4W6KA

Crystal structure of full-length split gfp mutant d117c disulfide dimer, p 41 21 2 space group
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
194
Chain Sequence
TGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQAFSFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGCTLVNRIELKGIDFKENILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGHYLSTQTILSKDLNEKRDHMVLLEYVTAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein D117C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 49
structure length 194
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w6kA00
4W7EA 4BDUA 4ZFSA 4H3NA 3O77A 4L1IA 5AQBB 3AI5A 3MGFA 3ST3A 4W74A 4JFGA 3UFZA 1KYRA 4W6NA 2H5OA 2WHSA 3PJBA 1EMCA 2VAEA 2A53B 4JEOA 3NF0A 5DY6A 2QLEA 2HPWA 5DQMA 3CFAA 3DQ9A 4Q9XA 4B30B 4H3LA 5J2OA 1YJ2A 1KYPA 3SG3A 2YDZA 3SVOA 4W6RA 4R6BA 4U2VA 3AI4A 2EMNA 3CB9A 2HFCA 1H4UA 1EMAA 3V3DA 4J88A 4ZIOA 3SVNA 4OHSA 3EVUA 3LS3A 1XMZA 3NT3A 2JADA 4JC2A 4W6KA 3ZUFA 5T3IA 3DQJA 3DQHA 2PXSA 3OGOA 5FVFA 1EMLA 3M22A 5DTZA 1MOVA 3E5VA 2YE1A 1EMMA 4L12A 4GESB 1MOUA 2QLGB 4KEXA 3SV5A 3CBEA 3U0LA 2DUEA 5KTGA 4N3DA 2AWMA 2WSNA 3U8AA 2V4EC 3DQ6A 2G5ZB 3ZTFA 2G6EA 5EHUA 4IK8A 2OKYA 3DQ4A 2H5QA 2HQKA 5DPHA 2VVIA 5LK4A 1H6RA 5HGEA 3BX9A 1RRXA 2HJOA 4J8AA 5FHVA 2OJKA 2WSOA 4JF9A 4DXMA 2Z6YA 2HGDA 3S05A 4KW8A 3CD9A 4W6FA 1YHGA 4W69A 4W6TA 5EXCI 1Q4EA 3DQLA 4EMQA 1Q4DA 1KP5A 1KYSA 3P28A 5HZOA 4AS8A 2ZO7A 4W6DA 5HW9A 5DTXA 1YJFA 4RTCA 4J89A 2YE0A 2H5RA 4KW4A 2H8QA 4PPJA 3U8CA 3VICA 4W6BA 2A46A 2H5PA 2A54B 2O29A 1ZGQA 1YHIA 4XOVA 2DUIA 3G9AA 4GF6B 4DXQA 1XAEA 5HZSA 2POXA 2DUFA 2QU1A 3SS0A 3EVRA 4RYSA 2Q57A 3W1DA 3EVPA 4EDOA 3IR8A 3PJ5A 3VK1A 3PJ7A 4DXNA 2H9WA 3ED8A 2G6YA 4IK1A 4KPIA 4ANJA 4ZF3A 2AHAA 2GX0A 2G2SB 2A48A 4TZAA 2EMDA 4DXIA 2V4EA 4LJBA 3TMTA 4ORNA 2G16B 1EMGA 3NT9A 3ADFA 3EK4A 3U0KA 3ZULA 1YFPA 4TZGA 3BXCA 2HCGA 2O2BA 5H89A 3ST2A 2QZ0A 5DTYA 2G6XA 3DPWA 1Q73A 2A50B 1GL4A 5DU0A 2HRSA 3H1RA 3WCKA 2WIQA 1XSSA 4Q7UA 4KGFA 2HQZA 4NWSA 4DKNA 4P76A 2AWLA 5F9GA 3CGLA 2IOVA 4XVPA 4XL5A 4Z4MA 3U0MA 1JC0A 3EVVA 4EULA 3DQAA 2DDDA 3GB3A 1RMOA 3KCTA 3NEZA 3DPXA 2GW3A 3SVSA 4XGYA 3DQEA 2P4MA 3ST4A 2HGYA 3RWAA 3SSLA 5EB6A 3H1OA 4W6HA 2ZO6A 4RYWA 4OGSA 4W7AA 1ZUXA 5DPGA 2FZUA 4PFEA 3DQFA 3DPZA 3LF4B 3GJ2A 2VVHA 3U0NA 3SG7A 3SG2A 3SSHA 1HCJA 5BTTA 4W7DA 1S6ZA 5H88A 1YZWA 4W7XA 4OY4A 2QRFA 1G7KA 5EBJA 3M24A 4HQCA 4LW5A 2DUHA 4L13A 2Y0GA 3OSQA 5HZTA 4DKMA 1JBZA 3DQCA 3SVRA 4OQWA 4H47A 2VADA 2GX2A 4OJ0A 5EXUA 4W7CA 3I19A 3SG4A 4W6MA 1ZGPA 4DXOA 3LSAA 4W77A 4W6CA 2FL1A 5HZUA 2IB5A 4W6AA 4HQ9A 1B9CA 1ZGOA 4B30A 3E5WA 4W6IA 4PPKA 2BTJA 3DQUA 4Z4KA 2WHTA 1XA9A 4Q7TA 2Z1OA 3O78A 5LTRA 4P1QA 5FVGA 1W7TA 3LVAA 4PPLA 3SVEA 4KW9A 1Z1QA 2IE2A 3NEDA 4B5YA 2A47A 2G3DB 4W6GA 2H6VA 4IK9A 1QYOA 5BQLA 1QYQA 4W7FA 3LF3A 1JBYA 4Q7RA 5EB7A 4EDSA 3CD1A 1F09A 3GEXA 4LJDC 3DQ7A 1QYFA 3SG6A 4GOBA 2AH8A 5H87A 4ZINA 3RWTA 2Z6ZA 1EMBA 4IK5A 4HVFA 4ZF5A 4KAGA 4W6JA 3A8SA 2WISA 3SSKA 1CV7A 3AKOA 1Z1PA 3EKHA 3P8UA 5BTTB 4W6OA 2GW4B 3SVBA 4EN1A 3SSYA 2QLIA 3LVDA 3ST0A 1GGXA 4UTSA 3DQNA 4W6UA 5EJUA 2G3OA 3IP2A 3DQDA 3DQ5A 4JRBA 1GFLA 4KF5C 3WLCA 3PIBA 4LQUA 5DQBA 3DQ1A 4R6DA 2IB6A 2DD7A 3SSPA 1EMFA 5FVIA 1HUYA 4Q9WA 1JC1A 1OXFA 3DQKA 1MYWA 2WHUA 4W75A 4W7RA 3CFFA 3DQOA 3UG0A 1YHHA 3K1KA 2WURA 4H48A 3VHTA 4LJCA 4W72A 4ZF4A 2Q6PA 4LJDA 1BFPA 2ZMUA 5DTLA 2PXWA 4IK3A 2ICRA 2DUGA 3DQ8A 1EMEA 2YFPA 3WLDA 4KA9A 4XOWA 3SSTA 3EK8A 3ZUJA 2RH7A 4H3MA 4IK4A 3BXBA 3SVDA 1Q4BA 5BT0A 2B3PA 3GJ1A 3DQMA 4KF4A 3SVCA 1Q4AA 4HQ8A 2O24A 1OXDA 4ZB1A 3W1CA 3LA1A 1F0BA 2VZXA 3GL4A 4DXPA 2V4EB 3CFHA 4KGEA 3E5TA 5DPJA 3SVUA 4I2YA 1EMKA 3BXAA 1C4FA 3DQ3A 3LVCA 4IZNA 2OKWA 3EK7A 1UISA 3SRYA 4W6SA 3TMRA 2DD9A 4KF5A 5DPIA 3OSRA 4W6LA 2OTEA 1W7UA 1RM9A 4HE4A 2B3QA 5EXBA 5HBDA 2C9JA 1OXEA 1Q4CA 3DQIA 2AWKA 5DRFA 2QLGA 2VVJA 4JGEA 1RMPA 5LTPA 2QT2A 1XQMA 3EKJA 3SG5A 4W6PA 5LTQA 2C9IA 2EMOA 1QXTA 1RMMA 2OTBA 3DQ2A 2A56B 2AWJA 4W73A 3U8PA 2FWQA 4ZBLA 4LQTA 4W76A 2DDCA 2A52B 3SSVA 5DRGA 3KCSA 2ARLA 2QLHA 2ZMWA 3VHTB 4AR7A 2Z6XA 1W7SA 2OGRA 1QY3A
chains in the Genus database with same CATH superfamily
4W7EA 4BDUA 4ZFSA 4H3NA 3O77A 4L1IA 5AQBB 3AI5A 3MGFA 3ST3A 4W74A 4JFGA 3UFZA 1KYRA 4W6NA 2H5OA 2WHSA 3PJBA 1EMCA 2VAEA 2A53B 4JEOA 3NF0A 5DY6A 2QLEA 2HPWA 5DQMA 3CFAA 3DQ9A 4Q9XA 4B30B 4H3LA 5J2OA 1YJ2A 1KYPA 3SG3A 2YDZA 3SVOA 4W6RA 4R6BA 4U2VA 3AI4A 2EMNA 3CB9A 2HFCA 1H4UA 1EMAA 3V3DA 4J88A 4ZIOA 3SVNA 4OHSA 3EVUA 3LS3A 1XMZA 3NT3A 2JADA 4JC2A 4W6KA 3ZUFA 5T3IA 3DQJA 3DQHA 2PXSA 3OGOA 5FVFA 1EMLA 3M22A 5DTZA 1MOVA 3E5VA 2YE1A 1EMMA 4L12A 4GESB 1MOUA 2QLGB 4KEXA 3SV5A 3CBEA 3U0LA 2DUEA 5KTGA 4N3DA 2AWMA 2WSNA 3U8AA 2V4EC 3DQ6A 2G5ZB 3ZTFA 2G6EA 5EHUA 4IK8A 2OKYA 3DQ4A 2H5QA 2HQKA 5DPHA 2VVIA 5LK4A 1H6RA 5HGEA 3BX9A 1RRXA 2HJOA 4J8AA 5FHVA 2OJKA 2WSOA 4JF9A 4DXMA 2Z6YA 2HGDA 3S05A 4KW8A 3CD9A 4W6FA 1YHGA 4W69A 4W6TA 5EXCI 1Q4EA 3DQLA 4EMQA 1Q4DA 1KP5A 1KYSA 3P28A 5HZOA 4AS8A 2ZO7A 4W6DA 5HW9A 5DTXA 1YJFA 4RTCA 4J89A 2YE0A 2H5RA 4KW4A 2H8QA 4PPJA 3U8CA 3VICA 4W6BA 2A46A 2H5PA 2A54B 2O29A 1ZGQA 1YHIA 4XOVA 2DUIA 3G9AA 4GF6B 4DXQA 1XAEA 5HZSA 2POXA 2DUFA 2QU1A 3SS0A 3EVRA 4RYSA 2Q57A 3W1DA 3EVPA 4EDOA 3IR8A 3PJ5A 3VK1A 3PJ7A 4DXNA 2H9WA 3ED8A 2G6YA 4IK1A 4KPIA 4ANJA 4ZF3A 2AHAA 2GX0A 2G2SB 2A48A 4TZAA 2EMDA 4DXIA 2V4EA 4LJBA 3TMTA 4ORNA 2G16B 1EMGA 3NT9A 3ADFA 3EK4A 3U0KA 3ZULA 1YFPA 4TZGA 3BXCA 2HCGA 2O2BA 5H89A 3ST2A 2QZ0A 5DTYA 2G6XA 3DPWA 1Q73A 2A50B 1GL4A 5DU0A 2HRSA 3H1RA 3WCKA 2WIQA 1XSSA 4Q7UA 4KGFA 2HQZA 4NWSA 4DKNA 4P76A 2AWLA 5F9GA 3CGLA 2IOVA 4XVPA 4XL5A 4Z4MA 3U0MA 1JC0A 3EVVA 4EULA 3DQAA 2DDDA 3GB3A 1RMOA 3KCTA 3NEZA 3DPXA 2GW3A 3SVSA 4XGYA 3DQEA 2P4MA 3ST4A 2HGYA 3RWAA 3SSLA 5EB6A 3H1OA 4W6HA 2ZO6A 4RYWA 4OGSA 4W7AA 1ZUXA 5DPGA 2FZUA 4PFEA 3DQFA 3DPZA 3LF4B 3GJ2A 2VVHA 3U0NA 3SG7A 3SG2A 3SSHA 1HCJA 5BTTA 4W7DA 1S6ZA 5H88A 1YZWA 4W7XA 4OY4A 2QRFA 1G7KA 5EBJA 3M24A 4HQCA 4LW5A 2DUHA 4L13A 2Y0GA 3OSQA 5HZTA 4DKMA 1JBZA 3DQCA 3SVRA 4OQWA 4H47A 2VADA 2GX2A 4OJ0A 5EXUA 4W7CA 3I19A 3SG4A 4W6MA 1ZGPA 4DXOA 3LSAA 4W77A 4W6CA 2FL1A 5HZUA 2IB5A 4W6AA 4HQ9A 1B9CA 1ZGOA 4B30A 3E5WA 4W6IA 4PPKA 2BTJA 3DQUA 4Z4KA 2WHTA 1XA9A 4Q7TA 2Z1OA 3O78A 5LTRA 4P1QA 5FVGA 1W7TA 3LVAA 4PPLA 3SVEA 4KW9A 1Z1QA 2IE2A 3NEDA 4B5YA 2A47A 2G3DB 4W6GA 2H6VA 4IK9A 1QYOA 5BQLA 1QYQA 4W7FA 3LF3A 1JBYA 4Q7RA 5EB7A 4EDSA 3CD1A 1F09A 3GEXA 4LJDC 3DQ7A 1QYFA 3SG6A 4GOBA 2AH8A 5H87A 4ZINA 3RWTA 2Z6ZA 1EMBA 4IK5A 4HVFA 4ZF5A 4KAGA 4W6JA 3A8SA 2WISA 3SSKA 1CV7A 3AKOA 1Z1PA 3EKHA 3P8UA 5BTTB 4W6OA 2GW4B 3SVBA 4EN1A 3SSYA 2QLIA 3LVDA 3ST0A 1GGXA 4UTSA 3DQNA 4W6UA 5EJUA 2G3OA 3IP2A 3DQDA 3DQ5A 4JRBA 1GFLA 4KF5C 3WLCA 3PIBA 4LQUA 5DQBA 3DQ1A 4R6DA 2IB6A 2DD7A 3SSPA 1EMFA 5FVIA 1HUYA 4Q9WA 1JC1A 1OXFA 3DQKA 1MYWA 2WHUA 4W75A 4W7RA 3CFFA 3DQOA 3UG0A 1YHHA 3K1KA 2WURA 4H48A 3VHTA 4LJCA 4W72A 4ZF4A 2Q6PA 4LJDA 1BFPA 2ZMUA 5DTLA 2PXWA 4IK3A 2ICRA 2DUGA 3DQ8A 1EMEA 2YFPA 3WLDA 4KA9A 4XOWA 3SSTA 3EK8A 3ZUJA 2RH7A 4H3MA 4IK4A 3BXBA 3SVDA 1Q4BA 5BT0A 2B3PA 3GJ1A 3DQMA 4KF4A 3SVCA 1Q4AA 4HQ8A 2O24A 1OXDA 4ZB1A 3W1CA 3LA1A 1F0BA 2VZXA 3GL4A 4DXPA 2V4EB 3CFHA 4KGEA 3E5TA 5DPJA 3SVUA 4I2YA 1EMKA 3BXAA 1C4FA 3DQ3A 3LVCA 4IZNA 2OKWA 3EK7A 1UISA 3SRYA 4W6SA 3TMRA 2DD9A 4KF5A 5DPIA 3OSRA 4W6LA 2OTEA 1W7UA 1RM9A 4HE4A 2B3QA 5EXBA 5HBDA 2C9JA 1OXEA 1Q4CA 3DQIA 2AWKA 5DRFA 2QLGA 2VVJA 4JGEA 1RMPA 5LTPA 2QT2A 1XQMA 3EKJA 3SG5A 4W6PA 5LTQA 2C9IA 2EMOA 1QXTA 1RMMA 2OTBA 3DQ2A 2A56B 2AWJA 4W73A 3U8PA 2FWQA 4ZBLA 4LQTA 4W76A 2DDCA 2A52B 3SSVA 5DRGA 3KCSA 2ARLA 2QLHA 2ZMWA 3VHTB 4AR7A 2Z6XA 1W7SA 2OGRA 1QY3A
chains in the Genus database with same CATH topology
4W7EA 4BDUA 4ZFSA 4H3NA 3O77A 4L1IA 5AQBB 3AI5A 3MGFA 3ST3A 4W74A 4JFGA 3UFZA 1KYRA 4W6NA 2H5OA 2WHSA 3PJBA 1EMCA 2VAEA 2A53B 4JEOA 3NF0A 5DY6A 2QLEA 2HPWA 5DQMA 3CFAA 3DQ9A 4Q9XA 4B30B 4H3LA 5J2OA 1YJ2A 1KYPA 3SG3A 2YDZA 3SVOA 4W6RA 4R6BA 4U2VA 3AI4A 2EMNA 3CB9A 2HFCA 1H4UA 1EMAA 3V3DA 4J88A 4ZIOA 3SVNA 4OHSA 3EVUA 3LS3A 1XMZA 3NT3A 2JADA 4JC2A 4W6KA 3ZUFA 5T3IA 3DQJA 3DQHA 2PXSA 3OGOA 5FVFA 1EMLA 3M22A 5DTZA 1MOVA 3E5VA 2YE1A 1EMMA 4L12A 4GESB 1MOUA 2QLGB 4KEXA 3SV5A 3CBEA 3U0LA 2DUEA 5KTGA 4N3DA 2AWMA 2WSNA 3U8AA 2V4EC 3DQ6A 2G5ZB 3ZTFA 2G6EA 5EHUA 4IK8A 2OKYA 3DQ4A 2H5QA 2HQKA 5DPHA 2VVIA 5LK4A 1H6RA 5HGEA 3BX9A 1RRXA 2HJOA 4J8AA 5FHVA 2OJKA 2WSOA 4JF9A 4DXMA 2Z6YA 2HGDA 3S05A 4KW8A 3CD9A 4W6FA 1YHGA 4W69A 4W6TA 5EXCI 1Q4EA 3DQLA 4EMQA 1Q4DA 1KP5A 1KYSA 3P28A 5HZOA 4AS8A 2ZO7A 4W6DA 5HW9A 5DTXA 1YJFA 4RTCA 4J89A 2YE0A 2H5RA 4KW4A 2H8QA 4PPJA 3U8CA 3VICA 4W6BA 2A46A 2H5PA 2A54B 2O29A 1ZGQA 1YHIA 4XOVA 2DUIA 3G9AA 4GF6B 4DXQA 1XAEA 5HZSA 2POXA 2DUFA 2QU1A 3SS0A 3EVRA 4RYSA 2Q57A 3W1DA 3EVPA 4EDOA 3IR8A 3PJ5A 3VK1A 3PJ7A 4DXNA 2H9WA 3ED8A 2G6YA 4IK1A 4KPIA 4ANJA 4ZF3A 2AHAA 2GX0A 2G2SB 2A48A 4TZAA 2EMDA 4DXIA 2V4EA 4LJBA 3TMTA 4ORNA 2G16B 1EMGA 3NT9A 3ADFA 3EK4A 3U0KA 3ZULA 1YFPA 4TZGA 3BXCA 2HCGA 2O2BA 5H89A 3ST2A 2QZ0A 5DTYA 2G6XA 3DPWA 1Q73A 2A50B 1GL4A 5DU0A 2HRSA 3H1RA 3WCKA 2WIQA 1XSSA 4Q7UA 4KGFA 2HQZA 4NWSA 4DKNA 4P76A 2AWLA 5F9GA 3CGLA 2IOVA 4XVPA 4XL5A 4Z4MA 3U0MA 1JC0A 3EVVA 4EULA 3DQAA 2DDDA 3GB3A 1RMOA 3KCTA 3NEZA 3DPXA 2GW3A 3SVSA 4XGYA 3DQEA 2P4MA 3ST4A 2HGYA 3RWAA 3SSLA 5EB6A 3H1OA 4W6HA 2ZO6A 4RYWA 4OGSA 4W7AA 1ZUXA 5DPGA 2FZUA 4PFEA 3DQFA 3DPZA 3LF4B 3GJ2A 2VVHA 3U0NA 3SG7A 3SG2A 3SSHA 1HCJA 5BTTA 4W7DA 1S6ZA 5H88A 1YZWA 4W7XA 4OY4A 2QRFA 1G7KA 5EBJA 3M24A 4HQCA 4LW5A 2DUHA 4L13A 2Y0GA 3OSQA 5HZTA 4DKMA 1JBZA 3DQCA 3SVRA 4OQWA 4H47A 2VADA 2GX2A 4OJ0A 5EXUA 4W7CA 3I19A 3SG4A 4W6MA 1ZGPA 4DXOA 3LSAA 4W77A 4W6CA 2FL1A 5HZUA 2IB5A 4W6AA 4HQ9A 1B9CA 1ZGOA 4B30A 3E5WA 4W6IA 4PPKA 2BTJA 3DQUA 4Z4KA 2WHTA 1XA9A 4Q7TA 2Z1OA 3O78A 5LTRA 4P1QA 5FVGA 1W7TA 3LVAA 4PPLA 3SVEA 4KW9A 1Z1QA 2IE2A 3NEDA 4B5YA 2A47A 2G3DB 4W6GA 2H6VA 4IK9A 1QYOA 5BQLA 1QYQA 4W7FA 3LF3A 1JBYA 4Q7RA 5EB7A 4EDSA 3CD1A 1F09A 3GEXA 4LJDC 3DQ7A 1QYFA 3SG6A 4GOBA 2AH8A 5H87A 4ZINA 3RWTA 2Z6ZA 1EMBA 4IK5A 4HVFA 4ZF5A 4KAGA 4W6JA 3A8SA 2WISA 3SSKA 1CV7A 3AKOA 1Z1PA 3EKHA 3P8UA 5BTTB 4W6OA 2GW4B 3SVBA 4EN1A 3SSYA 2QLIA 3LVDA 3ST0A 1GGXA 4UTSA 3DQNA 4W6UA 5EJUA 2G3OA 3IP2A 3DQDA 3DQ5A 4JRBA 1GFLA 4KF5C 3WLCA 3PIBA 4LQUA 5DQBA 3DQ1A 4R6DA 2IB6A 2DD7A 3SSPA 1EMFA 5FVIA 1HUYA 4Q9WA 1JC1A 1OXFA 3DQKA 1MYWA 2WHUA 4W75A 4W7RA 3CFFA 3DQOA 3UG0A 1YHHA 3K1KA 2WURA 4H48A 3VHTA 4LJCA 4W72A 4ZF4A 2Q6PA 4LJDA 1BFPA 2ZMUA 5DTLA 2PXWA 4IK3A 2ICRA 2DUGA 3DQ8A 1EMEA 2YFPA 3WLDA 4KA9A 4XOWA 3SSTA 3EK8A 3ZUJA 2RH7A 4H3MA 4IK4A 3BXBA 3SVDA 1Q4BA 5BT0A 2B3PA 3GJ1A 3DQMA 4KF4A 3SVCA 1Q4AA 4HQ8A 2O24A 1OXDA 4ZB1A 3W1CA 3LA1A 1F0BA 2VZXA 3GL4A 4DXPA 2V4EB 3CFHA 4KGEA 3E5TA 5DPJA 3SVUA 4I2YA 1EMKA 3BXAA 1C4FA 3DQ3A 3LVCA 4IZNA 2OKWA 3EK7A 1UISA 3SRYA 4W6SA 3TMRA 2DD9A 4KF5A 5DPIA 3OSRA 4W6LA 2OTEA 1W7UA 1RM9A 4HE4A 2B3QA 5EXBA 5HBDA 2C9JA 1OXEA 1Q4CA 3DQIA 2AWKA 5DRFA 2QLGA 2VVJA 4JGEA 1RMPA 5LTPA 2QT2A 1XQMA 3EKJA 3SG5A 4W6PA 5LTQA 2C9IA 2EMOA 1QXTA 1RMMA 2OTBA 3DQ2A 2A56B 2AWJA 4W73A 3U8PA 2FWQA 4ZBLA 4LQTA 4W76A 2DDCA 2A52B 3SSVA 5DRGA 3KCSA 2ARLA 2QLHA 2ZMWA 3VHTB 4AR7A 2Z6XA 1W7SA 2OGRA 1QY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W7E A;  4BDU A;  4ZFS A;  4H3N A;  3O77 A;  4L1I A;  5AQB B;  3AI5 A;  3MGF A;  3ST3 A;  4W74 A;  4JFG A;  3UFZ A;  1KYR A;  4W6N A;  2H5O A;  2WHS A;  3PJB A;  1EMC A;  2VAE A;  2A53 B;  4JEO A;  3NF0 A;  5DY6 A;  2QLE A;  2HPW A;  5DQM A;  3CFA A;  3DQ9 A;  4Q9X A;  4B30 B;  4H3L A;  5J2O A;  1YJ2 A;  1KYP A;  3SG3 A;  2YDZ A;  3SVO A;  4W6R A;  4R6B A;  4U2V A;  3AI4 A;  2EMN A;  3CB9 A;  2HFC A;  1H4U A;  1EMA A;  3V3D A;  4J88 A;  4ZIO A;  3SVN A;  4OHS A;  3EVU A;  3LS3 A;  1XMZ A;  3NT3 A;  2JAD A;  4JC2 A;  4W6K A;  3ZUF A;  5T3I A;  3DQJ A;  3DQH A;  2PXS A;  3OGO A;  5FVF A;  1EML A;  3M22 A;  5DTZ A;  1MOV A;  3E5V A;  2YE1 A;  1EMM A;  4L12 A;  4GES B;  1MOU A;  2QLG B;  4KEX A;  3SV5 A;  3CBE A;  3U0L A;  2DUE A;  5KTG A;  4N3D A;  2AWM A;  2WSN A;  3U8A A;  2V4E C;  3DQ6 A;  2G5Z B;  3ZTF A;  2G6E A;  5EHU A;  4IK8 A;  2OKY A;  3DQ4 A;  2H5Q A;  2HQK A;  5DPH A;  2VVI A;  5LK4 A;  1H6R A;  5HGE A;  3BX9 A;  1RRX A;  2HJO A;  4J8A A;  5FHV A;  2OJK A;  2WSO A;  4JF9 A;  4DXM A;  2Z6Y A;  2HGD A;  3S05 A;  4KW8 A;  3CD9 A;  4W6F A;  1YHG A;  4W69 A;  4W6T A;  5EXC I;  1Q4E A;  3DQL A;  4EMQ A;  1Q4D A;  1KP5 A;  1KYS A;  3P28 A;  5HZO A;  4AS8 A;  2ZO7 A;  4W6D A;  5HW9 A;  5DTX A;  1YJF A;  4RTC A;  4J89 A;  2YE0 A;  2H5R A;  4KW4 A;  2H8Q A;  4PPJ A;  3U8C A;  3VIC A;  4W6B A;  2A46 A;  2H5P A;  2A54 B;  2O29 A;  1ZGQ A;  1YHI A;  4XOV A;  2DUI A;  3G9A A;  4GF6 B;  4DXQ A;  1XAE A;  5HZS A;  2POX A;  2DUF A;  2QU1 A;  3SS0 A;  3EVR A;  4RYS A;  2Q57 A;  3W1D A;  3EVP A;  4EDO A;  3IR8 A;  3PJ5 A;  3VK1 A;  3PJ7 A;  4DXN A;  2H9W A;  3ED8 A;  2G6Y A;  4IK1 A;  4KPI A;  4ANJ A;  4ZF3 A;  2AHA A;  2GX0 A;  2G2S B;  2A48 A;  4TZA A;  2EMD A;  4DXI A;  2V4E A;  4LJB A;  3TMT A;  4ORN A;  2G16 B;  1EMG A;  3NT9 A;  3ADF A;  3EK4 A;  3U0K A;  3ZUL A;  1YFP A;  4TZG A;  3BXC A;  2HCG A;  2O2B A;  5H89 A;  3ST2 A;  2QZ0 A;  5DTY A;  2G6X A;  3DPW A;  1Q73 A;  2A50 B;  1GL4 A;  5DU0 A;  2HRS A;  3H1R A;  3WCK A;  2WIQ A;  1XSS A;  4Q7U A;  4KGF A;  2HQZ A;  4NWS A;  4DKN A;  4P76 A;  2AWL A;  5F9G A;  3CGL A;  2IOV A;  4XVP A;  4XL5 A;  4Z4M A;  3U0M A;  1JC0 A;  3EVV A;  4EUL A;  3DQA A;  2DDD A;  3GB3 A;  1RMO A;  3KCT A;  3NEZ A;  3DPX A;  2GW3 A;  3SVS A;  4XGY A;  3DQE A;  2P4M A;  3ST4 A;  2HGY A;  3RWA A;  3SSL A;  5EB6 A;  3H1O A;  4W6H A;  2ZO6 A;  4RYW A;  4OGS A;  4W7A A;  1ZUX A;  5DPG A;  2FZU A;  4PFE A;  3DQF A;  3DPZ A;  3LF4 B;  3GJ2 A;  2VVH A;  3U0N A;  3SG7 A;  3SG2 A;  3SSH A;  1HCJ A;  5BTT A;  4W7D A;  1S6Z A;  5H88 A;  1YZW A;  4W7X A;  4OY4 A;  2QRF A;  1G7K A;  5EBJ A;  3M24 A;  4HQC A;  4LW5 A;  2DUH A;  4L13 A;  2Y0G A;  3OSQ A;  5HZT A;  4DKM A;  1JBZ A;  3DQC A;  3SVR A;  4OQW A;  4H47 A;  2VAD A;  2GX2 A;  4OJ0 A;  5EXU A;  4W7C A;  3I19 A;  3SG4 A;  4W6M A;  1ZGP A;  4DXO A;  3LSA A;  4W77 A;  4W6C A;  2FL1 A;  5HZU A;  2IB5 A;  4W6A A;  4HQ9 A;  1B9C A;  1ZGO A;  4B30 A;  3E5W A;  4W6I A;  4PPK A;  2BTJ A;  3DQU A;  4Z4K A;  2WHT A;  1XA9 A;  4Q7T A;  2Z1O A;  3O78 A;  5LTR A;  4P1Q A;  5FVG A;  1W7T A;  3LVA A;  4PPL A;  3SVE A;  4KW9 A;  1Z1Q A;  2IE2 A;  3NED A;  4B5Y A;  2A47 A;  2G3D B;  4W6G A;  2H6V A;  4IK9 A;  1QYO A;  5BQL A;  1QYQ A;  4W7F A;  3LF3 A;  1JBY A;  4Q7R A;  5EB7 A;  4EDS A;  3CD1 A;  1F09 A;  3GEX A;  4LJD C;  3DQ7 A;  1QYF A;  3SG6 A;  4GOB A;  2AH8 A;  5H87 A;  4ZIN A;  3RWT A;  2Z6Z A;  1EMB A;  4IK5 A;  4HVF A;  4ZF5 A;  4KAG A;  4W6J A;  3A8S A;  2WIS A;  3SSK A;  1CV7 A;  3AKO A;  1Z1P A;  3EKH A;  3P8U A;  5BTT B;  4W6O A;  2GW4 B;  3SVB A;  4EN1 A;  3SSY A;  2QLI A;  3LVD A;  3ST0 A;  1GGX A;  4UTS A;  3DQN A;  4W6U A;  5EJU A;  2G3O A;  3IP2 A;  3DQD A;  3DQ5 A;  4JRB A;  1GFL A;  4KF5 C;  3WLC A;  3PIB A;  4LQU A;  5DQB A;  3DQ1 A;  4R6D A;  2IB6 A;  2DD7 A;  3SSP A;  1EMF A;  5FVI A;  1HUY A;  4Q9W A;  1JC1 A;  1OXF A;  3DQK A;  1MYW A;  2WHU A;  4W75 A;  4W7R A;  3CFF A;  3DQO A;  3UG0 A;  1YHH A;  3K1K A;  2WUR A;  4H48 A;  3VHT A;  4LJC A;  4W72 A;  4ZF4 A;  2Q6P A;  4LJD A;  1BFP A;  2ZMU A;  5DTL A;  2PXW A;  4IK3 A;  2ICR A;  2DUG A;  3DQ8 A;  1EME A;  2YFP A;  3WLD A;  4KA9 A;  4XOW A;  3SST A;  3EK8 A;  3ZUJ A;  2RH7 A;  4H3M A;  4IK4 A;  3BXB A;  3SVD A;  1Q4B A;  5BT0 A;  2B3P A;  3GJ1 A;  3DQM A;  4KF4 A;  3SVC A;  1Q4A A;  4HQ8 A;  2O24 A;  1OXD A;  4ZB1 A;  3W1C A;  3LA1 A;  1F0B A;  2VZX A;  3GL4 A;  4DXP A;  2V4E B;  3CFH A;  4KGE A;  3E5T A;  5DPJ A;  3SVU A;  4I2Y A;  1EMK A;  3BXA A;  1C4F A;  3DQ3 A;  3LVC A;  4IZN A;  2OKW A;  3EK7 A;  1UIS A;  3SRY A;  4W6S A;  3TMR A;  2DD9 A;  4KF5 A;  5DPI A;  3OSR A;  4W6L A;  2OTE A;  1W7U A;  1RM9 A;  4HE4 A;  2B3Q A;  5EXB A;  5HBD A;  2C9J A;  1OXE A;  1Q4C A;  3DQI A;  2AWK A;  5DRF A;  2QLG A;  2VVJ A;  4JGE A;  1RMP A;  5LTP A;  2QT2 A;  1XQM A;  3EKJ A;  3SG5 A;  4W6P A;  5LTQ A;  2C9I A;  2EMO A;  1QXT A;  1RMM A;  2OTB A;  3DQ2 A;  2A56 B;  2AWJ A;  4W73 A;  3U8P A;  2FWQ A;  4ZBL A;  4LQT A;  4W76 A;  2DDC A;  2A52 B;  3SSV A;  5DRG A;  3KCS A;  2ARL A;  2QLH A;  2ZMW A;  3VHT B;  4AR7 A;  2Z6X A;  1W7S A;  2OGR A;  1QY3 A; 
#chains in the Genus database with same CATH topology
 4W7E A;  4BDU A;  4ZFS A;  4H3N A;  3O77 A;  4L1I A;  5AQB B;  3AI5 A;  3MGF A;  3ST3 A;  4W74 A;  4JFG A;  3UFZ A;  1KYR A;  4W6N A;  2H5O A;  2WHS A;  3PJB A;  1EMC A;  2VAE A;  2A53 B;  4JEO A;  3NF0 A;  5DY6 A;  2QLE A;  2HPW A;  5DQM A;  3CFA A;  3DQ9 A;  4Q9X A;  4B30 B;  4H3L A;  5J2O A;  1YJ2 A;  1KYP A;  3SG3 A;  2YDZ A;  3SVO A;  4W6R A;  4R6B A;  4U2V A;  3AI4 A;  2EMN A;  3CB9 A;  2HFC A;  1H4U A;  1EMA A;  3V3D A;  4J88 A;  4ZIO A;  3SVN A;  4OHS A;  3EVU A;  3LS3 A;  1XMZ A;  3NT3 A;  2JAD A;  4JC2 A;  4W6K A;  3ZUF A;  5T3I A;  3DQJ A;  3DQH A;  2PXS A;  3OGO A;  5FVF A;  1EML A;  3M22 A;  5DTZ A;  1MOV A;  3E5V A;  2YE1 A;  1EMM A;  4L12 A;  4GES B;  1MOU A;  2QLG B;  4KEX A;  3SV5 A;  3CBE A;  3U0L A;  2DUE A;  5KTG A;  4N3D A;  2AWM A;  2WSN A;  3U8A A;  2V4E C;  3DQ6 A;  2G5Z B;  3ZTF A;  2G6E A;  5EHU A;  4IK8 A;  2OKY A;  3DQ4 A;  2H5Q A;  2HQK A;  5DPH A;  2VVI A;  5LK4 A;  1H6R A;  5HGE A;  3BX9 A;  1RRX A;  2HJO A;  4J8A A;  5FHV A;  2OJK A;  2WSO A;  4JF9 A;  4DXM A;  2Z6Y A;  2HGD A;  3S05 A;  4KW8 A;  3CD9 A;  4W6F A;  1YHG A;  4W69 A;  4W6T A;  5EXC I;  1Q4E A;  3DQL A;  4EMQ A;  1Q4D A;  1KP5 A;  1KYS A;  3P28 A;  5HZO A;  4AS8 A;  2ZO7 A;  4W6D A;  5HW9 A;  5DTX A;  1YJF A;  4RTC A;  4J89 A;  2YE0 A;  2H5R A;  4KW4 A;  2H8Q A;  4PPJ A;  3U8C A;  3VIC A;  4W6B A;  2A46 A;  2H5P A;  2A54 B;  2O29 A;  1ZGQ A;  1YHI A;  4XOV A;  2DUI A;  3G9A A;  4GF6 B;  4DXQ A;  1XAE A;  5HZS A;  2POX A;  2DUF A;  2QU1 A;  3SS0 A;  3EVR A;  4RYS A;  2Q57 A;  3W1D A;  3EVP A;  4EDO A;  3IR8 A;  3PJ5 A;  3VK1 A;  3PJ7 A;  4DXN A;  2H9W A;  3ED8 A;  2G6Y A;  4IK1 A;  4KPI A;  4ANJ A;  4ZF3 A;  2AHA A;  2GX0 A;  2G2S B;  2A48 A;  4TZA A;  2EMD A;  4DXI A;  2V4E A;  4LJB A;  3TMT A;  4ORN A;  2G16 B;  1EMG A;  3NT9 A;  3ADF A;  3EK4 A;  3U0K A;  3ZUL A;  1YFP A;  4TZG A;  3BXC A;  2HCG A;  2O2B A;  5H89 A;  3ST2 A;  2QZ0 A;  5DTY A;  2G6X A;  3DPW A;  1Q73 A;  2A50 B;  1GL4 A;  5DU0 A;  2HRS A;  3H1R A;  3WCK A;  2WIQ A;  1XSS A;  4Q7U A;  4KGF A;  2HQZ A;  4NWS A;  4DKN A;  4P76 A;  2AWL A;  5F9G A;  3CGL A;  2IOV A;  4XVP A;  4XL5 A;  4Z4M A;  3U0M A;  1JC0 A;  3EVV A;  4EUL A;  3DQA A;  2DDD A;  3GB3 A;  1RMO A;  3KCT A;  3NEZ A;  3DPX A;  2GW3 A;  3SVS A;  4XGY A;  3DQE A;  2P4M A;  3ST4 A;  2HGY A;  3RWA A;  3SSL A;  5EB6 A;  3H1O A;  4W6H A;  2ZO6 A;  4RYW A;  4OGS A;  4W7A A;  1ZUX A;  5DPG A;  2FZU A;  4PFE A;  3DQF A;  3DPZ A;  3LF4 B;  3GJ2 A;  2VVH A;  3U0N A;  3SG7 A;  3SG2 A;  3SSH A;  1HCJ A;  5BTT A;  4W7D A;  1S6Z A;  5H88 A;  1YZW A;  4W7X A;  4OY4 A;  2QRF A;  1G7K A;  5EBJ A;  3M24 A;  4HQC A;  4LW5 A;  2DUH A;  4L13 A;  2Y0G A;  3OSQ A;  5HZT A;  4DKM A;  1JBZ A;  3DQC A;  3SVR A;  4OQW A;  4H47 A;  2VAD A;  2GX2 A;  4OJ0 A;  5EXU A;  4W7C A;  3I19 A;  3SG4 A;  4W6M A;  1ZGP A;  4DXO A;  3LSA A;  4W77 A;  4W6C A;  2FL1 A;  5HZU A;  2IB5 A;  4W6A A;  4HQ9 A;  1B9C A;  1ZGO A;  4B30 A;  3E5W A;  4W6I A;  4PPK A;  2BTJ A;  3DQU A;  4Z4K A;  2WHT A;  1XA9 A;  4Q7T A;  2Z1O A;  3O78 A;  5LTR A;  4P1Q A;  5FVG A;  1W7T A;  3LVA A;  4PPL A;  3SVE A;  4KW9 A;  1Z1Q A;  2IE2 A;  3NED A;  4B5Y A;  2A47 A;  2G3D B;  4W6G A;  2H6V A;  4IK9 A;  1QYO A;  5BQL A;  1QYQ A;  4W7F A;  3LF3 A;  1JBY A;  4Q7R A;  5EB7 A;  4EDS A;  3CD1 A;  1F09 A;  3GEX A;  4LJD C;  3DQ7 A;  1QYF A;  3SG6 A;  4GOB A;  2AH8 A;  5H87 A;  4ZIN A;  3RWT A;  2Z6Z A;  1EMB A;  4IK5 A;  4HVF A;  4ZF5 A;  4KAG A;  4W6J A;  3A8S A;  2WIS A;  3SSK A;  1CV7 A;  3AKO A;  1Z1P A;  3EKH A;  3P8U A;  5BTT B;  4W6O A;  2GW4 B;  3SVB A;  4EN1 A;  3SSY A;  2QLI A;  3LVD A;  3ST0 A;  1GGX A;  4UTS A;  3DQN A;  4W6U A;  5EJU A;  2G3O A;  3IP2 A;  3DQD A;  3DQ5 A;  4JRB A;  1GFL A;  4KF5 C;  3WLC A;  3PIB A;  4LQU A;  5DQB A;  3DQ1 A;  4R6D A;  2IB6 A;  2DD7 A;  3SSP A;  1EMF A;  5FVI A;  1HUY A;  4Q9W A;  1JC1 A;  1OXF A;  3DQK A;  1MYW A;  2WHU A;  4W75 A;  4W7R A;  3CFF A;  3DQO A;  3UG0 A;  1YHH A;  3K1K A;  2WUR A;  4H48 A;  3VHT A;  4LJC A;  4W72 A;  4ZF4 A;  2Q6P A;  4LJD A;  1BFP A;  2ZMU A;  5DTL A;  2PXW A;  4IK3 A;  2ICR A;  2DUG A;  3DQ8 A;  1EME A;  2YFP A;  3WLD A;  4KA9 A;  4XOW A;  3SST A;  3EK8 A;  3ZUJ A;  2RH7 A;  4H3M A;  4IK4 A;  3BXB A;  3SVD A;  1Q4B A;  5BT0 A;  2B3P A;  3GJ1 A;  3DQM A;  4KF4 A;  3SVC A;  1Q4A A;  4HQ8 A;  2O24 A;  1OXD A;  4ZB1 A;  3W1C A;  3LA1 A;  1F0B A;  2VZX A;  3GL4 A;  4DXP A;  2V4E B;  3CFH A;  4KGE A;  3E5T A;  5DPJ A;  3SVU A;  4I2Y A;  1EMK A;  3BXA A;  1C4F A;  3DQ3 A;  3LVC A;  4IZN A;  2OKW A;  3EK7 A;  1UIS A;  3SRY A;  4W6S A;  3TMR A;  2DD9 A;  4KF5 A;  5DPI A;  3OSR A;  4W6L A;  2OTE A;  1W7U A;  1RM9 A;  4HE4 A;  2B3Q A;  5EXB A;  5HBD A;  2C9J A;  1OXE A;  1Q4C A;  3DQI A;  2AWK A;  5DRF A;  2QLG A;  2VVJ A;  4JGE A;  1RMP A;  5LTP A;  2QT2 A;  1XQM A;  3EKJ A;  3SG5 A;  4W6P A;  5LTQ A;  2C9I A;  2EMO A;  1QXT A;  1RMM A;  2OTB A;  3DQ2 A;  2A56 B;  2AWJ A;  4W73 A;  3U8P A;  2FWQ A;  4ZBL A;  4LQT A;  4W76 A;  2DDC A;  2A52 B;  3SSV A;  5DRG A;  3KCS A;  2ARL A;  2QLH A;  2ZMW A;  3VHT B;  4AR7 A;  2Z6X A;  1W7S A;  2OGR A;  1QY3 A; 
#chains in the Genus database with same CATH homology
 4W7E A;  4BDU A;  4ZFS A;  4H3N A;  3O77 A;  4L1I A;  5AQB B;  3AI5 A;  3MGF A;  3ST3 A;  4W74 A;  4JFG A;  3UFZ A;  1KYR A;  4W6N A;  2H5O A;  2WHS A;  3PJB A;  1EMC A;  2VAE A;  2A53 B;  4JEO A;  3NF0 A;  5DY6 A;  2QLE A;  2HPW A;  5DQM A;  3CFA A;  3DQ9 A;  4Q9X A;  4B30 B;  4H3L A;  5J2O A;  1YJ2 A;  1KYP A;  3SG3 A;  2YDZ A;  3SVO A;  4W6R A;  4R6B A;  4U2V A;  3AI4 A;  2EMN A;  3CB9 A;  2HFC A;  1H4U A;  1EMA A;  3V3D A;  4J88 A;  4ZIO A;  3SVN A;  4OHS A;  3EVU A;  3LS3 A;  1XMZ A;  3NT3 A;  2JAD A;  4JC2 A;  4W6K A;  3ZUF A;  5T3I A;  3DQJ A;  3DQH A;  2PXS A;  3OGO A;  5FVF A;  1EML A;  3M22 A;  5DTZ A;  1MOV A;  3E5V A;  2YE1 A;  1EMM A;  4L12 A;  4GES B;  1MOU A;  2QLG B;  4KEX A;  3SV5 A;  3CBE A;  3U0L A;  2DUE A;  5KTG A;  4N3D A;  2AWM A;  2WSN A;  3U8A A;  2V4E C;  3DQ6 A;  2G5Z B;  3ZTF A;  2G6E A;  5EHU A;  4IK8 A;  2OKY A;  3DQ4 A;  2H5Q A;  2HQK A;  5DPH A;  2VVI A;  5LK4 A;  1H6R A;  5HGE A;  3BX9 A;  1RRX A;  2HJO A;  4J8A A;  5FHV A;  2OJK A;  2WSO A;  4JF9 A;  4DXM A;  2Z6Y A;  2HGD A;  3S05 A;  4KW8 A;  3CD9 A;  4W6F A;  1YHG A;  4W69 A;  4W6T A;  5EXC I;  1Q4E A;  3DQL A;  4EMQ A;  1Q4D A;  1KP5 A;  1KYS A;  3P28 A;  5HZO A;  4AS8 A;  2ZO7 A;  4W6D A;  5HW9 A;  5DTX A;  1YJF A;  4RTC A;  4J89 A;  2YE0 A;  2H5R A;  4KW4 A;  2H8Q A;  4PPJ A;  3U8C A;  3VIC A;  4W6B A;  2A46 A;  2H5P A;  2A54 B;  2O29 A;  1ZGQ A;  1YHI A;  4XOV A;  2DUI A;  3G9A A;  4GF6 B;  4DXQ A;  1XAE A;  5HZS A;  2POX A;  2DUF A;  2QU1 A;  3SS0 A;  3EVR A;  4RYS A;  2Q57 A;  3W1D A;  3EVP A;  4EDO A;  3IR8 A;  3PJ5 A;  3VK1 A;  3PJ7 A;  4DXN A;  2H9W A;  3ED8 A;  2G6Y A;  4IK1 A;  4KPI A;  4ANJ A;  4ZF3 A;  2AHA A;  2GX0 A;  2G2S B;  2A48 A;  4TZA A;  2EMD A;  4DXI A;  2V4E A;  4LJB A;  3TMT A;  4ORN A;  2G16 B;  1EMG A;  3NT9 A;  3ADF A;  3EK4 A;  3U0K A;  3ZUL A;  1YFP A;  4TZG A;  3BXC A;  2HCG A;  2O2B A;  5H89 A;  3ST2 A;  2QZ0 A;  5DTY A;  2G6X A;  3DPW A;  1Q73 A;  2A50 B;  1GL4 A;  5DU0 A;  2HRS A;  3H1R A;  3WCK A;  2WIQ A;  1XSS A;  4Q7U A;  4KGF A;  2HQZ A;  4NWS A;  4DKN A;  4P76 A;  2AWL A;  5F9G A;  3CGL A;  2IOV A;  4XVP A;  4XL5 A;  4Z4M A;  3U0M A;  1JC0 A;  3EVV A;  4EUL A;  3DQA A;  2DDD A;  3GB3 A;  1RMO A;  3KCT A;  3NEZ A;  3DPX A;  2GW3 A;  3SVS A;  4XGY A;  3DQE A;  2P4M A;  3ST4 A;  2HGY A;  3RWA A;  3SSL A;  5EB6 A;  3H1O A;  4W6H A;  2ZO6 A;  4RYW A;  4OGS A;  4W7A A;  1ZUX A;  5DPG A;  2FZU A;  4PFE A;  3DQF A;  3DPZ A;  3LF4 B;  3GJ2 A;  2VVH A;  3U0N A;  3SG7 A;  3SG2 A;  3SSH A;  1HCJ A;  5BTT A;  4W7D A;  1S6Z A;  5H88 A;  1YZW A;  4W7X A;  4OY4 A;  2QRF A;  1G7K A;  5EBJ A;  3M24 A;  4HQC A;  4LW5 A;  2DUH A;  4L13 A;  2Y0G A;  3OSQ A;  5HZT A;  4DKM A;  1JBZ A;  3DQC A;  3SVR A;  4OQW A;  4H47 A;  2VAD A;  2GX2 A;  4OJ0 A;  5EXU A;  4W7C A;  3I19 A;  3SG4 A;  4W6M A;  1ZGP A;  4DXO A;  3LSA A;  4W77 A;  4W6C A;  2FL1 A;  5HZU A;  2IB5 A;  4W6A A;  4HQ9 A;  1B9C A;  1ZGO A;  4B30 A;  3E5W A;  4W6I A;  4PPK A;  2BTJ A;  3DQU A;  4Z4K A;  2WHT A;  1XA9 A;  4Q7T A;  2Z1O A;  3O78 A;  5LTR A;  4P1Q A;  5FVG A;  1W7T A;  3LVA A;  4PPL A;  3SVE A;  4KW9 A;  1Z1Q A;  2IE2 A;  3NED A;  4B5Y A;  2A47 A;  2G3D B;  4W6G A;  2H6V A;  4IK9 A;  1QYO A;  5BQL A;  1QYQ A;  4W7F A;  3LF3 A;  1JBY A;  4Q7R A;  5EB7 A;  4EDS A;  3CD1 A;  1F09 A;  3GEX A;  4LJD C;  3DQ7 A;  1QYF A;  3SG6 A;  4GOB A;  2AH8 A;  5H87 A;  4ZIN A;  3RWT A;  2Z6Z A;  1EMB A;  4IK5 A;  4HVF A;  4ZF5 A;  4KAG A;  4W6J A;  3A8S A;  2WIS A;  3SSK A;  1CV7 A;  3AKO A;  1Z1P A;  3EKH A;  3P8U A;  5BTT B;  4W6O A;  2GW4 B;  3SVB A;  4EN1 A;  3SSY A;  2QLI A;  3LVD A;  3ST0 A;  1GGX A;  4UTS A;  3DQN A;  4W6U A;  5EJU A;  2G3O A;  3IP2 A;  3DQD A;  3DQ5 A;  4JRB A;  1GFL A;  4KF5 C;  3WLC A;  3PIB A;  4LQU A;  5DQB A;  3DQ1 A;  4R6D A;  2IB6 A;  2DD7 A;  3SSP A;  1EMF A;  5FVI A;  1HUY A;  4Q9W A;  1JC1 A;  1OXF A;  3DQK A;  1MYW A;  2WHU A;  4W75 A;  4W7R A;  3CFF A;  3DQO A;  3UG0 A;  1YHH A;  3K1K A;  2WUR A;  4H48 A;  3VHT A;  4LJC A;  4W72 A;  4ZF4 A;  2Q6P A;  4LJD A;  1BFP A;  2ZMU A;  5DTL A;  2PXW A;  4IK3 A;  2ICR A;  2DUG A;  3DQ8 A;  1EME A;  2YFP A;  3WLD A;  4KA9 A;  4XOW A;  3SST A;  3EK8 A;  3ZUJ A;  2RH7 A;  4H3M A;  4IK4 A;  3BXB A;  3SVD A;  1Q4B A;  5BT0 A;  2B3P A;  3GJ1 A;  3DQM A;  4KF4 A;  3SVC A;  1Q4A A;  4HQ8 A;  2O24 A;  1OXD A;  4ZB1 A;  3W1C A;  3LA1 A;  1F0B A;  2VZX A;  3GL4 A;  4DXP A;  2V4E B;  3CFH A;  4KGE A;  3E5T A;  5DPJ A;  3SVU A;  4I2Y A;  1EMK A;  3BXA A;  1C4F A;  3DQ3 A;  3LVC A;  4IZN A;  2OKW A;  3EK7 A;  1UIS A;  3SRY A;  4W6S A;  3TMR A;  2DD9 A;  4KF5 A;  5DPI A;  3OSR A;  4W6L A;  2OTE A;  1W7U A;  1RM9 A;  4HE4 A;  2B3Q A;  5EXB A;  5HBD A;  2C9J A;  1OXE A;  1Q4C A;  3DQI A;  2AWK A;  5DRF A;  2QLG A;  2VVJ A;  4JGE A;  1RMP A;  5LTP A;  2QT2 A;  1XQM A;  3EKJ A;  3SG5 A;  4W6P A;  5LTQ A;  2C9I A;  2EMO A;  1QXT A;  1RMM A;  2OTB A;  3DQ2 A;  2A56 B;  2AWJ A;  4W73 A;  3U8P A;  2FWQ A;  4ZBL A;  4LQT A;  4W76 A;  2DDC A;  2A52 B;  3SSV A;  5DRG A;  3KCS A;  2ARL A;  2QLH A;  2ZMW A;  3VHT B;  4AR7 A;  2Z6X A;  1W7S A;  2OGR A;  1QY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...