3VH4 B;  1FD6 A;  4JLC A;  3SVS A;  2C7M B;  3BXC A;  1GNU A;  4H3M A;  1CQV A;  4RF0 A;  1UIS A;  1LXD A;  2CU1 A;  2BGF A;  1Z1Q A;  3IR8 A;  1RFA A;  2KDM A;  4KW4 A;  3DQ3 A;  2VZK D;  2WXH A;  3MJW A;  4RCO A;  1GPX A;  4MEM A;  2GBN A;  5KTG A;  3DQ2 A;  4II3 B;  4X57 B;  4M01 A;  3VK1 A;  4MGI E;  5H8Y E;  1LQB A;  3EKH A;  3P42 A;  2KQS A;  3EVU A;  1W7T A;  3Q8C A;  3DQ8 A;  3X0W A;  4JF9 A;  1TY2 A;  1V5O A;  2D2Q A;  2NBU A;  1TZ1 A;  3KLS X;  3ZJU A;  3IBE A;  2L05 A;  1OEY J;  2BPS A;  2JZ3 B;  2KWU B;  1SJE D;  4BOS C;  1FXI A;  4OZB A;  4NQK E;  4LK0 M;  3E9S A;  3AMZ A;  3R66 C;  4IUM B;  4DXQ A;  3AUL A;  3HVZ A;  3IXS A;  2OKW A;  4EN1 A;  2E3T A;  1FO4 A;  4NJ6 A;  4II2 B;  2FUG 1;  1ZUX A;  2KT7 A;  5BYR A;  1TIF A;  4JWU C;  2WXL A;  5KHQ A;  3H8H A;  4AQ7 A;  4N58 A;  4I6L B;  1JML A;  3DBS A;  2EMD A;  2I1K A;  2GBR A;  3AEE B;  3W5V B;  3AU4 A;  3TMT A;  4JGH B;  2MWS B;  4GES B;  4CYE A;  3H9D A;  3BX9 A;  4K1R B;  3SDL C;  3W5U B;  4EZL A;  4LJC A;  4W7R A;  2MBB B;  5FHV A;  4GXB A;  1RMO A;  1X1M A;  2WU2 B;  4IK3 A;  1HE8 A;  1ZXI A;  3AXC A;  4RMA A;  4YTP B;  3CWI A;  3PZ8 A;  3GZN B;  1N5X A;  2KLG A;  1FM0 D;  2EKE C;  3ZIM A;  2JPH A;  1H6R A;  1NDD A;  2KFK B;  5CTR C;  3E5V A;  1ACC A;  4NJC A;  4TV3 A;  4ZBL A;  2Z8L A;  5EXB A;  2JY6 A;  3L16 A;  3PGE A;  1FEH A;  1QIL A;  2LZ6 A;  4K81 A;  5C23 A;  2HTM E;  2WXG A;  1E7U A;  4MGY E;  5DPH A;  1JC1 A;  3MC0 B;  1QYF A;  4P76 A;  1E8W A;  1XQQ A;  4RH6 A;  3TL5 A;  4L23 A;  2CR5 A;  1OQQ A;  2WIQ A;  2JX5 A;  1P3Q U;  1FMA D;  3EK4 A;  3PLV A;  2K9X A;  5HZU A;  4IC7 B;  2WUR A;  3CFA A;  2BBC A;  3QA8 A;  3W1D A;  3AE4 B;  3DQO A;  2DDD A;  2QEJ C;  2ASQ A;  4NQL B;  1T0Q C;  2FE8 A;  3B0A A;  4BVU C;  1TKG A;  2WXQ A;  2MHJ A;  1QF6 A;  3ADF A;  2G45 B;  2ZW1 A;  4HKZ E;  4C56 C;  2CHZ A;  2G2S B;  1NYQ A;  2OOB B;  2EMN A;  1YQ4 B;  5L83 A;  3R3M A;  2JWU A;  4EUT A;  4TKN A;  4E71 A;  2WXF A;  2J4X A;  1UH6 A;  3AV8 A;  1IP9 A;  5DTX A;  1MG8 A;  2KQ4 X;  1E6E B;  3AE8 B;  2JZZ A;  2NCN A;  2DZJ A;  1QYQ A;  4B5Y A;  3GL4 A;  1VLB A;  1V2Y A;  1EU3 A;  1ZXH A;  1YN5 A;  2DUI A;  5CHV C;  5E6J A;  4WWN A;  3SVU A;  4J6I A;  2JYE A;  5HFY A;  2WXP A;  2HPW A;  3D32 A;  1SEB D;  1M94 A;  4WUR A;  4H2A A;  3QIJ A;  4I6N B;  2L0T A;  2JXT A;  1L4D B;  1L5P A;  3PSE B;  1VJK A;  4K7U A;  4NAM A;  1CMX B;  2N1W A;  3VRA B;  1L0X B;  2KAJ A;  3DQC A;  3P4S B;  2JZP A;  3SVC A;  1WYG A;  2K5P A;  3DQJ A;  4PPK A;  2A56 B;  4I2Y A;  1KLV A;  2O6V B;  3ZUF A;  3RNG C;  4DXG A;  1E8X A;  5LTP A;  1I4Q A;  1V86 A;  2PPH A;  2PIA A;  4W7E A;  1AN8 A;  3IVF A;  3W1S C;  4XDD A;  1EMA A;  2NS5 A;  2HQZ A;  1Q0W B;  5BYS A;  3QHT A;  2G3Q B;  1R4M I;  3LVA A;  2KHW B;  3BXB A;  1UZX B;  4WJN A;  3TEZ A;  3SRY A;  4A20 A;  1I4G A;  2B3A A;  2ZNV C;  3NT3 A;  3ST2 A;  4RM8 A;  2QIE B;  3B2G A;  4ANV A;  4JWS C;  2KN5 A;  5DY6 A;  2MP2 A;  3B2F A;  3O13 A;  2FCS A;  3JW0 X;  1SE9 A;  3A1Q B;  3ZXV A;  1WZ0 A;  5DTL A;  4WQO B;  2DD7 A;  4ZHP A;  4XGA B;  3PRM B;  1F0Z A;  1HA5 A;  3C19 A;  3Q3O C;  3PLU A;  1Z5S B;  3A33 B;  4YSY B;  2LXA A;  1XLO A;  1ZPS A;  2YEP F;  5H92 C;  4HQC A;  1V97 A;  1WX8 A;  2O2V A;  4A3P A;  2ZCC A;  4NNJ B;  1B9R A;  2JU6 X;  3SFD B;  2RGF A;  4ZIO A;  2DAF A;  2Z1O A;  3AEA B;  2L32 A;  2VH2 A;  1XSS A;  2KVR A;  3KH0 A;  4ZHO A;  3OLM D;  3M24 A;  2C60 A;  3RWA A;  1ZDX A;  1L6U A;  2ACZ B;  2G4D B;  2VVI A;  2IDY A;  5GXG B;  2Q6P A;  2IY0 B;  1TGZ B;  4H3N A;  1UUP A;  3ZW3 A;  1RM6 C;  4NY0 A;  1D4B A;  3GS2 A;  3MHZ A;  1I4X A;  2XNA C;  3RN9 C;  1VDV A;  5CHF A;  1IGD A;  2EMT A;  1JC0 A;  4BDU A;  2K0P A;  4LLG M;  3E5W A;  3DQF A;  5BTT B;  2R61 A;  3RNA C;  5T8I A;  3DCG A;  3U0M A;  4ANX A;  2O24 A;  4JE3 B;  3RNE C;  2JF5 A;  2G3O A;  3ML8 A;  4KF5 C;  3DWG C;  4ZF4 A;  3EUB 2;  3DQ6 A;  5JXV A;  1JRP A;  2GBJ A;  3DOW A;  4LDT B;  2R2Q A;  4HQ9 A;  1BFP A;  2PW9 A;  4OGS A;  4P16 A;  1Z1P A;  2O6V A;  1JRU A;  1GC7 A;  3TIX A;  5BTT A;  2V4I B;  3RZW C;  3VIC A;  3A9J A;  5CX3 A;  4L13 A;  1FXA A;  4YXD B;  3AH7 A;  2ZPN A;  4P1Q A;  2C9I A;  4ZYN A;  3SSY A;  1SSN A;  2YVC A;  2FCN A;  1E5W A;  1RFK A;  1AWD A;  3EVV A;  1EU4 A;  1OEY A;  2WDQ B;  3QWZ B;  4MGK E;  4A3O A;  1UNS A;  3MP9 A;  4W73 A;  5AUK A;  4B6W A;  2RD0 A;  4KVG B;  2BKR B;  1TJE A;  5HHD G;  2LGY A;  3ECI A;  2D11 A;  4F8C B;  2O2V B;  3EK7 A;  4REZ A;  4AS1 A;  3AE3 B;  2HQK A;  2M4N A;  2DYM A;  3AU5 A;  3KCT A;  3MHS D;  4OVZ A;  1N6Z A;  1OFF A;  1R4N I;  5DCN A;  1HQR D;  3M22 A;  2BYE A;  3VXW A;  1WX7 A;  1RAX A;  4Q9X A;  3N1X C;  3PS6 A;  3NVV A;  5D7G A;  5DPG A;  2A4Z A;  1HCJ A;  2AEH A;  3WIM A;  2Z0D B;  1WM2 A;  4KX6 B;  4W6O A;  5FVG A;  1GGX A;  2N7E A;  3VRB B;  1IBX B;  3N30 A;  5EE1 A;  2HDE A;  2QLE A;  1EMF A;  3SS0 A;  1SB3 C;  4JC2 A;  2HCG A;  4W9K A;  1IBX A;  3ETR A;  1AAR A;  2G6E A;  1YN3 A;  5AZH A;  2OKY A;  1L7Y A;  3P28 A;  4EUL A;  1KH0 A;  1AW7 A;  2WNM A;  3R2I A;  4AJW A;  2H5Q A;  3OGO A;  2WSN A;  4WJQ A;  4HCN B;  3LF3 A;  1K50 A;  1A70 A;  5I4D A;  2LGX A;  5EXU A;  1I4P A;  3BWU D;  3UGB B;  3GZN I;  4TZA A;  3SR6 A;  4KAG A;  1GOZ A;  4WJP A;  2V3N A;  2G6Y A;  4DXM A;  4BKG A;  1I7H A;  3PRE A;  4US8 A;  1V5T A;  3U0N A;  4GB9 A;  4PS8 A;  1MVK A;  4GOC A;  3APD A;  1E90 A;  1D5X C;  3NVW A;  2IB5 A;  3SSP A;  1XLP A;  4DK5 A;  1WRD B;  5EB6 A;  4W6F A;  5HZS A;  3DQD A;  1WZ3 A;  2D5G A;  4BFR A;  2KNB A;  4W9F A;  2WXM A;  1TS2 A;  2XK5 A;  4XX5 A;  1R4N B;  2LHE A;  5FVF A;  4KV2 A;  2DUH A;  2KKC A;  4W6U A;  4RYS A;  2I38 A;  2C9J A;  1GB1 A;  4DHJ B;  2LGS A;  4HVF A;  5G55 A;  4KKI A;  1HUY A;  4B30 A;  1FXT B;  2V3S A;  2RDG A;  4PS3 A;  2HJ1 A;  2NR2 A;  3LA1 A;  1C3T A;  1YX6 B;  3H7S A;  3DQL A;  4LNK A;  5E6O A;  2IY1 B;  2AL3 A;  2OTE A;  2DUE A;  2QLG B;  3GB3 A;  4FLH A;  2H5R A;  3MGF A;  2WDR B;  4WAF A;  3CGL A;  1WRI A;  3P1M A;  1I35 A;  2GB1 A;  2QRF A;  5FR6 A;  3IFW B;  2LXC A;  2CHW A;  2IO3 B;  1JWS D;  2IO2 B;  4MM3 B;  4OHS A;  1C4P A;  4W9C A;  3W9C B;  4OW0 A;  4B9K A;  2LFI A;  3AM9 A;  5E6P A;  2D3C A;  2O6V D;  1FRR A;  1FFV A;  1T0Y A;  1XLQ A;  2K1F A;  3M3J A;  2IO1 B;  4IZN A;  1FPY A;  1SIJ A;  3ZGZ A;  5IKC M;  3Q69 A;  3NS8 A;  1NBF C;  1P9D U;  2ZCB A;  2BT6 A;  3IT6 B;  3ZRF A;  4LDT D;  1RM9 A;  4FHK A;  2NPT A;  3DBL I;  3KYC D;  2N9X A;  2MRP A;  1PGA A;  2FIF A;  1Y8R C;  3EFC A;  2FCM A;  3TJP A;  2DX5 B;  1L0Y B;  3VAW A;  2L7R A;  3SSL A;  2QDF A;  1Z2M A;  3PPA A;  2LJ5 A;  4KZ0 A;  2ARL A;  1L0V B;  2KVZ A;  4M8M A;  3A1Q A;  4YTN B;  3DVG X;  4W69 A;  1GB4 A;  1C9F A;  4YSZ B;  2N9K A;  2SEB D;  3SVN A;  1P7E A;  1MHH E;  4Q2J A;  1LM8 B;  1VZ7 A;  4KGR A;  4RGO S;  1K8R B;  1I4H A;  1Q73 A;  2L00 B;  4USA A;  4WH4 A;  3SVO A;  1RRB A;  2NMQ A;  3FAH A;  4PPJ A;  5HKH A;  2LHD A;  1TKE A;  2KYW A;  1UF0 A;  3SST A;  4LJO B;  4ACF A;  3V61 A;  4FHJ A;  1QYO A;  1KLU D;  1NEN B;  2AHA A;  2VVJ A;  4D2K A;  4KKJ A;  2ZPY A;  2M17 A;  3WLD A;  2I2Y A;  4L1I A;  3AED B;  1NI2 A;  3AE6 B;  2PE9 A;  5J18 A;  4ZF3 A;  3BY4 B;  1N63 A;  2KMC A;  3PJB A;  3Q3N C;  4HE4 A;  2QJL A;  2DYO A;  3VDZ A;  1TTN A;  2XEW A;  4CQN A;  2O2B A;  4C80 A;  1EMG A;  3RUL A;  2FUH B;  1C4F A;  4ZRJ A;  1OXE A;  1N62 A;  1I42 A;  3DBL B;  4K3C A;  2BW2 A;  1YJJ A;  3ENE A;  3VH3 B;  3NS1 A;  2M1M A;  2ZVN A;  3AE1 B;  1MFW A;  3ZXR A;  1TYG B;  2K8H A;  3MTN B;  2MJD A;  5G5H A;  2H6V A;  3I3T B;  3C0R B;  1QOB A;  5HZO A;  3DBR I;  5CHW A;  2SAK A;  2OJR A;  1GJZ A;  4TMA B;  2M8S A;  2FBW B;  1E7P B;  2PXW A;  3WCQ A;  1C78 A;  3DQK A;  2KJ6 A;  3RI7 C;  1QOG A;  2B3P A;  4IK8 A;  5H89 A;  2LEK A;  3AE7 B;  2B3Q A;  3A4R A;  5BYQ A;  1WE7 A;  4JL9 A;  3U2S C;  1YJF A;  2KC1 A;  4Z4K A;  4DXP A;  3R2T A;  2DLB A;  4ZRQ A;  4W6P A;  3QAQ A;  4C4V A;  4BAX A;  4W72 A;  5AQB B;  2ZZP B;  3R7Q A;  5LNK 1;  2J42 A;  1ZW7 A;  4M00 A;  4XOW A;  2AH8 A;  3HUI A;  4ZF5 A;  3TEY A;  3LS3 A;  1NYR A;  4A55 A;  3UI3 A;  3MJ5 A;  1FCC C;  3N1Z C;  4MH8 A;  3HHM A;  4HPP A;  2KDE B;  1LO5 D;  4J3O D;  2RDB C;  4UDU C;  3A4S C;  1Q4B A;  3KWV A;  1WXS A;  4JEO A;  2KWD A;  4NPN A;  1KTK A;  3GE3 C;  3Q3J A;  5F9G A;  4ZRP A;  1TS3 A;  4W6R A;  1WM3 A;  4WWP A;  1YJI A;  4DHZ B;  1ENF A;  2FID A;  2PVO D;  1BUI C;  1KM7 A;  2V3P A;  4LNN A;  5JHB A;  2J52 A;  4J88 A;  3W1Y A;  4GIV A;  1ET6 A;  1C4C A;  2D3A A;  4A8X C;  1UEL A;  3VFK A;  1WR6 E;  2GBK A;  3DBR B;  1C77 A;  2K25 A;  2M56 B;  5J2R A;  3PV1 A;  1YIW A;  2JAD A;  3H1R A;  2PE6 B;  3J9C A;  1WXV A;  2HD5 B;  3DHI C;  3WAP A;  3QAR A;  2W9N A;  1DOY A;  3ZNI D;  3LB8 C;  1IGC A;  2YE1 A;  4N6E B;  1SJH D;  1PYW D;  5EE0 A;  5DPS A;  2MW5 A;  3IP2 A;  1GC6 A;  2IND C;  4RGT A;  1V1P A;  2QHO A;  3DQN A;  2AQ2 B;  1BXT A;  2W3S A;  4W9D A;  3VR9 B;  1L2N A;  4W6B A;  2N4F A;  4W7C A;  4J8A A;  3U0K A;  1DYQ A;  2AWJ A;  3N9Y C;  4OHJ A;  4M02 A;  2GX2 A;  3DPX A;  3H7P A;  2AL6 A;  4A9A A;  3L08 A;  3GOE A;  4W9L A;  4GDL A;  3WAN A;  1UBI A;  1PGX A;  1JWM D;  4HXD A;  5TR5 A;  4BBN F;  2W55 A;  4EEW A;  3ZJT A;  5DPW A;  4ANW A;  2K8C A;  2KFK A;  3KCS A;  2VVH A;  4Q7T A;  2A46 A;  2CKH B;  3EKJ A;  1TZO A;  3VHT B;  5LTQ A;  3QC8 B;  4IDI A;  4A90 A;  3LSA A;  2BWE S;  4A6Q A;  3SG6 A;  3GE8 C;  3O78 A;  3QK0 A;  3NZ3 A;  3H1O A;  5HZT A;  5IO9 A;  2KN4 A;  3N32 A;  3P4P B;  5L95 C;  4L2Y A;  1EMC A;  4ZIN A;  3VHT C;  2RH7 A;  3I19 A;  1T6B X;  4FA6 A;  4TQ0 A;  1KF6 B;  2VRR B;  2WHI A;  1P98 A;  3V6E B;  3VTV A;  5G2N A;  1YN4 A;  3ZNZ B;  2DEN B;  1J7B A;  4R6B A;  2C7N B;  4MJS A;  2UU7 A;  4IWO A;  2INC C;  4TSS A;  4R6D A;  1N5W A;  1YD8 U;  4BKS A;  2LGI A;  1GAQ B;  2JQR B;  4H3L A;  4B0M A;  2M0A A;  1JW9 D;  1EM7 A;  3ST3 A;  4MGZ E;  4HPL B;  1MYW A;  3ED8 A;  2HRS A;  4KZC A;  4OZC A;  1QZE A;  4WQM A;  5HGE A;  3L13 A;  4FUL A;  3NVZ A;  1F09 A;  1WJN A;  1FIQ A;  3A9K B;  1UWX A;  1WR1 A;  3ZVV A;  3KQ4 A;  1L6V A;  4W6J A;  4B30 B;  2OJK A;  2DUG A;  4XYC A;  3BII D;  1EWC A;  1LGR A;  1Q4A A;  5DPJ A;  2UWQ A;  2W82 A;  5EE9 A;  2L1A A;  3HM3 A;  2LUE A;  2VH1 A;  3AEB B;  3IHP C;  1EMK A;  1QT9 A;  3VTW A;  2KO3 A;  2KTF A;  1QY3 A;  3KW5 B;  2YLM A;  3UG0 A;  3PRP B;  4JPS A;  1K51 A;  1RMP A;  3APC A;  4W7D A;  2IB6 A;  5D94 A;  2IZV B;  3C8Y A;  1YFP A;  2IPK D;  2LMC A;  3SEB A;  3QCA A;  3ST4 A;  3G9A A;  4BOZ B;  4ZYS A;  5DQB A;  2DBY A;  1TKY A;  1XEE A;  1S3S G;  1ROE A;  3CIR B;  1JWA D;  2POX A;  1HTQ A;  2A54 B;  2GLS A;  4W6T A;  3OJ4 B;  4GN1 A;  2J53 A;  3U7D A;  1XA9 A;  3SVB A;  1VZ6 A;  3IG3 A;  4MDK E;  2KC2 A;  5EE3 A;  2KTR A;  4ANJ A;  2FNJ B;  3Q2A C;  2V4L A;  2WP9 B;  2W3R A;  2WDV B;  1NEK B;  4R3D A;  2J0J A;  1QXT A;  1MI0 A;  1T0R C;  4M0W B;  4AOF A;  2HJ8 A;  1Y56 A;  1V1P B;  1E10 A;  2YFP A;  1D5Z C;  3Q8F A;  4KEX A;  2B76 B;  3O65 B;  4IM3 A;  2ZVO A;  2IGD A;  3VQI A;  1UD7 A;  2BYV E;  2IO0 B;  3OJ3 A;  3ZTF A;  1GFL A;  1BT0 A;  1C76 A;  1PUT A;  1V8C A;  1CJE A;  4WWM A;  1W7S A;  3CF6 E;  4DBG A;  1OGW A;  1TS4 A;  4TQ1 A;  1PQS A;  4ICU A;  1PDX A;  4W6K A;  2KX0 A;  4OVU A;  2ZMW A;  3X23 A;  3TEW A;  1EO6 A;  1XD3 B;  3CSF A;  3SVR A;  5J17 A;  3I57 A;  2Y5B B;  4K3B A;  1VCB A;  2QIL A;  3LVD A;  4XWT A;  4W9H A;  5D3D A;  3SG5 A;  4NAW B;  2KDI A;  2BS4 B;  1ISN A;  2IOV A;  1WGH A;  2AX5 A;  5IP4 D;  3S05 A;  2C7H A;  3DQI A;  4N59 A;  4RGN A;  2JSV X;  1XQM A;  3SSH A;  4DWF A;  1VZ8 A;  4HVB A;  3DQ9 A;  4EMQ A;  3CFF A;  3Q14 C;  3N3K B;  4YT0 B;  4HEA 1;  3BZD B;  1ZUD 2;  1JRO A;  5DTY A;  5DPI A;  2WXR A;  3CBE A;  2I1J A;  3LXF A;  3AEG B;  3U0L A;  3MFG A;  1W7U A;  1IUE A;  2MQJ A;  1RRX A;  1JWB D;  4KA9 A;  4MT5 A;  1J8C A;  3RD2 A;  1PFD A;  3ABV B;  2IBI B;  3SSK A;  1HZ6 A;  3BVZ A;  1MG4 A;  3ZQ4 A;  2HE7 A;  1S6Z A;  2Y5C A;  1ZGP A;  3DDC B;  3ZDT A;  2V4E A;  3E5T A;  2PJH A;  3U4E G;  2V9H A;  2GX0 A;  2JXX A;  3SVD A;  3BXA A;  4ZDV A;  2KWC A;  1WXQ A;  1HTO A;  1OQY A;  1QOA A;  3PJ7 A;  4FJV B;  3RPF C;  4XWW A;  4M0W A;  4AUQ C;  2GBM A;  2EEL A;  4ZRK A;  3UIN B;  2NVU I;  3Q3M C;  1WMH B;  3K1K A;  2YEP B;  4EDS A;  4GGQ A;  3PO0 A;  4PT5 A;  5LXH A;  4EFO A;  2HJO A;  3KYD D;  4HWI B;  2K6Q A;  5LLI A;  2JRI B;  2FL1 A;  2WSO A;  3PTF C;  4W6S A;  4KIK B;  4IM2 A;  4KDI C;  2K39 A;  4N9F 4;  4RGM A;  4W9E A;  2HGD A;  2TSS A;  1KLG D;  4AP4 C;  4ORN A;  3SG4 A;  1YQB A;  4JRB A;  4DXO A;  1E8Z A;  2G4S A;  2KXJ A;  2Z6Z A;  4MM3 A;  2EMO A;  1JCK B;  2JT4 B;  2ICR A;  2L3Z A;  5HBD A;  3IAM 1;  2KFJ A;  4BZA A;  4DDG D;  2Z0E B;  4XL5 A;  2BF8 B;  3DWM A;  5FR3 A;  2PTL A;  2EKI A;  4GDL B;  3SVE A;  2QU1 A;  1OXF A;  3CFH A;  1M4V A;  3R7R A;  1JAL A;  5GMV A;  1JQ4 A;  1P1A A;  4PFE A;  2KOX A;  2WS3 B;  3RYT A;  1WJ6 A;  3WA0 A;  2JVC A;  1TS5 A;  3EGR A;  4W74 A;  4HDO A;  3BIN A;  3VTU A;  1WX9 A;  3FC4 A;  2K3U A;  4W6I A;  4HPM B;  1SE3 A;  2A50 B;  3NEZ A;  1YQ3 B;  5BT0 A;  2CHX A;  2KZR A;  3BVG A;  3P4Q B;  1CK1 A;  5DPT A;  2GW4 B;  5JHA A;  1Q4C A;  3TUO A;  4IKG A;  4MJS B;  2PLP A;  3NT9 A;  2AWM A;  2G5Z B;  2WIS A;  2KMM A;  2OJW A;  1XMZ A;  1T3Q A;  2IYD B;  2FCQ A;  2WXK A;  4IK5 A;  2YE0 A;  4P6V F;  1GL4 A;  4GLS C;  2FAZ A;  3R8B A;  5AUI A;  4M8N A;  1F9J A;  2R2O A;  1N61 A;  5EB7 A;  5H88 A;  3VUW A;  1H8C A;  4C00 A;  2GI9 A;  4GDK B;  2QLI A;  2Y3A A;  3ZNH B;  2CJN A;  2G1E A;  1VRA B;  3IAS 1;  3DQE A;  1MJD A;  4US9 A;  3ZRC A;  4GSW A;  3APF A;  3Q8E A;  1E9M A;  4TZG A;  3KWL A;  1WWT A;  2JUO A;  2IGH A;  3DBH B;  5FVI A;  3NED A;  3KUD B;  2MP2 B;  1D5M C;  2G3D B;  1EME A;  5KHO A;  2ZO6 A;  4AWJ A;  2PEA A;  3GJ2 A;  1F1H A;  2M0X A;  4O1N A;  3EVP A;  1YZW A;  3T8M A;  2PXS A;  3H7P B;  5LK4 A;  4RF1 A;  1Q5W B;  4DKN A;  2RR9 A;  4CHK A;  1F2R I;  2BWF A;  2KMA A;  4KF4 A;  3AN1 A;  2H5P A;  4TUU A;  3BK2 A;  3RNF C;  3QQ8 B;  1RYJ A;  4DQO C;  3P63 A;  1WXA A;  3I9V 1;  2WU5 B;  4ANU A;  4IWQ A;  1BML C;  2ICI A;  2E6X A;  5DRG A;  4EKU A;  2PMV A;  2BYT A;  1MHX A;  3U8Z A;  4IG7 B;  4OY4 A;  4WAA A;  2ZNV B;  3PIB A;  2WGS A;  4EDO A;  1AYF A;  2W54 A;  4PS7 A;  1KJT A;  4RFB A;  3BYT B;  3AEC B;  3NHE B;  4CO7 A;  3DPW A;  2A52 B;  3WAM A;  2AWT A;  2LI5 A;  2DZI A;  2K6D B;  2J7Q B;  2GMI C;  3WCK A;  2BVC A;  4KF5 A;  3JYU A;  1VR9 A;  2Y0G A;  4GDK A;  4RM9 A;  4DXA B;  2MEK A;  3SG2 A;  5EXC I;  4PK1 A;  4XOV A;  3UIP B;  2BKF A;  3QJZ A;  5IA7 A;  2KK8 A;  2LUM A;  4PPL A;  5HW9 A;  1EF1 A;  1EMB A;  2H89 B;  3DBH I;  1TBE A;  3DVG Y;  4DXN A;  3EFU A;  4JQW C;  3M63 B;  2WDT B;  3LVC A;  4XE0 A;  3SD5 A;  1V81 A;  2M19 A;  4OZA A;  1U4A A;  3DQ1 A;  4L12 A;  2XN9 C;  1A5R A;  4W6A A;  3DQU A;  3FKY A;  3E56 A;  2D3G A;  1SGH A;  4W6L A;  3ONS A;  2VZX A;  3U8P A;  2N7D A;  4YSX B;  5LTR A;  2AQ1 B;  3ZYY X;  4KPI A;  2AQ3 B;  2ONQ A;  3W2D A;  4F7Z A;  5DU0 A;  1WF9 A;  3SFE B;  4W7A A;  1KRH A;  1XXG A;  1YHG A;  3SSV A;  3U8A A;  3CST A;  1SXT A;  2BS3 B;  1J0G A;  1DOI A;  3PZD A;  1WGD A;  4W9J A;  1SE4 A;  1FCL A;  5C1Z A;  4XZ4 A;  2LD9 A;  3P2B A;  2LVQ A;  4XC2 A;  3EEC A;  2KLC A;  3V6C B;  3P8U A;  5HI1 A;  4W77 A;  5IOI A;  4LNF A;  4HRS A;  2KJH B;  2JWZ A;  2MJE A;  2V4E C;  4BBN C;  3W1S A;  1YJ1 A;  3B1L X;  1QOF A;  3PT2 B;  1R7S A;  2PKO A;  1JBZ A;  1XT9 B;  3HRD D;  4GMV A;  3A9J B;  4KGS A;  4LJD A;  4NWS A;  2Q57 A;  4BKS D;  3U8C A;  2V4E B;  5H87 A;  1C4A A;  3DVN V;  3LYY A;  1F52 A;  2RMM A;  3Q3F A;  3O77 A;  1PGB A;  5TSS A;  1WGY A;  3N20 C;  1YJ2 A;  4W6N A;  3KVF B;  4K7S A;  1WMH A;  4Q7U A;  3H6N A;  2WXO A;  1G7K A;  2WHU A;  1UGJ A;  3A9K A;  3KUZ A;  3RUI B;  1F0B A;  4EOY A;  3RWT A;  2P4M A;  3CB9 A;  5EJU A;  4W6C A;  1CZP A;  3S2A A;  3ZUN A;  4WJO A;  1WJ4 A;  2NBW B;  2JRH A;  1XCQ L;  4KGF A;  3NG0 A;  5MPO A;  2QLG A;  1Q4D A;  3CD1 A;  4W76 A;  4JFG A;  3JSV A;  3BK1 A;  2N7J A;  3PVL A;  3VR8 B;  4HQ8 A;  4Q7R A;  1JWU D;  2L52 A;  2ZMU A;  3DQ7 A;  3K9P B;  1S1Q B;  3FIL A;  3SV5 A;  4ZRI A;  1D3Z A;  2BB6 A;  2NBV B;  3RT3 B;  3RMK C;  2JYT A;  4JGE A;  2V1Y A;  1V6E A;  4F1S A;  1RMM A;  2IJ0 A;  1WI0 A;  4W7F A;  4AS8 A;  2MCN B;  3HIZ A;  2N0S B;  2NTT A;  2ON8 A;  2QMT A;  1MOU A;  2DWQ A;  4OVV A;  4XDC A;  1C1Y B;  3BVM A;  2REX A;  3BYY B;  2N9E B;  2A47 A;  4G50 A;  4KSL C;  3L10 B;  3HVD A;  3DQV A;  2H9W A;  4UTS A;  5FKA C;  4KW8 A;  2K8B A;  3B9J A;  1F77 A;  2ZEQ A;  2RSU A;  2QZ0 A;  1YMH E;  3V3D A;  2Z6X A;  3ZTC A;  4NAW A;  3T9L A;  2DDC A;  4KIK A;  1QKZ A;  1TY0 A;  5D2M B;  2KX3 A;  1WH3 A;  2DZM A;  4AR7 A;  1ZP0 B;  4HJK A;  4DDI D;  2L0F A;  1SBB B;  4P1C C;  2INN E;  2HGY A;  2MA9 B;  1E7V A;  2LRW A;  2AWK A;  1P7F A;  4B0E A;  1VD2 A;  3Q8B A;  4MSM B;  1J7A A;  1H4U A;  4LCD E;  4PYZ A;  1WE6 A;  3AE2 B;  3EC8 A;  4RYW A;  2DNF A;  1KP5 A;  3NZU A;  3RFZ B;  4DXI A;  1F2R C;  4B95 A;  2Q5W D;  5DRF A;  4HKQ A;  2Y5P A;  3NZS A;  2C5L C;  2BYF A;  2WXJ A;  3L4P A;  2OED A;  2LAS A;  1HZ5 A;  1H4R A;  2WQY B;  5JH5 C;  4G3X B;  4W9I A;  3V60 A;  1J19 A;  4DHJ D;  1EF5 A;  2WHT A;  2G16 B;  3L54 A;  4ITK A;  4S17 A;  1I4R A;  5HG2 A;  1UWM A;  3ST0 A;  2VAE A;  3NJT A;  2L8J A;  3AB5 A;  5G5G A;  2HTH A;  4URK A;  4MEL A;  2MSE D;  2KDB A;  2N1V A;  4IW0 A;  1WFY A;  3ZLZ A;  3WLC A;  4H48 A;  3ZKJ C;  1OXD A;  5C3J B;  3CD9 A;  1FNV A;  1NI3 A;  4ZOH C;  1RLF A;  2MBQ A;  4EZJ A;  5T3I A;  2AWL A;  1GG3 A;  2MX2 A;  3PRZ A;  4ZFS A;  4BKT A;  2ZJD A;  4I6P A;  3H1U A;  2QCZ A;  4DXF A;  4L1B A;  4Q9W A;  2GOW A;  4NZL B;  2A48 A;  2QT2 A;  2A5U A;  1KYR A;  1V49 A;  3MC8 A;  3OAW A;  4U2V A;  1GUA B;  3TBL D;  2UYZ B;  3JVZ X;  3I63 C;  3DQM A;  5DPR A;  3NF0 A;  3AI5 A;  4LQU A;  1V80 A;  4OQW A;  2DZK A;  3U7Z A;  3DQH A;  5BO4 B;  1ZGQ A;  3ML9 A;  3Q6B A;  4W6D A;  4IM0 A;  2MBO A;  3DQA A;  2KWV B;  1T5X D;  3MC9 A;  2WYQ A;  4LQT A;  3P4R B;  4KGT A;  2BTE A;  1N60 A;  3ALB A;  2J0M A;  3VUY A;  4IOI E;  2BS2 B;  5E6N A;  5BMG A;  1ZGU B;  3DPD A;  2HFC A;  3ZJV A;  1HXY D;  3ZO5 B;  1YX5 B;  2DHZ A;  1DOX A;  1K52 A;  2BQQ A;  3AEF B;  4XVP A;  2ZO7 A;  5IN7 A;  1HEZ E;  3RZF A;  4W6G A;  2V0G A;  2OTB A;  2LWP A;  3UFZ A;  1STE A;  3DQ5 A;  1MPE A;  4HLE A;  4ARI A;  3AKO A;  5EHU A;  1EML A;  4AJY B;  4FBJ B;  2IE2 A;  1Q10 A;  3M95 A;  1ZDV A;  4Z4M A;  4FJZ A;  2CS4 A;  2KTR B;  4OJ0 A;  3ZDM C;  2BTJ A;  4ICV A;  1EMM A;  2H5O A;  4W6M A;  4LJB A;  4HJG E;  3K9O B;  2G9H D;  3LDZ E;  3NUH B;  2RPV A;  2H88 B;  5EBJ A;  1ESF A;  1WSP A;  2DYB A;  3T3N A;  3RNB C;  1K53 A;  1WY8 A;  1WGK A;  3CMM B;  3VVW B;  2LVO A;  1T0S C;  4FXC A;  1XCT L;  4C7Z A;  4C7Y A;  2DAJ A;  2MJ3 A;  5D6J B;  2N9P C;  3UIO B;  4EE2 A;  5BMH A;  4YWG G;  1D6E C;  3GP7 A;  4JIO U;  4GOB A;  1WJU A;  5AEK B;  3SG3 A;  3VHT A;  4E74 A;  1B1Z A;  2KAN A;  5DTZ A;  4YTM B;  1DGJ A;  2FZU A;  3A8S A;  2WX1 A;  4HK2 A;  1QLB B;  1YHI A;  4HRO A;  5LXI B;  1KYS A;  4LNI A;  3M62 B;  3TMP B;  3AE5 B;  4FJY A;  2WXN A;  2YDZ A;  1YHH A;  4P1B C;  2MBH A;  2RPQ A;  1XLN A;  1UBQ A;  2G6X A;  3PHW B;  2WX0 A;  5BMI A;  2KJR A;  4LNO A;  2OHF A;  4N3D A;  3TCA A;  4IK4 A;  3JSV B;  1Q1O A;  3WAO A;  4LJD C;  3NOB A;  1C79 A;  1B9C A;  3RNC C;  3L0W B;  2A53 B;  3TMR A;  2XK5 B;  1IPG A;  1SE2 A;  2X8X X;  4W6H A;  2DUF A;  3GJ1 A;  3U30 A;  2WXI A;  4K7W A;  2WLB A;  2OGR A;  1Q4E A;  1WIA A;  2NPT B;  3UQA A;  2MH7 A;  5C2T B;  2LVP A;  3AI4 A;  1SIF A;  1XO3 A;  4ARC A;  2L83 A;  1E8Y A;  1SF0 A;  1L4Z B;  4YL8 A;  5D3I B;  2D3B A;  3EHV A;  4ZB1 A;  3HM6 X;  2ZW0 A;  3Q8A A;  2GRI A;  2MBE A;  3NY5 A;  1RWS A;  2Z59 B;  4RTC A;  4DHZ E;  1KFY B;  3GB1 A;  1XF5 L;  2LRU A;  3V3X A;  5BQL A;  4GU2 A;  1UGM A;  1JBY A;  4G0N B;  4WIP A;  1FNW A;  5IAA C;  4JX1 C;  1J7C A;  3WAL A;  3LJ3 A;  2X38 A;  4RNA A;  3OG5 A;  5EDS A;  1ZKH A;  3V05 A;  4G11 A;  2Z6Y A;  5JZE B;  3KUC B;  4LTU A;  3B08 A;  3LF4 B;  4DKM A;  3PJ5 A;  4KDL B;  3VUX A;  4WWO A;  2WWZ A;  1FNU A;  1WGG A;  3ZUL A;  2KDF B;  3NVY A;  3DPZ A;  3ZNG C;  3PHX B;  1P0R A;  2CJO A;  5J2O A;  3DQ4 A;  1TT5 B;  3N1Y C;  3W1C A;  4HDQ A;  2LGD A;  1WXM A;  4C4V B;  4HCP B;  1IYF A;  1G6J A;  4KGE A;  2H8Q A;  2QLH A;  3UQB A;  2INP E;  4H47 A;  2K22 A;  3OSR A;  4EZK A;  1ZE3 D;  4S0R A;  1QQR A;  3EVR A;  2IGG A;  2PVG C;  3U52 E;  2O29 A;  1EUV B;  4NJ7 A;  3V62 A;  1V9J A;  1R4M B;  1ET9 A;  2N9L A;  4KSK C;  2QC8 A;  3DHG C;  5AZF A;  1KYP A;  1WGR A;  4IK1 A;  3SG7 A;  4W9G A;  3QX1 A;  1YOV B;  4XGY A;  3SHQ A;  2VAD A;  3HK0 A;  1CV7 A;  5AZG A;  2KQ7 A;  3L17 A;  1LFD A;  3TEX A;  3AE9 B;  4KW9 A;  1KOT A;  2AYO B;  3RCZ A;  1ZGO A;  2NTS A;  4QAY A;  1YNT E;  3PZ7 A;  2VZK B;  4LW5 A;  2KD0 A;  2CU3 A;  4J89 A;  3URY A;  4IWP A;  4P7I A;  3SU8 X;  3UF8 A;  4IK9 A;  4MSQ B;  5FK9 C;  1MOV A; 
#chains in the Genus database with same CATH homology
 3OSQ A;  4E3C A;  1XAE A;  1OTR B;  2XBB C;  3GEX A;  4W7X A;  4FN2 A;  2D10 A;  2D07 B;  3ZTD A;  4W75 A;  2L76 A;  4LJP B;  2GW3 A;  4PYU A;  2WHS A;  2DD9 A;  2EMS A;  3DVN U;  3ZUJ A;  4GF6 B;  2FWQ A;  4ASW C;  5DQM A;  2MLB A;  1WYW B;  3EK8 A;  2C9W B;  4MH0 E;  4FAD A;  2J0K A;  3VH4 B;  4JLC A;  3SVS A;  2C7M B;  3BXC A;  1GNU A;  4H3M A;  1UIS A;  1LXD A;  2CU1 A;  2BGF A;  1Z1Q A;  3IR8 A;  1RFA A;  4KW4 A;  3DQ3 A;  3MJW A;  4MEM A;  2GBN A;  5KTG A;  3DQ2 A;  4II3 B;  4X57 B;  3VK1 A;  4MGI E;  1LQB A;  3EKH A;  2KQS A;  3EVU A;  1W7T A;  3DQ8 A;  3X0W A;  4JF9 A;  1V5O A;  2D2Q A;  2NBU A;  1TZ1 A;  3IBE A;  2L05 A;  1OEY J;  2BPS A;  2JZ3 B;  2KWU B;  4BOS C;  4NQK E;  3R66 C;  4IUM B;  4DXQ A;  3AUL A;  2OKW A;  4EN1 A;  4NJ6 A;  4II2 B;  1ZUX A;  5KHQ A;  4I6L B;  3DBS A;  2EMD A;  2I1K A;  2GBR A;  3AU4 A;  3TMT A;  4JGH B;  2MWS B;  4GES B;  4CYE A;  3H9D A;  3BX9 A;  4K1R B;  3SDL C;  4EZL A;  4LJC A;  4W7R A;  2MBB B;  5FHV A;  4GXB A;  1RMO A;  1X1M A;  4IK3 A;  1HE8 A;  3AXC A;  4RMA A;  2KLG A;  2EKE C;  3ZIM A;  2JPH A;  1H6R A;  1NDD A;  2KFK B;  5CTR C;  3E5V A;  4TV3 A;  4ZBL A;  5EXB A;  2JY6 A;  3L16 A;  3PGE A;  2LZ6 A;  4K81 A;  5C23 A;  1E7U A;  4MGY E;  5DPH A;  1JC1 A;  1QYF A;  4P76 A;  1E8W A;  1XQQ A;  3TL5 A;  2CR5 A;  2WIQ A;  1P3Q U;  3EK4 A;  3PLV A;  5HZU A;  4IC7 B;  2WUR A;  3CFA A;  3QA8 A;  3W1D A;  3DQO A;  2DDD A;  2ASQ A;  4NQL B;  3B0A A;  4BVU C;  3ADF A;  2G45 B;  2CHZ A;  2G2S B;  2OOB B;  2EMN A;  5L83 A;  3R3M A;  4EUT A;  4TKN A;  4E71 A;  1UH6 A;  1IP9 A;  5DTX A;  1MG8 A;  2JZZ A;  2NCN A;  2DZJ A;  1QYQ A;  4B5Y A;  3GL4 A;  1V2Y A;  2DUI A;  5CHV C;  4WWN A;  3SVU A;  4J6I A;  2HPW A;  3D32 A;  1M94 A;  3QIJ A;  4I6N B;  2L0T A;  3PSE B;  4K7U A;  1CMX B;  2N1W A;  3DQC A;  3SVC A;  3DQJ A;  4PPK A;  2A56 B;  4I2Y A;  1KLV A;  2O6V B;  3ZUF A;  1E8X A;  5LTP A;  1V86 A;  2PPH A;  4W7E A;  3IVF A;  3W1S C;  1EMA A;  2NS5 A;  2HQZ A;  1Q0W B;  3QHT A;  2G3Q B;  1R4M I;  3LVA A;  2KHW B;  3BXB A;  1UZX B;  4WJN A;  3SRY A;  4A20 A;  2B3A A;  2ZNV C;  3NT3 A;  3ST2 A;  4RM8 A;  4ANV A;  2KN5 A;  5DY6 A;  2MP2 A;  2FCS A;  3JW0 X;  1SE9 A;  3A1Q B;  1WZ0 A;  5DTL A;  4WQO B;  2DD7 A;  3PRM B;  3PLU A;  1Z5S B;  3A33 B;  2LXA A;  4HQC A;  1WX8 A;  2O2V A;  4A3P A;  2ZCC A;  4NNJ B;  2RGF A;  4ZIO A;  2DAF A;  2Z1O A;  1XSS A;  2KVR A;  3KH0 A;  3OLM D;  3M24 A;  2C60 A;  3RWA A;  2G4D B;  2VVI A;  2Q6P A;  2IY0 B;  1TGZ B;  4H3N A;  3ZW3 A;  4NY0 A;  5CHF A;  2EMT A;  1JC0 A;  4BDU A;  3E5W A;  3DQF A;  5BTT B;  3DCG A;  3U0M A;  4ANX A;  2O24 A;  2JF5 A;  2G3O A;  3ML8 A;  4KF5 C;  4ZF4 A;  3DQ6 A;  2GBJ A;  3DOW A;  4LDT B;  2R2Q A;  4HQ9 A;  1BFP A;  4OGS A;  1Z1P A;  2O6V A;  1JRU A;  1GC7 A;  3TIX A;  5BTT A;  3RZW C;  3VIC A;  3A9J A;  5CX3 A;  4L13 A;  2ZPN A;  4P1Q A;  2C9I A;  4ZYN A;  3SSY A;  2YVC A;  2FCN A;  1E5W A;  3EVV A;  1OEY A;  3QWZ B;  4MGK E;  4A3O A;  4W73 A;  4B6W A;  2RD0 A;  4KVG B;  2BKR B;  2LGY A;  3ECI A;  2D11 A;  4F8C B;  2O2V B;  3EK7 A;  2HQK A;  2M4N A;  2DYM A;  3AU5 A;  3KCT A;  3MHS D;  5DCN A;  1R4N I;  3M22 A;  2BYE A;  3VXW A;  1WX7 A;  1RAX A;  4Q9X A;  3PS6 A;  5D7G A;  5DPG A;  2A4Z A;  1HCJ A;  2AEH A;  3WIM A;  2Z0D B;  1WM2 A;  4W6O A;  5FVG A;  1GGX A;  2N7E A;  3N30 A;  2QLE A;  1EMF A;  3SS0 A;  4JC2 A;  2HCG A;  4W9K A;  1AAR A;  2G6E A;  5AZH A;  2OKY A;  1L7Y A;  3P28 A;  4EUL A;  4AJW A;  2H5Q A;  3OGO A;  2WSN A;  4WJQ A;  4HCN B;  3LF3 A;  2LGX A;  5EXU A;  3UGB B;  3GZN I;  4TZA A;  4KAG A;  4WJP A;  2G6Y A;  4DXM A;  4BKG A;  3PRE A;  1V5T A;  3U0N A;  4GB9 A;  4PS8 A;  4GOC A;  3APD A;  1E90 A;  2IB5 A;  3SSP A;  4DK5 A;  1WRD B;  5EB6 A;  4W6F A;  5HZS A;  3DQD A;  1WZ3 A;  4BFR A;  2KNB A;  4W9F A;  2XK5 A;  4XX5 A;  5FVF A;  4KV2 A;  2DUH A;  2KKC A;  4W6U A;  4RYS A;  2C9J A;  4DHJ B;  4HVF A;  5G55 A;  1HUY A;  4B30 A;  1FXT B;  2V3S A;  4PS3 A;  2NR2 A;  3LA1 A;  1C3T A;  1YX6 B;  3H7S A;  3DQL A;  5E6O A;  2IY1 B;  2AL3 A;  2OTE A;  2DUE A;  2QLG B;  3GB3 A;  4FLH A;  2H5R A;  3MGF A;  3CGL A;  1I35 A;  2QRF A;  5FR6 A;  3IFW B;  2LXC A;  2CHW A;  2IO3 B;  2IO2 B;  4OHS A;  4W9C A;  4B9K A;  5E6P A;  2O6V D;  1T0Y A;  2K1F A;  3M3J A;  2IO1 B;  4IZN A;  3NS8 A;  1NBF C;  1P9D U;  2ZCB A;  3ZRF A;  4LDT D;  1RM9 A;  4FHK A;  2NPT A;  3DBL I;  3KYC D;  2N9X A;  2MRP A;  2FIF A;  1Y8R C;  2FCM A;  3TJP A;  2DX5 B;  3VAW A;  2L7R A;  3SSL A;  1Z2M A;  3PPA A;  2LJ5 A;  4KZ0 A;  2ARL A;  4M8M A;  3A1Q A;  3DVG X;  4W69 A;  3SVN A;  1LM8 B;  1K8R B;  1Q73 A;  2L00 B;  3SVO A;  1RRB A;  4PPJ A;  5HKH A;  3SST A;  4LJO B;  3V61 A;  4FHJ A;  1QYO A;  2AHA A;  2VVJ A;  2ZPY A;  2M17 A;  3WLD A;  4L1I A;  1NI2 A;  2PE9 A;  5J18 A;  4ZF3 A;  3BY4 B;  2KMC A;  3PJB A;  4HE4 A;  2DYO A;  3VDZ A;  1TTN A;  2XEW A;  2O2B A;  1EMG A;  3RUL A;  2FUH B;  1C4F A;  4ZRJ A;  1OXE A;  1I42 A;  3ENE A;  3VH3 B;  2M1M A;  2ZVN A;  2K8H A;  3MTN B;  2H6V A;  3I3T B;  3C0R B;  5CHW A;  5HZO A;  3DBR I;  2OJR A;  1GJZ A;  2M8S A;  2PXW A;  3DQK A;  2KJ6 A;  2B3P A;  4IK8 A;  5H89 A;  2B3Q A;  3A4R A;  1WE7 A;  4JL9 A;  1YJF A;  2KC1 A;  4Z4K A;  4DXP A;  4W6P A;  3QAQ A;  4W72 A;  5AQB B;  2ZZP B;  3R7Q A;  1ZW7 A;  4XOW A;  2AH8 A;  4ZF5 A;  3LS3 A;  3HHM A;  2KDE B;  3A4S C;  1Q4B A;  1WXS A;  4JEO A;  4NPN A;  3Q3J A;  5F9G A;  4W6R A;  1WM3 A;  4WWP A;  4DHZ B;  2FID A;  1KM7 A;  5JHB A;  4J88 A;  3W1Y A;  4GIV A;  1UEL A;  3VFK A;  1WR6 E;  2GBK A;  2K25 A;  5J2R A;  3PV1 A;  1YIW A;  2JAD A;  3H1R A;  2PE6 B;  1WXV A;  2HD5 B;  3WAP A;  3QAR A;  2W9N A;  3ZNI D;  2YE1 A;  5DPS A;  2MW5 A;  3IP2 A;  1GC6 A;  2QHO A;  3DQN A;  1L2N A;  4W9D A;  4W6B A;  4W7C A;  4J8A A;  3U0K A;  2N4F A;  2AWJ A;  2GX2 A;  3DPX A;  3H7P A;  2AL6 A;  3L08 A;  3GOE A;  4W9L A;  4GDL A;  3WAN A;  1UBI A;  4HXD A;  5TR5 A;  4BBN F;  4EEW A;  5DPW A;  4ANW A;  2K8C A;  2KFK A;  3KCS A;  2VVH A;  4Q7T A;  2A46 A;  2CKH B;  3EKJ A;  3VHT B;  5LTQ A;  3QC8 B;  3LSA A;  2BWE S;  3SG6 A;  3O78 A;  3QK0 A;  3H1O A;  5HZT A;  3N32 A;  5L95 C;  1EMC A;  4ZIN A;  3VHT C;  2RH7 A;  3I19 A;  4FA6 A;  4TQ0 A;  2VRR B;  1P98 A;  3V6E B;  3VTV A;  5G2N A;  3ZNZ B;  2DEN B;  4R6B A;  2C7N B;  4MJS A;  4IWO A;  4R6D A;  1YD8 U;  4BKS A;  4H3L A;  3ST3 A;  4MGZ E;  4HPL B;  1MYW A;  3ED8 A;  2HRS A;  4KZC A;  1QZE A;  5HGE A;  3L13 A;  4FUL A;  1F09 A;  1WJN A;  3A9K B;  1WR1 A;  3ZVV A;  4W6J A;  4B30 B;  2OJK A;  2DUG A;  1Q4A A;  5DPJ A;  2UWQ A;  3HM3 A;  2LUE A;  3IHP C;  1EMK A;  3VTW A;  2KO3 A;  2KTF A;  1QY3 A;  3KW5 B;  2YLM A;  3UG0 A;  3PRP B;  1RMP A;  3APC A;  4W7D A;  2IB6 A;  5D94 A;  2IZV B;  1YFP A;  3QCA A;  3ST4 A;  3G9A A;  4BOZ B;  5DQB A;  1S3S G;  2POX A;  2A54 B;  4W6T A;  3OJ4 B;  4GN1 A;  3U7D A;  1XA9 A;  3SVB A;  3IG3 A;  4MDK E;  2KC2 A;  2KTR A;  4ANJ A;  2FNJ B;  2V4L A;  2J0J A;  1QXT A;  4M0W B;  4AOF A;  2HJ8 A;  2YFP A;  4KEX A;  3O65 B;  4IM3 A;  2ZVO A;  3VQI A;  1UD7 A;  2BYV E;  2IO0 B;  3OJ3 A;  3ZTF A;  1GFL A;  1BT0 A;  1W7S A;  3CF6 E;  4DBG A;  1OGW A;  4TQ1 A;  1PQS A;  4ICU A;  4W6K A;  2KX0 A;  4OVU A;  2ZMW A;  3X23 A;  1EO6 A;  1XD3 B;  3CSF A;  3SVR A;  5J17 A;  2Y5B B;  1VCB A;  3LVD A;  4W9H A;  3SG5 A;  4NAW B;  2KDI A;  1ISN A;  2IOV A;  1WGH A;  3S05 A;  2C7H A;  3DQI A;  1XQM A;  3SSH A;  4DWF A;  4HVB A;  3DQ9 A;  4EMQ A;  3CFF A;  3N3K B;  5DTY A;  5DPI A;  3CBE A;  2I1J A;  3U0L A;  1W7U A;  2MQJ A;  1RRX A;  4KA9 A;  1J8C A;  3RD2 A;  2IBI B;  3SSK A;  2HE7 A;  1S6Z A;  3DDC B;  1ZGP A;  3ZDT A;  2V4E A;  3E5T A;  2PJH A;  2GX0 A;  2JXX A;  3SVD A;  3BXA A;  4ZDV A;  2KWC A;  1OQY A;  3PJ7 A;  4FJV B;  4AUQ C;  2GBM A;  4ZRK A;  3UIN B;  2NVU I;  1WMH B;  3K1K A;  4EDS A;  4GGQ A;  5LXH A;  4EFO A;  2HJO A;  3KYD D;  4HWI B;  2K6Q A;  5LLI A;  2JRI B;  2FL1 A;  2WSO A;  3PTF C;  4W6S A;  4KIK B;  4IM2 A;  4KDI C;  2K39 A;  4N9F 4;  4W9E A;  2HGD A;  4AP4 C;  4ORN A;  3SG4 A;  1YQB A;  4JRB A;  4DXO A;  1E8Z A;  2G4S A;  2KXJ A;  2Z6Z A;  4MM3 A;  2EMO A;  2JT4 B;  2ICR A;  2L3Z A;  5HBD A;  2KFJ A;  4DDG D;  2Z0E B;  4XL5 A;  2BF8 B;  4GDL B;  3SVE A;  2QU1 A;  1OXF A;  3CFH A;  3R7R A;  5GMV A;  1P1A A;  4PFE A;  2KOX A;  3RYT A;  1WJ6 A;  3WA0 A;  2JVC A;  4W74 A;  4HDO A;  3BIN A;  3VTU A;  1WX9 A;  4W6I A;  4HPM B;  2A50 B;  3NEZ A;  5BT0 A;  2CHX A;  2KZR A;  5DPT A;  2GW4 B;  5JHA A;  1Q4C A;  4MJS B;  3NT9 A;  2AWM A;  2G5Z B;  2WIS A;  1XMZ A;  2IYD B;  2FCQ A;  4IK5 A;  2YE0 A;  1GL4 A;  2FAZ A;  4M8N A;  1F9J A;  2R2O A;  5EB7 A;  5H88 A;  3VUW A;  1H8C A;  4GDK B;  2QLI A;  3ZNH B;  3DQE A;  3ZRC A;  4GSW A;  3APF A;  4TZG A;  2JUO A;  5FVI A;  3NED A;  3KUD B;  2MP2 B;  2G3D B;  1EME A;  5KHO A;  2ZO6 A;  4AWJ A;  2PEA A;  3GJ2 A;  2M0X A;  3EVP A;  1YZW A;  3T8M A;  2PXS A;  3H7P B;  5LK4 A;  1Q5W B;  4DKN A;  2RR9 A;  4CHK A;  2BWF A;  2KMA A;  4KF4 A;  2H5P A;  4TUU A;  3QQ8 B;  1WXA A;  4ANU A;  4IWQ A;  5DRG A;  4EKU A;  3U8Z A;  4IG7 B;  4OY4 A;  4WAA A;  2ZNV B;  3PIB A;  4EDO A;  4PS7 A;  1KJT A;  3NHE B;  4CO7 A;  3DPW A;  2A52 B;  3WAM A;  2AWT A;  2LI5 A;  2DZI A;  2K6D B;  2J7Q B;  2GMI C;  3WCK A;  4KF5 A;  3JYU A;  4GDK A;  2Y0G A;  4DXA B;  4RM9 A;  3SG2 A;  5EXC I;  4XOV A;  3UIP B;  2BKF A;  3QJZ A;  5IA7 A;  2KK8 A;  4PPL A;  5HW9 A;  1EF1 A;  1EMB A;  3DBH I;  1TBE A;  3DVG Y;  4DXN A;  3EFU A;  4JQW C;  3M63 B;  2WDT B;  3LVC A;  3SD5 A;  1V81 A;  1U4A A;  3DQ1 A;  4L12 A;  1A5R A;  4W6A A;  3DQU A;  2D3G A;  1SGH A;  4W6L A;  3ONS A;  2VZX A;  3U8P A;  2N7D A;  5LTR A;  4KPI A;  4F7Z A;  5DU0 A;  1WF9 A;  4W7A A;  1YHG A;  3SSV A;  3U8A A;  3CST A;  1J0G A;  3PZD A;  1WGD A;  4W9J A;  5C1Z A;  4XZ4 A;  2LD9 A;  3P2B A;  2LVQ A;  4XC2 A;  3EEC A;  2KLC A;  3V6C B;  3P8U A;  4W77 A;  2KJH B;  2JWZ A;  4BBN C;  2V4E C;  3W1S A;  1YJ1 A;  3B1L X;  3PT2 B;  1JBZ A;  1XT9 B;  4GMV A;  3A9J B;  4LJD A;  4NWS A;  2Q57 A;  4BKS D;  3U8C A;  2V4E B;  5H87 A;  3DVN V;  3Q3F A;  3O77 A;  1WGY A;  1YJ2 A;  4W6N A;  3KVF B;  4K7S A;  1WMH A;  4Q7U A;  3H6N A;  1G7K A;  2WHU A;  3RUI B;  3A9K A;  3KUZ A;  4EOY A;  1F0B A;  3RWT A;  2P4M A;  3CB9 A;  5EJU A;  4W6C A;  3ZUN A;  3S2A A;  4WJO A;  1WJ4 A;  2NBW B;  2JRH A;  4KGF A;  2QLG A;  1Q4D A;  3CD1 A;  4W76 A;  4JFG A;  3JSV A;  3PVL A;  4HQ8 A;  4Q7R A;  2ZMU A;  3DQ7 A;  3K9P B;  1S1Q B;  3SV5 A;  4ZRI A;  1D3Z A;  2NBV B;  3RT3 B;  4JGE A;  2V1Y A;  1V6E A;  4F1S A;  1RMM A;  1WI0 A;  4W7F A;  4AS8 A;  2MCN B;  3HIZ A;  4OVV A;  1MOU A;  1C1Y B;  2REX A;  2N9E B;  2A47 A;  4G50 A;  4KSL C;  3L10 B;  3DQV A;  2H9W A;  4UTS A;  4KW8 A;  2K8B A;  2ZEQ A;  2RSU A;  2QZ0 A;  3V3D A;  2Z6X A;  3ZTC A;  4NAW A;  3T9L A;  2DDC A;  4KIK A;  5D2M B;  2KX3 A;  1WH3 A;  2DZM A;  4AR7 A;  4HJK A;  4DDI D;  2L0F A;  2HGY A;  2MA9 B;  1E7V A;  2LRW A;  2AWK A;  1VD2 A;  4MSM B;  1H4U A;  4LCD E;  4PYZ A;  1WE6 A;  3EC8 A;  4RYW A;  1KP5 A;  3NZU A;  4DXI A;  4B95 A;  5DRF A;  3NZS A;  2C5L C;  2BYF A;  2LAS A;  1H4R A;  5JH5 C;  4G3X B;  4W9I A;  3V60 A;  1J19 A;  4DHJ D;  1EF5 A;  2WHT A;  2G16 B;  3L54 A;  3ST0 A;  2VAE A;  2L8J A;  2HTH A;  4URK A;  4MEL A;  2MSE D;  2KDB A;  2N1V A;  4IW0 A;  1WFY A;  3ZLZ A;  3WLC A;  4H48 A;  3ZKJ C;  1OXD A;  3CD9 A;  1RLF A;  2MBQ A;  4EZJ A;  5T3I A;  2AWL A;  1GG3 A;  2MX2 A;  3PRZ A;  4ZFS A;  4BKT A;  2ZJD A;  4I6P A;  3H1U A;  4Q9W A;  2GOW A;  2A48 A;  2QT2 A;  2A5U A;  1KYR A;  1V49 A;  3OAW A;  4U2V A;  1GUA B;  3TBL D;  2UYZ B;  3JVZ X;  3DQM A;  5DPR A;  3NF0 A;  3AI5 A;  4LQU A;  1V80 A;  4OQW A;  2DZK A;  3DQH A;  5BO4 B;  1ZGQ A;  3ML9 A;  4W6D A;  4IM0 A;  2MBO A;  3DQA A;  2KWV B;  2WYQ A;  4LQT A;  3ALB A;  2J0M A;  3VUY A;  5E6N A;  1ZGU B;  3DPD A;  2HFC A;  3ZO5 B;  1YX5 B;  2DHZ A;  4XVP A;  2ZO7 A;  3RZF A;  4W6G A;  2OTB A;  2LWP A;  3UFZ A;  3DQ5 A;  4HLE A;  3AKO A;  5EHU A;  1EML A;  4AJY B;  4FBJ B;  2IE2 A;  3M95 A;  4Z4M A;  4FJZ A;  2CS4 A;  2KTR B;  4OJ0 A;  3ZDM C;  2BTJ A;  4ICV A;  1EMM A;  2H5O A;  4W6M A;  4LJB A;  3K9O B;  3LDZ E;  5EBJ A;  2DYB A;  1WY8 A;  3CMM B;  3VVW B;  2LVO A;  2DAJ A;  5D6J B;  2N9P C;  3UIO B;  4JIO U;  4GOB A;  1WJU A;  5AEK B;  3SG3 A;  3VHT A;  4E74 A;  2KAN A;  5DTZ A;  2FZU A;  3A8S A;  2WX1 A;  4HK2 A;  1YHI A;  5LXI B;  1KYS A;  3M62 B;  3TMP B;  4FJY A;  2YDZ A;  1YHH A;  2MBH A;  2RPQ A;  1UBQ A;  2G6X A;  3PHW B;  2WX0 A;  2KJR A;  4N3D A;  3TCA A;  4IK4 A;  3JSV B;  1Q1O A;  3WAO A;  4LJD C;  3NOB A;  1B9C A;  3L0W B;  2A53 B;  3TMR A;  2XK5 B;  1IPG A;  4W6H A;  2DUF A;  3GJ1 A;  3U30 A;  4K7W A;  2OGR A;  1Q4E A;  1WIA A;  2NPT B;  3UQA A;  2LVP A;  3AI4 A;  1SIF A;  1E8Y A;  4YL8 A;  3EHV A;  4ZB1 A;  3HM6 X;  2MBE A;  3NY5 A;  2Z59 B;  4RTC A;  4DHZ E;  2LRU A;  5BQL A;  4GU2 A;  1UGM A;  1JBY A;  4G0N B;  5IAA C;  3WAL A;  3LJ3 A;  5EDS A;  1ZKH A;  4G11 A;  2Z6Y A;  5JZE B;  3KUC B;  3B08 A;  3LF4 B;  4DKM A;  3PJ5 A;  4KDL B;  3VUX A;  4WWO A;  2WWZ A;  1WGG A;  3ZUL A;  2KDF B;  3DPZ A;  3ZNG C;  3PHX B;  1P0R A;  5J2O A;  3DQ4 A;  3W1C A;  4HDQ A;  2LGD A;  1WXM A;  1IYF A;  4HCP B;  1G6J A;  4KGE A;  2H8Q A;  2QLH A;  3UQB A;  4H47 A;  3OSR A;  4EZK A;  3EVR A;  2O29 A;  1EUV B;  4NJ7 A;  3V62 A;  1V9J A;  4KSK C;  5AZF A;  1KYP A;  1WGR A;  4IK1 A;  3SG7 A;  4W9G A;  3QX1 A;  4XGY A;  3SHQ A;  2VAD A;  3HK0 A;  1CV7 A;  5AZG A;  2KQ7 A;  3L17 A;  1LFD A;  4KW9 A;  1KOT A;  2AYO B;  3RCZ A;  1ZGO A;  4LW5 A;  2KD0 A;  4J89 A;  4IWP A;  4P7I A;  3SU8 X;  3UF8 A;  4IK9 A;  4MSQ B;  1MOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...