3EK8A

Calcium-saturated gcamp2 t116v/g87r mutant monomer
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
408
structure length
393
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDRGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 129
structure length 393
sequence length 408
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek8A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek8A02
3F45A 1SMGA 1E8AA 5F6TA 2BL0B 2ZO6A 1BU3A 3U0NA 2QRFA 1IJ6A 1QX7A 2BKIB 5HLVA 2DDDA 5DPJA 3EK8A 5FVGA 2VZXA 3SVOA 1MHOA 4W6PA 2OKYA 1NCXA 4W6AA 1H6RA 2L0PA 1QVIZ 2NCOA 4HSZA 3OB1B 1CV7A 4KW9A 3SJSA 3KEVA 2G3OA 4XJKB 2NCPA 2I18A 3AKBA 4GESB 1KYRA 1PRWA 2H61A 2MBXA 3PLFB 4MZLA 2KYCA 1KFUS 2KGRA 2PXWA 2AH8A 3SG4A 2JT3A 1K94A 1XYDA 1M31A 3WCKA 4B30A 5DTXA 1YUSA 2LCPA 2DDCA 2GGZA 2JPTA 2KDHA 3DQ9A 2JNFA 1DVIA 3DQLA 5FHVA 1DMOA 3SVCA 2Q4UA 4KF5A 1KP5A 3DQIA 1HCJA 1QV1A 2LVIA 1W7SA 1J55A 4M2OA 2PALA 3LF3A 1AP4A 4R6BA 4AOMA 3BUMB 3IR8A 4MVFA 4W6IA 1IKUA 2H5QA 1UHKA 2H5OA 1F55A 3OP0A 4C0KA 4N1FA 5KTYA 1EH2A 2K7DA 2KAXA 1SCMB 4HQCA 1DF0B 3CGLA 5H89A 1QX5B 2IS9A 2AWKA 5H88A 4BY5A 1KFXL 3RM1A 2ZRSA 3CD1A 2KHNA 5FVIA 4MZKA 2AAOA 3U8CA 4J8AA 5HKYA 4HVFA 2RGIA 1ZMZA 2HFCA 3SVSA 4USLA 3LCPC 2EC6C 2PVBA 1WDCB 1EL4A 1ZUZA 3BXKA 2M3WA 2DOQA 1QS7A 1TNXA 2HQKA 3DQ8A 4OGSA 4LJCA 1CNPA 3PM8A 4W73A 4YGCB 3EVUA 1W7TA 1JC1A 1NCYA 2LP3A 1SL9A 1JBYA 3UG0A 4DUQA 2WCFA 3RWTA 1GGZA 3LL8B 1A2XA 1SY9A 2A46A 4N5XA 1HQVA 2BCBA 3BYAA 1YURA 1PSBA 1UHIA 1U5IA 2O2BA 2OTBA 4PE1A 3GL4A 4W77A 1NX0A 1SCMC 1QVIY 2LV7A 1C7WA 3VK1A 3I5HB 1DGUA 2OGRA 2E30A 4UPGA 2YFPA 4W76A 5BT0A 4W6SA 1QYQA 2A54B 1G8IA 4ORBB 1Y1XA 4IK1A 4LW5A 2Z6ZA 1BFPA 2EHBA 3E5VA 2QACA 1K95A 5FYXA 4ZIOA 5D7FA 1AHRA 2V4EA 4JFGA 3GOFA 1OZSA 1BMOA 1ZGPA 4QJ4B 3LVDA 1Y1AA 3OGOA 2PASA 5KU1A 1KFUL 1L2OB 1RMOA 4EDSA 5CSFA 1QTXA 1OE9B 1M46A 3EVRA 1SW8A 3DQNA 3CFFA 2GGMA 1B8RA 1D1OA 3LK1A 4CIDA 3E5WA 3SSLA 1G7KA 2F3YA 2CT9A 5DU0A 4Q04A 1YZWA 2O29A 1LINA 2AHAA 2B3QA 3ST3A 4W6RA 2JNXA 4PE4A 4OKHA 4W6FA 1YFPA 3WHTB 3BUNB 4HQ8A 1YR5A 2L98A 4ZCVA 1U5IB 2OTEA 1DJGA 3U0KA 5DQMA 2LMVA 1LKJA 2DD9A 2HRSA 1DJIA 2IE2A 3NF0A 1SPYA 1IG5A 1XK4A 2FZUA 4RYSA 1S36A 1DJYA 2JXCA 1CFFA 1B8LA 3FWCA 2WISA 1SKTA 3LF4B 1BG1A 2L5XB 1K90D 3DQCA 1W7UA 4E68A 3FIAA 2ZN9A 4HE4A 2AUCA 1JC2A 2WHUA 2I7AA 1MYWA 3PFVA 3UFZA 2M29A 2WORA 4DCKA 2HF5A 3I5FB 2JU0A 4ZF5A 1CFPA 1F70A 4W6OA 2ISDA 3SG3A 1BR4B 1M39A 3SSHA 4DKNA 2YE1A 2KNEA 3AAJA 4W6DA 1SL8A 1HT9A 1ZUXA 3VHTB 1L7ZA 2A48A 3VGOA 2KFGA 2IB6A 4WRIA 4C0LA 5HGEA 4W6GA 3SG6A 2LP2A 2ZNEA 2K2FA 2WOSA 2HPSA 3SSYA 3SG7A 5AEQA 2OTGC 3WLDA 1JSAA 2LANA 4I2YA 4PHKA 1BT6A 1R2UA 1YHIA 2E6WA 2BCAA 2K7OA 1YVHA 2JOJA 4IK3A 1F09A 2EGDA 3SRYA 4LJBA 4IK5A 1IWQA 3JVTB 2BECA 4H3NA 4TZAA 1XFWO 1WLMA 3PALA 5AQBB 4PCWA 1Q4EA 1ZOTB 1N0YA 2ZKMX 3TS5B 3WLCA 2OS8B 2PRUA 1QIWA 1EMAA 3NT3A 1CDMA 2G9BA 2QU1A 4YGDB 3DQFA 1UP5A 3KPXA 1A75A 1YHHA 1KK8B 1G33A 2WCBA 4P1QA 2Q91A 3DVEA 5F9GA 2Y1NA 3BXCA 1SYMA 2HPWA 1QLSA 1NX2A 5EB7A 3NSLA 5HKZA 1ZGQA 4DXMA 5K89A 3DQOA 3ADFA 2JTZA 2HQZA 1TIZA 5I2QA 1FW4A 3KO0A 3EKHA 4GAOA 5B8IB 2JWWA 2VRGA 2ZMWA 3H4SE 1MF8B 4YGBB 1PULA 2I94A 2Q6PA 3LVCA 3SIBA 1JWDA 2RH7A 1EMMA 2CBLA 4OJ0A 2LAPA 1QIVA 1Y0VH 3KHEA 1GL4A 3SVEA 2AWMA 3VICA 3ST4A 5EJUA 1XMZA 1OQPA 4RTCA 1H4UA 3CBEA 2KQ6A 3PN7B 1FBVA 3TUYB 1NX1A 2MA2A 4YI8A 2WHTA 4P5OE 4QJ3B 3DPZA 2KI6D 1YTZC 2KI4B 1UWOA 1S5GY 4B5YA 4P76A 4NWSA 2COLB 2LNKA 5JOLA 4W6TA 5BTTB 4HREE 1DJWA 4XOWA 3I5IC 2KAYA 3AKOA 1ALVA 2BCXA 1YHGA 2ZN8A 5J2OA 4NDBA 3I19A 2Y1MA 2IB5A 3DQ5A 2K7BA 2L4HA 4Q7TA 1A03A 1YX7A 1CFCA 3OSQA 5ER5A 4GUKA 1Q4BA 2M1KB 2QLHA 1YJFA 1TNWA 2MAZA 1BODA 2H6VA 1TN4A 1CB1A 2EMOA 1V1FA 3EK7A 3A4UB 1GGWA 2VVJA 4OY4A 4M2PA 4W7XA 1OMDA 1PK0D 1UHJA 4LQUA 2ZFDA 3BUOB 1SNLA 2BL0C 3NSOA 3DQ7A 3GJ1A 4ZCUA 1AUIB 1IQ5A 3FWBA 1RMPA 4OHSA 5HBDA 2TN4A 3SG5A 2SCPA 2IOVA 4R6DA 3TMTA 4W6HA 2OJKA 4Q7UA 4PPKA 3IP2A 3SSPA 5AFPA 5J3XA 1KCYA 2G6EA 3EVVA 3LLEA 3OX5A 4DS7A 1KQVA 5LK4A 4JC2A 3U8AA 4IK8A 5DPIA 1J7QA 4XYNA 4NDCA 4ZFSA 3GEXA 2PMYA 3CWGA 3H1OA 3VRQA 1KSMA 1S6IA 1N2DA 4PDZA 2LHIA 3NSIA 1B4CA 2AMIA 1BR1B 4LJDA 3TZ1A 4B30B 4AS8A 3TDZA 4EN1A 2C9JA 1QX2A 1SL7A 1XAEA 3DD4A 3O2PA 1K9PA 2G16B 4ORCB 1UHNA 2LVJA 5CSJA 4TZGA 4NQGA 1CLLA 2Y5IA 4GGNA 4DXOA 3SSKA 2Z6XA 4AR7A 3SS0A 4H47A 4WQ3A 3AAKA 1R6PA 1B7TZ 1KK7Z 1XFZO 1RECA 5G08A 2G2SB 2F8PA 1J7PA 4Z4KA 4W7AA 2HCGA 1C7VA 1YVLA 3E5TA 3CB9A 4EDOA 2WURA 3LSAA 2Y4QA 2GX0A 2V53A 3NT9A 4OVNF 3SVDA 1UHHA 1DTLA 1RWYA 4W75A 3DQ6A 3VRNA 2P6BB 1RMMA 1GJYA 1NSHA 1EMEA 4GF6B 1WDCC 1FI6A 1IJ5A 2MJWB 2MLEC 2CXJA 2QLIA 1WRLA 4YBHB 2WHSA 2M0RA 2A47A 4PALA 4M2QA 2H5PA 5AANA 3LK0A 1GQMA 4CFRA 1BF5A 1RK9A 2H9WA 1UUSA 3DVMA 2MHHA 1GGXA 1SR6B 2QLGA 1OOJA 2MLFC 4XVPA 1NWDA 1RM9A 5T3IA 4JWQA 1M63B 3TDUA 1DT7B 1YJ2A 3CFHA 4DXNA 2NLNA 4R1EA 2O24A 1TOPA 3DF0A 2H2KA 4W6UA 4W6LA 1TTXA 1JF2A 2QLEA 2OKWA 2WCEA 3D10A 1NP8A 4I5NB 2CNPA 2VVIA 1NIWA 2A4JA 4HRHA 3I5HC 3MGFA 3C1VA 1KQMB 1TRFA 4ZB1A 2H8QA 4LQTA 2FCEA 1Z1PA 4PE0A 3SSTA 1JF0A 4JQ0D 4DXPA 1MWNA 1K9UA 5BQLA 1ZGOA 2GX2A 1LVCD 2LVVA 5GQQC 1AK8A 1QV0A 4YRUA 5LTPA 1WRZA 4YGEB 1SK6D 2OPOA 1CLBA 1G4YR 2M8UA 1NX3A 2V4EB 3O77A 5LTRA 4TNCA 1CTRA 1GFLA 4ZINA 4BDUA 2JT0A 1WLZA 3BXBA 3SVBA 2YDZA 1L2OC 1IH0A 2WSNA 1KWOB 2QZ0A 3DQKA 1SR6C 1LA0A 1CM1A 3SG2A 3VRPA 1QYOA 5D69A 2QLGB 1TNPA 4L12A 2DUFA 3DPXA 3DQJA 1K93D 3MSEB 3GK4X 1F8HA 4PHNA 5KSZA 3KF9A 2WSOA 1B7TY 1KK7Y 2BE4A 4GNKB 1Q4AA 1ODBA 3DQDA 1CDPA 3DF0B 3PIBA 4EULA 4W7RA 5EXBA 2JADA 3JTDB 2FL1A 2SASA 2BE6A 5LTQA 1S6ZA 1EG3A 3DQ4A 1YX8A 3DQHA 5HZTA 5DKNA 2VAEA 3A8RA 1ALWA 3O78A 4BY4A 2HJOA 1HUYA 5HZUA 5CSIA 3HX4A 1JBAA 1EXRA 1Q4DA 3DVKA 5JJGA 3SIAA 4XL5A 1F71A 2ZO7A 1H8BA 1KFXS 3ZTFA 2KAVA 4P2YB 1XFVO 3EVPA 2LHLA 2WIQA 1TCFA 3W1DA 3ZNIA 2V4EC 3NXAA 1JC0A 3W1CA 4U2VA 3I5FC 3CR4X 3BX9A 3A8SA 1MXEA 4OR9B 5EBJA 2VVHA 1B47A 4WQ2A 4KEXA 1F54A 3P8UA 1A4PA 3EK4A 1QASA 1Z1QA 4Q7RA 4XJKA 2DUGA 1JUOA 4HRGA 5HZOA 1RTP1 2EMNA 3O4YA 2EMDA 2JRFA 1PVBA 2NXQA 3H1RA 1OSAA 3ZWHA 1OXDA 1EMKA 3TMRA 4YGAA 1WRKA 1LA3A 4MN0A 4AQJA 2KQYA 5EB6A 4ORNA 4L1IA 4PPJA 2FOTA 3AKAA 2CTNA 3NEZA 3ED8A 1QLKA 3CFAA 4FTGA 1MUXA 4W72A 2AWLA 2GW3A 5I2LA 4W6KA 3KCSA 4KW4A 2LVKA 5DTLA 3JVTC 3VRRA 1AJ4A 5HZSA 3WXAA 5ER4X 2K61A 5FVFA 5DPGA 4IK9A 5DTYA 5KTGA 4W6JA 1QJTA 4W6MA 5AXIA 3TS5C 1MQ1A 1CDLA 2OS8C 3GB3A 1DF0A 3ICBA 3K1KA 1RROA 2QT2A 2LLUA 1SBJA 1VRKA 3O6BA 3BOWA 1IRJA 2KYFA 3ZUJA 1AJ5A 1PSRA 2KI6C 3TDIA 1KK8C 5HLOA 3DQ2A 1A75B 2LLSA 1NCZA 2F3ZA 2AWJA 3U8PA 1C4FA 4KA9A 5EXCI 4KW8A 3IQQA 2PSRA 2D8NA 2EC6B 2BBMA 1IQ3A 5DQBA 1Y1UA 4GGFC 4W7DA 5I8NA 2LUXA 3D0YA 4MEWA 4W69A 2FCDA 2F2PA 4ANJA 4OQWA 2DUHA 2KSPA 1W7JB 3LS3A 4C0JA 2DUEA 1XSSA 1EJ3A 3WNXB 1DJZA 1Q73A 5HKWA 2F2OA 3NEDA 1J1DA 2B1UA 1J7OA 4IL1A 1MR8A 1XA9A 2LLTA 1BJFA 1V1GA 4H3LA 4A4CA 3BUXB 2K2AA 2WC8A 3PN7C 4KF4A 2K0JA 3TUYC 2LM5A 1J7RA 2FWQA 5DKRA 1RJVA 4MZJA 4ZBLA 5CSNA 1QYFA 4PFEA 2KI4C 3GJ2A 4J88A 1A29A 3BOWB 3PATA 4PHJA 4Z4MA 1M45A 1UISA 1OMVA 3CR5X 2JTTA 1YRTB 4I5JA 1QY3A 3QRXA 1H4BA 1CDNA 3BUWB 4W74A 5IBWA 2GW4B 4KGFA 1YUTA 3LA1A 4H3MA 1F4OA 4DRWA 3DQMA 3CLNA 4JRBA 2HETA 2YE0A 3AI5A 4NDDA 2R2IA 4I5LB 2HGYA 1NYAA 4YI9A 2LMTA 2Z6YA 3D0YB 4Q9WA 4PE7A 1F0BA 2ZNDA 2O60A 3PJ5A 2HGDA 1TNQA 3DQEA 1XFXO 3CGAA 1MOVA 3K21A 2KBMA 2JZIA 1XVJA 3DVJA 3SSVA 3LVAA 1OMRA 1K8UA 1KYPA 4W7EA 1EG4A 1MXLC 1DJXA 2M49B 4KPIA 2FJUB 4J89A 4MRYA 1TCOB 3SVNA 1LXFC 3CZTX 2K8MB 3PJBA 2BBNA 4MSPA 4W6NA 3RWAA 1DJHA 4N3DA 4DXQA 2M1UA 4RYWA 2VADA 4F0ZB 3IQOA 4ORAB 2G5ZB 1XO5A 4UTSA 3P28A 2L4IA 3BQ3A 2JXLA 2H61C 2A50B 4OCIA 5BPJA 3FS7A 2MRDA 3NSKA 3ST0A 3WHUB 4ICBA 3M22A 2JQ6A 2L50A 3CD9A 1Q80A 2LE9B 4IZNA 4DKMA 2DUIA 1Q4CA 2HQ8A 2WNDA 2POXA 1C07A 2B3PA 4IK4A 1X02A 4L13A 1RRXA 3EKJA 5EXUA 1AVSA 1EMCA 4KF5C 3RLZA 2KFFA 2Y0GA 2H5RA 2KOTA 3VHTA 2L2EA 5DRFA 1NPQA 4PHMA 3OHMB 1MOUA 3I5GB 2ICRA 3GK1A 2K7CA 2HQWA 1S1EA 3KCTA 4MBEA 2KFHA 4ZF3A 2OTGB 2M7NA 5HW9A 4QJ5B 1KSOA 1CMGA 5EHUA 4PPLA 1SCVA 3G9AA 1S6CA 1KYSA 5DY6A 3OB2B 3DQ1A 2G3DB 4N1GA 1ZACA 5H87A 2ZMUA 3CR2A 2CCMA 2NZ0A 2I2RE 1FPWA 1BOCA 4U8DA 3M0WA 1B8CA 2Q57A 2Z1OA 5I2OA 2JT8A 4LJDC 4D1EA 4XGYA 1JBZA 1XA5A 1CKKA 3BXAA 2G6YA 4DXIA 1CFDA 4AQIA 3SV5A 3AI4A 4GOBA 1DGVA 2A53B 1OXFA 2M7LA 1FF1A 4Q9XA 2O5GA 3ZULA 1S5GZ 1QATA 4L9MA 5DKQA 2KBIA 2LUCA 2P4MA 2GV5A 1K2HA 2JULA 2M97A 1J1EA 3I5GC 2F33A 5HYDA 3V3DA 3U0MA 1K9KA 2ARLA 2M9GA 4MLWA 4GGFA 3PSRA 3IF7A 1KQMC 3SVRA 2LMUA 1B9CA 4JF9A 2DD7A 2PXSA 2BTJA 4CLNA 1FI5A 3GK2A 3DQUA 1K96A 1XFUO 4FQOA 1OZOA 4GBAA 4H48A 2A52B 3VROA 2KGBC 1ZFSA 3HCMA 5CPVA 2A56B 1BLQA 4ETOA 2ZRTA 1PVAA 4A4BA 4GPLB 1YRUB 4CFQA 1WY9A 3DQAA 5TNCA 4I5KA 2G6XA 3DPWA 1EMFA 1JFKA 1CMFA 1KWOC 2G2BA 1S6JA 4JPZB 1W7IB 4GFTA 5BTTA 1XFYO 4W6CA 4EMQA 1EMBA 3ST2A 3M24A 4ZF4A 1QXPA 3OSRA 1CM4A 4KGEA 4W6BA 4JEOA 3I5IB 1UURA 1EMLA 1YUUA 1S26D 5PALA 1QXTA 4MRXA 1OXEA 1XQMA 3JTDC 3ZUFA 1B9AA 3CTNA 4OV2A 3OX6A 1JFJA 1CLMA 1RFJA 4JGEA 2C9IA 5AERA 1IGVA 2BKHB 4XOVA 2JC2A 3DQ3A 3SVUA 4DIRA 4W7CA 3U0LA 2L51A 4HQ9A 1XK4C 5DRGA 2LC5A 1SRAA 1N65A 1EMGA 4W7FA 1B1GA 3S05A 1S3PA 4CPVA 2QPTA 1PALA 5DTZA 4KAGA 5DPHA 3E3RA 3CS1A 1Y6WA 3PJ7A 1NUBA 1F4QA
chains in the Genus database with same CATH superfamily
3F45A 1SMGA 1E8AA 2QEHA 5F6TA 3DY9A 2BL0B 2ZO6A 1BU3A 3U0NA 2QRFA 1IJ6A 1QX7A 2BKIB 5HLVA 2BNXA 2DDDA 5DPJA 3EK8A 5FVGA 3FE9A 2VZXA 3SVOA 1MHOA 4W6PA 2OKYA 1NCXA 4W6AA 1H6RA 2L0PA 1QVIZ 2NCOA 4HSZA 3OB1B 1CV7A 4KW9A 3SJSA 3KEVA 2G3OA 3PM2A 4XJKB 2NCPA 2I18A 3AKBA 4GESB 1KYRA 1PRWA 2H61A 2MBXA 3PLFB 4MZLA 2KYCA 1KFUS 2KGRA 2PXWA 2AH8A 3SG4A 2JT3A 1K94A 1XYDA 1M31A 3WCKA 4B30A 5DTXA 1YUSA 2LCPA 2DDCA 2P70A 3QMEA 3CABA 2GGZA 2JPTA 2KDHA 3DQ9A 2JNFA 1DVIA 4FQTA 3DQLA 5FHVA 1DMOA 3SVCA 2Q4UA 4KF5A 1KP5A 3DQIA 1HCJA 1QV1A 2LVIA 1W7SA 1J55A 4M2OA 2PALA 3LF3A 1AP4A 4R6BA 4AOMA 3BUMB 3IR8A 4MVFA 4W6IA 1IKUA 2H5QA 1UHKA 2H5OA 1F55A 3OP0A 4C0KA 4N1FA 5KTYA 1EH2A 2K7DA 2KAXA 1SCMB 4HQCA 1DF0B 3CGLA 5H89A 1QX5B 2IS9A 2AWKA 5H88A 4BY5A 1KFXL 3RM1A 2ZRSA 3PJIA 3CD1A 2KHNA 5FVIA 3EG5B 3B86A 4MZKA 2AAOA 3U8CA 3D78A 4J8AA 5HKYA 4HVFA 2RGIA 1ZMZA 2HFCA 3SVSA 4USLA 3LCPC 2EC6C 2PVBA 1WDCB 3B7AA 1EL4A 1ZUZA 3BXKA 2M3WA 2DOQA 4F7FA 1QS7A 1TNXA 2HQKA 3DQ8A 4OGSA 4LJCA 1CNPA 3PM8A 4W73A 4YGCB 3EVUA 1W7TA 1JC1A 1NCYA 2LP3A 1SL9A 1JBYA 3UG0A 4DUQA 2WCFA 3RWTA 1GGZA 3LL8B 1A2XA 1SY9A 2A46A 4N5XA 1HQVA 2BCBA 3BYAA 1YURA 1PSBA 1UHIA 1U5IA 3RZSA 2O2BA 2OTBA 4PE1A 3GL4A 4W77A 1NX0A 3N7HA 1SCMC 1QVIY 2LV7A 3SS5A 1C7WA 3VK1A 3I5HB 1DGUA 1Z2CB 3SS3A 2OGRA 2E30A 4UPGA 2YFPA 4W76A 5BT0A 4W6SA 1QYQA 2A54B 1G8IA 4ORBB 1Y1XA 4IK1A 4LW5A 2Z6ZA 1BFPA 2EHBA 3E5VA 1DC1A 2QACA 1K95A 5FYXA 4ZIOA 5D7FA 1AHRA 2V4EA 4JFGA 3S0DA 3GOFA 1OZSA 1BMOA 1ZGPA 4QJ4B 3LVDA 1Y1AA 3OGOA 2PASA 4IJ7A 5KU1A 1KFUL 1L2OB 1RMOA 4EDSA 1TUJA 5CSFA 1QTXA 1OE9B 1M46A 3EVRA 1SW8A 3DQNA 3CFFA 2GGMA 1B8RA 1D1OA 3LK1A 4CIDA 3E5WA 3SSLA 1G7KA 2F3YA 2CT9A 2WC5A 5DU0A 4Q04A 1YZWA 2O29A 1LINA 2AHAA 2B3QA 3ST3A 4W6RA 2JNXA 4PE4A 4OKHA 4W6FA 1YFPA 3WHTB 3BUNB 4HQ8A 1YR5A 2L98A 4ZCVA 1U5IB 2OTEA 1DJGA 3U0KA 2GTEA 5DQMA 1DEKA 2LMVA 1LKJA 2DD9A 2HRSA 1DJIA 2IE2A 3NF0A 1SPYA 1IG5A 1XK4A 3R1OA 2FZUA 2WCMA 4RYSA 1S36A 3BFBA 1DJYA 2JXCA 1CFFA 1B8LA 3FWCA 2WISA 1SKTA 3LF4B 1BG1A 2L5XB 1K90D 3DQCA 1W7UA 4E68A 3FIAA 2ZN9A 4HE4A 2AUCA 1JC2A 2WHUA 2I7AA 1MYWA 3PFVA 3UFZA 2M29A 2WORA 4DCKA 2HF5A 3I5FB 2JU0A 4ZF5A 3CZ2A 1CFPA 1TWOA 1F70A 4W6OA 2ISDA 3SG3A 1BR4B 1M39A 3SSHA 4DKNA 2YE1A 2KNEA 3SS4A 3AAJA 4W6DA 1SL8A 1HT9A 1ZUXA 3VHTB 1L7ZA 2A48A 3VGOA 3S0GA 2KFGA 2IB6A 4C0LA 4WRIA 5HGEA 3SG6A 2LP2A 4W6GA 2ZNEA 2K2FA 2WOSA 2HPSA 3SSYA 3SG7A 5AEQA 2OTGC 3WLDA 1JSAA 2LANA 4I2YA 1W9ZA 1DQEA 4PHKA 1BT6A 2KLEA 1R2UA 1YHIA 2E6WA 2BCAA 2K7OA 1YVHA 2JOJA 4IK3A 1F09A 2EGDA 3SRYA 4LJBA 4IK5A 1IWQA 3BFAA 3JVTB 2BECA 4H3NA 4TZAA 1XFWO 1WLMA 3PALA 5AQBB 4PCWA 1Q4EA 1ZOTB 1N0YA 2ZKMX 3TS5B 3WLCA 2OS8B 3V2LA 2PRUA 1QIWA 1EMAA 3NT3A 3S0BA 1CDMA 2G9BA 2QU1A 4YGDB 3DQFA 1UP5A 3KPXA 1A75A 1YHHA 1KK8B 1G33A 2WCBA 4P1QA 5D3OA 2Q91A 3DVEA 5F9GA 2Y1NA 3BXCA 1SYMA 2HPWA 1QLSA 1NX2A 5EB7A 3NSLA 5HKZA 1ZGQA 4DXMA 5K89A 5EL2A 3DQOA 3ADFA 1C3ZA 1LS8A 2JTZA 2HQZA 1TIZA 5I2QA 1FW4A 3KO0A 3EKHA 4GAOA 2YGUA 5B8IB 2JWWA 2VRGA 2ZMWA 3H4SE 1MF8B 4YGBB 1PULA 2I94A 2Q6PA 1JWDA 3SIBA 3LVCA 2RH7A 1EMMA 2CBLA 4OJ0A 2LAPA 3R72A 1QIVA 1Y0VH 3KHEA 1GL4A 3SVEA 2AWMA 3VICA 3ST4A 5EJUA 1XMZA 1OQPA 3S0FA 4RTCA 1H4UA 3CBEA 2KQ6A 3PN7B 1FBVA 3TUYB 1NX1A 2MA2A 4YI8A 2WHTA 4P5OE 4QJ3B 3DPZA 2KI6D 4INWA 1YTZC 2KI4B 1UWOA 1S5GY 3K1EA 4B5YA 4P76A 4NWSA 2COLB 2LNKA 5JOLA 4W6TA 5BTTB 4HREE 1DJWA 4XOWA 3I5IC 2KAYA 3AKOA 1ALVA 2BCXA 1YHGA 2ZN8A 3OBVA 5J2OA 4NDBA 2L2CA 3I19A 2Y1MA 2IB5A 3DQ5A 2K7BA 2L4HA 4Q7TA 1A03A 1YX7A 1CFCA 3OSQA 5ER5A 4GUKA 1Q4BA 2M1KB 3FE6A 2QLHA 1YJFA 1TNWA 2MAZA 1BODA 2H6VA 1TN4A 3D76A 3B6XA 1CB1A 2EMOA 4KYNA 1V1FA 3EK7A 3A4UB 1GGWA 2VVJA 4OY4A 4M2PA 4W7XA 1OMDA 1PK0D 1UHJA 4LQUA 2ZFDA 3BUOB 1SNLA 2BL0C 3NSOA 3DQ7A 3GJ1A 4ZCUA 1AUIB 2P71A 3D77A 1QWVA 1IQ5A 3FWBA 1RMPA 4OHSA 1OOIX 1TUZA 5HBDA 2TN4A 3SG5A 3FE8A 2SCPA 2IOVA 4R6DA 3TMTA 2OJKA 4Q7UA 4W6HA 4PPKA 3IP2A 3SSPA 5AFPA 5J3XA 1KCYA 2G6EA 2QDIA 3EVVA 4JD9A 3LLEA 3OX5A 4DS7A 1KQVA 5LK4A 4JC2A 3U8AA 4IK8A 5DPIA 1J7QA 4XYNA 4NDCA 4ZFSA 3GEXA 2PMYA 3CWGA 3H1OA 3VRQA 1KSMA 1S6IA 1N2DA 4PDZA 2LHIA 3NSIA 1B4CA 2AMIA 1BR1B 4LJDA 1T14A 3TZ1A 4B30B 4AS8A 3TDZA 4EN1A 2C9JA 1QX2A 1SL7A 1XAEA 3DD4A 3O2PA 1K9PA 2G16B 2QEVA 4ORCB 1UHNA 2LVJA 3NHIA 5CSJA 4TZGA 4NQGA 1CLLA 2Y5IA 4GGNA 4DXOA 3SSKA 3D73A 2Z6XA 4AR7A 3SS0A 4H47A 2WCKA 5FI7A 3Q8IA 4WQ3A 3AAKA 1R6PA 1B7TZ 1KK7Z 1XFZO 1RECA 5G08A 2G2SB 2F8PA 1J7PA 4Z4KA 4W7AA 2HCGA 1C7VA 1YVLA 3E5TA 3CB9A 4EDOA 2WURA 3LSAA 2Y4QA 2GX0A 2V53A 3NT9A 3CYZA 4OVNF 3SVDA 1P28A 1UHHA 1DTLA 1RWYA 4W75A 3DQ6A 3VRNA 2P6BB 1RMMA 1GJYA 1NSHA 1EMEA 4GF6B 1WDCC 1FI6A 1IJ5A 2MJWB 2MLEC 2CXJA 2QLIA 1C3YA 1WRLA 4YBHB 2WHSA 2M0RA 2A47A 4PALA 4M2QA 2H5PA 5AANA 3LK0A 3UO9A 1GQMA 3O4XA 4CFRA 1BF5A 1RK9A 2H9WA 1UUSA 2L5YA 3DVMA 2MHHA 1GGXA 1SR6B 2QLGA 1OOJA 2MLFC 4XVPA 1NWDA 1RM9A 5T3IA 4JWQA 1M63B 3TDUA 1DT7B 1YJ2A 3CFHA 3L4LA 4DXNA 2NLNA 4R1EA 2O24A 1TOPA 3DF0A 2H2KA 1SSEB 4W6UA 4W6LA 1TTXA 1JF2A 2QLEA 2OKWA 2WCEA 3D10A 1NP8A 4I5NB 2CNPA 2VVIA 1NIWA 2A4JA 4HRHA 3I5HC 3CZ0A 3MGFA 3C1VA 1KQMB 1TRFA 4ZB1A 2H8QA 4LQTA 2FCEA 1Z1PA 4PE0A 3SSTA 4JKTA 1JF0A 4JQ0D 4DXPA 1MWNA 1K9UA 5BQLA 1ZGOA 2FJYA 2GX2A 1LVCD 2LVVA 5GQQC 1AK8A 1QV0A 4YRUA 5LTPA 1WRZA 4YGEB 1SK6D 2OPOA 1CLBA 1G4YR 2M8UA 1NX3A 2V4EB 3O77A 5LTRA 4TNCA 1CTRA 1GFLA 4ZINA 4BDUA 2JT0A 1WLZA 3BXBA 3SVBA 2YDZA 1L2OC 1IH0A 2WSNA 1KWOB 2QZ0A 3DQKA 1SR6C 1LA0A 1CM1A 3SG2A 3VRPA 1QYOA 5D69A 3L47A 2QLGB 1TNPA 4L12A 2DUFA 3DPXA 3DQJA 1K93D 3MSEB 3GK4X 1F8HA 4PHNA 5KSZA 2K60A 1DELA 3KF9A 2WSOA 1B7TY 1KK7Y 2BE4A 4GNKB 1Q4AA 1ODBA 3DQDA 1CDPA 3DF0B 3PIBA 4EULA 4W7RA 5EXBA 2JADA 3JTDB 2FL1A 2SASA 2BE6A 5LTQA 1S6ZA 1EG3A 3DQ4A 1YX8A 3DQHA 5HZTA 5DKNA 2VAEA 3A8RA 1ALWA 3O78A 4BY4A 2HJOA 2WCHA 3NGVA 1HUYA 5HZUA 2WCLA 3CZ1A 5CSIA 3HX4A 1JBAA 1EXRA 1Q4DA 3DVKA 5JJGA 3SIAA 4XL5A 2WC6A 1F71A 2ZO7A 1H8BA 1KFXS 3ZTFA 2KAVA 4P2YB 1XFVO 3EVPA 2LHLA 2WIQA 1TCFA 3W1DA 3ZNIA 2V4EC 3NXAA 1JC0A 3W1CA 4U2VA 3I5FC 3CR4X 3BX9A 3A8SA 1MXEA 4OR9B 5EBJA 2VVHA 1B47A 4WQ2A 4KEXA 1F54A 3P8UA 1A4PA 3EK4A 1QASA 1Z1QA 4Q7RA 4XJKA 2DUGA 1JUOA 1OOFA 4HRGA 5HZOA 1RTP1 2EMNA 3O4YA 2EMDA 2JRFA 1PVBA 2NXQA 3H1RA 1OSAA 3ZWHA 1OXDA 1EMKA 3TMRA 4YGAA 1WRKA 1LA3A 3OGNA 4MN0A 4AQJA 3IVTA 2KQYA 5EB6A 4ORNA 4L1IA 5FI2A 2FOTA 3AKAA 4PPJA 2CTNA 3ED8A 1QLKA 3CFAA 3NEZA 4FTGA 1MUXA 4W72A 2AWLA 2GW3A 5I2LA 4W6KA 3KCSA 4KW4A 2LVKA 5DTLA 3JVTC 3DYEA 3VRRA 1AJ4A 5HZSA 3WXAA 5ER4X 2K61A 5FVFA 5DPGA 4IK9A 5DTYA 5KTGA 4W6JA 1QJTA 4W6MA 5AXIA 3TS5C 1MQ1A 1CDLA 2OS8C 3GB3A 1DF0A 3ICBA 3K1KA 1RROA 2QT2A 2LLUA 1SBJA 1VRKA 3O6BA 3BOWA 1IRJA 2KYFA 3ZUJA 3BFHA 1AJ5A 1PSRA 2KI6C 3TDIA 1KK8C 5HLOA 3DQ2A 1A75B 2LLSA 1NCZA 2F3ZA 2AWJA 3U8PA 1C4FA 2JPOA 4KA9A 5EXCI 4KW8A 3IQQA 2PSRA 4INXA 2D8NA 2EC6B 2BBMA 5FI6A 1IQ3A 5DQBA 1Y1UA 4GGFC 4W7DA 5I8NA 2LUXA 3D0YA 4MEWA 4W69A 2FCDA 2F2PA 4ANJA 4OQWA 2DUHA 2KSPA 1W7JB 3LS3A 4C0JA 2DUEA 1XSSA 3DXLA 1EJ3A 3WNXB 1DJZA 1Q73A 5HKWA 2F2OA 3NEDA 1IIOA 1J1DA 2B1UA 1J7OA 4IL1A 1MR8A 1XA9A 2LLTA 1BJFA 1V1GA 4H3LA 4A4CA 3BUXB 2K2AA 2WC8A 3PN7C 4KF4A 2K0JA 3TUYC 2LM5A 1J7RA 2FWQA 5DKRA 1RJVA 4MZJA 4ZBLA 5CSNA 1QYFA 4PFEA 2KI4C 3GJ2A 4J88A 1A29A 3BOWB 3PATA 4PHJA 4Z4MA 1M45A 1UISA 1OMVA 3CR5X 2JTTA 1GM0A 5HL1A 1YRTB 4I5JA 1QY3A 3QRXA 1H4BA 1CDNA 3BUWB 4W74A 5IBWA 2GW4B 3UNWA 4KGFA 1YUTA 3LA1A 4H3MA 1F4OA 4DRWA 3DQMA 3CLNA 3DZTA 4JRBA 2HETA 2YE0A 3AI5A 2KLDA 4NDDA 2R2IA 4I5LB 2BAPA 2HGYA 1NYAA 4YI9A 2LMTA 2Z6YA 3D0YB 4Q9WA 4PE7A 1F0BA 2ZNDA 2O60A 3PJ5A 2HGDA 1TNQA 3DQEA 1XFXO 3CGAA 1MOVA 3K21A 2KBMA 2JZIA 1XVJA 3DVJA 3SSVA 2WCJA 3LVAA 1OMRA 1K8UA 1KYPA 4W7EA 1EG4A 1MXLC 1DJXA 2M49B 4KPIA 2FJUB 4J89A 4MRYA 1TCOB 3SVNA 1LXFC 3CZTX 2K8MB 3NHTA 3PJBA 2BBNA 4MSPA 4W6NA 1OW4A 3B87A 3RWAA 1DJHA 4N3DA 4DXQA 2M1UA 4RYWA 2VADA 4F0ZB 3IQOA 4ORAB 2G5ZB 1XO5A 4UTSA 3P28A 2L4IA 3BQ3A 2JXLA 2H61C 2A50B 4OCIA 5BPJA 3FS7A 2MRDA 3NSKA 3ST0A 3WHUB 3L4AA 4ICBA 3BJHA 3M22A 2JQ6A 2L50A 3CD9A 1Q80A 2LE9B 4IZNA 4DKMA 2DUIA 1Q4CA 2HQ8A 2WNDA 2POXA 1C07A 2B3PA 4IK4A 1X02A 4L13A 1RRXA 3EKJA 5EXUA 1AVSA 1EMCA 4KF5C 3CDNA 3RLZA 2KFFA 2Y0GA 2H5RA 2KOTA 3VHTA 2L2EA 5DRFA 1NPQA 4PHMA 3OHMB 1MOUA 3I5GB 2ICRA 3S0AA 3R1PA 3GK1A 2K7CA 2HQWA 1S1EA 3KCTA 2PQLA 4MBEA 2KFHA 4ZF3A 5I94A 2OTGB 2M7NA 5HW9A 4QJ5B 1KSOA 2PYQA 1CMGA 5EHUA 4PPLA 1SCVA 3G9AA 1S6CA 1KYSA 2ERBA 5DY6A 3OB2B 3DQ1A 2G3DB 4N1GA 1ZACA 2H8VA 5H87A 2ZMUA 3CR2A 2KPHA 2CCMA 2NZ0A 4PT1A 2I2RE 1FPWA 1BOCA 4U8DA 3M0WA 1B8CA 2Q57A 2Z1OA 4OZDA 5I2OA 2JT8A 4LJDC 4D1EA 4XGYA 3D74A 1JBZA 1XA5A 1CKKA 3BXAA 2G6YA 4DXIA 1CFDA 4AQIA 3SV5A 3AI4A 4GOBA 1DGVA 2A53B 1OXFA 2M7LA 1FF1A 4Q9XA 2O5GA 3ZULA 1S5GZ 1QATA 4L9MA 5DKQA 2KBIA 2LUCA 2P4MA 2GV5A 1K2HA 2JULA 2M97A 1J1EA 3I5GC 2F33A 5HYDA 3V3DA 3U0MA 1K9KA 2ARLA 2M9GA 4MLWA 4GGFA 3PSRA 3IF7A 1KQMC 3SVRA 2LMUA 1B9CA 1Z4HA 4JF9A 2DD7A 2PXSA 2BTJA 4CLNA 3R1VA 1FI5A 3GK2A 3DQUA 1K96A 1XFUO 3B88A 4FQOA 1OZOA 4GBAA 4H48A 2A52B 3VROA 2KGBC 1ZFSA 3HCMA 5CPVA 2A56B 2QEBA 1XFRA 1BLQA 4ETOA 2ZRTA 1PVAA 3VB1A 4A4BA 4GPLB 1YRUB 4CFQA 1WY9A 3DQAA 5TNCA 4I5KA 2G6XA 3DPWA 1EMFA 1JFKA 1CMFA 3S0EA 1KWOC 2G2BA 1S6JA 1OOGA 4JPZB 1W7IB 4GFTA 5BTTA 1XFYO 4W6CA 4EMQA 1EMBA 3ST2A 3M24A 4ZF4A 1QXPA 3OSRA 1CM4A 4KGEA 4W6BA 4JEOA 3I5IB 1UURA 1EMLA 1YUUA 1S26D 5PALA 1QXTA 4MRXA 1OXEA 1XQMA 3JTDC 1OOHA 3ZUFA 1B9AA 3CTNA 4OV2A 3OX6A 1JFJA 1CLMA 1RFJA 4JGEA 2C9IA 5AERA 1IGVA 2BKHB 4XOVA 2JC2A 3DQ3A 3SVUA 4DIRA 4W7CA 3U0LA 2L51A 4HQ9A 1XK4C 5DRGA 2QEOA 2LC5A 1SRAA 1N65A 5DICA 1EMGA 1ORGA 4W7FA 1B1GA 3S05A 1S3PA 4CPVA 2QPTA 1PALA 5DTZA 4KAGA 5DPHA 3E3RA 3CS1A 3D75A 1Y6WA 3PJ7A 1NUBA 1F4QA
chains in the Genus database with same CATH topology
3F45A 1SMGA 1E8AA 5F6TA 2BL0B 2ZO6A 1BU3A 3U0NA 2QRFA 1IJ6A 1QX7A 2BKIB 5HLVA 2DDDA 5DPJA 3EK8A 5FVGA 2VZXA 3SVOA 1MHOA 4W6PA 2OKYA 1NCXA 4W6AA 1H6RA 2L0PA 1QVIZ 2NCOA 4HSZA 3OB1B 1CV7A 4KW9A 3SJSA 3KEVA 2G3OA 4XJKB 2NCPA 2I18A 3AKBA 4GESB 1KYRA 1PRWA 2H61A 2MBXA 3PLFB 4MZLA 2KYCA 1KFUS 2KGRA 2PXWA 2AH8A 3SG4A 2JT3A 1K94A 1XYDA 1M31A 3WCKA 4B30A 5DTXA 1YUSA 2LCPA 2DDCA 2GGZA 2JPTA 2KDHA 3DQ9A 2JNFA 1DVIA 3DQLA 5FHVA 1DMOA 3SVCA 2Q4UA 4KF5A 1KP5A 3DQIA 1HCJA 1QV1A 2LVIA 1W7SA 1J55A 4M2OA 2PALA 3LF3A 1AP4A 4R6BA 4AOMA 3BUMB 3IR8A 4MVFA 4W6IA 1IKUA 2H5QA 1UHKA 2H5OA 1F55A 3OP0A 4C0KA 4N1FA 5KTYA 1EH2A 2K7DA 2KAXA 1SCMB 4HQCA 1DF0B 3CGLA 5H89A 1QX5B 2IS9A 2AWKA 5H88A 4BY5A 1KFXL 3RM1A 2ZRSA 3CD1A 2KHNA 5FVIA 4MZKA 2AAOA 3U8CA 4J8AA 5HKYA 4HVFA 2RGIA 1ZMZA 2HFCA 3SVSA 4USLA 3LCPC 2EC6C 2PVBA 1WDCB 1EL4A 1ZUZA 3BXKA 2M3WA 2DOQA 1QS7A 1TNXA 2HQKA 3DQ8A 4OGSA 4LJCA 1CNPA 3PM8A 4W73A 4YGCB 3EVUA 1W7TA 1JC1A 1NCYA 2LP3A 1SL9A 1JBYA 3UG0A 4DUQA 2WCFA 3RWTA 1GGZA 3LL8B 1A2XA 1SY9A 2A46A 4N5XA 1HQVA 2BCBA 3BYAA 1YURA 1PSBA 1UHIA 1U5IA 2O2BA 2OTBA 4PE1A 3GL4A 4W77A 1NX0A 1SCMC 1QVIY 2LV7A 1C7WA 3VK1A 3I5HB 1DGUA 2OGRA 2E30A 4UPGA 2YFPA 4W76A 5BT0A 4W6SA 1QYQA 2A54B 1G8IA 4ORBB 1Y1XA 4IK1A 4LW5A 2Z6ZA 1BFPA 2EHBA 3E5VA 2QACA 1K95A 5FYXA 4ZIOA 5D7FA 1AHRA 2V4EA 4JFGA 3GOFA 1OZSA 1BMOA 1ZGPA 4QJ4B 3LVDA 1Y1AA 3OGOA 2PASA 5KU1A 1KFUL 1L2OB 1RMOA 4EDSA 5CSFA 1QTXA 1OE9B 1M46A 3EVRA 1SW8A 3DQNA 3CFFA 2GGMA 1B8RA 1D1OA 3LK1A 4CIDA 3E5WA 3SSLA 1G7KA 2F3YA 2CT9A 5DU0A 4Q04A 1YZWA 2O29A 1LINA 2AHAA 2B3QA 3ST3A 4W6RA 2JNXA 4PE4A 4OKHA 4W6FA 1YFPA 3WHTB 3BUNB 4HQ8A 1YR5A 2L98A 4ZCVA 1U5IB 2OTEA 1DJGA 3U0KA 5DQMA 2LMVA 1LKJA 2DD9A 2HRSA 1DJIA 2IE2A 3NF0A 1SPYA 1IG5A 1XK4A 2FZUA 4RYSA 1S36A 1DJYA 2JXCA 1CFFA 1B8LA 3FWCA 2WISA 1SKTA 3LF4B 1BG1A 2L5XB 1K90D 3DQCA 1W7UA 4E68A 3FIAA 2ZN9A 4HE4A 2AUCA 1JC2A 2WHUA 2I7AA 1MYWA 3PFVA 3UFZA 2M29A 2WORA 4DCKA 2HF5A 3I5FB 2JU0A 4ZF5A 1CFPA 1F70A 4W6OA 2ISDA 3SG3A 1BR4B 1M39A 3SSHA 4DKNA 2YE1A 2KNEA 3AAJA 4W6DA 1SL8A 1HT9A 1ZUXA 3VHTB 1L7ZA 2A48A 3VGOA 2KFGA 2IB6A 4WRIA 4C0LA 5HGEA 4W6GA 3SG6A 2LP2A 2ZNEA 2K2FA 2WOSA 2HPSA 3SSYA 3SG7A 5AEQA 2OTGC 3WLDA 1JSAA 2LANA 4I2YA 4PHKA 1BT6A 1R2UA 1YHIA 2E6WA 2BCAA 2K7OA 1YVHA 2JOJA 4IK3A 1F09A 2EGDA 3SRYA 4LJBA 4IK5A 1IWQA 3JVTB 2BECA 4H3NA 4TZAA 1XFWO 1WLMA 3PALA 5AQBB 4PCWA 1Q4EA 1ZOTB 1N0YA 2ZKMX 3TS5B 3WLCA 2OS8B 2PRUA 1QIWA 1EMAA 3NT3A 1CDMA 2G9BA 2QU1A 4YGDB 3DQFA 1UP5A 3KPXA 1A75A 1YHHA 1KK8B 1G33A 2WCBA 4P1QA 2Q91A 3DVEA 5F9GA 2Y1NA 3BXCA 1SYMA 2HPWA 1QLSA 1NX2A 5EB7A 3NSLA 5HKZA 1ZGQA 4DXMA 5K89A 3DQOA 3ADFA 2JTZA 2HQZA 1TIZA 5I2QA 1FW4A 3KO0A 3EKHA 4GAOA 5B8IB 2JWWA 2VRGA 2ZMWA 3H4SE 1MF8B 4YGBB 1PULA 2I94A 2Q6PA 3LVCA 3SIBA 1JWDA 2RH7A 1EMMA 2CBLA 4OJ0A 2LAPA 1QIVA 1Y0VH 3KHEA 1GL4A 3SVEA 2AWMA 3VICA 3ST4A 5EJUA 1XMZA 1OQPA 4RTCA 1H4UA 3CBEA 2KQ6A 3PN7B 1FBVA 3TUYB 1NX1A 2MA2A 4YI8A 2WHTA 4P5OE 4QJ3B 3DPZA 2KI6D 1YTZC 2KI4B 1UWOA 1S5GY 4B5YA 4P76A 4NWSA 2COLB 2LNKA 5JOLA 4W6TA 5BTTB 4HREE 1DJWA 4XOWA 3I5IC 2KAYA 3AKOA 1ALVA 2BCXA 1YHGA 2ZN8A 5J2OA 4NDBA 3I19A 2Y1MA 2IB5A 3DQ5A 2K7BA 2L4HA 4Q7TA 1A03A 1YX7A 1CFCA 3OSQA 5ER5A 4GUKA 1Q4BA 2M1KB 2QLHA 1YJFA 1TNWA 2MAZA 1BODA 2H6VA 1TN4A 1CB1A 2EMOA 1V1FA 3EK7A 3A4UB 1GGWA 2VVJA 4OY4A 4M2PA 4W7XA 1OMDA 1PK0D 1UHJA 4LQUA 2ZFDA 3BUOB 1SNLA 2BL0C 3NSOA 3DQ7A 3GJ1A 4ZCUA 1AUIB 1IQ5A 3FWBA 1RMPA 4OHSA 5HBDA 2TN4A 3SG5A 2SCPA 2IOVA 4R6DA 3TMTA 4W6HA 2OJKA 4Q7UA 4PPKA 3IP2A 3SSPA 5AFPA 5J3XA 1KCYA 2G6EA 3EVVA 3LLEA 3OX5A 4DS7A 1KQVA 5LK4A 4JC2A 3U8AA 4IK8A 5DPIA 1J7QA 4XYNA 4NDCA 4ZFSA 3GEXA 2PMYA 3CWGA 3H1OA 3VRQA 1KSMA 1S6IA 1N2DA 4PDZA 2LHIA 3NSIA 1B4CA 2AMIA 1BR1B 4LJDA 3TZ1A 4B30B 4AS8A 3TDZA 4EN1A 2C9JA 1QX2A 1SL7A 1XAEA 3DD4A 3O2PA 1K9PA 2G16B 4ORCB 1UHNA 2LVJA 5CSJA 4TZGA 4NQGA 1CLLA 2Y5IA 4GGNA 4DXOA 3SSKA 2Z6XA 4AR7A 3SS0A 4H47A 4WQ3A 3AAKA 1R6PA 1B7TZ 1KK7Z 1XFZO 1RECA 5G08A 2G2SB 2F8PA 1J7PA 4Z4KA 4W7AA 2HCGA 1C7VA 1YVLA 3E5TA 3CB9A 4EDOA 2WURA 3LSAA 2Y4QA 2GX0A 2V53A 3NT9A 4OVNF 3SVDA 1UHHA 1DTLA 1RWYA 4W75A 3DQ6A 3VRNA 2P6BB 1RMMA 1GJYA 1NSHA 1EMEA 4GF6B 1WDCC 1FI6A 1IJ5A 2MJWB 2MLEC 2CXJA 2QLIA 1WRLA 4YBHB 2WHSA 2M0RA 2A47A 4PALA 4M2QA 2H5PA 5AANA 3LK0A 1GQMA 4CFRA 1BF5A 1RK9A 2H9WA 1UUSA 3DVMA 2MHHA 1GGXA 1SR6B 2QLGA 1OOJA 2MLFC 4XVPA 1NWDA 1RM9A 5T3IA 4JWQA 1M63B 3TDUA 1DT7B 1YJ2A 3CFHA 4DXNA 2NLNA 4R1EA 2O24A 1TOPA 3DF0A 2H2KA 4W6UA 4W6LA 1TTXA 1JF2A 2QLEA 2OKWA 2WCEA 3D10A 1NP8A 4I5NB 2CNPA 2VVIA 1NIWA 2A4JA 4HRHA 3I5HC 3MGFA 3C1VA 1KQMB 1TRFA 4ZB1A 2H8QA 4LQTA 2FCEA 1Z1PA 4PE0A 3SSTA 1JF0A 4JQ0D 4DXPA 1MWNA 1K9UA 5BQLA 1ZGOA 2GX2A 1LVCD 2LVVA 5GQQC 1AK8A 1QV0A 4YRUA 5LTPA 1WRZA 4YGEB 1SK6D 2OPOA 1CLBA 1G4YR 2M8UA 1NX3A 2V4EB 3O77A 5LTRA 4TNCA 1CTRA 1GFLA 4ZINA 4BDUA 2JT0A 1WLZA 3BXBA 3SVBA 2YDZA 1L2OC 1IH0A 2WSNA 1KWOB 2QZ0A 3DQKA 1SR6C 1LA0A 1CM1A 3SG2A 3VRPA 1QYOA 5D69A 2QLGB 1TNPA 4L12A 2DUFA 3DPXA 3DQJA 1K93D 3MSEB 3GK4X 1F8HA 4PHNA 5KSZA 3KF9A 2WSOA 1B7TY 1KK7Y 2BE4A 4GNKB 1Q4AA 1ODBA 3DQDA 1CDPA 3DF0B 3PIBA 4EULA 4W7RA 5EXBA 2JADA 3JTDB 2FL1A 2SASA 2BE6A 5LTQA 1S6ZA 1EG3A 3DQ4A 1YX8A 3DQHA 5HZTA 5DKNA 2VAEA 3A8RA 1ALWA 3O78A 4BY4A 2HJOA 1HUYA 5HZUA 5CSIA 3HX4A 1JBAA 1EXRA 1Q4DA 3DVKA 5JJGA 3SIAA 4XL5A 1F71A 2ZO7A 1H8BA 1KFXS 3ZTFA 2KAVA 4P2YB 1XFVO 3EVPA 2LHLA 2WIQA 1TCFA 3W1DA 3ZNIA 2V4EC 3NXAA 1JC0A 3W1CA 4U2VA 3I5FC 3CR4X 3BX9A 3A8SA 1MXEA 4OR9B 5EBJA 2VVHA 1B47A 4WQ2A 4KEXA 1F54A 3P8UA 1A4PA 3EK4A 1QASA 1Z1QA 4Q7RA 4XJKA 2DUGA 1JUOA 4HRGA 5HZOA 1RTP1 2EMNA 3O4YA 2EMDA 2JRFA 1PVBA 2NXQA 3H1RA 1OSAA 3ZWHA 1OXDA 1EMKA 3TMRA 4YGAA 1WRKA 1LA3A 4MN0A 4AQJA 2KQYA 5EB6A 4ORNA 4L1IA 4PPJA 2FOTA 3AKAA 2CTNA 3NEZA 3ED8A 1QLKA 3CFAA 4FTGA 1MUXA 4W72A 2AWLA 2GW3A 5I2LA 4W6KA 3KCSA 4KW4A 2LVKA 5DTLA 3JVTC 3VRRA 1AJ4A 5HZSA 3WXAA 5ER4X 2K61A 5FVFA 5DPGA 4IK9A 5DTYA 5KTGA 4W6JA 1QJTA 4W6MA 5AXIA 3TS5C 1MQ1A 1CDLA 2OS8C 3GB3A 1DF0A 3ICBA 3K1KA 1RROA 2QT2A 2LLUA 1SBJA 1VRKA 3O6BA 3BOWA 1IRJA 2KYFA 3ZUJA 1AJ5A 1PSRA 2KI6C 3TDIA 1KK8C 5HLOA 3DQ2A 1A75B 2LLSA 1NCZA 2F3ZA 2AWJA 3U8PA 1C4FA 4KA9A 5EXCI 4KW8A 3IQQA 2PSRA 2D8NA 2EC6B 2BBMA 1IQ3A 5DQBA 1Y1UA 4GGFC 4W7DA 5I8NA 2LUXA 3D0YA 4MEWA 4W69A 2FCDA 2F2PA 4ANJA 4OQWA 2DUHA 2KSPA 1W7JB 3LS3A 4C0JA 2DUEA 1XSSA 1EJ3A 3WNXB 1DJZA 1Q73A 5HKWA 2F2OA 3NEDA 1J1DA 2B1UA 1J7OA 4IL1A 1MR8A 1XA9A 2LLTA 1BJFA 1V1GA 4H3LA 4A4CA 3BUXB 2K2AA 2WC8A 3PN7C 4KF4A 2K0JA 3TUYC 2LM5A 1J7RA 2FWQA 5DKRA 1RJVA 4MZJA 4ZBLA 5CSNA 1QYFA 4PFEA 2KI4C 3GJ2A 4J88A 1A29A 3BOWB 3PATA 4PHJA 4Z4MA 1M45A 1UISA 1OMVA 3CR5X 2JTTA 1YRTB 4I5JA 1QY3A 3QRXA 1H4BA 1CDNA 3BUWB 4W74A 5IBWA 2GW4B 4KGFA 1YUTA 3LA1A 4H3MA 1F4OA 4DRWA 3DQMA 3CLNA 4JRBA 2HETA 2YE0A 3AI5A 4NDDA 2R2IA 4I5LB 2HGYA 1NYAA 4YI9A 2LMTA 2Z6YA 3D0YB 4Q9WA 4PE7A 1F0BA 2ZNDA 2O60A 3PJ5A 2HGDA 1TNQA 3DQEA 1XFXO 3CGAA 1MOVA 3K21A 2KBMA 2JZIA 1XVJA 3DVJA 3SSVA 3LVAA 1OMRA 1K8UA 1KYPA 4W7EA 1EG4A 1MXLC 1DJXA 2M49B 4KPIA 2FJUB 4J89A 4MRYA 1TCOB 3SVNA 1LXFC 3CZTX 2K8MB 3PJBA 2BBNA 4MSPA 4W6NA 3RWAA 1DJHA 4N3DA 4DXQA 2M1UA 4RYWA 2VADA 4F0ZB 3IQOA 4ORAB 2G5ZB 1XO5A 4UTSA 3P28A 2L4IA 3BQ3A 2JXLA 2H61C 2A50B 4OCIA 5BPJA 3FS7A 2MRDA 3NSKA 3ST0A 3WHUB 4ICBA 3M22A 2JQ6A 2L50A 3CD9A 1Q80A 2LE9B 4IZNA 4DKMA 2DUIA 1Q4CA 2HQ8A 2WNDA 2POXA 1C07A 2B3PA 4IK4A 1X02A 4L13A 1RRXA 3EKJA 5EXUA 1AVSA 1EMCA 4KF5C 3RLZA 2KFFA 2Y0GA 2H5RA 2KOTA 3VHTA 2L2EA 5DRFA 1NPQA 4PHMA 3OHMB 1MOUA 3I5GB 2ICRA 3GK1A 2K7CA 2HQWA 1S1EA 3KCTA 4MBEA 2KFHA 4ZF3A 2OTGB 2M7NA 5HW9A 4QJ5B 1KSOA 1CMGA 5EHUA 4PPLA 1SCVA 3G9AA 1S6CA 1KYSA 5DY6A 3OB2B 3DQ1A 2G3DB 4N1GA 1ZACA 5H87A 2ZMUA 3CR2A 2CCMA 2NZ0A 2I2RE 1FPWA 1BOCA 4U8DA 3M0WA 1B8CA 2Q57A 2Z1OA 5I2OA 2JT8A 4LJDC 4D1EA 4XGYA 1JBZA 1XA5A 1CKKA 3BXAA 2G6YA 4DXIA 1CFDA 4AQIA 3SV5A 3AI4A 4GOBA 1DGVA 2A53B 1OXFA 2M7LA 1FF1A 4Q9XA 2O5GA 3ZULA 1S5GZ 1QATA 4L9MA 5DKQA 2KBIA 2LUCA 2P4MA 2GV5A 1K2HA 2JULA 2M97A 1J1EA 3I5GC 2F33A 5HYDA 3V3DA 3U0MA 1K9KA 2ARLA 2M9GA 4MLWA 4GGFA 3PSRA 3IF7A 1KQMC 3SVRA 2LMUA 1B9CA 4JF9A 2DD7A 2PXSA 2BTJA 4CLNA 1FI5A 3GK2A 3DQUA 1K96A 1XFUO 4FQOA 1OZOA 4GBAA 4H48A 2A52B 3VROA 2KGBC 1ZFSA 3HCMA 5CPVA 2A56B 1BLQA 4ETOA 2ZRTA 1PVAA 4A4BA 4GPLB 1YRUB 4CFQA 1WY9A 3DQAA 5TNCA 4I5KA 2G6XA 3DPWA 1EMFA 1JFKA 1CMFA 1KWOC 2G2BA 1S6JA 4JPZB 1W7IB 4GFTA 5BTTA 1XFYO 4W6CA 4EMQA 1EMBA 3ST2A 3M24A 4ZF4A 1QXPA 3OSRA 1CM4A 4KGEA 4W6BA 4JEOA 3I5IB 1UURA 1EMLA 1YUUA 1S26D 5PALA 1QXTA 4MRXA 1OXEA 1XQMA 3JTDC 3ZUFA 1B9AA 3CTNA 4OV2A 3OX6A 1JFJA 1CLMA 1RFJA 4JGEA 2C9IA 5AERA 1IGVA 2BKHB 4XOVA 2JC2A 3DQ3A 3SVUA 4DIRA 4W7CA 3U0LA 2L51A 4HQ9A 1XK4C 5DRGA 2LC5A 1SRAA 1N65A 1EMGA 4W7FA 1B1GA 3S05A 1S3PA 4CPVA 2QPTA 1PALA 5DTZA 4KAGA 5DPHA 3E3RA 3CS1A 1Y6WA 3PJ7A 1NUBA 1F4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F45 A;  1SMG A;  1E8A A;  5F6T A;  2BL0 B;  2ZO6 A;  1BU3 A;  3U0N A;  2QRF A;  1IJ6 A;  1QX7 A;  2BKI B;  5HLV A;  2DDD A;  5DPJ A;  3EK8 A;  5FVG A;  2VZX A;  3SVO A;  1MHO A;  4W6P A;  2OKY A;  1NCX A;  4W6A A;  1H6R A;  2L0P A;  1QVI Z;  2NCO A;  4HSZ A;  3OB1 B;  1CV7 A;  4KW9 A;  3SJS A;  3KEV A;  2G3O A;  4XJK B;  2NCP A;  2I18 A;  3AKB A;  4GES B;  1KYR A;  1PRW A;  2H61 A;  2MBX A;  3PLF B;  4MZL A;  2KYC A;  1KFU S;  2KGR A;  2PXW A;  2AH8 A;  3SG4 A;  2JT3 A;  1K94 A;  1XYD A;  1M31 A;  3WCK A;  4B30 A;  5DTX A;  1YUS A;  2LCP A;  2DDC A;  2GGZ A;  2JPT A;  2KDH A;  3DQ9 A;  2JNF A;  1DVI A;  3DQL A;  5FHV A;  1DMO A;  3SVC A;  2Q4U A;  4KF5 A;  1KP5 A;  3DQI A;  1HCJ A;  1QV1 A;  2LVI A;  1W7S A;  1J55 A;  4M2O A;  2PAL A;  3LF3 A;  1AP4 A;  4R6B A;  4AOM A;  3BUM B;  3IR8 A;  4MVF A;  4W6I A;  1IKU A;  2H5Q A;  1UHK A;  2H5O A;  1F55 A;  3OP0 A;  4C0K A;  4N1F A;  5KTY A;  1EH2 A;  2K7D A;  2KAX A;  1SCM B;  4HQC A;  1DF0 B;  3CGL A;  5H89 A;  1QX5 B;  2IS9 A;  2AWK A;  5H88 A;  4BY5 A;  1KFX L;  3RM1 A;  2ZRS A;  3CD1 A;  2KHN A;  5FVI A;  4MZK A;  2AAO A;  3U8C A;  4J8A A;  5HKY A;  4HVF A;  2RGI A;  1ZMZ A;  2HFC A;  3SVS A;  4USL A;  3LCP C;  2EC6 C;  2PVB A;  1WDC B;  1EL4 A;  1ZUZ A;  3BXK A;  2M3W A;  2DOQ A;  1QS7 A;  1TNX A;  2HQK A;  3DQ8 A;  4OGS A;  4LJC A;  1CNP A;  3PM8 A;  4W73 A;  4YGC B;  3EVU A;  1W7T A;  1JC1 A;  1NCY A;  2LP3 A;  1SL9 A;  1JBY A;  3UG0 A;  4DUQ A;  2WCF A;  3RWT A;  1GGZ A;  3LL8 B;  1A2X A;  1SY9 A;  2A46 A;  4N5X A;  1HQV A;  2BCB A;  3BYA A;  1YUR A;  1PSB A;  1UHI A;  1U5I A;  2O2B A;  2OTB A;  4PE1 A;  3GL4 A;  4W77 A;  1NX0 A;  1SCM C;  1QVI Y;  2LV7 A;  1C7W A;  3VK1 A;  3I5H B;  1DGU A;  2OGR A;  2E30 A;  4UPG A;  2YFP A;  4W76 A;  5BT0 A;  4W6S A;  1QYQ A;  2A54 B;  1G8I A;  4ORB B;  1Y1X A;  4IK1 A;  4LW5 A;  2Z6Z A;  1BFP A;  2EHB A;  3E5V A;  2QAC A;  1K95 A;  5FYX A;  4ZIO A;  5D7F A;  1AHR A;  2V4E A;  4JFG A;  3GOF A;  1OZS A;  1BMO A;  1ZGP A;  4QJ4 B;  3LVD A;  1Y1A A;  3OGO A;  2PAS A;  5KU1 A;  1KFU L;  1L2O B;  1RMO A;  4EDS A;  5CSF A;  1QTX A;  1OE9 B;  1M46 A;  3EVR A;  1SW8 A;  3DQN A;  3CFF A;  2GGM A;  1B8R A;  1D1O A;  3LK1 A;  4CID A;  3E5W A;  3SSL A;  1G7K A;  2F3Y A;  2CT9 A;  5DU0 A;  4Q04 A;  1YZW A;  2O29 A;  1LIN A;  2AHA A;  2B3Q A;  3ST3 A;  4W6R A;  2JNX A;  4PE4 A;  4OKH A;  4W6F A;  1YFP A;  3WHT B;  3BUN B;  4HQ8 A;  1YR5 A;  2L98 A;  4ZCV A;  1U5I B;  2OTE A;  1DJG A;  3U0K A;  5DQM A;  2LMV A;  1LKJ A;  2DD9 A;  2HRS A;  1DJI A;  2IE2 A;  3NF0 A;  1SPY A;  1IG5 A;  1XK4 A;  2FZU A;  4RYS A;  1S36 A;  1DJY A;  2JXC A;  1CFF A;  1B8L A;  3FWC A;  2WIS A;  1SKT A;  3LF4 B;  1BG1 A;  2L5X B;  1K90 D;  3DQC A;  1W7U A;  4E68 A;  3FIA A;  2ZN9 A;  4HE4 A;  2AUC A;  1JC2 A;  2WHU A;  2I7A A;  1MYW A;  3PFV A;  3UFZ A;  2M29 A;  2WOR A;  4DCK A;  2HF5 A;  3I5F B;  2JU0 A;  4ZF5 A;  1CFP A;  1F70 A;  4W6O A;  2ISD A;  3SG3 A;  1BR4 B;  1M39 A;  3SSH A;  4DKN A;  2YE1 A;  2KNE A;  3AAJ A;  4W6D A;  1SL8 A;  1HT9 A;  1ZUX A;  3VHT B;  1L7Z A;  2A48 A;  3VGO A;  2KFG A;  2IB6 A;  4WRI A;  4C0L A;  5HGE A;  4W6G A;  3SG6 A;  2LP2 A;  2ZNE A;  2K2F A;  2WOS A;  2HPS A;  3SSY A;  3SG7 A;  5AEQ A;  2OTG C;  3WLD A;  1JSA A;  2LAN A;  4I2Y A;  4PHK A;  1BT6 A;  1R2U A;  1YHI A;  2E6W A;  2BCA A;  2K7O A;  1YVH A;  2JOJ A;  4IK3 A;  1F09 A;  2EGD A;  3SRY A;  4LJB A;  4IK5 A;  1IWQ A;  3JVT B;  2BEC A;  4H3N A;  4TZA A;  1XFW O;  1WLM A;  3PAL A;  5AQB B;  4PCW A;  1Q4E A;  1ZOT B;  1N0Y A;  2ZKM X;  3TS5 B;  3WLC A;  2OS8 B;  2PRU A;  1QIW A;  1EMA A;  3NT3 A;  1CDM A;  2G9B A;  2QU1 A;  4YGD B;  3DQF A;  1UP5 A;  3KPX A;  1A75 A;  1YHH A;  1KK8 B;  1G33 A;  2WCB A;  4P1Q A;  2Q91 A;  3DVE A;  5F9G A;  2Y1N A;  3BXC A;  1SYM A;  2HPW A;  1QLS A;  1NX2 A;  5EB7 A;  3NSL A;  5HKZ A;  1ZGQ A;  4DXM A;  5K89 A;  3DQO A;  3ADF A;  2JTZ A;  2HQZ A;  1TIZ A;  5I2Q A;  1FW4 A;  3KO0 A;  3EKH A;  4GAO A;  5B8I B;  2JWW A;  2VRG A;  2ZMW A;  3H4S E;  1MF8 B;  4YGB B;  1PUL A;  2I94 A;  2Q6P A;  3LVC A;  3SIB A;  1JWD A;  2RH7 A;  1EMM A;  2CBL A;  4OJ0 A;  2LAP A;  1QIV A;  1Y0V H;  3KHE A;  1GL4 A;  3SVE A;  2AWM A;  3VIC A;  3ST4 A;  5EJU A;  1XMZ A;  1OQP A;  4RTC A;  1H4U A;  3CBE A;  2KQ6 A;  3PN7 B;  1FBV A;  3TUY B;  1NX1 A;  2MA2 A;  4YI8 A;  2WHT A;  4P5O E;  4QJ3 B;  3DPZ A;  2KI6 D;  1YTZ C;  2KI4 B;  1UWO A;  1S5G Y;  4B5Y A;  4P76 A;  4NWS A;  2COL B;  2LNK A;  5JOL A;  4W6T A;  5BTT B;  4HRE E;  1DJW A;  4XOW A;  3I5I C;  2KAY A;  3AKO A;  1ALV A;  2BCX A;  1YHG A;  2ZN8 A;  5J2O A;  4NDB A;  3I19 A;  2Y1M A;  2IB5 A;  3DQ5 A;  2K7B A;  2L4H A;  4Q7T A;  1A03 A;  1YX7 A;  1CFC A;  3OSQ A;  5ER5 A;  4GUK A;  1Q4B A;  2M1K B;  2QLH A;  1YJF A;  1TNW A;  2MAZ A;  1BOD A;  2H6V A;  1TN4 A;  1CB1 A;  2EMO A;  1V1F A;  3EK7 A;  3A4U B;  1GGW A;  2VVJ A;  4OY4 A;  4M2P A;  4W7X A;  1OMD A;  1PK0 D;  1UHJ A;  4LQU A;  2ZFD A;  3BUO B;  1SNL A;  2BL0 C;  3NSO A;  3DQ7 A;  3GJ1 A;  4ZCU A;  1AUI B;  1IQ5 A;  3FWB A;  1RMP A;  4OHS A;  5HBD A;  2TN4 A;  3SG5 A;  2SCP A;  2IOV A;  4R6D A;  3TMT A;  4W6H A;  2OJK A;  4Q7U A;  4PPK A;  3IP2 A;  3SSP A;  5AFP A;  5J3X A;  1KCY A;  2G6E A;  3EVV A;  3LLE A;  3OX5 A;  4DS7 A;  1KQV A;  5LK4 A;  4JC2 A;  3U8A A;  4IK8 A;  5DPI A;  1J7Q A;  4XYN A;  4NDC A;  4ZFS A;  3GEX A;  2PMY A;  3CWG A;  3H1O A;  3VRQ A;  1KSM A;  1S6I A;  1N2D A;  4PDZ A;  2LHI A;  3NSI A;  1B4C A;  2AMI A;  1BR1 B;  4LJD A;  3TZ1 A;  4B30 B;  4AS8 A;  3TDZ A;  4EN1 A;  2C9J A;  1QX2 A;  1SL7 A;  1XAE A;  3DD4 A;  3O2P A;  1K9P A;  2G16 B;  4ORC B;  1UHN A;  2LVJ A;  5CSJ A;  4TZG A;  4NQG A;  1CLL A;  2Y5I A;  4GGN A;  4DXO A;  3SSK A;  2Z6X A;  4AR7 A;  3SS0 A;  4H47 A;  4WQ3 A;  3AAK A;  1R6P A;  1B7T Z;  1KK7 Z;  1XFZ O;  1REC A;  5G08 A;  2G2S B;  2F8P A;  1J7P A;  4Z4K A;  4W7A A;  2HCG A;  1C7V A;  1YVL A;  3E5T A;  3CB9 A;  4EDO A;  2WUR A;  3LSA A;  2Y4Q A;  2GX0 A;  2V53 A;  3NT9 A;  4OVN F;  3SVD A;  1UHH A;  1DTL A;  1RWY A;  4W75 A;  3DQ6 A;  3VRN A;  2P6B B;  1RMM A;  1GJY A;  1NSH A;  1EME A;  4GF6 B;  1WDC C;  1FI6 A;  1IJ5 A;  2MJW B;  2MLE C;  2CXJ A;  2QLI A;  1WRL A;  4YBH B;  2WHS A;  2M0R A;  2A47 A;  4PAL A;  4M2Q A;  2H5P A;  5AAN A;  3LK0 A;  1GQM A;  4CFR A;  1BF5 A;  1RK9 A;  2H9W A;  1UUS A;  3DVM A;  2MHH A;  1GGX A;  1SR6 B;  2QLG A;  1OOJ A;  2MLF C;  4XVP A;  1NWD A;  1RM9 A;  5T3I A;  4JWQ A;  1M63 B;  3TDU A;  1DT7 B;  1YJ2 A;  3CFH A;  4DXN A;  2NLN A;  4R1E A;  2O24 A;  1TOP A;  3DF0 A;  2H2K A;  4W6U A;  4W6L A;  1TTX A;  1JF2 A;  2QLE A;  2OKW A;  2WCE A;  3D10 A;  1NP8 A;  4I5N B;  2CNP A;  2VVI A;  1NIW A;  2A4J A;  4HRH A;  3I5H C;  3MGF A;  3C1V A;  1KQM B;  1TRF A;  4ZB1 A;  2H8Q A;  4LQT A;  2FCE A;  1Z1P A;  4PE0 A;  3SST A;  1JF0 A;  4JQ0 D;  4DXP A;  1MWN A;  1K9U A;  5BQL A;  1ZGO A;  2GX2 A;  1LVC D;  2LVV A;  5GQQ C;  1AK8 A;  1QV0 A;  4YRU A;  5LTP A;  1WRZ A;  4YGE B;  1SK6 D;  2OPO A;  1CLB A;  1G4Y R;  2M8U A;  1NX3 A;  2V4E B;  3O77 A;  5LTR A;  4TNC A;  1CTR A;  1GFL A;  4ZIN A;  4BDU A;  2JT0 A;  1WLZ A;  3BXB A;  3SVB A;  2YDZ A;  1L2O C;  1IH0 A;  2WSN A;  1KWO B;  2QZ0 A;  3DQK A;  1SR6 C;  1LA0 A;  1CM1 A;  3SG2 A;  3VRP A;  1QYO A;  5D69 A;  2QLG B;  1TNP A;  4L12 A;  2DUF A;  3DPX A;  3DQJ A;  1K93 D;  3MSE B;  3GK4 X;  1F8H A;  4PHN A;  5KSZ A;  3KF9 A;  2WSO A;  1B7T Y;  1KK7 Y;  2BE4 A;  4GNK B;  1Q4A A;  1ODB A;  3DQD A;  1CDP A;  3DF0 B;  3PIB A;  4EUL A;  4W7R A;  5EXB A;  2JAD A;  3JTD B;  2FL1 A;  2SAS A;  2BE6 A;  5LTQ A;  1S6Z A;  1EG3 A;  3DQ4 A;  1YX8 A;  3DQH A;  5HZT A;  5DKN A;  2VAE A;  3A8R A;  1ALW A;  3O78 A;  4BY4 A;  2HJO A;  1HUY A;  5HZU A;  5CSI A;  3HX4 A;  1JBA A;  1EXR A;  1Q4D A;  3DVK A;  5JJG A;  3SIA A;  4XL5 A;  1F71 A;  2ZO7 A;  1H8B A;  1KFX S;  3ZTF A;  2KAV A;  4P2Y B;  1XFV O;  3EVP A;  2LHL A;  2WIQ A;  1TCF A;  3W1D A;  3ZNI A;  2V4E C;  3NXA A;  1JC0 A;  3W1C A;  4U2V A;  3I5F C;  3CR4 X;  3BX9 A;  3A8S A;  1MXE A;  4OR9 B;  5EBJ A;  2VVH A;  1B47 A;  4WQ2 A;  4KEX A;  1F54 A;  3P8U A;  1A4P A;  3EK4 A;  1QAS A;  1Z1Q A;  4Q7R A;  4XJK A;  2DUG A;  1JUO A;  4HRG A;  5HZO A;  1RTP 1;  2EMN A;  3O4Y A;  2EMD A;  2JRF A;  1PVB A;  2NXQ A;  3H1R A;  1OSA A;  3ZWH A;  1OXD A;  1EMK A;  3TMR A;  4YGA A;  1WRK A;  1LA3 A;  4MN0 A;  4AQJ A;  2KQY A;  5EB6 A;  4ORN A;  4L1I A;  4PPJ A;  2FOT A;  3AKA A;  2CTN A;  3NEZ A;  3ED8 A;  1QLK A;  3CFA A;  4FTG A;  1MUX A;  4W72 A;  2AWL A;  2GW3 A;  5I2L A;  4W6K A;  3KCS A;  4KW4 A;  2LVK A;  5DTL A;  3JVT C;  3VRR A;  1AJ4 A;  5HZS A;  3WXA A;  5ER4 X;  2K61 A;  5FVF A;  5DPG A;  4IK9 A;  5DTY A;  5KTG A;  4W6J A;  1QJT A;  4W6M A;  5AXI A;  3TS5 C;  1MQ1 A;  1CDL A;  2OS8 C;  3GB3 A;  1DF0 A;  3ICB A;  3K1K A;  1RRO A;  2QT2 A;  2LLU A;  1SBJ A;  1VRK A;  3O6B A;  3BOW A;  1IRJ A;  2KYF A;  3ZUJ A;  1AJ5 A;  1PSR A;  2KI6 C;  3TDI A;  1KK8 C;  5HLO A;  3DQ2 A;  1A75 B;  2LLS A;  1NCZ A;  2F3Z A;  2AWJ A;  3U8P A;  1C4F A;  4KA9 A;  5EXC I;  4KW8 A;  3IQQ A;  2PSR A;  2D8N A;  2EC6 B;  2BBM A;  1IQ3 A;  5DQB A;  1Y1U A;  4GGF C;  4W7D A;  5I8N A;  2LUX A;  3D0Y A;  4MEW A;  4W69 A;  2FCD A;  2F2P A;  4ANJ A;  4OQW A;  2DUH A;  2KSP A;  1W7J B;  3LS3 A;  4C0J A;  2DUE A;  1XSS A;  1EJ3 A;  3WNX B;  1DJZ A;  1Q73 A;  5HKW A;  2F2O A;  3NED A;  1J1D A;  2B1U A;  1J7O A;  4IL1 A;  1MR8 A;  1XA9 A;  2LLT A;  1BJF A;  1V1G A;  4H3L A;  4A4C A;  3BUX B;  2K2A A;  2WC8 A;  3PN7 C;  4KF4 A;  2K0J A;  3TUY C;  2LM5 A;  1J7R A;  2FWQ A;  5DKR A;  1RJV A;  4MZJ A;  4ZBL A;  5CSN A;  1QYF A;  4PFE A;  2KI4 C;  3GJ2 A;  4J88 A;  1A29 A;  3BOW B;  3PAT A;  4PHJ A;  4Z4M A;  1M45 A;  1UIS A;  1OMV A;  3CR5 X;  2JTT A;  1YRT B;  4I5J A;  1QY3 A;  3QRX A;  1H4B A;  1CDN A;  3BUW B;  4W74 A;  5IBW A;  2GW4 B;  4KGF A;  1YUT A;  3LA1 A;  4H3M A;  1F4O A;  4DRW A;  3DQM A;  3CLN A;  4JRB A;  2HET A;  2YE0 A;  3AI5 A;  4NDD A;  2R2I A;  4I5L B;  2HGY A;  1NYA A;  4YI9 A;  2LMT A;  2Z6Y A;  3D0Y B;  4Q9W A;  4PE7 A;  1F0B A;  2ZND A;  2O60 A;  3PJ5 A;  2HGD A;  1TNQ A;  3DQE A;  1XFX O;  3CGA A;  1MOV A;  3K21 A;  2KBM A;  2JZI A;  1XVJ A;  3DVJ A;  3SSV A;  3LVA A;  1OMR A;  1K8U A;  1KYP A;  4W7E A;  1EG4 A;  1MXL C;  1DJX A;  2M49 B;  4KPI A;  2FJU B;  4J89 A;  4MRY A;  1TCO B;  3SVN A;  1LXF C;  3CZT X;  2K8M B;  3PJB A;  2BBN A;  4MSP A;  4W6N A;  3RWA A;  1DJH A;  4N3D A;  4DXQ A;  2M1U A;  4RYW A;  2VAD A;  4F0Z B;  3IQO A;  4ORA B;  2G5Z B;  1XO5 A;  4UTS A;  3P28 A;  2L4I A;  3BQ3 A;  2JXL A;  2H61 C;  2A50 B;  4OCI A;  5BPJ A;  3FS7 A;  2MRD A;  3NSK A;  3ST0 A;  3WHU B;  4ICB A;  3M22 A;  2JQ6 A;  2L50 A;  3CD9 A;  1Q80 A;  2LE9 B;  4IZN A;  4DKM A;  2DUI A;  1Q4C A;  2HQ8 A;  2WND A;  2POX A;  1C07 A;  2B3P A;  4IK4 A;  1X02 A;  4L13 A;  1RRX A;  3EKJ A;  5EXU A;  1AVS A;  1EMC A;  4KF5 C;  3RLZ A;  2KFF A;  2Y0G A;  2H5R A;  2KOT A;  3VHT A;  2L2E A;  5DRF A;  1NPQ A;  4PHM A;  3OHM B;  1MOU A;  3I5G B;  2ICR A;  3GK1 A;  2K7C A;  2HQW A;  1S1E A;  3KCT A;  4MBE A;  2KFH A;  4ZF3 A;  2OTG B;  2M7N A;  5HW9 A;  4QJ5 B;  1KSO A;  1CMG A;  5EHU A;  4PPL A;  1SCV A;  3G9A A;  1S6C A;  1KYS A;  5DY6 A;  3OB2 B;  3DQ1 A;  2G3D B;  4N1G A;  1ZAC A;  5H87 A;  2ZMU A;  3CR2 A;  2CCM A;  2NZ0 A;  2I2R E;  1FPW A;  1BOC A;  4U8D A;  3M0W A;  1B8C A;  2Q57 A;  2Z1O A;  5I2O A;  2JT8 A;  4LJD C;  4D1E A;  4XGY A;  1JBZ A;  1XA5 A;  1CKK A;  3BXA A;  2G6Y A;  4DXI A;  1CFD A;  4AQI A;  3SV5 A;  3AI4 A;  4GOB A;  1DGV A;  2A53 B;  1OXF A;  2M7L A;  1FF1 A;  4Q9X A;  2O5G A;  3ZUL A;  1S5G Z;  1QAT A;  4L9M A;  5DKQ A;  2KBI A;  2LUC A;  2P4M A;  2GV5 A;  1K2H A;  2JUL A;  2M97 A;  1J1E A;  3I5G C;  2F33 A;  5HYD A;  3V3D A;  3U0M A;  1K9K A;  2ARL A;  2M9G A;  4MLW A;  4GGF A;  3PSR A;  3IF7 A;  1KQM C;  3SVR A;  2LMU A;  1B9C A;  4JF9 A;  2DD7 A;  2PXS A;  2BTJ A;  4CLN A;  1FI5 A;  3GK2 A;  3DQU A;  1K96 A;  1XFU O;  4FQO A;  1OZO A;  4GBA A;  4H48 A;  2A52 B;  3VRO A;  2KGB C;  1ZFS A;  3HCM A;  5CPV A;  2A56 B;  1BLQ A;  4ETO A;  2ZRT A;  1PVA A;  4A4B A;  4GPL B;  1YRU B;  4CFQ A;  1WY9 A;  3DQA A;  5TNC A;  4I5K A;  2G6X A;  3DPW A;  1EMF A;  1JFK A;  1CMF A;  1KWO C;  2G2B A;  1S6J A;  4JPZ B;  1W7I B;  4GFT A;  5BTT A;  1XFY O;  4W6C A;  4EMQ A;  1EMB A;  3ST2 A;  3M24 A;  4ZF4 A;  1QXP A;  3OSR A;  1CM4 A;  4KGE A;  4W6B A;  4JEO A;  3I5I B;  1UUR A;  1EML A;  1YUU A;  1S26 D;  5PAL A;  1QXT A;  4MRX A;  1OXE A;  1XQM A;  3JTD C;  3ZUF A;  1B9A A;  3CTN A;  4OV2 A;  3OX6 A;  1JFJ A;  1CLM A;  1RFJ A;  4JGE A;  2C9I A;  5AER A;  1IGV A;  2BKH B;  4XOV A;  2JC2 A;  3DQ3 A;  3SVU A;  4DIR A;  4W7C A;  3U0L A;  2L51 A;  4HQ9 A;  1XK4 C;  5DRG A;  2LC5 A;  1SRA A;  1N65 A;  1EMG A;  4W7F A;  1B1G A;  3S05 A;  1S3P A;  4CPV A;  2QPT A;  1PAL A;  5DTZ A;  4KAG A;  5DPH A;  3E3R A;  3CS1 A;  1Y6W A;  3PJ7 A;  1NUB A;  1F4Q A; 
#chains in the Genus database with same CATH topology
 3F45 A;  1SMG A;  1E8A A;  2QEH A;  5F6T A;  3DY9 A;  2BL0 B;  2ZO6 A;  1BU3 A;  3U0N A;  2QRF A;  1IJ6 A;  1QX7 A;  2BKI B;  5HLV A;  2BNX A;  2DDD A;  5DPJ A;  3EK8 A;  5FVG A;  3FE9 A;  2VZX A;  3SVO A;  1MHO A;  4W6P A;  2OKY A;  1NCX A;  4W6A A;  1H6R A;  2L0P A;  1QVI Z;  2NCO A;  4HSZ A;  3OB1 B;  1CV7 A;  4KW9 A;  3SJS A;  3KEV A;  2G3O A;  3PM2 A;  4XJK B;  2NCP A;  2I18 A;  3AKB A;  4GES B;  1KYR A;  1PRW A;  2H61 A;  2MBX A;  3PLF B;  4MZL A;  2KYC A;  1KFU S;  2KGR A;  2PXW A;  2AH8 A;  3SG4 A;  2JT3 A;  1K94 A;  1XYD A;  1M31 A;  3WCK A;  4B30 A;  5DTX A;  1YUS A;  2LCP A;  2DDC A;  2P70 A;  3QME A;  3CAB A;  2GGZ A;  2JPT A;  2KDH A;  3DQ9 A;  2JNF A;  1DVI A;  4FQT A;  3DQL A;  5FHV A;  1DMO A;  3SVC A;  2Q4U A;  4KF5 A;  1KP5 A;  3DQI A;  1HCJ A;  1QV1 A;  2LVI A;  1W7S A;  1J55 A;  4M2O A;  2PAL A;  3LF3 A;  1AP4 A;  4R6B A;  4AOM A;  3BUM B;  3IR8 A;  4MVF A;  4W6I A;  1IKU A;  2H5Q A;  1UHK A;  2H5O A;  1F55 A;  3OP0 A;  4C0K A;  4N1F A;  5KTY A;  1EH2 A;  2K7D A;  2KAX A;  1SCM B;  4HQC A;  1DF0 B;  3CGL A;  5H89 A;  1QX5 B;  2IS9 A;  2AWK A;  5H88 A;  4BY5 A;  1KFX L;  3RM1 A;  2ZRS A;  3PJI A;  3CD1 A;  2KHN A;  5FVI A;  3EG5 B;  3B86 A;  4MZK A;  2AAO A;  3U8C A;  3D78 A;  4J8A A;  5HKY A;  4HVF A;  2RGI A;  1ZMZ A;  2HFC A;  3SVS A;  4USL A;  3LCP C;  2EC6 C;  2PVB A;  1WDC B;  3B7A A;  1EL4 A;  1ZUZ A;  3BXK A;  2M3W A;  2DOQ A;  4F7F A;  1QS7 A;  1TNX A;  2HQK A;  3DQ8 A;  4OGS A;  4LJC A;  1CNP A;  3PM8 A;  4W73 A;  4YGC B;  3EVU A;  1W7T A;  1JC1 A;  1NCY A;  2LP3 A;  1SL9 A;  1JBY A;  3UG0 A;  4DUQ A;  2WCF A;  3RWT A;  1GGZ A;  3LL8 B;  1A2X A;  1SY9 A;  2A46 A;  4N5X A;  1HQV A;  2BCB A;  3BYA A;  1YUR A;  1PSB A;  1UHI A;  1U5I A;  3RZS A;  2O2B A;  2OTB A;  4PE1 A;  3GL4 A;  4W77 A;  1NX0 A;  3N7H A;  1SCM C;  1QVI Y;  2LV7 A;  3SS5 A;  1C7W A;  3VK1 A;  3I5H B;  1DGU A;  1Z2C B;  3SS3 A;  2OGR A;  2E30 A;  4UPG A;  2YFP A;  4W76 A;  5BT0 A;  4W6S A;  1QYQ A;  2A54 B;  1G8I A;  4ORB B;  1Y1X A;  4IK1 A;  4LW5 A;  2Z6Z A;  1BFP A;  2EHB A;  3E5V A;  1DC1 A;  2QAC A;  1K95 A;  5FYX A;  4ZIO A;  5D7F A;  1AHR A;  2V4E A;  4JFG A;  3S0D A;  3GOF A;  1OZS A;  1BMO A;  1ZGP A;  4QJ4 B;  3LVD A;  1Y1A A;  3OGO A;  2PAS A;  4IJ7 A;  5KU1 A;  1KFU L;  1L2O B;  1RMO A;  4EDS A;  1TUJ A;  5CSF A;  1QTX A;  1OE9 B;  1M46 A;  3EVR A;  1SW8 A;  3DQN A;  3CFF A;  2GGM A;  1B8R A;  1D1O A;  3LK1 A;  4CID A;  3E5W A;  3SSL A;  1G7K A;  2F3Y A;  2CT9 A;  2WC5 A;  5DU0 A;  4Q04 A;  1YZW A;  2O29 A;  1LIN A;  2AHA A;  2B3Q A;  3ST3 A;  4W6R A;  2JNX A;  4PE4 A;  4OKH A;  4W6F A;  1YFP A;  3WHT B;  3BUN B;  4HQ8 A;  1YR5 A;  2L98 A;  4ZCV A;  1U5I B;  2OTE A;  1DJG A;  3U0K A;  2GTE A;  5DQM A;  1DEK A;  2LMV A;  1LKJ A;  2DD9 A;  2HRS A;  1DJI A;  2IE2 A;  3NF0 A;  1SPY A;  1IG5 A;  1XK4 A;  3R1O A;  2FZU A;  2WCM A;  4RYS A;  1S36 A;  3BFB A;  1DJY A;  2JXC A;  1CFF A;  1B8L A;  3FWC A;  2WIS A;  1SKT A;  3LF4 B;  1BG1 A;  2L5X B;  1K90 D;  3DQC A;  1W7U A;  4E68 A;  3FIA A;  2ZN9 A;  4HE4 A;  2AUC A;  1JC2 A;  2WHU A;  2I7A A;  1MYW A;  3PFV A;  3UFZ A;  2M29 A;  2WOR A;  4DCK A;  2HF5 A;  3I5F B;  2JU0 A;  4ZF5 A;  3CZ2 A;  1CFP A;  1TWO A;  1F70 A;  4W6O A;  2ISD A;  3SG3 A;  1BR4 B;  1M39 A;  3SSH A;  4DKN A;  2YE1 A;  2KNE A;  3SS4 A;  3AAJ A;  4W6D A;  1SL8 A;  1HT9 A;  1ZUX A;  3VHT B;  1L7Z A;  2A48 A;  3VGO A;  3S0G A;  2KFG A;  2IB6 A;  4C0L A;  4WRI A;  5HGE A;  3SG6 A;  2LP2 A;  4W6G A;  2ZNE A;  2K2F A;  2WOS A;  2HPS A;  3SSY A;  3SG7 A;  5AEQ A;  2OTG C;  3WLD A;  1JSA A;  2LAN A;  4I2Y A;  1W9Z A;  1DQE A;  4PHK A;  1BT6 A;  2KLE A;  1R2U A;  1YHI A;  2E6W A;  2BCA A;  2K7O A;  1YVH A;  2JOJ A;  4IK3 A;  1F09 A;  2EGD A;  3SRY A;  4LJB A;  4IK5 A;  1IWQ A;  3BFA A;  3JVT B;  2BEC A;  4H3N A;  4TZA A;  1XFW O;  1WLM A;  3PAL A;  5AQB B;  4PCW A;  1Q4E A;  1ZOT B;  1N0Y A;  2ZKM X;  3TS5 B;  3WLC A;  2OS8 B;  3V2L A;  2PRU A;  1QIW A;  1EMA A;  3NT3 A;  3S0B A;  1CDM A;  2G9B A;  2QU1 A;  4YGD B;  3DQF A;  1UP5 A;  3KPX A;  1A75 A;  1YHH A;  1KK8 B;  1G33 A;  2WCB A;  4P1Q A;  5D3O A;  2Q91 A;  3DVE A;  5F9G A;  2Y1N A;  3BXC A;  1SYM A;  2HPW A;  1QLS A;  1NX2 A;  5EB7 A;  3NSL A;  5HKZ A;  1ZGQ A;  4DXM A;  5K89 A;  5EL2 A;  3DQO A;  3ADF A;  1C3Z A;  1LS8 A;  2JTZ A;  2HQZ A;  1TIZ A;  5I2Q A;  1FW4 A;  3KO0 A;  3EKH A;  4GAO A;  2YGU A;  5B8I B;  2JWW A;  2VRG A;  2ZMW A;  3H4S E;  1MF8 B;  4YGB B;  1PUL A;  2I94 A;  2Q6P A;  1JWD A;  3SIB A;  3LVC A;  2RH7 A;  1EMM A;  2CBL A;  4OJ0 A;  2LAP A;  3R72 A;  1QIV A;  1Y0V H;  3KHE A;  1GL4 A;  3SVE A;  2AWM A;  3VIC A;  3ST4 A;  5EJU A;  1XMZ A;  1OQP A;  3S0F A;  4RTC A;  1H4U A;  3CBE A;  2KQ6 A;  3PN7 B;  1FBV A;  3TUY B;  1NX1 A;  2MA2 A;  4YI8 A;  2WHT A;  4P5O E;  4QJ3 B;  3DPZ A;  2KI6 D;  4INW A;  1YTZ C;  2KI4 B;  1UWO A;  1S5G Y;  3K1E A;  4B5Y A;  4P76 A;  4NWS A;  2COL B;  2LNK A;  5JOL A;  4W6T A;  5BTT B;  4HRE E;  1DJW A;  4XOW A;  3I5I C;  2KAY A;  3AKO A;  1ALV A;  2BCX A;  1YHG A;  2ZN8 A;  3OBV A;  5J2O A;  4NDB A;  2L2C A;  3I19 A;  2Y1M A;  2IB5 A;  3DQ5 A;  2K7B A;  2L4H A;  4Q7T A;  1A03 A;  1YX7 A;  1CFC A;  3OSQ A;  5ER5 A;  4GUK A;  1Q4B A;  2M1K B;  3FE6 A;  2QLH A;  1YJF A;  1TNW A;  2MAZ A;  1BOD A;  2H6V A;  1TN4 A;  3D76 A;  3B6X A;  1CB1 A;  2EMO A;  4KYN A;  1V1F A;  3EK7 A;  3A4U B;  1GGW A;  2VVJ A;  4OY4 A;  4M2P A;  4W7X A;  1OMD A;  1PK0 D;  1UHJ A;  4LQU A;  2ZFD A;  3BUO B;  1SNL A;  2BL0 C;  3NSO A;  3DQ7 A;  3GJ1 A;  4ZCU A;  1AUI B;  2P71 A;  3D77 A;  1QWV A;  1IQ5 A;  3FWB A;  1RMP A;  4OHS A;  1OOI X;  1TUZ A;  5HBD A;  2TN4 A;  3SG5 A;  3FE8 A;  2SCP A;  2IOV A;  4R6D A;  3TMT A;  2OJK A;  4Q7U A;  4W6H A;  4PPK A;  3IP2 A;  3SSP A;  5AFP A;  5J3X A;  1KCY A;  2G6E A;  2QDI A;  3EVV A;  4JD9 A;  3LLE A;  3OX5 A;  4DS7 A;  1KQV A;  5LK4 A;  4JC2 A;  3U8A A;  4IK8 A;  5DPI A;  1J7Q A;  4XYN A;  4NDC A;  4ZFS A;  3GEX A;  2PMY A;  3CWG A;  3H1O A;  3VRQ A;  1KSM A;  1S6I A;  1N2D A;  4PDZ A;  2LHI A;  3NSI A;  1B4C A;  2AMI A;  1BR1 B;  4LJD A;  1T14 A;  3TZ1 A;  4B30 B;  4AS8 A;  3TDZ A;  4EN1 A;  2C9J A;  1QX2 A;  1SL7 A;  1XAE A;  3DD4 A;  3O2P A;  1K9P A;  2G16 B;  2QEV A;  4ORC B;  1UHN A;  2LVJ A;  3NHI A;  5CSJ A;  4TZG A;  4NQG A;  1CLL A;  2Y5I A;  4GGN A;  4DXO A;  3SSK A;  3D73 A;  2Z6X A;  4AR7 A;  3SS0 A;  4H47 A;  2WCK A;  5FI7 A;  3Q8I A;  4WQ3 A;  3AAK A;  1R6P A;  1B7T Z;  1KK7 Z;  1XFZ O;  1REC A;  5G08 A;  2G2S B;  2F8P A;  1J7P A;  4Z4K A;  4W7A A;  2HCG A;  1C7V A;  1YVL A;  3E5T A;  3CB9 A;  4EDO A;  2WUR A;  3LSA A;  2Y4Q A;  2GX0 A;  2V53 A;  3NT9 A;  3CYZ A;  4OVN F;  3SVD A;  1P28 A;  1UHH A;  1DTL A;  1RWY A;  4W75 A;  3DQ6 A;  3VRN A;  2P6B B;  1RMM A;  1GJY A;  1NSH A;  1EME A;  4GF6 B;  1WDC C;  1FI6 A;  1IJ5 A;  2MJW B;  2MLE C;  2CXJ A;  2QLI A;  1C3Y A;  1WRL A;  4YBH B;  2WHS A;  2M0R A;  2A47 A;  4PAL A;  4M2Q A;  2H5P A;  5AAN A;  3LK0 A;  3UO9 A;  1GQM A;  3O4X A;  4CFR A;  1BF5 A;  1RK9 A;  2H9W A;  1UUS A;  2L5Y A;  3DVM A;  2MHH A;  1GGX A;  1SR6 B;  2QLG A;  1OOJ A;  2MLF C;  4XVP A;  1NWD A;  1RM9 A;  5T3I A;  4JWQ A;  1M63 B;  3TDU A;  1DT7 B;  1YJ2 A;  3CFH A;  3L4L A;  4DXN A;  2NLN A;  4R1E A;  2O24 A;  1TOP A;  3DF0 A;  2H2K A;  1SSE B;  4W6U A;  4W6L A;  1TTX A;  1JF2 A;  2QLE A;  2OKW A;  2WCE A;  3D10 A;  1NP8 A;  4I5N B;  2CNP A;  2VVI A;  1NIW A;  2A4J A;  4HRH A;  3I5H C;  3CZ0 A;  3MGF A;  3C1V A;  1KQM B;  1TRF A;  4ZB1 A;  2H8Q A;  4LQT A;  2FCE A;  1Z1P A;  4PE0 A;  3SST A;  4JKT A;  1JF0 A;  4JQ0 D;  4DXP A;  1MWN A;  1K9U A;  5BQL A;  1ZGO A;  2FJY A;  2GX2 A;  1LVC D;  2LVV A;  5GQQ C;  1AK8 A;  1QV0 A;  4YRU A;  5LTP A;  1WRZ A;  4YGE B;  1SK6 D;  2OPO A;  1CLB A;  1G4Y R;  2M8U A;  1NX3 A;  2V4E B;  3O77 A;  5LTR A;  4TNC A;  1CTR A;  1GFL A;  4ZIN A;  4BDU A;  2JT0 A;  1WLZ A;  3BXB A;  3SVB A;  2YDZ A;  1L2O C;  1IH0 A;  2WSN A;  1KWO B;  2QZ0 A;  3DQK A;  1SR6 C;  1LA0 A;  1CM1 A;  3SG2 A;  3VRP A;  1QYO A;  5D69 A;  3L47 A;  2QLG B;  1TNP A;  4L12 A;  2DUF A;  3DPX A;  3DQJ A;  1K93 D;  3MSE B;  3GK4 X;  1F8H A;  4PHN A;  5KSZ A;  2K60 A;  1DEL A;  3KF9 A;  2WSO A;  1B7T Y;  1KK7 Y;  2BE4 A;  4GNK B;  1Q4A A;  1ODB A;  3DQD A;  1CDP A;  3DF0 B;  3PIB A;  4EUL A;  4W7R A;  5EXB A;  2JAD A;  3JTD B;  2FL1 A;  2SAS A;  2BE6 A;  5LTQ A;  1S6Z A;  1EG3 A;  3DQ4 A;  1YX8 A;  3DQH A;  5HZT A;  5DKN A;  2VAE A;  3A8R A;  1ALW A;  3O78 A;  4BY4 A;  2HJO A;  2WCH A;  3NGV A;  1HUY A;  5HZU A;  2WCL A;  3CZ1 A;  5CSI A;  3HX4 A;  1JBA A;  1EXR A;  1Q4D A;  3DVK A;  5JJG A;  3SIA A;  4XL5 A;  2WC6 A;  1F71 A;  2ZO7 A;  1H8B A;  1KFX S;  3ZTF A;  2KAV A;  4P2Y B;  1XFV O;  3EVP A;  2LHL A;  2WIQ A;  1TCF A;  3W1D A;  3ZNI A;  2V4E C;  3NXA A;  1JC0 A;  3W1C A;  4U2V A;  3I5F C;  3CR4 X;  3BX9 A;  3A8S A;  1MXE A;  4OR9 B;  5EBJ A;  2VVH A;  1B47 A;  4WQ2 A;  4KEX A;  1F54 A;  3P8U A;  1A4P A;  3EK4 A;  1QAS A;  1Z1Q A;  4Q7R A;  4XJK A;  2DUG A;  1JUO A;  1OOF A;  4HRG A;  5HZO A;  1RTP 1;  2EMN A;  3O4Y A;  2EMD A;  2JRF A;  1PVB A;  2NXQ A;  3H1R A;  1OSA A;  3ZWH A;  1OXD A;  1EMK A;  3TMR A;  4YGA A;  1WRK A;  1LA3 A;  3OGN A;  4MN0 A;  4AQJ A;  3IVT A;  2KQY A;  5EB6 A;  4ORN A;  4L1I A;  5FI2 A;  2FOT A;  3AKA A;  4PPJ A;  2CTN A;  3ED8 A;  1QLK A;  3CFA A;  3NEZ A;  4FTG A;  1MUX A;  4W72 A;  2AWL A;  2GW3 A;  5I2L A;  4W6K A;  3KCS A;  4KW4 A;  2LVK A;  5DTL A;  3JVT C;  3DYE A;  3VRR A;  1AJ4 A;  5HZS A;  3WXA A;  5ER4 X;  2K61 A;  5FVF A;  5DPG A;  4IK9 A;  5DTY A;  5KTG A;  4W6J A;  1QJT A;  4W6M A;  5AXI A;  3TS5 C;  1MQ1 A;  1CDL A;  2OS8 C;  3GB3 A;  1DF0 A;  3ICB A;  3K1K A;  1RRO A;  2QT2 A;  2LLU A;  1SBJ A;  1VRK A;  3O6B A;  3BOW A;  1IRJ A;  2KYF A;  3ZUJ A;  3BFH A;  1AJ5 A;  1PSR A;  2KI6 C;  3TDI A;  1KK8 C;  5HLO A;  3DQ2 A;  1A75 B;  2LLS A;  1NCZ A;  2F3Z A;  2AWJ A;  3U8P A;  1C4F A;  2JPO A;  4KA9 A;  5EXC I;  4KW8 A;  3IQQ A;  2PSR A;  4INX A;  2D8N A;  2EC6 B;  2BBM A;  5FI6 A;  1IQ3 A;  5DQB A;  1Y1U A;  4GGF C;  4W7D A;  5I8N A;  2LUX A;  3D0Y A;  4MEW A;  4W69 A;  2FCD A;  2F2P A;  4ANJ A;  4OQW A;  2DUH A;  2KSP A;  1W7J B;  3LS3 A;  4C0J A;  2DUE A;  1XSS A;  3DXL A;  1EJ3 A;  3WNX B;  1DJZ A;  1Q73 A;  5HKW A;  2F2O A;  3NED A;  1IIO A;  1J1D A;  2B1U A;  1J7O A;  4IL1 A;  1MR8 A;  1XA9 A;  2LLT A;  1BJF A;  1V1G A;  4H3L A;  4A4C A;  3BUX B;  2K2A A;  2WC8 A;  3PN7 C;  4KF4 A;  2K0J A;  3TUY C;  2LM5 A;  1J7R A;  2FWQ A;  5DKR A;  1RJV A;  4MZJ A;  4ZBL A;  5CSN A;  1QYF A;  4PFE A;  2KI4 C;  3GJ2 A;  4J88 A;  1A29 A;  3BOW B;  3PAT A;  4PHJ A;  4Z4M A;  1M45 A;  1UIS A;  1OMV A;  3CR5 X;  2JTT A;  1GM0 A;  5HL1 A;  1YRT B;  4I5J A;  1QY3 A;  3QRX A;  1H4B A;  1CDN A;  3BUW B;  4W74 A;  5IBW A;  2GW4 B;  3UNW A;  4KGF A;  1YUT A;  3LA1 A;  4H3M A;  1F4O A;  4DRW A;  3DQM A;  3CLN A;  3DZT A;  4JRB A;  2HET A;  2YE0 A;  3AI5 A;  2KLD A;  4NDD A;  2R2I A;  4I5L B;  2BAP A;  2HGY A;  1NYA A;  4YI9 A;  2LMT A;  2Z6Y A;  3D0Y B;  4Q9W A;  4PE7 A;  1F0B A;  2ZND A;  2O60 A;  3PJ5 A;  2HGD A;  1TNQ A;  3DQE A;  1XFX O;  3CGA A;  1MOV A;  3K21 A;  2KBM A;  2JZI A;  1XVJ A;  3DVJ A;  3SSV A;  2WCJ A;  3LVA A;  1OMR A;  1K8U A;  1KYP A;  4W7E A;  1EG4 A;  1MXL C;  1DJX A;  2M49 B;  4KPI A;  2FJU B;  4J89 A;  4MRY A;  1TCO B;  3SVN A;  1LXF C;  3CZT X;  2K8M B;  3NHT A;  3PJB A;  2BBN A;  4MSP A;  4W6N A;  1OW4 A;  3B87 A;  3RWA A;  1DJH A;  4N3D A;  4DXQ A;  2M1U A;  4RYW A;  2VAD A;  4F0Z B;  3IQO A;  4ORA B;  2G5Z B;  1XO5 A;  4UTS A;  3P28 A;  2L4I A;  3BQ3 A;  2JXL A;  2H61 C;  2A50 B;  4OCI A;  5BPJ A;  3FS7 A;  2MRD A;  3NSK A;  3ST0 A;  3WHU B;  3L4A A;  4ICB A;  3BJH A;  3M22 A;  2JQ6 A;  2L50 A;  3CD9 A;  1Q80 A;  2LE9 B;  4IZN A;  4DKM A;  2DUI A;  1Q4C A;  2HQ8 A;  2WND A;  2POX A;  1C07 A;  2B3P A;  4IK4 A;  1X02 A;  4L13 A;  1RRX A;  3EKJ A;  5EXU A;  1AVS A;  1EMC A;  4KF5 C;  3CDN A;  3RLZ A;  2KFF A;  2Y0G A;  2H5R A;  2KOT A;  3VHT A;  2L2E A;  5DRF A;  1NPQ A;  4PHM A;  3OHM B;  1MOU A;  3I5G B;  2ICR A;  3S0A A;  3R1P A;  3GK1 A;  2K7C A;  2HQW A;  1S1E A;  3KCT A;  2PQL A;  4MBE A;  2KFH A;  4ZF3 A;  5I94 A;  2OTG B;  2M7N A;  5HW9 A;  4QJ5 B;  1KSO A;  2PYQ A;  1CMG A;  5EHU A;  4PPL A;  1SCV A;  3G9A A;  1S6C A;  1KYS A;  2ERB A;  5DY6 A;  3OB2 B;  3DQ1 A;  2G3D B;  4N1G A;  1ZAC A;  2H8V A;  5H87 A;  2ZMU A;  3CR2 A;  2KPH A;  2CCM A;  2NZ0 A;  4PT1 A;  2I2R E;  1FPW A;  1BOC A;  4U8D A;  3M0W A;  1B8C A;  2Q57 A;  2Z1O A;  4OZD A;  5I2O A;  2JT8 A;  4LJD C;  4D1E A;  4XGY A;  3D74 A;  1JBZ A;  1XA5 A;  1CKK A;  3BXA A;  2G6Y A;  4DXI A;  1CFD A;  4AQI A;  3SV5 A;  3AI4 A;  4GOB A;  1DGV A;  2A53 B;  1OXF A;  2M7L A;  1FF1 A;  4Q9X A;  2O5G A;  3ZUL A;  1S5G Z;  1QAT A;  4L9M A;  5DKQ A;  2KBI A;  2LUC A;  2P4M A;  2GV5 A;  1K2H A;  2JUL A;  2M97 A;  1J1E A;  3I5G C;  2F33 A;  5HYD A;  3V3D A;  3U0M A;  1K9K A;  2ARL A;  2M9G A;  4MLW A;  4GGF A;  3PSR A;  3IF7 A;  1KQM C;  3SVR A;  2LMU A;  1B9C A;  1Z4H A;  4JF9 A;  2DD7 A;  2PXS A;  2BTJ A;  4CLN A;  3R1V A;  1FI5 A;  3GK2 A;  3DQU A;  1K96 A;  1XFU O;  3B88 A;  4FQO A;  1OZO A;  4GBA A;  4H48 A;  2A52 B;  3VRO A;  2KGB C;  1ZFS A;  3HCM A;  5CPV A;  2A56 B;  2QEB A;  1XFR A;  1BLQ A;  4ETO A;  2ZRT A;  1PVA A;  3VB1 A;  4A4B A;  4GPL B;  1YRU B;  4CFQ A;  1WY9 A;  3DQA A;  5TNC A;  4I5K A;  2G6X A;  3DPW A;  1EMF A;  1JFK A;  1CMF A;  3S0E A;  1KWO C;  2G2B A;  1S6J A;  1OOG A;  4JPZ B;  1W7I B;  4GFT A;  5BTT A;  1XFY O;  4W6C A;  4EMQ A;  1EMB A;  3ST2 A;  3M24 A;  4ZF4 A;  1QXP A;  3OSR A;  1CM4 A;  4KGE A;  4W6B A;  4JEO A;  3I5I B;  1UUR A;  1EML A;  1YUU A;  1S26 D;  5PAL A;  1QXT A;  4MRX A;  1OXE A;  1XQM A;  3JTD C;  1OOH A;  3ZUF A;  1B9A A;  3CTN A;  4OV2 A;  3OX6 A;  1JFJ A;  1CLM A;  1RFJ A;  4JGE A;  2C9I A;  5AER A;  1IGV A;  2BKH B;  4XOV A;  2JC2 A;  3DQ3 A;  3SVU A;  4DIR A;  4W7C A;  3U0L A;  2L51 A;  4HQ9 A;  1XK4 C;  5DRG A;  2QEO A;  2LC5 A;  1SRA A;  1N65 A;  5DIC A;  1EMG A;  1ORG A;  4W7F A;  1B1G A;  3S05 A;  1S3P A;  4CPV A;  2QPT A;  1PAL A;  5DTZ A;  4KAG A;  5DPH A;  3E3R A;  3CS1 A;  3D75 A;  1Y6W A;  3PJ7 A;  1NUB A;  1F4Q A; 
#chains in the Genus database with same CATH homology
 3F45 A;  1SMG A;  1E8A A;  5F6T A;  2BL0 B;  2ZO6 A;  1BU3 A;  3U0N A;  2QRF A;  1IJ6 A;  1QX7 A;  2BKI B;  5HLV A;  2DDD A;  5DPJ A;  3EK8 A;  5FVG A;  2VZX A;  3SVO A;  1MHO A;  4W6P A;  2OKY A;  1NCX A;  4W6A A;  1H6R A;  2L0P A;  1QVI Z;  2NCO A;  4HSZ A;  3OB1 B;  1CV7 A;  4KW9 A;  3SJS A;  3KEV A;  2G3O A;  4XJK B;  2NCP A;  2I18 A;  3AKB A;  4GES B;  1KYR A;  1PRW A;  2H61 A;  2MBX A;  3PLF B;  4MZL A;  2KYC A;  1KFU S;  2KGR A;  2PXW A;  2AH8 A;  3SG4 A;  2JT3 A;  1K94 A;  1XYD A;  1M31 A;  3WCK A;  4B30 A;  5DTX A;  1YUS A;  2LCP A;  2DDC A;  2GGZ A;  2JPT A;  2KDH A;  3DQ9 A;  2JNF A;  1DVI A;  3DQL A;  5FHV A;  1DMO A;  3SVC A;  2Q4U A;  4KF5 A;  1KP5 A;  3DQI A;  1HCJ A;  1QV1 A;  2LVI A;  1W7S A;  1J55 A;  4M2O A;  2PAL A;  3LF3 A;  1AP4 A;  4R6B A;  4AOM A;  3BUM B;  3IR8 A;  4MVF A;  4W6I A;  1IKU A;  2H5Q A;  1UHK A;  2H5O A;  1F55 A;  3OP0 A;  4C0K A;  4N1F A;  5KTY A;  1EH2 A;  2K7D A;  2KAX A;  1SCM B;  4HQC A;  1DF0 B;  3CGL A;  5H89 A;  1QX5 B;  2IS9 A;  2AWK A;  5H88 A;  4BY5 A;  1KFX L;  3RM1 A;  2ZRS A;  3CD1 A;  2KHN A;  5FVI A;  4MZK A;  2AAO A;  3U8C A;  4J8A A;  5HKY A;  4HVF A;  2RGI A;  1ZMZ A;  2HFC A;  3SVS A;  4USL A;  3LCP C;  2EC6 C;  2PVB A;  1WDC B;  1EL4 A;  1ZUZ A;  3BXK A;  2M3W A;  2DOQ A;  1QS7 A;  1TNX A;  2HQK A;  3DQ8 A;  4OGS A;  4LJC A;  1CNP A;  3PM8 A;  4W73 A;  4YGC B;  3EVU A;  1W7T A;  1JC1 A;  1NCY A;  2LP3 A;  1SL9 A;  1JBY A;  3UG0 A;  4DUQ A;  2WCF A;  3RWT A;  1GGZ A;  3LL8 B;  1A2X A;  1SY9 A;  2A46 A;  4N5X A;  1HQV A;  2BCB A;  3BYA A;  1YUR A;  1PSB A;  1UHI A;  1U5I A;  2O2B A;  2OTB A;  4PE1 A;  3GL4 A;  4W77 A;  1NX0 A;  1SCM C;  1QVI Y;  2LV7 A;  1C7W A;  3VK1 A;  3I5H B;  1DGU A;  2OGR A;  2E30 A;  4UPG A;  2YFP A;  4W76 A;  5BT0 A;  4W6S A;  1QYQ A;  2A54 B;  1G8I A;  4ORB B;  1Y1X A;  4IK1 A;  4LW5 A;  2Z6Z A;  1BFP A;  2EHB A;  3E5V A;  2QAC A;  1K95 A;  5FYX A;  4ZIO A;  5D7F A;  1AHR A;  2V4E A;  4JFG A;  3GOF A;  1OZS A;  1BMO A;  1ZGP A;  4QJ4 B;  3LVD A;  1Y1A A;  3OGO A;  2PAS A;  5KU1 A;  1KFU L;  1L2O B;  1RMO A;  4EDS A;  5CSF A;  1QTX A;  1OE9 B;  1M46 A;  3EVR A;  1SW8 A;  3DQN A;  3CFF A;  2GGM A;  1B8R A;  1D1O A;  3LK1 A;  4CID A;  3E5W A;  3SSL A;  1G7K A;  2F3Y A;  2CT9 A;  5DU0 A;  4Q04 A;  1YZW A;  2O29 A;  1LIN A;  2AHA A;  2B3Q A;  3ST3 A;  4W6R A;  2JNX A;  4PE4 A;  4OKH A;  4W6F A;  1YFP A;  3WHT B;  3BUN B;  4HQ8 A;  1YR5 A;  2L98 A;  4ZCV A;  1U5I B;  2OTE A;  1DJG A;  3U0K A;  5DQM A;  2LMV A;  1LKJ A;  2DD9 A;  2HRS A;  1DJI A;  2IE2 A;  3NF0 A;  1SPY A;  1IG5 A;  1XK4 A;  2FZU A;  4RYS A;  1S36 A;  1DJY A;  2JXC A;  1CFF A;  1B8L A;  3FWC A;  2WIS A;  1SKT A;  3LF4 B;  1BG1 A;  2L5X B;  1K90 D;  3DQC A;  1W7U A;  4E68 A;  3FIA A;  2ZN9 A;  4HE4 A;  2AUC A;  1JC2 A;  2WHU A;  2I7A A;  1MYW A;  3PFV A;  3UFZ A;  2M29 A;  2WOR A;  4DCK A;  2HF5 A;  3I5F B;  2JU0 A;  4ZF5 A;  1CFP A;  1F70 A;  4W6O A;  2ISD A;  3SG3 A;  1BR4 B;  1M39 A;  3SSH A;  4DKN A;  2YE1 A;  2KNE A;  3AAJ A;  4W6D A;  1SL8 A;  1HT9 A;  1ZUX A;  3VHT B;  1L7Z A;  2A48 A;  3VGO A;  2KFG A;  2IB6 A;  4WRI A;  4C0L A;  5HGE A;  4W6G A;  3SG6 A;  2LP2 A;  2ZNE A;  2K2F A;  2WOS A;  2HPS A;  3SSY A;  3SG7 A;  5AEQ A;  2OTG C;  3WLD A;  1JSA A;  2LAN A;  4I2Y A;  4PHK A;  1BT6 A;  1R2U A;  1YHI A;  2E6W A;  2BCA A;  2K7O A;  1YVH A;  2JOJ A;  4IK3 A;  1F09 A;  2EGD A;  3SRY A;  4LJB A;  4IK5 A;  1IWQ A;  3JVT B;  2BEC A;  4H3N A;  4TZA A;  1XFW O;  1WLM A;  3PAL A;  5AQB B;  4PCW A;  1Q4E A;  1ZOT B;  1N0Y A;  2ZKM X;  3TS5 B;  3WLC A;  2OS8 B;  2PRU A;  1QIW A;  1EMA A;  3NT3 A;  1CDM A;  2G9B A;  2QU1 A;  4YGD B;  3DQF A;  1UP5 A;  3KPX A;  1A75 A;  1YHH A;  1KK8 B;  1G33 A;  2WCB A;  4P1Q A;  2Q91 A;  3DVE A;  5F9G A;  2Y1N A;  3BXC A;  1SYM A;  2HPW A;  1QLS A;  1NX2 A;  5EB7 A;  3NSL A;  5HKZ A;  1ZGQ A;  4DXM A;  5K89 A;  3DQO A;  3ADF A;  2JTZ A;  2HQZ A;  1TIZ A;  5I2Q A;  1FW4 A;  3KO0 A;  3EKH A;  4GAO A;  5B8I B;  2JWW A;  2VRG A;  2ZMW A;  3H4S E;  1MF8 B;  4YGB B;  1PUL A;  2I94 A;  2Q6P A;  3LVC A;  3SIB A;  1JWD A;  2RH7 A;  1EMM A;  2CBL A;  4OJ0 A;  2LAP A;  1QIV A;  1Y0V H;  3KHE A;  1GL4 A;  3SVE A;  2AWM A;  3VIC A;  3ST4 A;  5EJU A;  1XMZ A;  1OQP A;  4RTC A;  1H4U A;  3CBE A;  2KQ6 A;  3PN7 B;  1FBV A;  3TUY B;  1NX1 A;  2MA2 A;  4YI8 A;  2WHT A;  4P5O E;  4QJ3 B;  3DPZ A;  2KI6 D;  1YTZ C;  2KI4 B;  1UWO A;  1S5G Y;  4B5Y A;  4P76 A;  4NWS A;  2COL B;  2LNK A;  5JOL A;  4W6T A;  5BTT B;  4HRE E;  1DJW A;  4XOW A;  3I5I C;  2KAY A;  3AKO A;  1ALV A;  2BCX A;  1YHG A;  2ZN8 A;  5J2O A;  4NDB A;  3I19 A;  2Y1M A;  2IB5 A;  3DQ5 A;  2K7B A;  2L4H A;  4Q7T A;  1A03 A;  1YX7 A;  1CFC A;  3OSQ A;  5ER5 A;  4GUK A;  1Q4B A;  2M1K B;  2QLH A;  1YJF A;  1TNW A;  2MAZ A;  1BOD A;  2H6V A;  1TN4 A;  1CB1 A;  2EMO A;  1V1F A;  3EK7 A;  3A4U B;  1GGW A;  2VVJ A;  4OY4 A;  4M2P A;  4W7X A;  1OMD A;  1PK0 D;  1UHJ A;  4LQU A;  2ZFD A;  3BUO B;  1SNL A;  2BL0 C;  3NSO A;  3DQ7 A;  3GJ1 A;  4ZCU A;  1AUI B;  1IQ5 A;  3FWB A;  1RMP A;  4OHS A;  5HBD A;  2TN4 A;  3SG5 A;  2SCP A;  2IOV A;  4R6D A;  3TMT A;  4W6H A;  2OJK A;  4Q7U A;  4PPK A;  3IP2 A;  3SSP A;  5AFP A;  5J3X A;  1KCY A;  2G6E A;  3EVV A;  3LLE A;  3OX5 A;  4DS7 A;  1KQV A;  5LK4 A;  4JC2 A;  3U8A A;  4IK8 A;  5DPI A;  1J7Q A;  4XYN A;  4NDC A;  4ZFS A;  3GEX A;  2PMY A;  3CWG A;  3H1O A;  3VRQ A;  1KSM A;  1S6I A;  1N2D A;  4PDZ A;  2LHI A;  3NSI A;  1B4C A;  2AMI A;  1BR1 B;  4LJD A;  3TZ1 A;  4B30 B;  4AS8 A;  3TDZ A;  4EN1 A;  2C9J A;  1QX2 A;  1SL7 A;  1XAE A;  3DD4 A;  3O2P A;  1K9P A;  2G16 B;  4ORC B;  1UHN A;  2LVJ A;  5CSJ A;  4TZG A;  4NQG A;  1CLL A;  2Y5I A;  4GGN A;  4DXO A;  3SSK A;  2Z6X A;  4AR7 A;  3SS0 A;  4H47 A;  4WQ3 A;  3AAK A;  1R6P A;  1B7T Z;  1KK7 Z;  1XFZ O;  1REC A;  5G08 A;  2G2S B;  2F8P A;  1J7P A;  4Z4K A;  4W7A A;  2HCG A;  1C7V A;  1YVL A;  3E5T A;  3CB9 A;  4EDO A;  2WUR A;  3LSA A;  2Y4Q A;  2GX0 A;  2V53 A;  3NT9 A;  4OVN F;  3SVD A;  1UHH A;  1DTL A;  1RWY A;  4W75 A;  3DQ6 A;  3VRN A;  2P6B B;  1RMM A;  1GJY A;  1NSH A;  1EME A;  4GF6 B;  1WDC C;  1FI6 A;  1IJ5 A;  2MJW B;  2MLE C;  2CXJ A;  2QLI A;  1WRL A;  4YBH B;  2WHS A;  2M0R A;  2A47 A;  4PAL A;  4M2Q A;  2H5P A;  5AAN A;  3LK0 A;  1GQM A;  4CFR A;  1BF5 A;  1RK9 A;  2H9W A;  1UUS A;  3DVM A;  2MHH A;  1GGX A;  1SR6 B;  2QLG A;  1OOJ A;  2MLF C;  4XVP A;  1NWD A;  1RM9 A;  5T3I A;  4JWQ A;  1M63 B;  3TDU A;  1DT7 B;  1YJ2 A;  3CFH A;  4DXN A;  2NLN A;  4R1E A;  2O24 A;  1TOP A;  3DF0 A;  2H2K A;  4W6U A;  4W6L A;  1TTX A;  1JF2 A;  2QLE A;  2OKW A;  2WCE A;  3D10 A;  1NP8 A;  4I5N B;  2CNP A;  2VVI A;  1NIW A;  2A4J A;  4HRH A;  3I5H C;  3MGF A;  3C1V A;  1KQM B;  1TRF A;  4ZB1 A;  2H8Q A;  4LQT A;  2FCE A;  1Z1P A;  4PE0 A;  3SST A;  1JF0 A;  4JQ0 D;  4DXP A;  1MWN A;  1K9U A;  5BQL A;  1ZGO A;  2GX2 A;  1LVC D;  2LVV A;  5GQQ C;  1AK8 A;  1QV0 A;  4YRU A;  5LTP A;  1WRZ A;  4YGE B;  1SK6 D;  2OPO A;  1CLB A;  1G4Y R;  2M8U A;  1NX3 A;  2V4E B;  3O77 A;  5LTR A;  4TNC A;  1CTR A;  1GFL A;  4ZIN A;  4BDU A;  2JT0 A;  1WLZ A;  3BXB A;  3SVB A;  2YDZ A;  1L2O C;  1IH0 A;  2WSN A;  1KWO B;  2QZ0 A;  3DQK A;  1SR6 C;  1LA0 A;  1CM1 A;  3SG2 A;  3VRP A;  1QYO A;  5D69 A;  2QLG B;  1TNP A;  4L12 A;  2DUF A;  3DPX A;  3DQJ A;  1K93 D;  3MSE B;  3GK4 X;  1F8H A;  4PHN A;  5KSZ A;  3KF9 A;  2WSO A;  1B7T Y;  1KK7 Y;  2BE4 A;  4GNK B;  1Q4A A;  1ODB A;  3DQD A;  1CDP A;  3DF0 B;  3PIB A;  4EUL A;  4W7R A;  5EXB A;  2JAD A;  3JTD B;  2FL1 A;  2SAS A;  2BE6 A;  5LTQ A;  1S6Z A;  1EG3 A;  3DQ4 A;  1YX8 A;  3DQH A;  5HZT A;  5DKN A;  2VAE A;  3A8R A;  1ALW A;  3O78 A;  4BY4 A;  2HJO A;  1HUY A;  5HZU A;  5CSI A;  3HX4 A;  1JBA A;  1EXR A;  1Q4D A;  3DVK A;  5JJG A;  3SIA A;  4XL5 A;  1F71 A;  2ZO7 A;  1H8B A;  1KFX S;  3ZTF A;  2KAV A;  4P2Y B;  1XFV O;  3EVP A;  2LHL A;  2WIQ A;  1TCF A;  3W1D A;  3ZNI A;  2V4E C;  3NXA A;  1JC0 A;  3W1C A;  4U2V A;  3I5F C;  3CR4 X;  3BX9 A;  3A8S A;  1MXE A;  4OR9 B;  5EBJ A;  2VVH A;  1B47 A;  4WQ2 A;  4KEX A;  1F54 A;  3P8U A;  1A4P A;  3EK4 A;  1QAS A;  1Z1Q A;  4Q7R A;  4XJK A;  2DUG A;  1JUO A;  4HRG A;  5HZO A;  1RTP 1;  2EMN A;  3O4Y A;  2EMD A;  2JRF A;  1PVB A;  2NXQ A;  3H1R A;  1OSA A;  3ZWH A;  1OXD A;  1EMK A;  3TMR A;  4YGA A;  1WRK A;  1LA3 A;  4MN0 A;  4AQJ A;  2KQY A;  5EB6 A;  4ORN A;  4L1I A;  4PPJ A;  2FOT A;  3AKA A;  2CTN A;  3NEZ A;  3ED8 A;  1QLK A;  3CFA A;  4FTG A;  1MUX A;  4W72 A;  2AWL A;  2GW3 A;  5I2L A;  4W6K A;  3KCS A;  4KW4 A;  2LVK A;  5DTL A;  3JVT C;  3VRR A;  1AJ4 A;  5HZS A;  3WXA A;  5ER4 X;  2K61 A;  5FVF A;  5DPG A;  4IK9 A;  5DTY A;  5KTG A;  4W6J A;  1QJT A;  4W6M A;  5AXI A;  3TS5 C;  1MQ1 A;  1CDL A;  2OS8 C;  3GB3 A;  1DF0 A;  3ICB A;  3K1K A;  1RRO A;  2QT2 A;  2LLU A;  1SBJ A;  1VRK A;  3O6B A;  3BOW A;  1IRJ A;  2KYF A;  3ZUJ A;  1AJ5 A;  1PSR A;  2KI6 C;  3TDI A;  1KK8 C;  5HLO A;  3DQ2 A;  1A75 B;  2LLS A;  1NCZ A;  2F3Z A;  2AWJ A;  3U8P A;  1C4F A;  4KA9 A;  5EXC I;  4KW8 A;  3IQQ A;  2PSR A;  2D8N A;  2EC6 B;  2BBM A;  1IQ3 A;  5DQB A;  1Y1U A;  4GGF C;  4W7D A;  5I8N A;  2LUX A;  3D0Y A;  4MEW A;  4W69 A;  2FCD A;  2F2P A;  4ANJ A;  4OQW A;  2DUH A;  2KSP A;  1W7J B;  3LS3 A;  4C0J A;  2DUE A;  1XSS A;  1EJ3 A;  3WNX B;  1DJZ A;  1Q73 A;  5HKW A;  2F2O A;  3NED A;  1J1D A;  2B1U A;  1J7O A;  4IL1 A;  1MR8 A;  1XA9 A;  2LLT A;  1BJF A;  1V1G A;  4H3L A;  4A4C A;  3BUX B;  2K2A A;  2WC8 A;  3PN7 C;  4KF4 A;  2K0J A;  3TUY C;  2LM5 A;  1J7R A;  2FWQ A;  5DKR A;  1RJV A;  4MZJ A;  4ZBL A;  5CSN A;  1QYF A;  4PFE A;  2KI4 C;  3GJ2 A;  4J88 A;  1A29 A;  3BOW B;  3PAT A;  4PHJ A;  4Z4M A;  1M45 A;  1UIS A;  1OMV A;  3CR5 X;  2JTT A;  1YRT B;  4I5J A;  1QY3 A;  3QRX A;  1H4B A;  1CDN A;  3BUW B;  4W74 A;  5IBW A;  2GW4 B;  4KGF A;  1YUT A;  3LA1 A;  4H3M A;  1F4O A;  4DRW A;  3DQM A;  3CLN A;  4JRB A;  2HET A;  2YE0 A;  3AI5 A;  4NDD A;  2R2I A;  4I5L B;  2HGY A;  1NYA A;  4YI9 A;  2LMT A;  2Z6Y A;  3D0Y B;  4Q9W A;  4PE7 A;  1F0B A;  2ZND A;  2O60 A;  3PJ5 A;  2HGD A;  1TNQ A;  3DQE A;  1XFX O;  3CGA A;  1MOV A;  3K21 A;  2KBM A;  2JZI A;  1XVJ A;  3DVJ A;  3SSV A;  3LVA A;  1OMR A;  1K8U A;  1KYP A;  4W7E A;  1EG4 A;  1MXL C;  1DJX A;  2M49 B;  4KPI A;  2FJU B;  4J89 A;  4MRY A;  1TCO B;  3SVN A;  1LXF C;  3CZT X;  2K8M B;  3PJB A;  2BBN A;  4MSP A;  4W6N A;  3RWA A;  1DJH A;  4N3D A;  4DXQ A;  2M1U A;  4RYW A;  2VAD A;  4F0Z B;  3IQO A;  4ORA B;  2G5Z B;  1XO5 A;  4UTS A;  3P28 A;  2L4I A;  3BQ3 A;  2JXL A;  2H61 C;  2A50 B;  4OCI A;  5BPJ A;  3FS7 A;  2MRD A;  3NSK A;  3ST0 A;  3WHU B;  4ICB A;  3M22 A;  2JQ6 A;  2L50 A;  3CD9 A;  1Q80 A;  2LE9 B;  4IZN A;  4DKM A;  2DUI A;  1Q4C A;  2HQ8 A;  2WND A;  2POX A;  1C07 A;  2B3P A;  4IK4 A;  1X02 A;  4L13 A;  1RRX A;  3EKJ A;  5EXU A;  1AVS A;  1EMC A;  4KF5 C;  3RLZ A;  2KFF A;  2Y0G A;  2H5R A;  2KOT A;  3VHT A;  2L2E A;  5DRF A;  1NPQ A;  4PHM A;  3OHM B;  1MOU A;  3I5G B;  2ICR A;  3GK1 A;  2K7C A;  2HQW A;  1S1E A;  3KCT A;  4MBE A;  2KFH A;  4ZF3 A;  2OTG B;  2M7N A;  5HW9 A;  4QJ5 B;  1KSO A;  1CMG A;  5EHU A;  4PPL A;  1SCV A;  3G9A A;  1S6C A;  1KYS A;  5DY6 A;  3OB2 B;  3DQ1 A;  2G3D B;  4N1G A;  1ZAC A;  5H87 A;  2ZMU A;  3CR2 A;  2CCM A;  2NZ0 A;  2I2R E;  1FPW A;  1BOC A;  4U8D A;  3M0W A;  1B8C A;  2Q57 A;  2Z1O A;  5I2O A;  2JT8 A;  4LJD C;  4D1E A;  4XGY A;  1JBZ A;  1XA5 A;  1CKK A;  3BXA A;  2G6Y A;  4DXI A;  1CFD A;  4AQI A;  3SV5 A;  3AI4 A;  4GOB A;  1DGV A;  2A53 B;  1OXF A;  2M7L A;  1FF1 A;  4Q9X A;  2O5G A;  3ZUL A;  1S5G Z;  1QAT A;  4L9M A;  5DKQ A;  2KBI A;  2LUC A;  2P4M A;  2GV5 A;  1K2H A;  2JUL A;  2M97 A;  1J1E A;  3I5G C;  2F33 A;  5HYD A;  3V3D A;  3U0M A;  1K9K A;  2ARL A;  2M9G A;  4MLW A;  4GGF A;  3PSR A;  3IF7 A;  1KQM C;  3SVR A;  2LMU A;  1B9C A;  4JF9 A;  2DD7 A;  2PXS A;  2BTJ A;  4CLN A;  1FI5 A;  3GK2 A;  3DQU A;  1K96 A;  1XFU O;  4FQO A;  1OZO A;  4GBA A;  4H48 A;  2A52 B;  3VRO A;  2KGB C;  1ZFS A;  3HCM A;  5CPV A;  2A56 B;  1BLQ A;  4ETO A;  2ZRT A;  1PVA A;  4A4B A;  4GPL B;  1YRU B;  4CFQ A;  1WY9 A;  3DQA A;  5TNC A;  4I5K A;  2G6X A;  3DPW A;  1EMF A;  1JFK A;  1CMF A;  1KWO C;  2G2B A;  1S6J A;  4JPZ B;  1W7I B;  4GFT A;  5BTT A;  1XFY O;  4W6C A;  4EMQ A;  1EMB A;  3ST2 A;  3M24 A;  4ZF4 A;  1QXP A;  3OSR A;  1CM4 A;  4KGE A;  4W6B A;  4JEO A;  3I5I B;  1UUR A;  1EML A;  1YUU A;  1S26 D;  5PAL A;  1QXT A;  4MRX A;  1OXE A;  1XQM A;  3JTD C;  3ZUF A;  1B9A A;  3CTN A;  4OV2 A;  3OX6 A;  1JFJ A;  1CLM A;  1RFJ A;  4JGE A;  2C9I A;  5AER A;  1IGV A;  2BKH B;  4XOV A;  2JC2 A;  3DQ3 A;  3SVU A;  4DIR A;  4W7C A;  3U0L A;  2L51 A;  4HQ9 A;  1XK4 C;  5DRG A;  2LC5 A;  1SRA A;  1N65 A;  1EMG A;  4W7F A;  1B1G A;  3S05 A;  1S3P A;  4CPV A;  2QPT A;  1PAL A;  5DTZ A;  4KAG A;  5DPH A;  3E3R A;  3CS1 A;  1Y6W A;  3PJ7 A;  1NUB A;  1F4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...