3DPXA

Structure of the yellow fluorescent protein citrine frozen at 5000 atmospheres: structure 26 in a series of 26 high pressure structures
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
231
structure length
230
Chain Sequence
DPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Alteration of citrine structure by hydrostatic pressure explains the accompanying spectral shift.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 62
structure length 230
sequence length 231
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3dpxA00
3W1CA 1QY3A 1YHIA 4DXIA 4DXNA 2QLIA 1ZGPA 2ZO6A 3GB3A 5EBJA 4PFEA 2G3DB 4JEOA 1Q4AA 4HQCA 4W6BA 2AWMA 5DPGA 3SVEA 2WSOA 3OSRA 3EK4A 5FVIA 3DQUA 4W76A 3EVPA 2V4EA 2FZUA 4W6OA 2G5ZB 2YFPA 1B9CA 5H88A 4W6IA 2WIQA 3DQEA 4W7AA 3LA1A 1MYWA 3SSPA 5LTRA 4JFGA 4ZBLA 4H3MA 5DRFA 1EMMA 2POXA 3NF0A 4Z4MA 3VHTB 5BQLA 4KW9A 2C9JA 4ANJA 5DTLA 2IOVA 1MOUA 4Z4KA 3BXBA 5BTTA 4ZFSA 4W6NA 1KYSA 4KEXA 1EMCA 4W72A 3ST4A 1RMMA 2OKWA 3U0NA 4IK1A 5DPIA 5HGEA 1BFPA 1YJFA 3KCSA 4IZNA 5T3IA 2OJKA 2YE0A 4AR7A 2WURA 1JBZA 5HZOA 2EMDA 5J2OA 2GX0A 3LVDA 2G2SB 3GEXA 1RRXA 4H47A 2A52B 2AWKA 3E5WA 4N3DA 3CBEA 4R6BA 3SVRA 2GX2A 4ZB1A 3ZUFA 1YHGA 4HQ8A 3DQ8A 2Q6PA 3CFAA 3DQAA 3SG6A 4W7FA 3WLDA 2DD9A 3W1DA 1GFLA 1RMPA 3PIBA 5FVGA 2DUGA 3DQCA 2DUEA 3NEZA 1KP5A 4OQWA 4HQ9A 3TMRA 3SSTA 3IR8A 2DDDA 2QRFA 1XQMA 4W73A 5DTYA 2PXWA 4JC2A 4DXPA 4W7EA 4W6GA 4JGEA 2G3OA 1HUYA 4W6HA 5LTPA 2H5PA 4PPJA 4KPIA 3ZULA 3ST2A 4KW8A 4XOVA 5DTZA 1Q4BA 2G16B 1C4FA 3LF4B 2AWLA 4H48A 2H5RA 3RWTA 4L12A 1W7UA 3LS3A 4JF9A 4W6JA 5EXBA 2O24A 3DQ4A 4W6RA 4P76A 3S05A 3CD9A 2ARLA 3LVAA 4ZF3A 4IK3A 3P28A 2VZXA 3SG2A 2OGRA 4B30B 4KGEA 4W6LA 3DQIA 3SG3A 3O78A 4W6CA 4OJ0A 4W6UA 1ZUXA 2VVIA 3SSVA 4W77A 2DUIA 3EK7A 2B3PA 2ZMWA 4W6FA 3WLCA 4GESB 3ST0A 2ZMUA 4DXOA 5AQBB 4RYSA 2G6YA 1XSSA 1XA9A 3DQ1A 5DPHA 2DDCA 3SVNA 2IB6A 4U2VA 2A54B 3DQHA 1XAEA 4Q7TA 2VADA 5KTGA 3NEDA 5HZUA 2DD7A 1EMFA 1F0BA 3K1KA 5BT0A 1EMLA 3DQ6A 4W7XA 3EKHA 4LQTA 3PJ7A 4L1IA 3U0LA 2WSNA 1EMEA 1EMAA 3CFFA 5DTXA 3ST3A 2WHUA 2QLGB 4W69A 1QYFA 3GL4A 2A46A 3DQ9A 2IB5A 2HRSA 3EVRA 4XGYA 2JADA 3EVUA 5H87A 1OXEA 3AKOA 5H89A 2B3QA 4LJDC 2WHSA 3ZTFA 4OHSA 1YHHA 3KCTA 2GW4B 3DQFA 2PXSA 2Y0GA 3VHTA 2P4MA 3OSQA 2A48A 4PPLA 5HZTA 4TZAA 4XOWA 3IP2A 1XMZA 5HZSA 4AS8A 4B5YA 1JC1A 2VAEA 1CV7A 3DQJA 4IK9A 4KA9A 3RWAA 3EK8A 5DY6A 2Z6YA 2Z1OA 1OXDA 1OXFA 3SSKA 4PPKA 2A56B 1G7KA 4W6PA 4TZGA 4W6SA 2O29A 3SVDA 4ORNA 2FWQA 4W6KA 3CFHA 4EDOA 1RM9A 2A50B 3EKJA 3NT9A 2OTEA 2IE2A 3LF3A 3GJ1A 4NWSA 5EB7A 3DQDA 4KAGA 2G6XA 2YDZA 4EULA 5DU0A 3DQ5A 1JBYA 2RH7A 4EN1A 1Q4DA 3EVVA 5HBDA 3U0MA 5FHVA 3ADFA 1Z1PA 4H3NA 4ZF5A 3SVCA 4W6MA 1YJ2A 4RYWA 2Z6ZA 1S6ZA 4KGFA 5EXCI 3M22A 3U8CA 3H1OA 3M24A 2QLHA 3UFZA 4IK8A 2AHAA 3CGLA 4HVFA 4LJCA 3H1RA 3PJBA 2OKYA 3VK1A 4LJDA 1EMGA 3E5VA 1Z1QA 1EMBA 4LJBA 2AWJA 4UTSA 3WCKA 4Q9XA 2FL1A 2HGYA 2EMOA 3DQLA 2QLEA 2EMNA 1KYPA 2HGDA 3CD1A 4OGSA 3SVSA 4HE4A 1H6RA 4BDUA 1YFPA 2O2BA 4J89A 4ZF4A 3BXCA 5EHUA 3U8PA 2WHTA 2V4EB 2C9IA 2OTBA 2Z6XA 5LTQA 1F09A 2H6VA 4B30A 1QYQA 3CB9A 3DPWA 5DRGA 3LVCA 4KF4A 2HPWA 3DQ3A 4W7CA 4IK4A 2QT2A 4R6DA 3SSLA 1YZWA 5FVFA 4DKMA 5DPJA 3SRYA 3NT3A 3ZUJA 1EMKA 5BTTB 1UISA 3DQKA 3SV5A 4XVPA 3V3DA 4IK5A 1KYRA 3DQ2A 5EB6A 1QYOA 4GF6B 4ZIOA 4W6TA 5HW9A 3DQOA 3A8SA 3E5TA 3O77A 4JRBA 2HCGA 4P1QA 2GW3A 4W74A 5EJUA 3SG5A 1ZGQA 3I19A 4RTCA 3P8UA 4J88A 1MOVA 1ZGOA 1GGXA 2QZ0A 5DQMA 2AH8A 4XL5A 5DQBA 3SS0A 2DUHA 1HCJA 2QLGA 1Q4EA 2H5OA 3VICA 4LQUA 3SVBA 2A47A 3BXAA 4OY4A 3G9AA 3AI4A 1H4UA 4W6AA 4KF5A 1QXTA 4Q9WA 4EMQA 2VVHA 3LSAA 5LK4A 2BTJA 3SSHA 4GOBA 2H8QA 4ZINA 2VVJA 2H5QA 4L13A 2WISA 1Q4CA 3MGFA 3PJ5A 4I2YA 2V4EC 3U8AA 3SVOA 2ZO7A 4W75A 3UG0A 3DQNA 2A53B 3DQ7A 3DQMA 3TMTA 4W7DA 3SG4A 1Q73A 2Q57A 4W6DA 3GJ2A 4J8AA 4Q7UA 2HQZA 3BX9A 1W7TA 4KW4A 1JC0A 4EDSA 2HQKA 3DPZA 2ICRA 2YE1A 3SVUA 3AI5A 3ED8A 4DKNA 3U0KA 1RMOA 4Q7RA 2DUFA 2G6EA 2QU1A 5F9GA 1W7SA 5EXUA 4H3LA 4DXQA 3SG7A 1GL4A 4W7RA 3SSYA 2HFCA 3OGOA 4DXMA 4LW5A 2HJOA 4KF5C 3DPXA 2H9WA
chains in the Genus database with same CATH superfamily
3W1CA 1QY3A 1YHIA 4DXIA 4DXNA 2QLIA 1ZGPA 2ZO6A 3GB3A 5EBJA 4PFEA 2G3DB 4JEOA 1Q4AA 4HQCA 4W6BA 2AWMA 5DPGA 3SVEA 2WSOA 3OSRA 3EK4A 5FVIA 3DQUA 4W76A 3EVPA 2V4EA 2FZUA 4W6OA 2G5ZB 2YFPA 1B9CA 5H88A 4W6IA 2WIQA 3DQEA 4W7AA 3LA1A 1MYWA 3SSPA 5LTRA 4JFGA 4ZBLA 4H3MA 5DRFA 1EMMA 2POXA 3NF0A 4Z4MA 3VHTB 5BQLA 4KW9A 2C9JA 4ANJA 5DTLA 2IOVA 1MOUA 4Z4KA 3BXBA 5BTTA 4ZFSA 4W6NA 1KYSA 4KEXA 1EMCA 4W72A 3ST4A 1RMMA 2OKWA 3U0NA 4IK1A 5DPIA 5HGEA 1BFPA 1YJFA 3KCSA 4IZNA 5T3IA 2OJKA 2YE0A 4AR7A 2WURA 1JBZA 5HZOA 2EMDA 5J2OA 2GX0A 3LVDA 2G2SB 3GEXA 1RRXA 4H47A 2A52B 2AWKA 3E5WA 4N3DA 3CBEA 4R6BA 3SVRA 2GX2A 4ZB1A 3ZUFA 1YHGA 4HQ8A 3DQ8A 2Q6PA 3CFAA 3DQAA 3SG6A 4W7FA 3WLDA 2DD9A 3W1DA 1GFLA 1RMPA 3PIBA 5FVGA 2DUGA 3DQCA 2DUEA 3NEZA 1KP5A 4OQWA 4HQ9A 3TMRA 3SSTA 3IR8A 2DDDA 2QRFA 1XQMA 4W73A 5DTYA 2PXWA 4JC2A 4DXPA 4W7EA 4W6GA 4JGEA 2G3OA 1HUYA 4W6HA 5LTPA 2H5PA 4PPJA 4KPIA 3ZULA 3ST2A 4KW8A 4XOVA 5DTZA 1Q4BA 2G16B 1C4FA 3LF4B 2AWLA 4H48A 2H5RA 3RWTA 4L12A 1W7UA 3LS3A 4JF9A 4W6JA 5EXBA 2O24A 3DQ4A 4W6RA 4P76A 3S05A 3CD9A 2ARLA 3LVAA 4ZF3A 4IK3A 3P28A 2VZXA 3SG2A 2OGRA 4B30B 4KGEA 4W6LA 3DQIA 3SG3A 3O78A 4W6CA 4OJ0A 4W6UA 1ZUXA 2VVIA 3SSVA 4W77A 2DUIA 3EK7A 2B3PA 2ZMWA 4W6FA 3WLCA 4GESB 3ST0A 2ZMUA 4DXOA 5AQBB 4RYSA 2G6YA 1XSSA 1XA9A 3DQ1A 5DPHA 2DDCA 3SVNA 2IB6A 4U2VA 2A54B 3DQHA 1XAEA 4Q7TA 2VADA 5KTGA 3NEDA 5HZUA 2DD7A 1EMFA 1F0BA 3K1KA 5BT0A 1EMLA 3DQ6A 4W7XA 3EKHA 4LQTA 3PJ7A 4L1IA 3U0LA 2WSNA 1EMEA 1EMAA 3CFFA 5DTXA 3ST3A 2WHUA 2QLGB 4W69A 1QYFA 3GL4A 2A46A 3DQ9A 2IB5A 2HRSA 3EVRA 4XGYA 2JADA 3EVUA 5H87A 1OXEA 3AKOA 5H89A 2B3QA 4LJDC 2WHSA 3ZTFA 4OHSA 1YHHA 3KCTA 2GW4B 3DQFA 2PXSA 2Y0GA 3VHTA 2P4MA 3OSQA 2A48A 4PPLA 5HZTA 4TZAA 4XOWA 3IP2A 1XMZA 5HZSA 4AS8A 4B5YA 1JC1A 2VAEA 1CV7A 3DQJA 4IK9A 4KA9A 3RWAA 3EK8A 5DY6A 2Z6YA 2Z1OA 1OXDA 1OXFA 3SSKA 4PPKA 2A56B 1G7KA 4W6PA 4TZGA 4W6SA 2O29A 3SVDA 4ORNA 2FWQA 4W6KA 3CFHA 4EDOA 1RM9A 2A50B 3EKJA 3NT9A 2OTEA 2IE2A 3LF3A 3GJ1A 4NWSA 5EB7A 3DQDA 4KAGA 2G6XA 2YDZA 4EULA 5DU0A 3DQ5A 1JBYA 2RH7A 4EN1A 1Q4DA 3EVVA 5HBDA 3U0MA 5FHVA 3ADFA 1Z1PA 4H3NA 4ZF5A 3SVCA 4W6MA 1YJ2A 4RYWA 2Z6ZA 1S6ZA 4KGFA 5EXCI 3M22A 3U8CA 3H1OA 3M24A 2QLHA 3UFZA 4IK8A 2AHAA 3CGLA 4HVFA 4LJCA 3H1RA 3PJBA 2OKYA 3VK1A 4LJDA 1EMGA 3E5VA 1Z1QA 1EMBA 4LJBA 2AWJA 4UTSA 3WCKA 4Q9XA 2FL1A 2HGYA 2EMOA 3DQLA 2QLEA 2EMNA 1KYPA 2HGDA 3CD1A 4OGSA 3SVSA 4HE4A 1H6RA 4BDUA 1YFPA 2O2BA 4J89A 4ZF4A 3BXCA 5EHUA 3U8PA 2WHTA 2V4EB 2C9IA 2OTBA 2Z6XA 5LTQA 1F09A 2H6VA 4B30A 1QYQA 3CB9A 3DPWA 5DRGA 3LVCA 4KF4A 2HPWA 3DQ3A 4W7CA 4IK4A 2QT2A 4R6DA 3SSLA 1YZWA 5FVFA 4DKMA 5DPJA 3SRYA 3NT3A 3ZUJA 1EMKA 5BTTB 1UISA 3DQKA 3SV5A 4XVPA 3V3DA 4IK5A 1KYRA 3DQ2A 5EB6A 1QYOA 4GF6B 4ZIOA 4W6TA 5HW9A 3DQOA 3A8SA 3E5TA 3O77A 4JRBA 2HCGA 4P1QA 2GW3A 4W74A 5EJUA 3SG5A 1ZGQA 3I19A 4RTCA 3P8UA 4J88A 1MOVA 1ZGOA 1GGXA 2QZ0A 5DQMA 2AH8A 4XL5A 5DQBA 3SS0A 2DUHA 1HCJA 2QLGA 1Q4EA 2H5OA 3VICA 4LQUA 3SVBA 2A47A 3BXAA 4OY4A 3G9AA 3AI4A 1H4UA 4W6AA 4KF5A 1QXTA 4Q9WA 4EMQA 2VVHA 3LSAA 5LK4A 2BTJA 3SSHA 4GOBA 2H8QA 4ZINA 2VVJA 2H5QA 4L13A 2WISA 1Q4CA 3MGFA 3PJ5A 4I2YA 2V4EC 3U8AA 3SVOA 2ZO7A 4W75A 3UG0A 3DQNA 2A53B 3DQ7A 3DQMA 3TMTA 4W7DA 3SG4A 1Q73A 2Q57A 4W6DA 3GJ2A 4J8AA 4Q7UA 2HQZA 3BX9A 1W7TA 4KW4A 1JC0A 4EDSA 2HQKA 3DPZA 2ICRA 2YE1A 3SVUA 3AI5A 3ED8A 4DKNA 3U0KA 1RMOA 4Q7RA 2DUFA 2G6EA 2QU1A 5F9GA 1W7SA 5EXUA 4H3LA 4DXQA 3SG7A 1GL4A 4W7RA 3SSYA 2HFCA 3OGOA 4DXMA 4LW5A 2HJOA 4KF5C 3DPXA 2H9WA
chains in the Genus database with same CATH topology
3W1CA 1QY3A 1YHIA 4DXIA 4DXNA 2QLIA 1ZGPA 2ZO6A 3GB3A 5EBJA 4PFEA 2G3DB 4JEOA 1Q4AA 4HQCA 4W6BA 2AWMA 5DPGA 3SVEA 2WSOA 3OSRA 3EK4A 5FVIA 3DQUA 4W76A 3EVPA 2V4EA 2FZUA 4W6OA 2G5ZB 2YFPA 1B9CA 5H88A 4W6IA 2WIQA 3DQEA 4W7AA 3LA1A 1MYWA 3SSPA 5LTRA 4JFGA 4ZBLA 4H3MA 5DRFA 1EMMA 2POXA 3NF0A 4Z4MA 3VHTB 5BQLA 4KW9A 2C9JA 4ANJA 5DTLA 2IOVA 1MOUA 4Z4KA 3BXBA 5BTTA 4ZFSA 4W6NA 1KYSA 4KEXA 1EMCA 4W72A 3ST4A 1RMMA 2OKWA 3U0NA 4IK1A 5DPIA 5HGEA 1BFPA 1YJFA 3KCSA 4IZNA 5T3IA 2OJKA 2YE0A 4AR7A 2WURA 1JBZA 5HZOA 2EMDA 5J2OA 2GX0A 3LVDA 2G2SB 3GEXA 1RRXA 4H47A 2A52B 2AWKA 3E5WA 4N3DA 3CBEA 4R6BA 3SVRA 2GX2A 4ZB1A 3ZUFA 1YHGA 4HQ8A 3DQ8A 2Q6PA 3CFAA 3DQAA 3SG6A 4W7FA 3WLDA 2DD9A 3W1DA 1GFLA 1RMPA 3PIBA 5FVGA 2DUGA 3DQCA 2DUEA 3NEZA 1KP5A 4OQWA 4HQ9A 3TMRA 3SSTA 3IR8A 2DDDA 2QRFA 1XQMA 4W73A 5DTYA 2PXWA 4JC2A 4DXPA 4W7EA 4W6GA 4JGEA 2G3OA 1HUYA 4W6HA 5LTPA 2H5PA 4PPJA 4KPIA 3ZULA 3ST2A 4KW8A 4XOVA 5DTZA 1Q4BA 2G16B 1C4FA 3LF4B 2AWLA 4H48A 2H5RA 3RWTA 4L12A 1W7UA 3LS3A 4JF9A 4W6JA 5EXBA 2O24A 3DQ4A 4W6RA 4P76A 3S05A 3CD9A 2ARLA 3LVAA 4ZF3A 4IK3A 3P28A 2VZXA 3SG2A 2OGRA 4B30B 4KGEA 4W6LA 3DQIA 3SG3A 3O78A 4W6CA 4OJ0A 4W6UA 1ZUXA 2VVIA 3SSVA 4W77A 2DUIA 3EK7A 2B3PA 2ZMWA 4W6FA 3WLCA 4GESB 3ST0A 2ZMUA 4DXOA 5AQBB 4RYSA 2G6YA 1XSSA 1XA9A 3DQ1A 5DPHA 2DDCA 3SVNA 2IB6A 4U2VA 2A54B 3DQHA 1XAEA 4Q7TA 2VADA 5KTGA 3NEDA 5HZUA 2DD7A 1EMFA 1F0BA 3K1KA 5BT0A 1EMLA 3DQ6A 4W7XA 3EKHA 4LQTA 3PJ7A 4L1IA 3U0LA 2WSNA 1EMEA 1EMAA 3CFFA 5DTXA 3ST3A 2WHUA 2QLGB 4W69A 1QYFA 3GL4A 2A46A 3DQ9A 2IB5A 2HRSA 3EVRA 4XGYA 2JADA 3EVUA 5H87A 1OXEA 3AKOA 5H89A 2B3QA 4LJDC 2WHSA 3ZTFA 4OHSA 1YHHA 3KCTA 2GW4B 3DQFA 2PXSA 2Y0GA 3VHTA 2P4MA 3OSQA 2A48A 4PPLA 5HZTA 4TZAA 4XOWA 3IP2A 1XMZA 5HZSA 4AS8A 4B5YA 1JC1A 2VAEA 1CV7A 3DQJA 4IK9A 4KA9A 3RWAA 3EK8A 5DY6A 2Z6YA 2Z1OA 1OXDA 1OXFA 3SSKA 4PPKA 2A56B 1G7KA 4W6PA 4TZGA 4W6SA 2O29A 3SVDA 4ORNA 2FWQA 4W6KA 3CFHA 4EDOA 1RM9A 2A50B 3EKJA 3NT9A 2OTEA 2IE2A 3LF3A 3GJ1A 4NWSA 5EB7A 3DQDA 4KAGA 2G6XA 2YDZA 4EULA 5DU0A 3DQ5A 1JBYA 2RH7A 4EN1A 1Q4DA 3EVVA 5HBDA 3U0MA 5FHVA 3ADFA 1Z1PA 4H3NA 4ZF5A 3SVCA 4W6MA 1YJ2A 4RYWA 2Z6ZA 1S6ZA 4KGFA 5EXCI 3M22A 3U8CA 3H1OA 3M24A 2QLHA 3UFZA 4IK8A 2AHAA 3CGLA 4HVFA 4LJCA 3H1RA 3PJBA 2OKYA 3VK1A 4LJDA 1EMGA 3E5VA 1Z1QA 1EMBA 4LJBA 2AWJA 4UTSA 3WCKA 4Q9XA 2FL1A 2HGYA 2EMOA 3DQLA 2QLEA 2EMNA 1KYPA 2HGDA 3CD1A 4OGSA 3SVSA 4HE4A 1H6RA 4BDUA 1YFPA 2O2BA 4J89A 4ZF4A 3BXCA 5EHUA 3U8PA 2WHTA 2V4EB 2C9IA 2OTBA 2Z6XA 5LTQA 1F09A 2H6VA 4B30A 1QYQA 3CB9A 3DPWA 5DRGA 3LVCA 4KF4A 2HPWA 3DQ3A 4W7CA 4IK4A 2QT2A 4R6DA 3SSLA 1YZWA 5FVFA 4DKMA 5DPJA 3SRYA 3NT3A 3ZUJA 1EMKA 5BTTB 1UISA 3DQKA 3SV5A 4XVPA 3V3DA 4IK5A 1KYRA 3DQ2A 5EB6A 1QYOA 4GF6B 4ZIOA 4W6TA 5HW9A 3DQOA 3A8SA 3E5TA 3O77A 4JRBA 2HCGA 4P1QA 2GW3A 4W74A 5EJUA 3SG5A 1ZGQA 3I19A 4RTCA 3P8UA 4J88A 1MOVA 1ZGOA 1GGXA 2QZ0A 5DQMA 2AH8A 4XL5A 5DQBA 3SS0A 2DUHA 1HCJA 2QLGA 1Q4EA 2H5OA 3VICA 4LQUA 3SVBA 2A47A 3BXAA 4OY4A 3G9AA 3AI4A 1H4UA 4W6AA 4KF5A 1QXTA 4Q9WA 4EMQA 2VVHA 3LSAA 5LK4A 2BTJA 3SSHA 4GOBA 2H8QA 4ZINA 2VVJA 2H5QA 4L13A 2WISA 1Q4CA 3MGFA 3PJ5A 4I2YA 2V4EC 3U8AA 3SVOA 2ZO7A 4W75A 3UG0A 3DQNA 2A53B 3DQ7A 3DQMA 3TMTA 4W7DA 3SG4A 1Q73A 2Q57A 4W6DA 3GJ2A 4J8AA 4Q7UA 2HQZA 3BX9A 1W7TA 4KW4A 1JC0A 4EDSA 2HQKA 3DPZA 2ICRA 2YE1A 3SVUA 3AI5A 3ED8A 4DKNA 3U0KA 1RMOA 4Q7RA 2DUFA 2G6EA 2QU1A 5F9GA 1W7SA 5EXUA 4H3LA 4DXQA 3SG7A 1GL4A 4W7RA 3SSYA 2HFCA 3OGOA 4DXMA 4LW5A 2HJOA 4KF5C 3DPXA 2H9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1C A;  1QY3 A;  1YHI A;  4DXI A;  4DXN A;  2QLI A;  1ZGP A;  2ZO6 A;  3GB3 A;  5EBJ A;  4PFE A;  2G3D B;  4JEO A;  1Q4A A;  4HQC A;  4W6B A;  2AWM A;  5DPG A;  3SVE A;  2WSO A;  3OSR A;  3EK4 A;  5FVI A;  3DQU A;  4W76 A;  3EVP A;  2V4E A;  2FZU A;  4W6O A;  2G5Z B;  2YFP A;  1B9C A;  5H88 A;  4W6I A;  2WIQ A;  3DQE A;  4W7A A;  3LA1 A;  1MYW A;  3SSP A;  5LTR A;  4JFG A;  4ZBL A;  4H3M A;  5DRF A;  1EMM A;  2POX A;  3NF0 A;  4Z4M A;  3VHT B;  5BQL A;  4KW9 A;  2C9J A;  4ANJ A;  5DTL A;  2IOV A;  1MOU A;  4Z4K A;  3BXB A;  5BTT A;  4ZFS A;  4W6N A;  1KYS A;  4KEX A;  1EMC A;  4W72 A;  3ST4 A;  1RMM A;  2OKW A;  3U0N A;  4IK1 A;  5DPI A;  5HGE A;  1BFP A;  1YJF A;  3KCS A;  4IZN A;  5T3I A;  2OJK A;  2YE0 A;  4AR7 A;  2WUR A;  1JBZ A;  5HZO A;  2EMD A;  5J2O A;  2GX0 A;  3LVD A;  2G2S B;  3GEX A;  1RRX A;  4H47 A;  2A52 B;  2AWK A;  3E5W A;  4N3D A;  3CBE A;  4R6B A;  3SVR A;  2GX2 A;  4ZB1 A;  3ZUF A;  1YHG A;  4HQ8 A;  3DQ8 A;  2Q6P A;  3CFA A;  3DQA A;  3SG6 A;  4W7F A;  3WLD A;  2DD9 A;  3W1D A;  1GFL A;  1RMP A;  3PIB A;  5FVG A;  2DUG A;  3DQC A;  2DUE A;  3NEZ A;  1KP5 A;  4OQW A;  4HQ9 A;  3TMR A;  3SST A;  3IR8 A;  2DDD A;  2QRF A;  1XQM A;  4W73 A;  5DTY A;  2PXW A;  4JC2 A;  4DXP A;  4W7E A;  4W6G A;  4JGE A;  2G3O A;  1HUY A;  4W6H A;  5LTP A;  2H5P A;  4PPJ A;  4KPI A;  3ZUL A;  3ST2 A;  4KW8 A;  4XOV A;  5DTZ A;  1Q4B A;  2G16 B;  1C4F A;  3LF4 B;  2AWL A;  4H48 A;  2H5R A;  3RWT A;  4L12 A;  1W7U A;  3LS3 A;  4JF9 A;  4W6J A;  5EXB A;  2O24 A;  3DQ4 A;  4W6R A;  4P76 A;  3S05 A;  3CD9 A;  2ARL A;  3LVA A;  4ZF3 A;  4IK3 A;  3P28 A;  2VZX A;  3SG2 A;  2OGR A;  4B30 B;  4KGE A;  4W6L A;  3DQI A;  3SG3 A;  3O78 A;  4W6C A;  4OJ0 A;  4W6U A;  1ZUX A;  2VVI A;  3SSV A;  4W77 A;  2DUI A;  3EK7 A;  2B3P A;  2ZMW A;  4W6F A;  3WLC A;  4GES B;  3ST0 A;  2ZMU A;  4DXO A;  5AQB B;  4RYS A;  2G6Y A;  1XSS A;  1XA9 A;  3DQ1 A;  5DPH A;  2DDC A;  3SVN A;  2IB6 A;  4U2V A;  2A54 B;  3DQH A;  1XAE A;  4Q7T A;  2VAD A;  5KTG A;  3NED A;  5HZU A;  2DD7 A;  1EMF A;  1F0B A;  3K1K A;  5BT0 A;  1EML A;  3DQ6 A;  4W7X A;  3EKH A;  4LQT A;  3PJ7 A;  4L1I A;  3U0L A;  2WSN A;  1EME A;  1EMA A;  3CFF A;  5DTX A;  3ST3 A;  2WHU A;  2QLG B;  4W69 A;  1QYF A;  3GL4 A;  2A46 A;  3DQ9 A;  2IB5 A;  2HRS A;  3EVR A;  4XGY A;  2JAD A;  3EVU A;  5H87 A;  1OXE A;  3AKO A;  5H89 A;  2B3Q A;  4LJD C;  2WHS A;  3ZTF A;  4OHS A;  1YHH A;  3KCT A;  2GW4 B;  3DQF A;  2PXS A;  2Y0G A;  3VHT A;  2P4M A;  3OSQ A;  2A48 A;  4PPL A;  5HZT A;  4TZA A;  4XOW A;  3IP2 A;  1XMZ A;  5HZS A;  4AS8 A;  4B5Y A;  1JC1 A;  2VAE A;  1CV7 A;  3DQJ A;  4IK9 A;  4KA9 A;  3RWA A;  3EK8 A;  5DY6 A;  2Z6Y A;  2Z1O A;  1OXD A;  1OXF A;  3SSK A;  4PPK A;  2A56 B;  1G7K A;  4W6P A;  4TZG A;  4W6S A;  2O29 A;  3SVD A;  4ORN A;  2FWQ A;  4W6K A;  3CFH A;  4EDO A;  1RM9 A;  2A50 B;  3EKJ A;  3NT9 A;  2OTE A;  2IE2 A;  3LF3 A;  3GJ1 A;  4NWS A;  5EB7 A;  3DQD A;  4KAG A;  2G6X A;  2YDZ A;  4EUL A;  5DU0 A;  3DQ5 A;  1JBY A;  2RH7 A;  4EN1 A;  1Q4D A;  3EVV A;  5HBD A;  3U0M A;  5FHV A;  3ADF A;  1Z1P A;  4H3N A;  4ZF5 A;  3SVC A;  4W6M A;  1YJ2 A;  4RYW A;  2Z6Z A;  1S6Z A;  4KGF A;  5EXC I;  3M22 A;  3U8C A;  3H1O A;  3M24 A;  2QLH A;  3UFZ A;  4IK8 A;  2AHA A;  3CGL A;  4HVF A;  4LJC A;  3H1R A;  3PJB A;  2OKY A;  3VK1 A;  4LJD A;  1EMG A;  3E5V A;  1Z1Q A;  1EMB A;  4LJB A;  2AWJ A;  4UTS A;  3WCK A;  4Q9X A;  2FL1 A;  2HGY A;  2EMO A;  3DQL A;  2QLE A;  2EMN A;  1KYP A;  2HGD A;  3CD1 A;  4OGS A;  3SVS A;  4HE4 A;  1H6R A;  4BDU A;  1YFP A;  2O2B A;  4J89 A;  4ZF4 A;  3BXC A;  5EHU A;  3U8P A;  2WHT A;  2V4E B;  2C9I A;  2OTB A;  2Z6X A;  5LTQ A;  1F09 A;  2H6V A;  4B30 A;  1QYQ A;  3CB9 A;  3DPW A;  5DRG A;  3LVC A;  4KF4 A;  2HPW A;  3DQ3 A;  4W7C A;  4IK4 A;  2QT2 A;  4R6D A;  3SSL A;  1YZW A;  5FVF A;  4DKM A;  5DPJ A;  3SRY A;  3NT3 A;  3ZUJ A;  1EMK A;  5BTT B;  1UIS A;  3DQK A;  3SV5 A;  4XVP A;  3V3D A;  4IK5 A;  1KYR A;  3DQ2 A;  5EB6 A;  1QYO A;  4GF6 B;  4ZIO A;  4W6T A;  5HW9 A;  3DQO A;  3A8S A;  3E5T A;  3O77 A;  4JRB A;  2HCG A;  4P1Q A;  2GW3 A;  4W74 A;  5EJU A;  3SG5 A;  1ZGQ A;  3I19 A;  4RTC A;  3P8U A;  4J88 A;  1MOV A;  1ZGO A;  1GGX A;  2QZ0 A;  5DQM A;  2AH8 A;  4XL5 A;  5DQB A;  3SS0 A;  2DUH A;  1HCJ A;  2QLG A;  1Q4E A;  2H5O A;  3VIC A;  4LQU A;  3SVB A;  2A47 A;  3BXA A;  4OY4 A;  3G9A A;  3AI4 A;  1H4U A;  4W6A A;  4KF5 A;  1QXT A;  4Q9W A;  4EMQ A;  2VVH A;  3LSA A;  5LK4 A;  2BTJ A;  3SSH A;  4GOB A;  2H8Q A;  4ZIN A;  2VVJ A;  2H5Q A;  4L13 A;  2WIS A;  1Q4C A;  3MGF A;  3PJ5 A;  4I2Y A;  2V4E C;  3U8A A;  3SVO A;  2ZO7 A;  4W75 A;  3UG0 A;  3DQN A;  2A53 B;  3DQ7 A;  3DQM A;  3TMT A;  4W7D A;  3SG4 A;  1Q73 A;  2Q57 A;  4W6D A;  3GJ2 A;  4J8A A;  4Q7U A;  2HQZ A;  3BX9 A;  1W7T A;  4KW4 A;  1JC0 A;  4EDS A;  2HQK A;  3DPZ A;  2ICR A;  2YE1 A;  3SVU A;  3AI5 A;  3ED8 A;  4DKN A;  3U0K A;  1RMO A;  4Q7R A;  2DUF A;  2G6E A;  2QU1 A;  5F9G A;  1W7S A;  5EXU A;  4H3L A;  4DXQ A;  3SG7 A;  1GL4 A;  4W7R A;  3SSY A;  2HFC A;  3OGO A;  4DXM A;  4LW5 A;  2HJO A;  4KF5 C;  3DPX A;  2H9W A; 
#chains in the Genus database with same CATH topology
 3W1C A;  1QY3 A;  1YHI A;  4DXI A;  4DXN A;  2QLI A;  1ZGP A;  2ZO6 A;  3GB3 A;  5EBJ A;  4PFE A;  2G3D B;  4JEO A;  1Q4A A;  4HQC A;  4W6B A;  2AWM A;  5DPG A;  3SVE A;  2WSO A;  3OSR A;  3EK4 A;  5FVI A;  3DQU A;  4W76 A;  3EVP A;  2V4E A;  2FZU A;  4W6O A;  2G5Z B;  2YFP A;  1B9C A;  5H88 A;  4W6I A;  2WIQ A;  3DQE A;  4W7A A;  3LA1 A;  1MYW A;  3SSP A;  5LTR A;  4JFG A;  4ZBL A;  4H3M A;  5DRF A;  1EMM A;  2POX A;  3NF0 A;  4Z4M A;  3VHT B;  5BQL A;  4KW9 A;  2C9J A;  4ANJ A;  5DTL A;  2IOV A;  1MOU A;  4Z4K A;  3BXB A;  5BTT A;  4ZFS A;  4W6N A;  1KYS A;  4KEX A;  1EMC A;  4W72 A;  3ST4 A;  1RMM A;  2OKW A;  3U0N A;  4IK1 A;  5DPI A;  5HGE A;  1BFP A;  1YJF A;  3KCS A;  4IZN A;  5T3I A;  2OJK A;  2YE0 A;  4AR7 A;  2WUR A;  1JBZ A;  5HZO A;  2EMD A;  5J2O A;  2GX0 A;  3LVD A;  2G2S B;  3GEX A;  1RRX A;  4H47 A;  2A52 B;  2AWK A;  3E5W A;  4N3D A;  3CBE A;  4R6B A;  3SVR A;  2GX2 A;  4ZB1 A;  3ZUF A;  1YHG A;  4HQ8 A;  3DQ8 A;  2Q6P A;  3CFA A;  3DQA A;  3SG6 A;  4W7F A;  3WLD A;  2DD9 A;  3W1D A;  1GFL A;  1RMP A;  3PIB A;  5FVG A;  2DUG A;  3DQC A;  2DUE A;  3NEZ A;  1KP5 A;  4OQW A;  4HQ9 A;  3TMR A;  3SST A;  3IR8 A;  2DDD A;  2QRF A;  1XQM A;  4W73 A;  5DTY A;  2PXW A;  4JC2 A;  4DXP A;  4W7E A;  4W6G A;  4JGE A;  2G3O A;  1HUY A;  4W6H A;  5LTP A;  2H5P A;  4PPJ A;  4KPI A;  3ZUL A;  3ST2 A;  4KW8 A;  4XOV A;  5DTZ A;  1Q4B A;  2G16 B;  1C4F A;  3LF4 B;  2AWL A;  4H48 A;  2H5R A;  3RWT A;  4L12 A;  1W7U A;  3LS3 A;  4JF9 A;  4W6J A;  5EXB A;  2O24 A;  3DQ4 A;  4W6R A;  4P76 A;  3S05 A;  3CD9 A;  2ARL A;  3LVA A;  4ZF3 A;  4IK3 A;  3P28 A;  2VZX A;  3SG2 A;  2OGR A;  4B30 B;  4KGE A;  4W6L A;  3DQI A;  3SG3 A;  3O78 A;  4W6C A;  4OJ0 A;  4W6U A;  1ZUX A;  2VVI A;  3SSV A;  4W77 A;  2DUI A;  3EK7 A;  2B3P A;  2ZMW A;  4W6F A;  3WLC A;  4GES B;  3ST0 A;  2ZMU A;  4DXO A;  5AQB B;  4RYS A;  2G6Y A;  1XSS A;  1XA9 A;  3DQ1 A;  5DPH A;  2DDC A;  3SVN A;  2IB6 A;  4U2V A;  2A54 B;  3DQH A;  1XAE A;  4Q7T A;  2VAD A;  5KTG A;  3NED A;  5HZU A;  2DD7 A;  1EMF A;  1F0B A;  3K1K A;  5BT0 A;  1EML A;  3DQ6 A;  4W7X A;  3EKH A;  4LQT A;  3PJ7 A;  4L1I A;  3U0L A;  2WSN A;  1EME A;  1EMA A;  3CFF A;  5DTX A;  3ST3 A;  2WHU A;  2QLG B;  4W69 A;  1QYF A;  3GL4 A;  2A46 A;  3DQ9 A;  2IB5 A;  2HRS A;  3EVR A;  4XGY A;  2JAD A;  3EVU A;  5H87 A;  1OXE A;  3AKO A;  5H89 A;  2B3Q A;  4LJD C;  2WHS A;  3ZTF A;  4OHS A;  1YHH A;  3KCT A;  2GW4 B;  3DQF A;  2PXS A;  2Y0G A;  3VHT A;  2P4M A;  3OSQ A;  2A48 A;  4PPL A;  5HZT A;  4TZA A;  4XOW A;  3IP2 A;  1XMZ A;  5HZS A;  4AS8 A;  4B5Y A;  1JC1 A;  2VAE A;  1CV7 A;  3DQJ A;  4IK9 A;  4KA9 A;  3RWA A;  3EK8 A;  5DY6 A;  2Z6Y A;  2Z1O A;  1OXD A;  1OXF A;  3SSK A;  4PPK A;  2A56 B;  1G7K A;  4W6P A;  4TZG A;  4W6S A;  2O29 A;  3SVD A;  4ORN A;  2FWQ A;  4W6K A;  3CFH A;  4EDO A;  1RM9 A;  2A50 B;  3EKJ A;  3NT9 A;  2OTE A;  2IE2 A;  3LF3 A;  3GJ1 A;  4NWS A;  5EB7 A;  3DQD A;  4KAG A;  2G6X A;  2YDZ A;  4EUL A;  5DU0 A;  3DQ5 A;  1JBY A;  2RH7 A;  4EN1 A;  1Q4D A;  3EVV A;  5HBD A;  3U0M A;  5FHV A;  3ADF A;  1Z1P A;  4H3N A;  4ZF5 A;  3SVC A;  4W6M A;  1YJ2 A;  4RYW A;  2Z6Z A;  1S6Z A;  4KGF A;  5EXC I;  3M22 A;  3U8C A;  3H1O A;  3M24 A;  2QLH A;  3UFZ A;  4IK8 A;  2AHA A;  3CGL A;  4HVF A;  4LJC A;  3H1R A;  3PJB A;  2OKY A;  3VK1 A;  4LJD A;  1EMG A;  3E5V A;  1Z1Q A;  1EMB A;  4LJB A;  2AWJ A;  4UTS A;  3WCK A;  4Q9X A;  2FL1 A;  2HGY A;  2EMO A;  3DQL A;  2QLE A;  2EMN A;  1KYP A;  2HGD A;  3CD1 A;  4OGS A;  3SVS A;  4HE4 A;  1H6R A;  4BDU A;  1YFP A;  2O2B A;  4J89 A;  4ZF4 A;  3BXC A;  5EHU A;  3U8P A;  2WHT A;  2V4E B;  2C9I A;  2OTB A;  2Z6X A;  5LTQ A;  1F09 A;  2H6V A;  4B30 A;  1QYQ A;  3CB9 A;  3DPW A;  5DRG A;  3LVC A;  4KF4 A;  2HPW A;  3DQ3 A;  4W7C A;  4IK4 A;  2QT2 A;  4R6D A;  3SSL A;  1YZW A;  5FVF A;  4DKM A;  5DPJ A;  3SRY A;  3NT3 A;  3ZUJ A;  1EMK A;  5BTT B;  1UIS A;  3DQK A;  3SV5 A;  4XVP A;  3V3D A;  4IK5 A;  1KYR A;  3DQ2 A;  5EB6 A;  1QYO A;  4GF6 B;  4ZIO A;  4W6T A;  5HW9 A;  3DQO A;  3A8S A;  3E5T A;  3O77 A;  4JRB A;  2HCG A;  4P1Q A;  2GW3 A;  4W74 A;  5EJU A;  3SG5 A;  1ZGQ A;  3I19 A;  4RTC A;  3P8U A;  4J88 A;  1MOV A;  1ZGO A;  1GGX A;  2QZ0 A;  5DQM A;  2AH8 A;  4XL5 A;  5DQB A;  3SS0 A;  2DUH A;  1HCJ A;  2QLG A;  1Q4E A;  2H5O A;  3VIC A;  4LQU A;  3SVB A;  2A47 A;  3BXA A;  4OY4 A;  3G9A A;  3AI4 A;  1H4U A;  4W6A A;  4KF5 A;  1QXT A;  4Q9W A;  4EMQ A;  2VVH A;  3LSA A;  5LK4 A;  2BTJ A;  3SSH A;  4GOB A;  2H8Q A;  4ZIN A;  2VVJ A;  2H5Q A;  4L13 A;  2WIS A;  1Q4C A;  3MGF A;  3PJ5 A;  4I2Y A;  2V4E C;  3U8A A;  3SVO A;  2ZO7 A;  4W75 A;  3UG0 A;  3DQN A;  2A53 B;  3DQ7 A;  3DQM A;  3TMT A;  4W7D A;  3SG4 A;  1Q73 A;  2Q57 A;  4W6D A;  3GJ2 A;  4J8A A;  4Q7U A;  2HQZ A;  3BX9 A;  1W7T A;  4KW4 A;  1JC0 A;  4EDS A;  2HQK A;  3DPZ A;  2ICR A;  2YE1 A;  3SVU A;  3AI5 A;  3ED8 A;  4DKN A;  3U0K A;  1RMO A;  4Q7R A;  2DUF A;  2G6E A;  2QU1 A;  5F9G A;  1W7S A;  5EXU A;  4H3L A;  4DXQ A;  3SG7 A;  1GL4 A;  4W7R A;  3SSY A;  2HFC A;  3OGO A;  4DXM A;  4LW5 A;  2HJO A;  4KF5 C;  3DPX A;  2H9W A; 
#chains in the Genus database with same CATH homology
 3W1C A;  1QY3 A;  1YHI A;  4DXI A;  4DXN A;  2QLI A;  1ZGP A;  2ZO6 A;  3GB3 A;  5EBJ A;  4PFE A;  2G3D B;  4JEO A;  1Q4A A;  4HQC A;  4W6B A;  2AWM A;  5DPG A;  3SVE A;  2WSO A;  3OSR A;  3EK4 A;  5FVI A;  3DQU A;  4W76 A;  3EVP A;  2V4E A;  2FZU A;  4W6O A;  2G5Z B;  2YFP A;  1B9C A;  5H88 A;  4W6I A;  2WIQ A;  3DQE A;  4W7A A;  3LA1 A;  1MYW A;  3SSP A;  5LTR A;  4JFG A;  4ZBL A;  4H3M A;  5DRF A;  1EMM A;  2POX A;  3NF0 A;  4Z4M A;  3VHT B;  5BQL A;  4KW9 A;  2C9J A;  4ANJ A;  5DTL A;  2IOV A;  1MOU A;  4Z4K A;  3BXB A;  5BTT A;  4ZFS A;  4W6N A;  1KYS A;  4KEX A;  1EMC A;  4W72 A;  3ST4 A;  1RMM A;  2OKW A;  3U0N A;  4IK1 A;  5DPI A;  5HGE A;  1BFP A;  1YJF A;  3KCS A;  4IZN A;  5T3I A;  2OJK A;  2YE0 A;  4AR7 A;  2WUR A;  1JBZ A;  5HZO A;  2EMD A;  5J2O A;  2GX0 A;  3LVD A;  2G2S B;  3GEX A;  1RRX A;  4H47 A;  2A52 B;  2AWK A;  3E5W A;  4N3D A;  3CBE A;  4R6B A;  3SVR A;  2GX2 A;  4ZB1 A;  3ZUF A;  1YHG A;  4HQ8 A;  3DQ8 A;  2Q6P A;  3CFA A;  3DQA A;  3SG6 A;  4W7F A;  3WLD A;  2DD9 A;  3W1D A;  1GFL A;  1RMP A;  3PIB A;  5FVG A;  2DUG A;  3DQC A;  2DUE A;  3NEZ A;  1KP5 A;  4OQW A;  4HQ9 A;  3TMR A;  3SST A;  3IR8 A;  2DDD A;  2QRF A;  1XQM A;  4W73 A;  5DTY A;  2PXW A;  4JC2 A;  4DXP A;  4W7E A;  4W6G A;  4JGE A;  2G3O A;  1HUY A;  4W6H A;  5LTP A;  2H5P A;  4PPJ A;  4KPI A;  3ZUL A;  3ST2 A;  4KW8 A;  4XOV A;  5DTZ A;  1Q4B A;  2G16 B;  1C4F A;  3LF4 B;  2AWL A;  4H48 A;  2H5R A;  3RWT A;  4L12 A;  1W7U A;  3LS3 A;  4JF9 A;  4W6J A;  5EXB A;  2O24 A;  3DQ4 A;  4W6R A;  4P76 A;  3S05 A;  3CD9 A;  2ARL A;  3LVA A;  4ZF3 A;  4IK3 A;  3P28 A;  2VZX A;  3SG2 A;  2OGR A;  4B30 B;  4KGE A;  4W6L A;  3DQI A;  3SG3 A;  3O78 A;  4W6C A;  4OJ0 A;  4W6U A;  1ZUX A;  2VVI A;  3SSV A;  4W77 A;  2DUI A;  3EK7 A;  2B3P A;  2ZMW A;  4W6F A;  3WLC A;  4GES B;  3ST0 A;  2ZMU A;  4DXO A;  5AQB B;  4RYS A;  2G6Y A;  1XSS A;  1XA9 A;  3DQ1 A;  5DPH A;  2DDC A;  3SVN A;  2IB6 A;  4U2V A;  2A54 B;  3DQH A;  1XAE A;  4Q7T A;  2VAD A;  5KTG A;  3NED A;  5HZU A;  2DD7 A;  1EMF A;  1F0B A;  3K1K A;  5BT0 A;  1EML A;  3DQ6 A;  4W7X A;  3EKH A;  4LQT A;  3PJ7 A;  4L1I A;  3U0L A;  2WSN A;  1EME A;  1EMA A;  3CFF A;  5DTX A;  3ST3 A;  2WHU A;  2QLG B;  4W69 A;  1QYF A;  3GL4 A;  2A46 A;  3DQ9 A;  2IB5 A;  2HRS A;  3EVR A;  4XGY A;  2JAD A;  3EVU A;  5H87 A;  1OXE A;  3AKO A;  5H89 A;  2B3Q A;  4LJD C;  2WHS A;  3ZTF A;  4OHS A;  1YHH A;  3KCT A;  2GW4 B;  3DQF A;  2PXS A;  2Y0G A;  3VHT A;  2P4M A;  3OSQ A;  2A48 A;  4PPL A;  5HZT A;  4TZA A;  4XOW A;  3IP2 A;  1XMZ A;  5HZS A;  4AS8 A;  4B5Y A;  1JC1 A;  2VAE A;  1CV7 A;  3DQJ A;  4IK9 A;  4KA9 A;  3RWA A;  3EK8 A;  5DY6 A;  2Z6Y A;  2Z1O A;  1OXD A;  1OXF A;  3SSK A;  4PPK A;  2A56 B;  1G7K A;  4W6P A;  4TZG A;  4W6S A;  2O29 A;  3SVD A;  4ORN A;  2FWQ A;  4W6K A;  3CFH A;  4EDO A;  1RM9 A;  2A50 B;  3EKJ A;  3NT9 A;  2OTE A;  2IE2 A;  3LF3 A;  3GJ1 A;  4NWS A;  5EB7 A;  3DQD A;  4KAG A;  2G6X A;  2YDZ A;  4EUL A;  5DU0 A;  3DQ5 A;  1JBY A;  2RH7 A;  4EN1 A;  1Q4D A;  3EVV A;  5HBD A;  3U0M A;  5FHV A;  3ADF A;  1Z1P A;  4H3N A;  4ZF5 A;  3SVC A;  4W6M A;  1YJ2 A;  4RYW A;  2Z6Z A;  1S6Z A;  4KGF A;  5EXC I;  3M22 A;  3U8C A;  3H1O A;  3M24 A;  2QLH A;  3UFZ A;  4IK8 A;  2AHA A;  3CGL A;  4HVF A;  4LJC A;  3H1R A;  3PJB A;  2OKY A;  3VK1 A;  4LJD A;  1EMG A;  3E5V A;  1Z1Q A;  1EMB A;  4LJB A;  2AWJ A;  4UTS A;  3WCK A;  4Q9X A;  2FL1 A;  2HGY A;  2EMO A;  3DQL A;  2QLE A;  2EMN A;  1KYP A;  2HGD A;  3CD1 A;  4OGS A;  3SVS A;  4HE4 A;  1H6R A;  4BDU A;  1YFP A;  2O2B A;  4J89 A;  4ZF4 A;  3BXC A;  5EHU A;  3U8P A;  2WHT A;  2V4E B;  2C9I A;  2OTB A;  2Z6X A;  5LTQ A;  1F09 A;  2H6V A;  4B30 A;  1QYQ A;  3CB9 A;  3DPW A;  5DRG A;  3LVC A;  4KF4 A;  2HPW A;  3DQ3 A;  4W7C A;  4IK4 A;  2QT2 A;  4R6D A;  3SSL A;  1YZW A;  5FVF A;  4DKM A;  5DPJ A;  3SRY A;  3NT3 A;  3ZUJ A;  1EMK A;  5BTT B;  1UIS A;  3DQK A;  3SV5 A;  4XVP A;  3V3D A;  4IK5 A;  1KYR A;  3DQ2 A;  5EB6 A;  1QYO A;  4GF6 B;  4ZIO A;  4W6T A;  5HW9 A;  3DQO A;  3A8S A;  3E5T A;  3O77 A;  4JRB A;  2HCG A;  4P1Q A;  2GW3 A;  4W74 A;  5EJU A;  3SG5 A;  1ZGQ A;  3I19 A;  4RTC A;  3P8U A;  4J88 A;  1MOV A;  1ZGO A;  1GGX A;  2QZ0 A;  5DQM A;  2AH8 A;  4XL5 A;  5DQB A;  3SS0 A;  2DUH A;  1HCJ A;  2QLG A;  1Q4E A;  2H5O A;  3VIC A;  4LQU A;  3SVB A;  2A47 A;  3BXA A;  4OY4 A;  3G9A A;  3AI4 A;  1H4U A;  4W6A A;  4KF5 A;  1QXT A;  4Q9W A;  4EMQ A;  2VVH A;  3LSA A;  5LK4 A;  2BTJ A;  3SSH A;  4GOB A;  2H8Q A;  4ZIN A;  2VVJ A;  2H5Q A;  4L13 A;  2WIS A;  1Q4C A;  3MGF A;  3PJ5 A;  4I2Y A;  2V4E C;  3U8A A;  3SVO A;  2ZO7 A;  4W75 A;  3UG0 A;  3DQN A;  2A53 B;  3DQ7 A;  3DQM A;  3TMT A;  4W7D A;  3SG4 A;  1Q73 A;  2Q57 A;  4W6D A;  3GJ2 A;  4J8A A;  4Q7U A;  2HQZ A;  3BX9 A;  1W7T A;  4KW4 A;  1JC0 A;  4EDS A;  2HQK A;  3DPZ A;  2ICR A;  2YE1 A;  3SVU A;  3AI5 A;  3ED8 A;  4DKN A;  3U0K A;  1RMO A;  4Q7R A;  2DUF A;  2G6E A;  2QU1 A;  5F9G A;  1W7S A;  5EXU A;  4H3L A;  4DXQ A;  3SG7 A;  1GL4 A;  4W7R A;  3SSY A;  2HFC A;  3OGO A;  4DXM A;  4LW5 A;  2HJO A;  4KF5 C;  3DPX A;  2H9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...