3EK8A

Calcium-saturated gcamp2 t116v/g87r mutant monomer
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
408
structure length
393
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDRGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 129
structure length 393
sequence length 408
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek8A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek8A02
2JXLA 4J89A 2HGYA 2KSPA 3AKAA 2JQ6A 2HQZA 2WSNA 1Z1QA 5H87A 3W1CA 4AQIA 2HJOA 2LMVA 1SKTA 1JF0A 2LV7A 4XL5A 1PVAA 3PM8A 4PHKA 3TZ1A 4N1FA 3DVEA 2A52B 5DTYA 3ZWHA 2K7BA 1YFPA 1EXRA 3BUNB 2ZRSA 4CFQA 3I5FB 2KI6C 2O24A 3UFZA 2F2OA 4W7EA 3JTDC 5HZOA 4AS8A 2OTGB 2KI4C 1BR4B 2QLGB 2JADA 4JQ0D 4Z4MA 2Y4QA 1B8CA 1RRXA 4NDDA 3G9AA 2WORA 2ZMUA 3ZUFA 2LHIA 1U5IB 3E5WA 2LP3A 4DRWA 3NT3A 1C07A 1FF1A 2KBMA 1YVHA 2GGMA 2MHHA 2K7CA 5KTYA 1LXFC 1S26D 4ORAB 2OTBA 5H89A 3KF9A 4W7FA 2HPSA 3SG5A 5KTGA 2NLNA 3LK1A 4TNCA 3AAJA 1QIWA 2OTGC 1QTXA 5KSZA 3F45A 1NX3A 3BXBA 1BFPA 2ZO6A 1SY9A 1E8AA 5D69A 1IRJA 4R6BA 1SRAA 2WISA 2A47A 1Y1XA 3M22A 3OB1B 2KDHA 3K1KA 1TIZA 1K95A 1TCOB 4DCKA 1SR6B 2MAZA 4OJ0A 1JUOA 4GF6B 4PDZA 4ICBA 3DQIA 4GESB 1SCMC 2FJUB 2ISDA 2HCGA 1F8HA 1S5GZ 4W7DA 4JEOA 4JRBA 1EG4A 3SIAA 4W6HA 1YVLA 4GGNA 2DD7A 5DTXA 4GPLB 5EXCI 1CM4A 1NCYA 2L51A 2M7NA 2OTEA 4P1QA 2A46A 2WURA 4PHNA 1LINA 3DVJA 3NF0A 2SASA 1NPQA 3LA1A 2LVJA 5B8IB 3LVCA 1CDPA 1S36A 3EVPA 1BU3A 4H3MA 4ZFSA 3DF0A 4HE4A 2LLSA 1W7TA 3SG4A 5FVGA 2FWQA 3BYAA 2JT3A 4LW5A 2LUCA 2H5OA 2NCPA 5J2OA 4IK5A 4XYNA 1M39A 4YGCB 4H3LA 2P6BB 1QATA 3CR2A 4Q7UA 1ALVA 4I2YA 3JTDB 3CBEA 1Q4EA 2CT9A 3DQ9A 1A75B 3DQCA 3ZULA 3CB9A 1KQMB 1SCVA 4IK1A 5HKYA 5JJGA 3CLNA 1WRKA 5EB7A 1GFLA 3SSKA 2AWLA 1IG5A 1KK8C 3VGOA 2ZO7A 5AANA 1A4PA 1CMFA 1K8UA 2O60A 4OCIA 1CLLA 3C1VA 1LA3A 4W6NA 3M24A 3CGAA 1AUIB 3O2PA 1S3PA 1ZGPA 2FOTA 1V1GA 4ZBLA 1YRTB 3TDZA 4AQJA 4C0LA 4BDUA 2OPOA 4ZINA 1F4QA 1BT6A 2FL1A 1WRZA 4W7AA 2M8UA 2MRDA 2JNXA 4YBHB 2CBLA 2G6EA 1IH0A 2OGRA 3IQQA 1DJWA 3SS0A 4R6DA 3DQEA 1TNXA 4W6LA 1DJGA 1QLSA 2KFFA 1QV0A 2HQKA 5EBJA 4PE1A 2KAXA 4UPGA 2H6VA 3BXCA 3GEXA 3PLFB 1F54A 3AAKA 1ZUXA 1TNQA 1Q80A 2BL0B 1BMOA 1ZGQA 1ZOTB 3CTNA 1YJFA 1G7KA 3ST2A 4GGFC 4U2VA 2DUIA 1RECA 5BQLA 2QLEA 3I5HC 3OSRA 2Q57A 5DQBA 2LC5A 2CNPA 3GL4A 3TDUA 4LQUA 3DQMA 2Z1OA 2HF5A 5AQBB 3PJ7A 5HLVA 1XAEA 2F3ZA 4YRUA 1CLMA 4JPZB 5LTPA 4JFGA 1Y1AA 1PRWA 2OJKA 1YUTA 4YGEB 1PSRA 2WC8A 3MGFA 4KF5A 2QT2A 2CCMA 1HT9A 3H4SE 4HSZA 2BKHB 1KWOB 1OQPA 1KYSA 1L2OB 4W7XA 5HKWA 2JTTA 2LUXA 1A29A 5CSJA 5HGEA 2G2BA 4GBAA 3IR8A 1L2OC 1HCJA 1KFXL 4W6SA 1LVCD 1DJHA 4AOMA 3EK7A 3OSQA 5DQMA 1OZOA 1NCXA 2ARLA 4W6AA 1KQMC 1DMOA 3KHEA 2RGIA 1X02A 1DJIA 1BLQA 5DKQA 2JOJA 3BQ3A 2QLHA 4KA9A 4U8DA 3VICA 4CLNA 2H9WA 3I5HB 1YX8A 2HETA 2H5QA 2QLGA 2ZNEA 4EULA 2KBIA 2IOVA 2VZXA 4YGBB 1K94A 4IK4A 2KHNA 2AHAA 5BTTB 1XFYO 5DRFA 2QU1A 5DPGA 1UISA 2E30A 1QYOA 1XFXO 2Y1MA 2G9BA 5JOLA 1WRLA 3FWBA 3E5TA 4HVFA 1IQ3A 1EMFA 2MLFC 5DKRA 4W6RA 1DJYA 2F3YA 1WDCB 5DRGA 4W72A 2EGDA 1B4CA 3TS5B 1S6CA 3VHTA 4IK8A 4MSPA 2OS8B 3NSLA 5DU0A 3SG6A 2BCXA 1CKKA 2LNKA 4DXQA 4EDOA 4TZAA 4USLA 3M0WA 2H61A 3DQUA 2QACA 1SCMB 2G16B 2YDZA 2C9IA 4A4CA 4JC2A 4B30B 4BY4A 3GK4X 1XVJA 2BKIB 3SSHA 5ER4X 1AJ4A 5EB6A 1ZFSA 3HX4A 2EMDA 1GL4A 3SSYA 1JBZA 1S1EA 4PPLA 2LVIA 4W6BA 4HQ9A 3ZNIA 1XA5A 4XOWA 3GJ2A 4RTCA 3DQLA 5DPHA 4ORCB 2M0RA 4PE0A 3JVTC 1ZGOA 2RH7A 4MZJA 2MBXA 2NCOA 4JWQA 4DXIA 4MBEA 3SVCA 2ICRA 1G4YR 2IE2A 1JSAA 5AXIA 1KK8B 1J55A 1XFUO 2LVVA 4KF4A 1DT7B 3A8RA 3DQ2A 3A4UB 1EMLA 1NYAA 5DY6A 2L50A 3O4YA 4I5KA 4F0ZB 2M97A 2M9GA 4ANJA 1CMGA 4ZF4A 4P5OE 2EMOA 1TTXA 1NX2A 1QV1A 1B8RA 1H8BA 2QZ0A 5CSIA 1TNWA 1V1FA 4GUKA 1F55A 3VRPA 1S5GY 2WHUA 4L12A 2F8PA 3CZTX 1KYRA 2PALA 4M2OA 2EHBA 4KW4A 1TCFA 4HRGA 2YE1A 1KWOC 3S05A 1EMCA 1SBJA 2VRGA 2AWKA 1CDNA 2KQ6A 4BY5A 3TS5C 2M49B 3IF7A 1F70A 3P8UA 2DUHA 2JRFA 3BUMB 3AKBA 1K9PA 5CSFA 3FIAA 2BBMA 4ZF5A 4W6TA 3ZUJA 4OQWA 4W73A 2LVKA 3SV5A 1G33A 4UTSA 2K61A 4QJ4B 2PVBA 1XK4A 2ZN9A 4H47A 1LKJA 1HQVA 1SL9A 5KU1A 1W7UA 4KW8A 2OKYA 2COLB 2WCEA 2KI4B 1OOJA 2BE4A 1QS7A 1EMBA 4LJCA 2TN4A 3AI4A 1QY3A 3EVUA 5K89A 4GFTA 1NSHA 1ODBA 1LA0A 3WXAA 1CFFA 2AUCA 1N65A 1QASA 4KGFA 3I5IB 3VRRA 3DQJA 1NWDA 3VRQA 1CDMA 5EXBA 1Q4CA 1C7WA 2CTNA 5IBWA 3CWGA 4P76A 2L98A 2HRSA 1W7SA 3OHMB 1B7TZ 4R1EA 2EC6C 1Y1UA 1UP5A 5HZSA 1N2DA 3EVRA 3KO0A 4TZGA 3U0KA 4EMQA 4CPVA 4MZLA 3NSKA 4W6KA 3CGLA 3LL8B 2BCAA 1RFJA 1RJVA 4DS7A 5I2OA 4PPJA 1S6ZA 4EDSA 5AERA 3MSEB 1A03A 1UHKA 2KYCA 4IK3A 1KYPA 2LHLA 2JT0A 1Z1PA 1AK8A 1JFJA 3KCTA 3LK0A 4PPKA 1TOPA 3DQHA 4W6GA 5FHVA 2F2PA 1UHHA 1KCYA 3BXKA 1DF0B 1IKUA 2AH8A 1NUBA 3PSRA 3GOFA 3V3DA 3WNXB 2WHSA 4XOVA 1FPWA 1IGVA 4XGYA 1TRFA 3CFFA 1NP8A 1XQMA 1QXTA 2L4HA 4MLWA 2GX2A 2H8QA 3TMRA 2HQWA 4PHJA 1EMKA 2H61C 1YURA 1CFDA 4YGAA 1EJ3A 3DPXA 3OP0A 3DQ4A 4A4BA 2DUEA 1F4OA 3BUWB 1S6IA 1K96A 1K93D 1EMGA 4ORBB 1H6RA 2LANA 3I5FC 3CFAA 4E68A 2M3WA 3IP2A 4MN0A 1NIWA 4B5YA 1Q4BA 1F71A 2L0PA 2H2KA 1CB1A 3DQ3A 4PE4A 2VVIA 2EMNA 4WQ2A 3ADFA 4ZIOA 2D8NA 1YHGA 1CTRA 1MQ1A 2OKWA 1KFUL 5CSNA 1QYFA 2V53A 1YUUA 1EMAA 3RLZA 3CS1A 2KI6D 4MEWA 5EJUA 3OX5A 3NEDA 1OE9B 4RYWA 2WSOA 2M1KB 2Z6XA 1QJTA 4DUQA 3PJBA 4MRYA 4H3NA 2KAVA 3DQ5A 2NXQA 3O77A 1IJ5A 4YGDB 4W6FA 4DXMA 2FCEA 2M1UA 2L2EA 2L5XB 1B9AA 2V4EA 2PXSA 4Z4KA 2JNFA 3ED8A 2Z6YA 2IS9A 1YJ2A 3LF4B 4RYSA 3HCMA 2O29A 1UUSA 4W6DA 3SIBA 2A53B 3GJ1A 3SRYA 4IZNA 3U8PA 1BODA 5DPJA 3DQ8A 1SK6D 1Y0VH 3BOWA 2JULA 4IK9A 2OS8C 5EHUA 1GGZA 3DQKA 3DQ1A 1FI5A 3TDIA 4KAGA 2JZIA 5HZUA 1KQVA 1UURA 2BCBA 4MVFA 1QXPA 2JTZA 1DTLA 1XA9A 2KAYA 4PE7A 4Q7RA 2K7DA 2VVHA 4W7CA 2WOSA 4NDBA 4ZCVA 4C0JA 3WHTB 4OKHA 2DUFA 1GGWA 1J7PA 2HQ8A 5HLOA 3NXAA 1SPYA 1Q4AA 3TUYB 2HGDA 3OX6A 2LP2A 1W7JB 4XJKB 4Q04A 3AKOA 2MA2A 1KK7Z 1JC0A 1XFVO 1XO5A 1KFUS 4YI8A 3I5GC 2POXA 2Z6ZA 4DIRA 1IQ5A 1OMRA 4AR7A 1L7ZA 2DDCA 1CV7A 1QX2A 4J88A 4LQTA 3CR5X 4OR9B 4H48A 5FYXA 3U0LA 4OVNF 2O2BA 2KNEA 2EC6B 2AWJA 1OMVA 4OY4A 4LJBA 4JF9A 3SSTA 1RROA 3EK4A 3LVDA 4L9MA 4D1EA 1KSMA 2I94A 1AP4A 4KPIA 3SVOA 3P28A 3WLDA 4W6MA 2K2AA 3SVBA 1BF5A 1OXDA 4HRHA 2LM5A 3DVMA 4WQ3A 2V4EC 2Y0GA 2PMYA 4J8AA 4LJDC 1OXFA 2KFGA 1KK7Y 3WLCA 4DXOA 2C9JA 3SVEA 2FZUA 3LSAA 3LCPC 3D10A 2B3QA 4YI9A 4GNKB 1QVIZ 3SG7A 3U0MA 4ZF3A 3TMTA 1M46A 3LVAA 1JC2A 5HZTA 2P4MA 2JPTA 4NQGA 5I8NA 1KSOA 3NEZA 1CLBA 3PJ5A 2A48A 3U8AA 1ZACA 1RTP1 2WNDA 3SSVA 2WHTA 4FQOA 1H4UA 3EKHA 3ZTFA 4GOBA 4OV2A 1WY9A 1C4FA 4ZB1A 3D0YB 3FWCA 4N3DA 4PHMA 3PIBA 5I2QA 2YE0A 1R6PA 3ST0A 5G08A 5TNCA 2KGRA 3VROA 3ST4A 1OMDA 2JC2A 3RM1A 3EK8A 1QVIY 2H5RA 2GV5A 1GGXA 2K7OA 5DPIA 1K90D 1PK0D 1SYMA 4OHSA 1DJZA 2K0JA 3KEVA 1Y6WA 2KQYA 3AI5A 2DD9A 2KOTA 4W6IA 1XFZO 2G5ZB 2SCPA 2KFHA 2JXCA 2I2RE 2YFPA 3GK2A 1U5IA 4N1GA 1ZMZA 1B9CA 3ICBA 1JBAA 5FVIA 4MZKA 1F0BA 3SSPA 3DQ6A 2BECA 2GGZA 2BBNA 3DQOA 1PSBA 3I5IC 3WCKA 1K2HA 1J7OA 4LJDA 2ZFDA 1WLMA 5PALA 4CIDA 3O6BA 2VADA 1B1GA 1MYWA 2CXJA 3ST3A 4WRIA 1N0YA 1SNLA 3QRXA 5FVFA 2KGBC 1SMGA 1J7QA 1AHRA 1SL8A 1UHNA 1XSSA 1G8IA 5D7FA 4L1IA 3U8CA 2AMIA 1YX7A 2ZRTA 4IL1A 5HW9A 2A50B 4I5JA 4CFRA 1PULA 4NDCA 1S6JA 1B8LA 1MF8B 1QLKA 2PSRA 3I5GB 5T3IA 1OZSA 5DTZA 2BE6A 2LMUA 1VRKA 2PXWA 1K9UA 1J1EA 3DVKA 3EVVA 3CFHA 1YZWA 4W6UA 1SR6C 5HYDA 1D1OA 4EN1A 2I7AA 1SW8A 5LTRA 4ORNA 1RWYA 3BUOB 2G6YA 2NZ0A 4W74A 3PN7B 5AEQA 4W6JA 3DQDA 2VVJA 3TUYC 1F09A 4PCWA 1YTZC 3GK1A 1RM9A 4W69A 4B30A 1QX5B 2IB6A 4M2QA 5I2LA 2KYFA 3E3RA 3LS3A 1A2XA 1MWNA 1YRUB 1JWDA 1WDCC 4NWSA 1RK9A 4Q9XA 3DQFA 4I5NB 1BJFA 3PATA 2JU0A 2M7LA 2IB5A 1DF0A 1ALWA 5BT0A 1YR5A 1M31A 1FW4A 3KCSA 5LK4A 1H4BA 1IJ6A 4QJ3B 3BX9A 3CD9A 4MRXA 2H5PA 2GW3A 1XK4C 2AWMA 5F9GA 1EG3A 4W77A 4KEXA 3SVRA 4FTGA 5DTLA 3VRNA 1HUYA 4W6CA 4DXPA 2LE9B 3SVSA 2WIQA 3SG2A 3JVTB 1W7IB 4W75A 2QRFA 1XFWO 3A8SA 1MXLC 4OGSA 3RWTA 1JC1A 2PASA 3K21A 2PRUA 4C0KA 1QIVA 1PVBA 1YUSA 1CFCA 2WCFA 3DD4A 2A56B 1M45A 2VAEA 3NSOA 3UG0A 4W7RA 3WHUB 1Q4DA 4DXNA 4W6OA 3W1DA 2FCDA 3CR4X 2MLEC 3GB3A 3PFVA 2Q91A 4W6PA 2Y1NA 2I18A 3U0NA 1B7TY 5LTQA 2LLTA 3NT9A 1XYDA 1WLZA 4HQCA 3O78A 5CPVA 2BTJA 1DJXA 3BUXB 2G2SB 5ER5A 3E5VA 2G6XA 2AAOA 2G3DB 4XVPA 4HQ8A 3BOWB 2K8MB 3LF3A 3DQAA 1MUXA 4M2PA 2Q4UA 1OSAA 1OXEA 3D0YA 4I5LB 1QYQA 1BG1A 1MOUA 5J3XA 3RWAA 4KW9A 2BL0C 4JGEA 1RMPA 1DVIA 4HREE 4GGFA 1CM1A 5DKNA 2LMTA 2A4JA 2WCBA 2O5GA 1FBVA 1TN4A 1UHIA 3NSIA 1AVSA 1M63B 2LLUA 1A75A 1RMOA 1J1DA 2L4IA 3DPWA 4Q7TA 1PALA 1BOCA 5BPJA 3OB2B 2QPTA 1YHHA 1MHOA 2B1UA 2DUGA 1MR8A 5AFPA 1RMMA 1R2UA 1NX1A 1JFKA 3LLEA 3DF0B 4KF5C 1JF2A 4KGEA 4XJKA 1NX0A 4W76A 5HBDA 3EKJA 2QLIA 1GQMA 5GQQC 2A54B 3DPZA 1CFPA 3VHTB 1DGUA 2LAPA 3SVDA 5F6TA 1MXEA 2Y5IA 1XMZA 1NCZA 1J7RA 3BXAA 3VK1A 1YHIA 1JBYA 1KFXS 1AJ5A 3SVNA 2DOQA 4ZCUA 4P2YB 2M29A 1K9KA 2ZN8A 1EH2A 4N5XA 3SJSA 1BR1B 1CDLA 1GJYA 3KPXA 3DQ7A 1FI6A 2ZNDA 1EL4A 4PFEA 1UHJA 1Q73A 2B3PA 4QJ5B 5EXUA 2DDDA 1DGVA 2ZMWA 3I19A 2HPWA 1UWOA 2JWWA 2MJWB 3SG3A 3H1RA 1TNPA 2LCPA 2HFCA 1ZUZA 4PALA 2G3OA 1CNPA 3CD1A 4L13A 2JT8A 1C7VA 3SVUA 2V4EB 4Q9WA 4DKMA 1SL7A 3PALA 3H1OA 3OGOA 1EMMA 4GAOA 1IWQA 1QX7A 2GW4B 3PN7C 4ETOA 2R2IA 3FS7A 3DQNA 2F33A 2ZKMX 1KP5A 3SSLA 5BTTA 2E6WA 5H88A 3IQOA 1MOVA 2GX0A 5HKZA 4DKNA 2K2FA 2Q6PA 1EMEA 1B47A
chains in the Genus database with same CATH superfamily
2JXLA 4J89A 1DELA 2HGYA 2KSPA 3AKAA 2JQ6A 2L5YA 3PJIA 2HQZA 2WSNA 1Z1QA 5H87A 3W1CA 2WCJA 4AQIA 2HJOA 2LMVA 1SKTA 1JF0A 2LV7A 4XL5A 1PVAA 3PM8A 4PHKA 3TZ1A 4N1FA 3DVEA 2A52B 5DTYA 3ZWHA 2K7BA 3B86A 1YFPA 1EXRA 3BUNB 2ZRSA 4CFQA 3I5FB 3R72A 2KI6C 2O24A 3IVTA 3UFZA 2F2OA 4W7EA 3JTDC 5HZOA 4AS8A 2OTGB 2KI4C 1BR4B 2QLGB 2JADA 4JQ0D 4Z4MA 2Y4QA 1B8CA 1RRXA 4NDDA 3G9AA 2WORA 2ZMUA 3ZUFA 3N7HA 2LHIA 1U5IB 3E5WA 2LP3A 4DRWA 3NT3A 1C07A 1FF1A 2KBMA 1YVHA 2GGMA 2MHHA 2K7CA 5KTYA 1LXFC 1S26D 3FE9A 4ORAB 2OTBA 5H89A 3KF9A 4W7FA 2HPSA 3SG5A 5KTGA 3S0GA 2NLNA 3LK1A 4TNCA 3AAJA 1QIWA 3BFHA 3O4XA 4IJ7A 2OTGC 1QTXA 5KSZA 3F45A 1NX3A 3BXBA 1BFPA 2ZO6A 1SY9A 2P71A 1E8AA 5D69A 1IRJA 4R6BA 1SRAA 2WISA 2A47A 1Y1XA 3M22A 3OB1B 2KDHA 3K1KA 1TIZA 1K95A 1TCOB 4DCKA 1SR6B 2MAZA 4OJ0A 1JUOA 4GF6B 4PDZA 4ICBA 3DQIA 4GESB 1SCMC 2FJUB 2ISDA 2HCGA 1F8HA 1S5GZ 4W7DA 4JEOA 4JRBA 1EG4A 3SIAA 4W6HA 1YVLA 1IIOA 4GGNA 2DD7A 5DTXA 1C3YA 4GPLB 5EXCI 1CM4A 1NCYA 2L51A 2M7NA 2OTEA 4P1QA 2A46A 2WURA 4PHNA 1LINA 3DVJA 3NF0A 2SASA 1NPQA 3LA1A 2LVJA 5B8IB 3LVCA 1CDPA 1S36A 3EVPA 2QDIA 1BU3A 4H3MA 4ZFSA 3DF0A 4HE4A 2LLSA 1W7TA 3SG4A 5FVGA 2FWQA 3BYAA 2JT3A 4LW5A 2LUCA 2H5OA 2NCPA 5J2OA 4IK5A 4XYNA 1M39A 4YGCB 4H3LA 2P6BB 1QATA 3CR2A 4Q7UA 1ALVA 4I2YA 3JTDB 3CBEA 1Q4EA 2CT9A 3DQ9A 1A75B 3DQCA 3ZULA 3CB9A 1KQMB 3FE8A 1SCVA 4IK1A 5HKYA 5JJGA 3CLNA 1WRKA 5EB7A 1GFLA 3SSKA 2AWLA 1IG5A 1KK8C 3VGOA 2ZO7A 5AANA 1A4PA 1CMFA 1K8UA 2O60A 4OCIA 1QWVA 1CLLA 3C1VA 1LA3A 4W6NA 3M24A 3CGAA 1AUIB 3O2PA 1S3PA 1ZGPA 2FOTA 1SSEB 1V1GA 4ZBLA 1YRTB 3TDZA 4AQJA 3CYZA 4C0LA 4BDUA 2OPOA 4ZINA 1F4QA 1BT6A 3UO9A 2FL1A 1WRZA 4W7AA 2M8UA 3S0DA 2MRDA 2JNXA 4YBHB 2CBLA 2QEOA 2G6EA 1IH0A 2OGRA 3V2LA 3IQQA 1DJWA 3SS0A 4R6DA 3DQEA 1TNXA 4W6LA 1DJGA 1QLSA 2KFFA 1QV0A 3B87A 2HQKA 5EBJA 4PE1A 2KAXA 4UPGA 2H6VA 3BXCA 3GEXA 3PLFB 1F54A 3AAKA 1ZUXA 1TNQA 1Q80A 2BL0B 1BMOA 2QEVA 1ZGQA 1ZOTB 3CTNA 1YJFA 1G7KA 3ST2A 4GGFC 4U2VA 2DUIA 5FI6A 1RECA 5BQLA 2QLEA 3I5HC 3OSRA 2Q57A 5DQBA 2LC5A 2CNPA 3GL4A 3TDUA 4LQUA 3DQMA 2Z1OA 2HF5A 5AQBB 3PJ7A 5HLVA 1XAEA 2F3ZA 4YRUA 1CLMA 4JPZB 5LTPA 4JFGA 1Y1AA 1PRWA 1DQEA 2OJKA 1YUTA 4YGEB 1PSRA 2WC8A 3MGFA 4KF5A 2QT2A 2CCMA 1HT9A 1ORGA 3H4SE 4HSZA 2BKHB 1KWOB 1OQPA 1KYSA 1L2OB 4W7XA 5HKWA 1XFRA 2JTTA 1OW4A 2LUXA 1A29A 5CSJA 5HGEA 2G2BA 4GBAA 3IR8A 1L2OC 1HCJA 1KFXL 4W6SA 1LVCD 1DJHA 4AOMA 3EK7A 3OSQA 5DQMA 1OZOA 2WC5A 1NCXA 2ARLA 4W6AA 3NHIA 1KQMC 1DMOA 3KHEA 2RGIA 1X02A 1DJIA 1BLQA 5DKQA 2JOJA 3BQ3A 2QLHA 4KA9A 4U8DA 3VICA 4CLNA 2H9WA 3I5HB 1YX8A 2HETA 2H5QA 2QLGA 2ZNEA 4EULA 2KBIA 2IOVA 2VZXA 2L2CA 4YGBB 1K94A 4IK4A 2KHNA 2AHAA 5BTTB 1XFYO 5DRFA 2QU1A 5DPGA 1UISA 2E30A 1QYOA 1XFXO 2Y1MA 2G9BA 5JOLA 1WRLA 3FWBA 3E5TA 4HVFA 1IQ3A 1EMFA 2MLFC 5DKRA 4W6RA 1DJYA 2F3YA 1WDCB 5DRGA 4W72A 2EGDA 1B4CA 3TS5B 1S6CA 3VHTA 4IK8A 4MSPA 2OS8B 3NSLA 5DU0A 3SG6A 2BCXA 1CKKA 2LNKA 4DXQA 4EDOA 4TZAA 1TUJA 4USLA 3M0WA 2H61A 3DQUA 2QACA 1SCMB 2G16B 2YDZA 2C9IA 4A4CA 4JC2A 4B30B 4BY4A 3B88A 3GK4X 1XVJA 2BKIB 3SSHA 5ER4X 1AJ4A 5EB6A 1ZFSA 3HX4A 3D75A 3K1EA 2EMDA 1GL4A 3SSYA 4INXA 1JBZA 1S1EA 5FI7A 4PPLA 2LVIA 4W6BA 4HQ9A 3ZNIA 1XA5A 4XOWA 3GJ2A 4RTCA 3DQLA 5DPHA 4ORCB 2M0RA 4PE0A 2WCKA 3JVTC 1ZGOA 2RH7A 4MZJA 2KPHA 2MBXA 2NCOA 4JWQA 4MBEA 3SVCA 4DXIA 2ICRA 1G4YR 2IE2A 1JSAA 5AXIA 4OZDA 1KK8B 2K60A 1J55A 1XFUO 2LVVA 4KF4A 1DT7B 3A8RA 3DQ2A 3A4UB 1EMLA 1NYAA 5DY6A 3BJHA 2L50A 3O4YA 4I5KA 4F0ZB 2M97A 2M9GA 4ANJA 1CMGA 4ZF4A 4P5OE 3UNWA 2EMOA 1TTXA 1NX2A 1QV1A 1B8RA 1H8BA 2QZ0A 5CSIA 1TNWA 3BFBA 1V1FA 4GUKA 1F55A 3VRPA 1S5GY 2WHUA 4L12A 2F8PA 3CZTX 1KYRA 2PALA 4M2OA 2EHBA 4KW4A 2YGUA 1TCFA 4HRGA 4PT1A 2YE1A 1KWOC 3S05A 1EMCA 1SBJA 2VRGA 2AWKA 1CDNA 2KQ6A 4BY5A 3TS5C 2M49B 3IF7A 1F70A 3P8UA 2DUHA 2JRFA 3BUMB 3AKBA 1K9PA 5CSFA 3FIAA 2BBMA 4ZF5A 4W6TA 3ZUJA 4OQWA 4W73A 2LVKA 3SV5A 1G33A 4UTSA 4INWA 2K61A 4QJ4B 2PVBA 1XK4A 2ZN9A 3D78A 4H47A 1LKJA 1HQVA 1SL9A 5KU1A 1W7UA 4KW8A 2OKYA 2COLB 2WCEA 2KI4B 1OOJA 2BE4A 1QS7A 5DICA 1EMBA 4LJCA 2TN4A 3AI4A 1QY3A 1Z2CB 2PYQA 3EVUA 5K89A 4GFTA 1NSHA 1ODBA 1LA0A 1OOHA 3WXAA 1CFFA 2P70A 2AUCA 3Q8IA 1N65A 1QASA 4KGFA 3I5IB 3VRRA 3DQJA 1NWDA 3VB1A 3VRQA 3SS3A 1CDMA 3CABA 5EXBA 1Q4CA 1C7WA 2CTNA 5IBWA 3CWGA 4P76A 2L98A 2HRSA 1W7SA 3OHMB 1B7TZ 4R1EA 2EC6C 1Y1UA 1UP5A 5HZSA 1N2DA 3EVRA 3KO0A 4TZGA 3U0KA 4EMQA 4CPVA 4MZLA 3NSKA 4W6KA 3CGLA 3L47A 3LL8B 2BCAA 1RFJA 1RJVA 4DS7A 5I2OA 4PPJA 1S6ZA 5AERA 4EDSA 3MSEB 1A03A 1UHKA 2KYCA 4IK3A 1KYPA 2LHLA 2JT0A 1Z1PA 1AK8A 1JFJA 3KCTA 3LK0A 3NGVA 4PPKA 3R1OA 1TOPA 3DQHA 4W6GA 5FHVA 2F2PA 1UHHA 1KCYA 3BXKA 1DF0B 1IKUA 2AH8A 1NUBA 3PSRA 3GOFA 3V3DA 3WNXB 2WHSA 4XOVA 1FPWA 1IGVA 4XGYA 1TRFA 3CFFA 1NP8A 1XQMA 1QXTA 2L4HA 4MLWA 2GX2A 2H8QA 3TMRA 2HQWA 4PHJA 1EMKA 2H61C 1YURA 1CFDA 4YGAA 1EJ3A 3DPXA 5EL2A 3OP0A 3DQ4A 4A4BA 2DUEA 1F4OA 3BUWB 1S6IA 2H8VA 1K96A 2BNXA 1K93D 1EMGA 4ORBB 1H6RA 2LANA 3I5FC 3CFAA 4E68A 2M3WA 3IP2A 4MN0A 1NIWA 4B5YA 1Q4BA 1F71A 2L0PA 2H2KA 1CB1A 3DQ3A 4PE4A 2VVIA 2EMNA 4WQ2A 3ADFA 4ZIOA 2D8NA 1YHGA 1CTRA 1MQ1A 2OKWA 1KFUL 5CSNA 1QYFA 2V53A 1YUUA 1EMAA 3CDNA 3RLZA 3CS1A 2KI6D 4MEWA 5EJUA 3OX5A 3NEDA 1OE9B 4RYWA 2WSOA 2M1KB 2Z6XA 1QJTA 4DUQA 3PJBA 4MRYA 4H3NA 2KAVA 3DQ5A 2NXQA 3O77A 1IJ5A 4YGDB 4W6FA 4DXMA 2FCEA 2M1UA 2L2EA 2L5XB 1OOFA 1B9AA 2V4EA 2PXSA 4Z4KA 2JNFA 3ED8A 2Z6YA 2IS9A 1YJ2A 3LF4B 1DC1A 4RYSA 3HCMA 4JKTA 2O29A 1UUSA 4W6DA 3SIBA 2A53B 3GJ1A 3SRYA 4IZNA 3U8PA 1BODA 3SS4A 5DPJA 3DQ8A 1SK6D 1Y0VH 3BOWA 2JULA 4IK9A 2OS8C 5EHUA 3DY9A 1GGZA 3DQKA 3DQ1A 1FI5A 3TDIA 4KAGA 2JZIA 5HZUA 5HL1A 1KQVA 1UURA 2BCBA 4MVFA 1QXPA 2JTZA 1DTLA 1XA9A 2KAYA 4PE7A 4Q7RA 2K7DA 2VVHA 4W7CA 2WOSA 4NDBA 4ZCVA 4C0JA 3WHTB 4OKHA 2DUFA 1GGWA 1J7PA 2HQ8A 5HLOA 3NXAA 1SPYA 1Q4AA 3TUYB 2HGDA 3OX6A 2LP2A 1W7JB 4XJKB 4Q04A 3AKOA 2MA2A 1KK7Z 1JC0A 1XFVO 1XO5A 1KFUS 4YI8A 3I5GC 2POXA 2Z6ZA 4DIRA 1IQ5A 1OMRA 4AR7A 1L7ZA 2KLDA 1CV7A 2DDCA 1QX2A 4J88A 4LQTA 3CR5X 4OR9B 4H48A 5FYXA 3U0LA 4OVNF 2O2BA 2KNEA 2EC6B 2AWJA 4JD9A 4OY4A 1OMVA 4LJBA 4JF9A 3SSTA 1RROA 3EK4A 3LVDA 4L9MA 4D1EA 1KSMA 2I94A 1AP4A 4KPIA 3SVOA 3P28A 3WLDA 4W6MA 2K2AA 3SVBA 1BF5A 1OXDA 4HRHA 2LM5A 3DVMA 4WQ3A 2V4EC 2Y0GA 2PMYA 4J8AA 1P28A 4LJDC 1OXFA 2KFGA 1KK7Y 3WLCA 3B6XA 4DXOA 2C9JA 3SVEA 2FZUA 3LSAA 3LCPC 3D10A 2B3QA 4YI9A 4GNKB 1QVIZ 3SG7A 3U0MA 4ZF3A 3TMTA 1T14A 1M46A 3LVAA 1LS8A 3L4AA 1JC2A 5HZTA 2P4MA 2JPTA 4NQGA 5I8NA 1KSOA 3NEZA 1CLBA 3PJ5A 2A48A 3U8AA 1ZACA 1RTP1 2WNDA 3SSVA 2WHTA 4FQOA 1H4UA 3EKHA 3ZTFA 4GOBA 4OV2A 1WY9A 1C4FA 1TWOA 4ZB1A 3D0YB 3FWCA 4N3DA 4PHMA 3PIBA 5I2QA 2YE0A 1W9ZA 1R6PA 3ST0A 5G08A 1C3ZA 5TNCA 2KGRA 3VROA 3ST4A 1OMDA 2JC2A 3RM1A 3EK8A 1QVIY 2H5RA 2GV5A 1GGXA 2K7OA 3PM2A 5DPIA 1K90D 3D76A 1PK0D 1SYMA 4OHSA 1DJZA 2K0JA 3KEVA 1Y6WA 2KQYA 3AI5A 2DD9A 2KOTA 4W6IA 1XFZO 2G5ZB 2SCPA 2KFHA 2JXCA 2I2RE 2YFPA 3GK2A 1U5IA 4N1GA 1ZMZA 1B9CA 3ICBA 1JBAA 4FQTA 5FVIA 2FJYA 4MZKA 1F0BA 3BFAA 3DYEA 3SSPA 3DQ6A 2BECA 2GGZA 2BBNA 3DQOA 1PSBA 3I5IC 3WCKA 1K2HA 2WCLA 1J7OA 4LJDA 2ZFDA 1WLMA 3OBVA 5PALA 4CIDA 2BAPA 3O6BA 2VADA 1B1GA 1MYWA 2CXJA 3ST3A 2QEHA 4WRIA 1N0YA 1SNLA 3QRXA 5FVFA 3R1PA 2KGBC 1SMGA 1J7QA 1AHRA 1SL8A 1UHNA 1XSSA 1G8IA 5D7FA 4L1IA 3U8CA 2AMIA 1YX7A 2ZRTA 4IL1A 5HW9A 2A50B 4I5JA 4CFRA 1PULA 4NDCA 1S6JA 1B8LA 1MF8B 1QLKA 2PSRA 3I5GB 5T3IA 3OGNA 1OZSA 5DTZA 2BE6A 2LMUA 1VRKA 2PXWA 1K9UA 1J1EA 3DVKA 3FE6A 3EVVA 1OOGA 3CFHA 1YZWA 4W6UA 1SR6C 5HYDA 1D1OA 4EN1A 2I7AA 1SW8A 3S0AA 3QMEA 5LTRA 4ORNA 1GM0A 1RWYA 3BUOB 2G6YA 2NZ0A 4W74A 3PN7B 5AEQA 3S0BA 4W6JA 3DQDA 2VVJA 3TUYC 3RZSA 1F09A 4PCWA 1YTZC 3GK1A 2WCHA 1RM9A 4W69A 4B30A 1QX5B 2IB6A 2QEBA 4M2QA 5I2LA 2KYFA 3E3RA 3R1VA 3LS3A 1A2XA 1MWNA 1YRUB 1JWDA 1WDCC 4NWSA 1RK9A 4Q9XA 3DQFA 4I5NB 1BJFA 3PATA 2JU0A 2M7LA 2IB5A 1DF0A 1ALWA 5BT0A 3CZ2A 3DZTA 1YR5A 1M31A 2WC6A 1FW4A 3KCSA 5LK4A 1H4BA 1IJ6A 2KLEA 4QJ3B 3BX9A 3CD9A 4MRXA 3CZ0A 2H5PA 2GW3A 1XK4C 2AWMA 3DXLA 5F9GA 1EG3A 4W77A 2ERBA 4KEXA 3SVRA 4FTGA 5DTLA 3VRNA 1HUYA 4W6CA 4DXPA 2LE9B 3SVSA 2WIQA 3SG2A 3JVTB 1W7IB 4W75A 2QRFA 1XFWO 3A8SA 1MXLC 4OGSA 3RWTA 1JC1A 2PASA 3K21A 5FI2A 2PRUA 4C0KA 1QIVA 5D3OA 3NHTA 1PVBA 1YUSA 1CFCA 2WCFA 3DD4A 2A56B 1M45A 2VAEA 3CZ1A 3NSOA 1DEKA 3UG0A 4W7RA 3WHUB 1Q4DA 4DXNA 4W6OA 3B7AA 3W1DA 2FCDA 3CR4X 2MLEC 3GB3A 3PFVA 3D77A 2Q91A 4W6PA 4F7FA 2Y1NA 2I18A 3U0NA 1B7TY 5LTQA 3NT9A 2LLTA 1XYDA 1WLZA 3S0FA 4HQCA 3O78A 5CPVA 2BTJA 1DJXA 3BUXB 2G2SB 5ER5A 3E5VA 2G6XA 2AAOA 2G3DB 4XVPA 4HQ8A 3BOWB 2K8MB 3LF3A 3DQAA 1MUXA 4M2PA 2Q4UA 1OSAA 1OXEA 3D0YA 4I5LB 1QYQA 1BG1A 1MOUA 5J3XA 3RWAA 4KW9A 2BL0C 4JGEA 1RMPA 1DVIA 4HREE 4GGFA 1CM1A 5DKNA 2LMTA 2A4JA 2WCBA 2O5GA 1FBVA 1TN4A 1UHIA 3NSIA 1AVSA 1M63B 2LLUA 2PQLA 1A75A 1RMOA 1J1DA 2L4IA 3DPWA 4Q7TA 1PALA 1BOCA 5BPJA 3OB2B 2QPTA 1YHHA 1MHOA 3SS5A 2B1UA 2DUGA 1MR8A 5AFPA 1RMMA 3EG5B 1R2UA 1NX1A 1JFKA 3LLEA 3DF0B 4KF5C 1JF2A 4KGEA 4XJKA 1NX0A 3D73A 4W76A 1Z4HA 3S0EA 3EKJA 5HBDA 2QLIA 1GQMA 5GQQC 2A54B 3DPZA 1OOIX 1CFPA 3VHTB 1DGUA 2LAPA 3SVDA 3L4LA 5F6TA 1MXEA 2Y5IA 1XMZA 1NCZA 1J7RA 3BXAA 3VK1A 1YHIA 1JBYA 1KFXS 1AJ5A 3SVNA 5I94A 2DOQA 2GTEA 4ZCUA 4P2YB 2M29A 1K9KA 2ZN8A 1EH2A 4N5XA 3SJSA 1BR1B 1CDLA 1GJYA 3KPXA 3DQ7A 1FI6A 2ZNDA 1EL4A 4PFEA 1UHJA 1Q73A 2B3PA 4QJ5B 5EXUA 1TUZA 2DDDA 1DGVA 2ZMWA 3I19A 2HPWA 1UWOA 2WCMA 2JWWA 2MJWB 3SG3A 3H1RA 1TNPA 2LCPA 2HFCA 1ZUZA 4PALA 2G3OA 3D74A 1CNPA 3CD1A 4L13A 2JT8A 4KYNA 1C7VA 3SVUA 2V4EB 4Q9WA 4DKMA 1SL7A 3PALA 3H1OA 3OGOA 1EMMA 4GAOA 1IWQA 2JPOA 1QX7A 2GW4B 3PN7C 4ETOA 2R2IA 3FS7A 3DQNA 2F33A 2ZKMX 1KP5A 3SSLA 5BTTA 2E6WA 5H88A 3IQOA 1MOVA 2GX0A 5HKZA 4DKNA 2K2FA 2Q6PA 1EMEA 1B47A
chains in the Genus database with same CATH topology
2JXLA 4J89A 2HGYA 2KSPA 3AKAA 2JQ6A 2HQZA 2WSNA 1Z1QA 5H87A 3W1CA 4AQIA 2HJOA 2LMVA 1SKTA 1JF0A 2LV7A 4XL5A 1PVAA 3PM8A 4PHKA 3TZ1A 4N1FA 3DVEA 2A52B 5DTYA 3ZWHA 2K7BA 1YFPA 1EXRA 3BUNB 2ZRSA 4CFQA 3I5FB 2KI6C 2O24A 3UFZA 2F2OA 4W7EA 3JTDC 5HZOA 4AS8A 2OTGB 2KI4C 1BR4B 2QLGB 2JADA 4JQ0D 4Z4MA 2Y4QA 1B8CA 1RRXA 4NDDA 3G9AA 2WORA 2ZMUA 3ZUFA 2LHIA 1U5IB 3E5WA 2LP3A 4DRWA 3NT3A 1C07A 1FF1A 2KBMA 1YVHA 2GGMA 2MHHA 2K7CA 5KTYA 1LXFC 1S26D 4ORAB 2OTBA 5H89A 3KF9A 4W7FA 2HPSA 3SG5A 5KTGA 2NLNA 3LK1A 4TNCA 3AAJA 1QIWA 2OTGC 1QTXA 5KSZA 3F45A 1NX3A 3BXBA 1BFPA 2ZO6A 1SY9A 1E8AA 5D69A 1IRJA 4R6BA 1SRAA 2WISA 2A47A 1Y1XA 3M22A 3OB1B 2KDHA 3K1KA 1TIZA 1K95A 1TCOB 4DCKA 1SR6B 2MAZA 4OJ0A 1JUOA 4GF6B 4PDZA 4ICBA 3DQIA 4GESB 1SCMC 2FJUB 2ISDA 2HCGA 1F8HA 1S5GZ 4W7DA 4JEOA 4JRBA 1EG4A 3SIAA 4W6HA 1YVLA 4GGNA 2DD7A 5DTXA 4GPLB 5EXCI 1CM4A 1NCYA 2L51A 2M7NA 2OTEA 4P1QA 2A46A 2WURA 4PHNA 1LINA 3DVJA 3NF0A 2SASA 1NPQA 3LA1A 2LVJA 5B8IB 3LVCA 1CDPA 1S36A 3EVPA 1BU3A 4H3MA 4ZFSA 3DF0A 4HE4A 2LLSA 1W7TA 3SG4A 5FVGA 2FWQA 3BYAA 2JT3A 4LW5A 2LUCA 2H5OA 2NCPA 5J2OA 4IK5A 4XYNA 1M39A 4YGCB 4H3LA 2P6BB 1QATA 3CR2A 4Q7UA 1ALVA 4I2YA 3JTDB 3CBEA 1Q4EA 2CT9A 3DQ9A 1A75B 3DQCA 3ZULA 3CB9A 1KQMB 1SCVA 4IK1A 5HKYA 5JJGA 3CLNA 1WRKA 5EB7A 1GFLA 3SSKA 2AWLA 1IG5A 1KK8C 3VGOA 2ZO7A 5AANA 1A4PA 1CMFA 1K8UA 2O60A 4OCIA 1CLLA 3C1VA 1LA3A 4W6NA 3M24A 3CGAA 1AUIB 3O2PA 1S3PA 1ZGPA 2FOTA 1V1GA 4ZBLA 1YRTB 3TDZA 4AQJA 4C0LA 4BDUA 2OPOA 4ZINA 1F4QA 1BT6A 2FL1A 1WRZA 4W7AA 2M8UA 2MRDA 2JNXA 4YBHB 2CBLA 2G6EA 1IH0A 2OGRA 3IQQA 1DJWA 3SS0A 4R6DA 3DQEA 1TNXA 4W6LA 1DJGA 1QLSA 2KFFA 1QV0A 2HQKA 5EBJA 4PE1A 2KAXA 4UPGA 2H6VA 3BXCA 3GEXA 3PLFB 1F54A 3AAKA 1ZUXA 1TNQA 1Q80A 2BL0B 1BMOA 1ZGQA 1ZOTB 3CTNA 1YJFA 1G7KA 3ST2A 4GGFC 4U2VA 2DUIA 1RECA 5BQLA 2QLEA 3I5HC 3OSRA 2Q57A 5DQBA 2LC5A 2CNPA 3GL4A 3TDUA 4LQUA 3DQMA 2Z1OA 2HF5A 5AQBB 3PJ7A 5HLVA 1XAEA 2F3ZA 4YRUA 1CLMA 4JPZB 5LTPA 4JFGA 1Y1AA 1PRWA 2OJKA 1YUTA 4YGEB 1PSRA 2WC8A 3MGFA 4KF5A 2QT2A 2CCMA 1HT9A 3H4SE 4HSZA 2BKHB 1KWOB 1OQPA 1KYSA 1L2OB 4W7XA 5HKWA 2JTTA 2LUXA 1A29A 5CSJA 5HGEA 2G2BA 4GBAA 3IR8A 1L2OC 1HCJA 1KFXL 4W6SA 1LVCD 1DJHA 4AOMA 3EK7A 3OSQA 5DQMA 1OZOA 1NCXA 2ARLA 4W6AA 1KQMC 1DMOA 3KHEA 2RGIA 1X02A 1DJIA 1BLQA 5DKQA 2JOJA 3BQ3A 2QLHA 4KA9A 4U8DA 3VICA 4CLNA 2H9WA 3I5HB 1YX8A 2HETA 2H5QA 2QLGA 2ZNEA 4EULA 2KBIA 2IOVA 2VZXA 4YGBB 1K94A 4IK4A 2KHNA 2AHAA 5BTTB 1XFYO 5DRFA 2QU1A 5DPGA 1UISA 2E30A 1QYOA 1XFXO 2Y1MA 2G9BA 5JOLA 1WRLA 3FWBA 3E5TA 4HVFA 1IQ3A 1EMFA 2MLFC 5DKRA 4W6RA 1DJYA 2F3YA 1WDCB 5DRGA 4W72A 2EGDA 1B4CA 3TS5B 1S6CA 3VHTA 4IK8A 4MSPA 2OS8B 3NSLA 5DU0A 3SG6A 2BCXA 1CKKA 2LNKA 4DXQA 4EDOA 4TZAA 4USLA 3M0WA 2H61A 3DQUA 2QACA 1SCMB 2G16B 2YDZA 2C9IA 4A4CA 4JC2A 4B30B 4BY4A 3GK4X 1XVJA 2BKIB 3SSHA 5ER4X 1AJ4A 5EB6A 1ZFSA 3HX4A 2EMDA 1GL4A 3SSYA 1JBZA 1S1EA 4PPLA 2LVIA 4W6BA 4HQ9A 3ZNIA 1XA5A 4XOWA 3GJ2A 4RTCA 3DQLA 5DPHA 4ORCB 2M0RA 4PE0A 3JVTC 1ZGOA 2RH7A 4MZJA 2MBXA 2NCOA 4JWQA 4DXIA 4MBEA 3SVCA 2ICRA 1G4YR 2IE2A 1JSAA 5AXIA 1KK8B 1J55A 1XFUO 2LVVA 4KF4A 1DT7B 3A8RA 3DQ2A 3A4UB 1EMLA 1NYAA 5DY6A 2L50A 3O4YA 4I5KA 4F0ZB 2M97A 2M9GA 4ANJA 1CMGA 4ZF4A 4P5OE 2EMOA 1TTXA 1NX2A 1QV1A 1B8RA 1H8BA 2QZ0A 5CSIA 1TNWA 1V1FA 4GUKA 1F55A 3VRPA 1S5GY 2WHUA 4L12A 2F8PA 3CZTX 1KYRA 2PALA 4M2OA 2EHBA 4KW4A 1TCFA 4HRGA 2YE1A 1KWOC 3S05A 1EMCA 1SBJA 2VRGA 2AWKA 1CDNA 2KQ6A 4BY5A 3TS5C 2M49B 3IF7A 1F70A 3P8UA 2DUHA 2JRFA 3BUMB 3AKBA 1K9PA 5CSFA 3FIAA 2BBMA 4ZF5A 4W6TA 3ZUJA 4OQWA 4W73A 2LVKA 3SV5A 1G33A 4UTSA 2K61A 4QJ4B 2PVBA 1XK4A 2ZN9A 4H47A 1LKJA 1HQVA 1SL9A 5KU1A 1W7UA 4KW8A 2OKYA 2COLB 2WCEA 2KI4B 1OOJA 2BE4A 1QS7A 1EMBA 4LJCA 2TN4A 3AI4A 1QY3A 3EVUA 5K89A 4GFTA 1NSHA 1ODBA 1LA0A 3WXAA 1CFFA 2AUCA 1N65A 1QASA 4KGFA 3I5IB 3VRRA 3DQJA 1NWDA 3VRQA 1CDMA 5EXBA 1Q4CA 1C7WA 2CTNA 5IBWA 3CWGA 4P76A 2L98A 2HRSA 1W7SA 3OHMB 1B7TZ 4R1EA 2EC6C 1Y1UA 1UP5A 5HZSA 1N2DA 3EVRA 3KO0A 4TZGA 3U0KA 4EMQA 4CPVA 4MZLA 3NSKA 4W6KA 3CGLA 3LL8B 2BCAA 1RFJA 1RJVA 4DS7A 5I2OA 4PPJA 1S6ZA 4EDSA 5AERA 3MSEB 1A03A 1UHKA 2KYCA 4IK3A 1KYPA 2LHLA 2JT0A 1Z1PA 1AK8A 1JFJA 3KCTA 3LK0A 4PPKA 1TOPA 3DQHA 4W6GA 5FHVA 2F2PA 1UHHA 1KCYA 3BXKA 1DF0B 1IKUA 2AH8A 1NUBA 3PSRA 3GOFA 3V3DA 3WNXB 2WHSA 4XOVA 1FPWA 1IGVA 4XGYA 1TRFA 3CFFA 1NP8A 1XQMA 1QXTA 2L4HA 4MLWA 2GX2A 2H8QA 3TMRA 2HQWA 4PHJA 1EMKA 2H61C 1YURA 1CFDA 4YGAA 1EJ3A 3DPXA 3OP0A 3DQ4A 4A4BA 2DUEA 1F4OA 3BUWB 1S6IA 1K96A 1K93D 1EMGA 4ORBB 1H6RA 2LANA 3I5FC 3CFAA 4E68A 2M3WA 3IP2A 4MN0A 1NIWA 4B5YA 1Q4BA 1F71A 2L0PA 2H2KA 1CB1A 3DQ3A 4PE4A 2VVIA 2EMNA 4WQ2A 3ADFA 4ZIOA 2D8NA 1YHGA 1CTRA 1MQ1A 2OKWA 1KFUL 5CSNA 1QYFA 2V53A 1YUUA 1EMAA 3RLZA 3CS1A 2KI6D 4MEWA 5EJUA 3OX5A 3NEDA 1OE9B 4RYWA 2WSOA 2M1KB 2Z6XA 1QJTA 4DUQA 3PJBA 4MRYA 4H3NA 2KAVA 3DQ5A 2NXQA 3O77A 1IJ5A 4YGDB 4W6FA 4DXMA 2FCEA 2M1UA 2L2EA 2L5XB 1B9AA 2V4EA 2PXSA 4Z4KA 2JNFA 3ED8A 2Z6YA 2IS9A 1YJ2A 3LF4B 4RYSA 3HCMA 2O29A 1UUSA 4W6DA 3SIBA 2A53B 3GJ1A 3SRYA 4IZNA 3U8PA 1BODA 5DPJA 3DQ8A 1SK6D 1Y0VH 3BOWA 2JULA 4IK9A 2OS8C 5EHUA 1GGZA 3DQKA 3DQ1A 1FI5A 3TDIA 4KAGA 2JZIA 5HZUA 1KQVA 1UURA 2BCBA 4MVFA 1QXPA 2JTZA 1DTLA 1XA9A 2KAYA 4PE7A 4Q7RA 2K7DA 2VVHA 4W7CA 2WOSA 4NDBA 4ZCVA 4C0JA 3WHTB 4OKHA 2DUFA 1GGWA 1J7PA 2HQ8A 5HLOA 3NXAA 1SPYA 1Q4AA 3TUYB 2HGDA 3OX6A 2LP2A 1W7JB 4XJKB 4Q04A 3AKOA 2MA2A 1KK7Z 1JC0A 1XFVO 1XO5A 1KFUS 4YI8A 3I5GC 2POXA 2Z6ZA 4DIRA 1IQ5A 1OMRA 4AR7A 1L7ZA 2DDCA 1CV7A 1QX2A 4J88A 4LQTA 3CR5X 4OR9B 4H48A 5FYXA 3U0LA 4OVNF 2O2BA 2KNEA 2EC6B 2AWJA 1OMVA 4OY4A 4LJBA 4JF9A 3SSTA 1RROA 3EK4A 3LVDA 4L9MA 4D1EA 1KSMA 2I94A 1AP4A 4KPIA 3SVOA 3P28A 3WLDA 4W6MA 2K2AA 3SVBA 1BF5A 1OXDA 4HRHA 2LM5A 3DVMA 4WQ3A 2V4EC 2Y0GA 2PMYA 4J8AA 4LJDC 1OXFA 2KFGA 1KK7Y 3WLCA 4DXOA 2C9JA 3SVEA 2FZUA 3LSAA 3LCPC 3D10A 2B3QA 4YI9A 4GNKB 1QVIZ 3SG7A 3U0MA 4ZF3A 3TMTA 1M46A 3LVAA 1JC2A 5HZTA 2P4MA 2JPTA 4NQGA 5I8NA 1KSOA 3NEZA 1CLBA 3PJ5A 2A48A 3U8AA 1ZACA 1RTP1 2WNDA 3SSVA 2WHTA 4FQOA 1H4UA 3EKHA 3ZTFA 4GOBA 4OV2A 1WY9A 1C4FA 4ZB1A 3D0YB 3FWCA 4N3DA 4PHMA 3PIBA 5I2QA 2YE0A 1R6PA 3ST0A 5G08A 5TNCA 2KGRA 3VROA 3ST4A 1OMDA 2JC2A 3RM1A 3EK8A 1QVIY 2H5RA 2GV5A 1GGXA 2K7OA 5DPIA 1K90D 1PK0D 1SYMA 4OHSA 1DJZA 2K0JA 3KEVA 1Y6WA 2KQYA 3AI5A 2DD9A 2KOTA 4W6IA 1XFZO 2G5ZB 2SCPA 2KFHA 2JXCA 2I2RE 2YFPA 3GK2A 1U5IA 4N1GA 1ZMZA 1B9CA 3ICBA 1JBAA 5FVIA 4MZKA 1F0BA 3SSPA 3DQ6A 2BECA 2GGZA 2BBNA 3DQOA 1PSBA 3I5IC 3WCKA 1K2HA 1J7OA 4LJDA 2ZFDA 1WLMA 5PALA 4CIDA 3O6BA 2VADA 1B1GA 1MYWA 2CXJA 3ST3A 4WRIA 1N0YA 1SNLA 3QRXA 5FVFA 2KGBC 1SMGA 1J7QA 1AHRA 1SL8A 1UHNA 1XSSA 1G8IA 5D7FA 4L1IA 3U8CA 2AMIA 1YX7A 2ZRTA 4IL1A 5HW9A 2A50B 4I5JA 4CFRA 1PULA 4NDCA 1S6JA 1B8LA 1MF8B 1QLKA 2PSRA 3I5GB 5T3IA 1OZSA 5DTZA 2BE6A 2LMUA 1VRKA 2PXWA 1K9UA 1J1EA 3DVKA 3EVVA 3CFHA 1YZWA 4W6UA 1SR6C 5HYDA 1D1OA 4EN1A 2I7AA 1SW8A 5LTRA 4ORNA 1RWYA 3BUOB 2G6YA 2NZ0A 4W74A 3PN7B 5AEQA 4W6JA 3DQDA 2VVJA 3TUYC 1F09A 4PCWA 1YTZC 3GK1A 1RM9A 4W69A 4B30A 1QX5B 2IB6A 4M2QA 5I2LA 2KYFA 3E3RA 3LS3A 1A2XA 1MWNA 1YRUB 1JWDA 1WDCC 4NWSA 1RK9A 4Q9XA 3DQFA 4I5NB 1BJFA 3PATA 2JU0A 2M7LA 2IB5A 1DF0A 1ALWA 5BT0A 1YR5A 1M31A 1FW4A 3KCSA 5LK4A 1H4BA 1IJ6A 4QJ3B 3BX9A 3CD9A 4MRXA 2H5PA 2GW3A 1XK4C 2AWMA 5F9GA 1EG3A 4W77A 4KEXA 3SVRA 4FTGA 5DTLA 3VRNA 1HUYA 4W6CA 4DXPA 2LE9B 3SVSA 2WIQA 3SG2A 3JVTB 1W7IB 4W75A 2QRFA 1XFWO 3A8SA 1MXLC 4OGSA 3RWTA 1JC1A 2PASA 3K21A 2PRUA 4C0KA 1QIVA 1PVBA 1YUSA 1CFCA 2WCFA 3DD4A 2A56B 1M45A 2VAEA 3NSOA 3UG0A 4W7RA 3WHUB 1Q4DA 4DXNA 4W6OA 3W1DA 2FCDA 3CR4X 2MLEC 3GB3A 3PFVA 2Q91A 4W6PA 2Y1NA 2I18A 3U0NA 1B7TY 5LTQA 2LLTA 3NT9A 1XYDA 1WLZA 4HQCA 3O78A 5CPVA 2BTJA 1DJXA 3BUXB 2G2SB 5ER5A 3E5VA 2G6XA 2AAOA 2G3DB 4XVPA 4HQ8A 3BOWB 2K8MB 3LF3A 3DQAA 1MUXA 4M2PA 2Q4UA 1OSAA 1OXEA 3D0YA 4I5LB 1QYQA 1BG1A 1MOUA 5J3XA 3RWAA 4KW9A 2BL0C 4JGEA 1RMPA 1DVIA 4HREE 4GGFA 1CM1A 5DKNA 2LMTA 2A4JA 2WCBA 2O5GA 1FBVA 1TN4A 1UHIA 3NSIA 1AVSA 1M63B 2LLUA 1A75A 1RMOA 1J1DA 2L4IA 3DPWA 4Q7TA 1PALA 1BOCA 5BPJA 3OB2B 2QPTA 1YHHA 1MHOA 2B1UA 2DUGA 1MR8A 5AFPA 1RMMA 1R2UA 1NX1A 1JFKA 3LLEA 3DF0B 4KF5C 1JF2A 4KGEA 4XJKA 1NX0A 4W76A 5HBDA 3EKJA 2QLIA 1GQMA 5GQQC 2A54B 3DPZA 1CFPA 3VHTB 1DGUA 2LAPA 3SVDA 5F6TA 1MXEA 2Y5IA 1XMZA 1NCZA 1J7RA 3BXAA 3VK1A 1YHIA 1JBYA 1KFXS 1AJ5A 3SVNA 2DOQA 4ZCUA 4P2YB 2M29A 1K9KA 2ZN8A 1EH2A 4N5XA 3SJSA 1BR1B 1CDLA 1GJYA 3KPXA 3DQ7A 1FI6A 2ZNDA 1EL4A 4PFEA 1UHJA 1Q73A 2B3PA 4QJ5B 5EXUA 2DDDA 1DGVA 2ZMWA 3I19A 2HPWA 1UWOA 2JWWA 2MJWB 3SG3A 3H1RA 1TNPA 2LCPA 2HFCA 1ZUZA 4PALA 2G3OA 1CNPA 3CD1A 4L13A 2JT8A 1C7VA 3SVUA 2V4EB 4Q9WA 4DKMA 1SL7A 3PALA 3H1OA 3OGOA 1EMMA 4GAOA 1IWQA 1QX7A 2GW4B 3PN7C 4ETOA 2R2IA 3FS7A 3DQNA 2F33A 2ZKMX 1KP5A 3SSLA 5BTTA 2E6WA 5H88A 3IQOA 1MOVA 2GX0A 5HKZA 4DKNA 2K2FA 2Q6PA 1EMEA 1B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXL A;  4J89 A;  2HGY A;  2KSP A;  3AKA A;  2JQ6 A;  2HQZ A;  2WSN A;  1Z1Q A;  5H87 A;  3W1C A;  4AQI A;  2HJO A;  2LMV A;  1SKT A;  1JF0 A;  2LV7 A;  4XL5 A;  1PVA A;  3PM8 A;  4PHK A;  3TZ1 A;  4N1F A;  3DVE A;  2A52 B;  5DTY A;  3ZWH A;  2K7B A;  1YFP A;  1EXR A;  3BUN B;  2ZRS A;  4CFQ A;  3I5F B;  2KI6 C;  2O24 A;  3UFZ A;  2F2O A;  4W7E A;  3JTD C;  5HZO A;  4AS8 A;  2OTG B;  2KI4 C;  1BR4 B;  2QLG B;  2JAD A;  4JQ0 D;  4Z4M A;  2Y4Q A;  1B8C A;  1RRX A;  4NDD A;  3G9A A;  2WOR A;  2ZMU A;  3ZUF A;  2LHI A;  1U5I B;  3E5W A;  2LP3 A;  4DRW A;  3NT3 A;  1C07 A;  1FF1 A;  2KBM A;  1YVH A;  2GGM A;  2MHH A;  2K7C A;  5KTY A;  1LXF C;  1S26 D;  4ORA B;  2OTB A;  5H89 A;  3KF9 A;  4W7F A;  2HPS A;  3SG5 A;  5KTG A;  2NLN A;  3LK1 A;  4TNC A;  3AAJ A;  1QIW A;  2OTG C;  1QTX A;  5KSZ A;  3F45 A;  1NX3 A;  3BXB A;  1BFP A;  2ZO6 A;  1SY9 A;  1E8A A;  5D69 A;  1IRJ A;  4R6B A;  1SRA A;  2WIS A;  2A47 A;  1Y1X A;  3M22 A;  3OB1 B;  2KDH A;  3K1K A;  1TIZ A;  1K95 A;  1TCO B;  4DCK A;  1SR6 B;  2MAZ A;  4OJ0 A;  1JUO A;  4GF6 B;  4PDZ A;  4ICB A;  3DQI A;  4GES B;  1SCM C;  2FJU B;  2ISD A;  2HCG A;  1F8H A;  1S5G Z;  4W7D A;  4JEO A;  4JRB A;  1EG4 A;  3SIA A;  4W6H A;  1YVL A;  4GGN A;  2DD7 A;  5DTX A;  4GPL B;  5EXC I;  1CM4 A;  1NCY A;  2L51 A;  2M7N A;  2OTE A;  4P1Q A;  2A46 A;  2WUR A;  4PHN A;  1LIN A;  3DVJ A;  3NF0 A;  2SAS A;  1NPQ A;  3LA1 A;  2LVJ A;  5B8I B;  3LVC A;  1CDP A;  1S36 A;  3EVP A;  1BU3 A;  4H3M A;  4ZFS A;  3DF0 A;  4HE4 A;  2LLS A;  1W7T A;  3SG4 A;  5FVG A;  2FWQ A;  3BYA A;  2JT3 A;  4LW5 A;  2LUC A;  2H5O A;  2NCP A;  5J2O A;  4IK5 A;  4XYN A;  1M39 A;  4YGC B;  4H3L A;  2P6B B;  1QAT A;  3CR2 A;  4Q7U A;  1ALV A;  4I2Y A;  3JTD B;  3CBE A;  1Q4E A;  2CT9 A;  3DQ9 A;  1A75 B;  3DQC A;  3ZUL A;  3CB9 A;  1KQM B;  1SCV A;  4IK1 A;  5HKY A;  5JJG A;  3CLN A;  1WRK A;  5EB7 A;  1GFL A;  3SSK A;  2AWL A;  1IG5 A;  1KK8 C;  3VGO A;  2ZO7 A;  5AAN A;  1A4P A;  1CMF A;  1K8U A;  2O60 A;  4OCI A;  1CLL A;  3C1V A;  1LA3 A;  4W6N A;  3M24 A;  3CGA A;  1AUI B;  3O2P A;  1S3P A;  1ZGP A;  2FOT A;  1V1G A;  4ZBL A;  1YRT B;  3TDZ A;  4AQJ A;  4C0L A;  4BDU A;  2OPO A;  4ZIN A;  1F4Q A;  1BT6 A;  2FL1 A;  1WRZ A;  4W7A A;  2M8U A;  2MRD A;  2JNX A;  4YBH B;  2CBL A;  2G6E A;  1IH0 A;  2OGR A;  3IQQ A;  1DJW A;  3SS0 A;  4R6D A;  3DQE A;  1TNX A;  4W6L A;  1DJG A;  1QLS A;  2KFF A;  1QV0 A;  2HQK A;  5EBJ A;  4PE1 A;  2KAX A;  4UPG A;  2H6V A;  3BXC A;  3GEX A;  3PLF B;  1F54 A;  3AAK A;  1ZUX A;  1TNQ A;  1Q80 A;  2BL0 B;  1BMO A;  1ZGQ A;  1ZOT B;  3CTN A;  1YJF A;  1G7K A;  3ST2 A;  4GGF C;  4U2V A;  2DUI A;  1REC A;  5BQL A;  2QLE A;  3I5H C;  3OSR A;  2Q57 A;  5DQB A;  2LC5 A;  2CNP A;  3GL4 A;  3TDU A;  4LQU A;  3DQM A;  2Z1O A;  2HF5 A;  5AQB B;  3PJ7 A;  5HLV A;  1XAE A;  2F3Z A;  4YRU A;  1CLM A;  4JPZ B;  5LTP A;  4JFG A;  1Y1A A;  1PRW A;  2OJK A;  1YUT A;  4YGE B;  1PSR A;  2WC8 A;  3MGF A;  4KF5 A;  2QT2 A;  2CCM A;  1HT9 A;  3H4S E;  4HSZ A;  2BKH B;  1KWO B;  1OQP A;  1KYS A;  1L2O B;  4W7X A;  5HKW A;  2JTT A;  2LUX A;  1A29 A;  5CSJ A;  5HGE A;  2G2B A;  4GBA A;  3IR8 A;  1L2O C;  1HCJ A;  1KFX L;  4W6S A;  1LVC D;  1DJH A;  4AOM A;  3EK7 A;  3OSQ A;  5DQM A;  1OZO A;  1NCX A;  2ARL A;  4W6A A;  1KQM C;  1DMO A;  3KHE A;  2RGI A;  1X02 A;  1DJI A;  1BLQ A;  5DKQ A;  2JOJ A;  3BQ3 A;  2QLH A;  4KA9 A;  4U8D A;  3VIC A;  4CLN A;  2H9W A;  3I5H B;  1YX8 A;  2HET A;  2H5Q A;  2QLG A;  2ZNE A;  4EUL A;  2KBI A;  2IOV A;  2VZX A;  4YGB B;  1K94 A;  4IK4 A;  2KHN A;  2AHA A;  5BTT B;  1XFY O;  5DRF A;  2QU1 A;  5DPG A;  1UIS A;  2E30 A;  1QYO A;  1XFX O;  2Y1M A;  2G9B A;  5JOL A;  1WRL A;  3FWB A;  3E5T A;  4HVF A;  1IQ3 A;  1EMF A;  2MLF C;  5DKR A;  4W6R A;  1DJY A;  2F3Y A;  1WDC B;  5DRG A;  4W72 A;  2EGD A;  1B4C A;  3TS5 B;  1S6C A;  3VHT A;  4IK8 A;  4MSP A;  2OS8 B;  3NSL A;  5DU0 A;  3SG6 A;  2BCX A;  1CKK A;  2LNK A;  4DXQ A;  4EDO A;  4TZA A;  4USL A;  3M0W A;  2H61 A;  3DQU A;  2QAC A;  1SCM B;  2G16 B;  2YDZ A;  2C9I A;  4A4C A;  4JC2 A;  4B30 B;  4BY4 A;  3GK4 X;  1XVJ A;  2BKI B;  3SSH A;  5ER4 X;  1AJ4 A;  5EB6 A;  1ZFS A;  3HX4 A;  2EMD A;  1GL4 A;  3SSY A;  1JBZ A;  1S1E A;  4PPL A;  2LVI A;  4W6B A;  4HQ9 A;  3ZNI A;  1XA5 A;  4XOW A;  3GJ2 A;  4RTC A;  3DQL A;  5DPH A;  4ORC B;  2M0R A;  4PE0 A;  3JVT C;  1ZGO A;  2RH7 A;  4MZJ A;  2MBX A;  2NCO A;  4JWQ A;  4DXI A;  4MBE A;  3SVC A;  2ICR A;  1G4Y R;  2IE2 A;  1JSA A;  5AXI A;  1KK8 B;  1J55 A;  1XFU O;  2LVV A;  4KF4 A;  1DT7 B;  3A8R A;  3DQ2 A;  3A4U B;  1EML A;  1NYA A;  5DY6 A;  2L50 A;  3O4Y A;  4I5K A;  4F0Z B;  2M97 A;  2M9G A;  4ANJ A;  1CMG A;  4ZF4 A;  4P5O E;  2EMO A;  1TTX A;  1NX2 A;  1QV1 A;  1B8R A;  1H8B A;  2QZ0 A;  5CSI A;  1TNW A;  1V1F A;  4GUK A;  1F55 A;  3VRP A;  1S5G Y;  2WHU A;  4L12 A;  2F8P A;  3CZT X;  1KYR A;  2PAL A;  4M2O A;  2EHB A;  4KW4 A;  1TCF A;  4HRG A;  2YE1 A;  1KWO C;  3S05 A;  1EMC A;  1SBJ A;  2VRG A;  2AWK A;  1CDN A;  2KQ6 A;  4BY5 A;  3TS5 C;  2M49 B;  3IF7 A;  1F70 A;  3P8U A;  2DUH A;  2JRF A;  3BUM B;  3AKB A;  1K9P A;  5CSF A;  3FIA A;  2BBM A;  4ZF5 A;  4W6T A;  3ZUJ A;  4OQW A;  4W73 A;  2LVK A;  3SV5 A;  1G33 A;  4UTS A;  2K61 A;  4QJ4 B;  2PVB A;  1XK4 A;  2ZN9 A;  4H47 A;  1LKJ A;  1HQV A;  1SL9 A;  5KU1 A;  1W7U A;  4KW8 A;  2OKY A;  2COL B;  2WCE A;  2KI4 B;  1OOJ A;  2BE4 A;  1QS7 A;  1EMB A;  4LJC A;  2TN4 A;  3AI4 A;  1QY3 A;  3EVU A;  5K89 A;  4GFT A;  1NSH A;  1ODB A;  1LA0 A;  3WXA A;  1CFF A;  2AUC A;  1N65 A;  1QAS A;  4KGF A;  3I5I B;  3VRR A;  3DQJ A;  1NWD A;  3VRQ A;  1CDM A;  5EXB A;  1Q4C A;  1C7W A;  2CTN A;  5IBW A;  3CWG A;  4P76 A;  2L98 A;  2HRS A;  1W7S A;  3OHM B;  1B7T Z;  4R1E A;  2EC6 C;  1Y1U A;  1UP5 A;  5HZS A;  1N2D A;  3EVR A;  3KO0 A;  4TZG A;  3U0K A;  4EMQ A;  4CPV A;  4MZL A;  3NSK A;  4W6K A;  3CGL A;  3LL8 B;  2BCA A;  1RFJ A;  1RJV A;  4DS7 A;  5I2O A;  4PPJ A;  1S6Z A;  4EDS A;  5AER A;  3MSE B;  1A03 A;  1UHK A;  2KYC A;  4IK3 A;  1KYP A;  2LHL A;  2JT0 A;  1Z1P A;  1AK8 A;  1JFJ A;  3KCT A;  3LK0 A;  4PPK A;  1TOP A;  3DQH A;  4W6G A;  5FHV A;  2F2P A;  1UHH A;  1KCY A;  3BXK A;  1DF0 B;  1IKU A;  2AH8 A;  1NUB A;  3PSR A;  3GOF A;  3V3D A;  3WNX B;  2WHS A;  4XOV A;  1FPW A;  1IGV A;  4XGY A;  1TRF A;  3CFF A;  1NP8 A;  1XQM A;  1QXT A;  2L4H A;  4MLW A;  2GX2 A;  2H8Q A;  3TMR A;  2HQW A;  4PHJ A;  1EMK A;  2H61 C;  1YUR A;  1CFD A;  4YGA A;  1EJ3 A;  3DPX A;  3OP0 A;  3DQ4 A;  4A4B A;  2DUE A;  1F4O A;  3BUW B;  1S6I A;  1K96 A;  1K93 D;  1EMG A;  4ORB B;  1H6R A;  2LAN A;  3I5F C;  3CFA A;  4E68 A;  2M3W A;  3IP2 A;  4MN0 A;  1NIW A;  4B5Y A;  1Q4B A;  1F71 A;  2L0P A;  2H2K A;  1CB1 A;  3DQ3 A;  4PE4 A;  2VVI A;  2EMN A;  4WQ2 A;  3ADF A;  4ZIO A;  2D8N A;  1YHG A;  1CTR A;  1MQ1 A;  2OKW A;  1KFU L;  5CSN A;  1QYF A;  2V53 A;  1YUU A;  1EMA A;  3RLZ A;  3CS1 A;  2KI6 D;  4MEW A;  5EJU A;  3OX5 A;  3NED A;  1OE9 B;  4RYW A;  2WSO A;  2M1K B;  2Z6X A;  1QJT A;  4DUQ A;  3PJB A;  4MRY A;  4H3N A;  2KAV A;  3DQ5 A;  2NXQ A;  3O77 A;  1IJ5 A;  4YGD B;  4W6F A;  4DXM A;  2FCE A;  2M1U A;  2L2E A;  2L5X B;  1B9A A;  2V4E A;  2PXS A;  4Z4K A;  2JNF A;  3ED8 A;  2Z6Y A;  2IS9 A;  1YJ2 A;  3LF4 B;  4RYS A;  3HCM A;  2O29 A;  1UUS A;  4W6D A;  3SIB A;  2A53 B;  3GJ1 A;  3SRY A;  4IZN A;  3U8P A;  1BOD A;  5DPJ A;  3DQ8 A;  1SK6 D;  1Y0V H;  3BOW A;  2JUL A;  4IK9 A;  2OS8 C;  5EHU A;  1GGZ A;  3DQK A;  3DQ1 A;  1FI5 A;  3TDI A;  4KAG A;  2JZI A;  5HZU A;  1KQV A;  1UUR A;  2BCB A;  4MVF A;  1QXP A;  2JTZ A;  1DTL A;  1XA9 A;  2KAY A;  4PE7 A;  4Q7R A;  2K7D A;  2VVH A;  4W7C A;  2WOS A;  4NDB A;  4ZCV A;  4C0J A;  3WHT B;  4OKH A;  2DUF A;  1GGW A;  1J7P A;  2HQ8 A;  5HLO A;  3NXA A;  1SPY A;  1Q4A A;  3TUY B;  2HGD A;  3OX6 A;  2LP2 A;  1W7J B;  4XJK B;  4Q04 A;  3AKO A;  2MA2 A;  1KK7 Z;  1JC0 A;  1XFV O;  1XO5 A;  1KFU S;  4YI8 A;  3I5G C;  2POX A;  2Z6Z A;  4DIR A;  1IQ5 A;  1OMR A;  4AR7 A;  1L7Z A;  2DDC A;  1CV7 A;  1QX2 A;  4J88 A;  4LQT A;  3CR5 X;  4OR9 B;  4H48 A;  5FYX A;  3U0L A;  4OVN F;  2O2B A;  2KNE A;  2EC6 B;  2AWJ A;  1OMV A;  4OY4 A;  4LJB A;  4JF9 A;  3SST A;  1RRO A;  3EK4 A;  3LVD A;  4L9M A;  4D1E A;  1KSM A;  2I94 A;  1AP4 A;  4KPI A;  3SVO A;  3P28 A;  3WLD A;  4W6M A;  2K2A A;  3SVB A;  1BF5 A;  1OXD A;  4HRH A;  2LM5 A;  3DVM A;  4WQ3 A;  2V4E C;  2Y0G A;  2PMY A;  4J8A A;  4LJD C;  1OXF A;  2KFG A;  1KK7 Y;  3WLC A;  4DXO A;  2C9J A;  3SVE A;  2FZU A;  3LSA A;  3LCP C;  3D10 A;  2B3Q A;  4YI9 A;  4GNK B;  1QVI Z;  3SG7 A;  3U0M A;  4ZF3 A;  3TMT A;  1M46 A;  3LVA A;  1JC2 A;  5HZT A;  2P4M A;  2JPT A;  4NQG A;  5I8N A;  1KSO A;  3NEZ A;  1CLB A;  3PJ5 A;  2A48 A;  3U8A A;  1ZAC A;  1RTP 1;  2WND A;  3SSV A;  2WHT A;  4FQO A;  1H4U A;  3EKH A;  3ZTF A;  4GOB A;  4OV2 A;  1WY9 A;  1C4F A;  4ZB1 A;  3D0Y B;  3FWC A;  4N3D A;  4PHM A;  3PIB A;  5I2Q A;  2YE0 A;  1R6P A;  3ST0 A;  5G08 A;  5TNC A;  2KGR A;  3VRO A;  3ST4 A;  1OMD A;  2JC2 A;  3RM1 A;  3EK8 A;  1QVI Y;  2H5R A;  2GV5 A;  1GGX A;  2K7O A;  5DPI A;  1K90 D;  1PK0 D;  1SYM A;  4OHS A;  1DJZ A;  2K0J A;  3KEV A;  1Y6W A;  2KQY A;  3AI5 A;  2DD9 A;  2KOT A;  4W6I A;  1XFZ O;  2G5Z B;  2SCP A;  2KFH A;  2JXC A;  2I2R E;  2YFP A;  3GK2 A;  1U5I A;  4N1G A;  1ZMZ A;  1B9C A;  3ICB A;  1JBA A;  5FVI A;  4MZK A;  1F0B A;  3SSP A;  3DQ6 A;  2BEC A;  2GGZ A;  2BBN A;  3DQO A;  1PSB A;  3I5I C;  3WCK A;  1K2H A;  1J7O A;  4LJD A;  2ZFD A;  1WLM A;  5PAL A;  4CID A;  3O6B A;  2VAD A;  1B1G A;  1MYW A;  2CXJ A;  3ST3 A;  4WRI A;  1N0Y A;  1SNL A;  3QRX A;  5FVF A;  2KGB C;  1SMG A;  1J7Q A;  1AHR A;  1SL8 A;  1UHN A;  1XSS A;  1G8I A;  5D7F A;  4L1I A;  3U8C A;  2AMI A;  1YX7 A;  2ZRT A;  4IL1 A;  5HW9 A;  2A50 B;  4I5J A;  4CFR A;  1PUL A;  4NDC A;  1S6J A;  1B8L A;  1MF8 B;  1QLK A;  2PSR A;  3I5G B;  5T3I A;  1OZS A;  5DTZ A;  2BE6 A;  2LMU A;  1VRK A;  2PXW A;  1K9U A;  1J1E A;  3DVK A;  3EVV A;  3CFH A;  1YZW A;  4W6U A;  1SR6 C;  5HYD A;  1D1O A;  4EN1 A;  2I7A A;  1SW8 A;  5LTR A;  4ORN A;  1RWY A;  3BUO B;  2G6Y A;  2NZ0 A;  4W74 A;  3PN7 B;  5AEQ A;  4W6J A;  3DQD A;  2VVJ A;  3TUY C;  1F09 A;  4PCW A;  1YTZ C;  3GK1 A;  1RM9 A;  4W69 A;  4B30 A;  1QX5 B;  2IB6 A;  4M2Q A;  5I2L A;  2KYF A;  3E3R A;  3LS3 A;  1A2X A;  1MWN A;  1YRU B;  1JWD A;  1WDC C;  4NWS A;  1RK9 A;  4Q9X A;  3DQF A;  4I5N B;  1BJF A;  3PAT A;  2JU0 A;  2M7L A;  2IB5 A;  1DF0 A;  1ALW A;  5BT0 A;  1YR5 A;  1M31 A;  1FW4 A;  3KCS A;  5LK4 A;  1H4B A;  1IJ6 A;  4QJ3 B;  3BX9 A;  3CD9 A;  4MRX A;  2H5P A;  2GW3 A;  1XK4 C;  2AWM A;  5F9G A;  1EG3 A;  4W77 A;  4KEX A;  3SVR A;  4FTG A;  5DTL A;  3VRN A;  1HUY A;  4W6C A;  4DXP A;  2LE9 B;  3SVS A;  2WIQ A;  3SG2 A;  3JVT B;  1W7I B;  4W75 A;  2QRF A;  1XFW O;  3A8S A;  1MXL C;  4OGS A;  3RWT A;  1JC1 A;  2PAS A;  3K21 A;  2PRU A;  4C0K A;  1QIV A;  1PVB A;  1YUS A;  1CFC A;  2WCF A;  3DD4 A;  2A56 B;  1M45 A;  2VAE A;  3NSO A;  3UG0 A;  4W7R A;  3WHU B;  1Q4D A;  4DXN A;  4W6O A;  3W1D A;  2FCD A;  3CR4 X;  2MLE C;  3GB3 A;  3PFV A;  2Q91 A;  4W6P A;  2Y1N A;  2I18 A;  3U0N A;  1B7T Y;  5LTQ A;  2LLT A;  3NT9 A;  1XYD A;  1WLZ A;  4HQC A;  3O78 A;  5CPV A;  2BTJ A;  1DJX A;  3BUX B;  2G2S B;  5ER5 A;  3E5V A;  2G6X A;  2AAO A;  2G3D B;  4XVP A;  4HQ8 A;  3BOW B;  2K8M B;  3LF3 A;  3DQA A;  1MUX A;  4M2P A;  2Q4U A;  1OSA A;  1OXE A;  3D0Y A;  4I5L B;  1QYQ A;  1BG1 A;  1MOU A;  5J3X A;  3RWA A;  4KW9 A;  2BL0 C;  4JGE A;  1RMP A;  1DVI A;  4HRE E;  4GGF A;  1CM1 A;  5DKN A;  2LMT A;  2A4J A;  2WCB A;  2O5G A;  1FBV A;  1TN4 A;  1UHI A;  3NSI A;  1AVS A;  1M63 B;  2LLU A;  1A75 A;  1RMO A;  1J1D A;  2L4I A;  3DPW A;  4Q7T A;  1PAL A;  1BOC A;  5BPJ A;  3OB2 B;  2QPT A;  1YHH A;  1MHO A;  2B1U A;  2DUG A;  1MR8 A;  5AFP A;  1RMM A;  1R2U A;  1NX1 A;  1JFK A;  3LLE A;  3DF0 B;  4KF5 C;  1JF2 A;  4KGE A;  4XJK A;  1NX0 A;  4W76 A;  5HBD A;  3EKJ A;  2QLI A;  1GQM A;  5GQQ C;  2A54 B;  3DPZ A;  1CFP A;  3VHT B;  1DGU A;  2LAP A;  3SVD A;  5F6T A;  1MXE A;  2Y5I A;  1XMZ A;  1NCZ A;  1J7R A;  3BXA A;  3VK1 A;  1YHI A;  1JBY A;  1KFX S;  1AJ5 A;  3SVN A;  2DOQ A;  4ZCU A;  4P2Y B;  2M29 A;  1K9K A;  2ZN8 A;  1EH2 A;  4N5X A;  3SJS A;  1BR1 B;  1CDL A;  1GJY A;  3KPX A;  3DQ7 A;  1FI6 A;  2ZND A;  1EL4 A;  4PFE A;  1UHJ A;  1Q73 A;  2B3P A;  4QJ5 B;  5EXU A;  2DDD A;  1DGV A;  2ZMW A;  3I19 A;  2HPW A;  1UWO A;  2JWW A;  2MJW B;  3SG3 A;  3H1R A;  1TNP A;  2LCP A;  2HFC A;  1ZUZ A;  4PAL A;  2G3O A;  1CNP A;  3CD1 A;  4L13 A;  2JT8 A;  1C7V A;  3SVU A;  2V4E B;  4Q9W A;  4DKM A;  1SL7 A;  3PAL A;  3H1O A;  3OGO A;  1EMM A;  4GAO A;  1IWQ A;  1QX7 A;  2GW4 B;  3PN7 C;  4ETO A;  2R2I A;  3FS7 A;  3DQN A;  2F33 A;  2ZKM X;  1KP5 A;  3SSL A;  5BTT A;  2E6W A;  5H88 A;  3IQO A;  1MOV A;  2GX0 A;  5HKZ A;  4DKN A;  2K2F A;  2Q6P A;  1EME A;  1B47 A; 
#chains in the Genus database with same CATH topology
 2JXL A;  4J89 A;  1DEL A;  2HGY A;  2KSP A;  3AKA A;  2JQ6 A;  2L5Y A;  3PJI A;  2HQZ A;  2WSN A;  1Z1Q A;  5H87 A;  3W1C A;  2WCJ A;  4AQI A;  2HJO A;  2LMV A;  1SKT A;  1JF0 A;  2LV7 A;  4XL5 A;  1PVA A;  3PM8 A;  4PHK A;  3TZ1 A;  4N1F A;  3DVE A;  2A52 B;  5DTY A;  3ZWH A;  2K7B A;  3B86 A;  1YFP A;  1EXR A;  3BUN B;  2ZRS A;  4CFQ A;  3I5F B;  3R72 A;  2KI6 C;  2O24 A;  3IVT A;  3UFZ A;  2F2O A;  4W7E A;  3JTD C;  5HZO A;  4AS8 A;  2OTG B;  2KI4 C;  1BR4 B;  2QLG B;  2JAD A;  4JQ0 D;  4Z4M A;  2Y4Q A;  1B8C A;  1RRX A;  4NDD A;  3G9A A;  2WOR A;  2ZMU A;  3ZUF A;  3N7H A;  2LHI A;  1U5I B;  3E5W A;  2LP3 A;  4DRW A;  3NT3 A;  1C07 A;  1FF1 A;  2KBM A;  1YVH A;  2GGM A;  2MHH A;  2K7C A;  5KTY A;  1LXF C;  1S26 D;  3FE9 A;  4ORA B;  2OTB A;  5H89 A;  3KF9 A;  4W7F A;  2HPS A;  3SG5 A;  5KTG A;  3S0G A;  2NLN A;  3LK1 A;  4TNC A;  3AAJ A;  1QIW A;  3BFH A;  3O4X A;  4IJ7 A;  2OTG C;  1QTX A;  5KSZ A;  3F45 A;  1NX3 A;  3BXB A;  1BFP A;  2ZO6 A;  1SY9 A;  2P71 A;  1E8A A;  5D69 A;  1IRJ A;  4R6B A;  1SRA A;  2WIS A;  2A47 A;  1Y1X A;  3M22 A;  3OB1 B;  2KDH A;  3K1K A;  1TIZ A;  1K95 A;  1TCO B;  4DCK A;  1SR6 B;  2MAZ A;  4OJ0 A;  1JUO A;  4GF6 B;  4PDZ A;  4ICB A;  3DQI A;  4GES B;  1SCM C;  2FJU B;  2ISD A;  2HCG A;  1F8H A;  1S5G Z;  4W7D A;  4JEO A;  4JRB A;  1EG4 A;  3SIA A;  4W6H A;  1YVL A;  1IIO A;  4GGN A;  2DD7 A;  5DTX A;  1C3Y A;  4GPL B;  5EXC I;  1CM4 A;  1NCY A;  2L51 A;  2M7N A;  2OTE A;  4P1Q A;  2A46 A;  2WUR A;  4PHN A;  1LIN A;  3DVJ A;  3NF0 A;  2SAS A;  1NPQ A;  3LA1 A;  2LVJ A;  5B8I B;  3LVC A;  1CDP A;  1S36 A;  3EVP A;  2QDI A;  1BU3 A;  4H3M A;  4ZFS A;  3DF0 A;  4HE4 A;  2LLS A;  1W7T A;  3SG4 A;  5FVG A;  2FWQ A;  3BYA A;  2JT3 A;  4LW5 A;  2LUC A;  2H5O A;  2NCP A;  5J2O A;  4IK5 A;  4XYN A;  1M39 A;  4YGC B;  4H3L A;  2P6B B;  1QAT A;  3CR2 A;  4Q7U A;  1ALV A;  4I2Y A;  3JTD B;  3CBE A;  1Q4E A;  2CT9 A;  3DQ9 A;  1A75 B;  3DQC A;  3ZUL A;  3CB9 A;  1KQM B;  3FE8 A;  1SCV A;  4IK1 A;  5HKY A;  5JJG A;  3CLN A;  1WRK A;  5EB7 A;  1GFL A;  3SSK A;  2AWL A;  1IG5 A;  1KK8 C;  3VGO A;  2ZO7 A;  5AAN A;  1A4P A;  1CMF A;  1K8U A;  2O60 A;  4OCI A;  1QWV A;  1CLL A;  3C1V A;  1LA3 A;  4W6N A;  3M24 A;  3CGA A;  1AUI B;  3O2P A;  1S3P A;  1ZGP A;  2FOT A;  1SSE B;  1V1G A;  4ZBL A;  1YRT B;  3TDZ A;  4AQJ A;  3CYZ A;  4C0L A;  4BDU A;  2OPO A;  4ZIN A;  1F4Q A;  1BT6 A;  3UO9 A;  2FL1 A;  1WRZ A;  4W7A A;  2M8U A;  3S0D A;  2MRD A;  2JNX A;  4YBH B;  2CBL A;  2QEO A;  2G6E A;  1IH0 A;  2OGR A;  3V2L A;  3IQQ A;  1DJW A;  3SS0 A;  4R6D A;  3DQE A;  1TNX A;  4W6L A;  1DJG A;  1QLS A;  2KFF A;  1QV0 A;  3B87 A;  2HQK A;  5EBJ A;  4PE1 A;  2KAX A;  4UPG A;  2H6V A;  3BXC A;  3GEX A;  3PLF B;  1F54 A;  3AAK A;  1ZUX A;  1TNQ A;  1Q80 A;  2BL0 B;  1BMO A;  2QEV A;  1ZGQ A;  1ZOT B;  3CTN A;  1YJF A;  1G7K A;  3ST2 A;  4GGF C;  4U2V A;  2DUI A;  5FI6 A;  1REC A;  5BQL A;  2QLE A;  3I5H C;  3OSR A;  2Q57 A;  5DQB A;  2LC5 A;  2CNP A;  3GL4 A;  3TDU A;  4LQU A;  3DQM A;  2Z1O A;  2HF5 A;  5AQB B;  3PJ7 A;  5HLV A;  1XAE A;  2F3Z A;  4YRU A;  1CLM A;  4JPZ B;  5LTP A;  4JFG A;  1Y1A A;  1PRW A;  1DQE A;  2OJK A;  1YUT A;  4YGE B;  1PSR A;  2WC8 A;  3MGF A;  4KF5 A;  2QT2 A;  2CCM A;  1HT9 A;  1ORG A;  3H4S E;  4HSZ A;  2BKH B;  1KWO B;  1OQP A;  1KYS A;  1L2O B;  4W7X A;  5HKW A;  1XFR A;  2JTT A;  1OW4 A;  2LUX A;  1A29 A;  5CSJ A;  5HGE A;  2G2B A;  4GBA A;  3IR8 A;  1L2O C;  1HCJ A;  1KFX L;  4W6S A;  1LVC D;  1DJH A;  4AOM A;  3EK7 A;  3OSQ A;  5DQM A;  1OZO A;  2WC5 A;  1NCX A;  2ARL A;  4W6A A;  3NHI A;  1KQM C;  1DMO A;  3KHE A;  2RGI A;  1X02 A;  1DJI A;  1BLQ A;  5DKQ A;  2JOJ A;  3BQ3 A;  2QLH A;  4KA9 A;  4U8D A;  3VIC A;  4CLN A;  2H9W A;  3I5H B;  1YX8 A;  2HET A;  2H5Q A;  2QLG A;  2ZNE A;  4EUL A;  2KBI A;  2IOV A;  2VZX A;  2L2C A;  4YGB B;  1K94 A;  4IK4 A;  2KHN A;  2AHA A;  5BTT B;  1XFY O;  5DRF A;  2QU1 A;  5DPG A;  1UIS A;  2E30 A;  1QYO A;  1XFX O;  2Y1M A;  2G9B A;  5JOL A;  1WRL A;  3FWB A;  3E5T A;  4HVF A;  1IQ3 A;  1EMF A;  2MLF C;  5DKR A;  4W6R A;  1DJY A;  2F3Y A;  1WDC B;  5DRG A;  4W72 A;  2EGD A;  1B4C A;  3TS5 B;  1S6C A;  3VHT A;  4IK8 A;  4MSP A;  2OS8 B;  3NSL A;  5DU0 A;  3SG6 A;  2BCX A;  1CKK A;  2LNK A;  4DXQ A;  4EDO A;  4TZA A;  1TUJ A;  4USL A;  3M0W A;  2H61 A;  3DQU A;  2QAC A;  1SCM B;  2G16 B;  2YDZ A;  2C9I A;  4A4C A;  4JC2 A;  4B30 B;  4BY4 A;  3B88 A;  3GK4 X;  1XVJ A;  2BKI B;  3SSH A;  5ER4 X;  1AJ4 A;  5EB6 A;  1ZFS A;  3HX4 A;  3D75 A;  3K1E A;  2EMD A;  1GL4 A;  3SSY A;  4INX A;  1JBZ A;  1S1E A;  5FI7 A;  4PPL A;  2LVI A;  4W6B A;  4HQ9 A;  3ZNI A;  1XA5 A;  4XOW A;  3GJ2 A;  4RTC A;  3DQL A;  5DPH A;  4ORC B;  2M0R A;  4PE0 A;  2WCK A;  3JVT C;  1ZGO A;  2RH7 A;  4MZJ A;  2KPH A;  2MBX A;  2NCO A;  4JWQ A;  4MBE A;  3SVC A;  4DXI A;  2ICR A;  1G4Y R;  2IE2 A;  1JSA A;  5AXI A;  4OZD A;  1KK8 B;  2K60 A;  1J55 A;  1XFU O;  2LVV A;  4KF4 A;  1DT7 B;  3A8R A;  3DQ2 A;  3A4U B;  1EML A;  1NYA A;  5DY6 A;  3BJH A;  2L50 A;  3O4Y A;  4I5K A;  4F0Z B;  2M97 A;  2M9G A;  4ANJ A;  1CMG A;  4ZF4 A;  4P5O E;  3UNW A;  2EMO A;  1TTX A;  1NX2 A;  1QV1 A;  1B8R A;  1H8B A;  2QZ0 A;  5CSI A;  1TNW A;  3BFB A;  1V1F A;  4GUK A;  1F55 A;  3VRP A;  1S5G Y;  2WHU A;  4L12 A;  2F8P A;  3CZT X;  1KYR A;  2PAL A;  4M2O A;  2EHB A;  4KW4 A;  2YGU A;  1TCF A;  4HRG A;  4PT1 A;  2YE1 A;  1KWO C;  3S05 A;  1EMC A;  1SBJ A;  2VRG A;  2AWK A;  1CDN A;  2KQ6 A;  4BY5 A;  3TS5 C;  2M49 B;  3IF7 A;  1F70 A;  3P8U A;  2DUH A;  2JRF A;  3BUM B;  3AKB A;  1K9P A;  5CSF A;  3FIA A;  2BBM A;  4ZF5 A;  4W6T A;  3ZUJ A;  4OQW A;  4W73 A;  2LVK A;  3SV5 A;  1G33 A;  4UTS A;  4INW A;  2K61 A;  4QJ4 B;  2PVB A;  1XK4 A;  2ZN9 A;  3D78 A;  4H47 A;  1LKJ A;  1HQV A;  1SL9 A;  5KU1 A;  1W7U A;  4KW8 A;  2OKY A;  2COL B;  2WCE A;  2KI4 B;  1OOJ A;  2BE4 A;  1QS7 A;  5DIC A;  1EMB A;  4LJC A;  2TN4 A;  3AI4 A;  1QY3 A;  1Z2C B;  2PYQ A;  3EVU A;  5K89 A;  4GFT A;  1NSH A;  1ODB A;  1LA0 A;  1OOH A;  3WXA A;  1CFF A;  2P70 A;  2AUC A;  3Q8I A;  1N65 A;  1QAS A;  4KGF A;  3I5I B;  3VRR A;  3DQJ A;  1NWD A;  3VB1 A;  3VRQ A;  3SS3 A;  1CDM A;  3CAB A;  5EXB A;  1Q4C A;  1C7W A;  2CTN A;  5IBW A;  3CWG A;  4P76 A;  2L98 A;  2HRS A;  1W7S A;  3OHM B;  1B7T Z;  4R1E A;  2EC6 C;  1Y1U A;  1UP5 A;  5HZS A;  1N2D A;  3EVR A;  3KO0 A;  4TZG A;  3U0K A;  4EMQ A;  4CPV A;  4MZL A;  3NSK A;  4W6K A;  3CGL A;  3L47 A;  3LL8 B;  2BCA A;  1RFJ A;  1RJV A;  4DS7 A;  5I2O A;  4PPJ A;  1S6Z A;  5AER A;  4EDS A;  3MSE B;  1A03 A;  1UHK A;  2KYC A;  4IK3 A;  1KYP A;  2LHL A;  2JT0 A;  1Z1P A;  1AK8 A;  1JFJ A;  3KCT A;  3LK0 A;  3NGV A;  4PPK A;  3R1O A;  1TOP A;  3DQH A;  4W6G A;  5FHV A;  2F2P A;  1UHH A;  1KCY A;  3BXK A;  1DF0 B;  1IKU A;  2AH8 A;  1NUB A;  3PSR A;  3GOF A;  3V3D A;  3WNX B;  2WHS A;  4XOV A;  1FPW A;  1IGV A;  4XGY A;  1TRF A;  3CFF A;  1NP8 A;  1XQM A;  1QXT A;  2L4H A;  4MLW A;  2GX2 A;  2H8Q A;  3TMR A;  2HQW A;  4PHJ A;  1EMK A;  2H61 C;  1YUR A;  1CFD A;  4YGA A;  1EJ3 A;  3DPX A;  5EL2 A;  3OP0 A;  3DQ4 A;  4A4B A;  2DUE A;  1F4O A;  3BUW B;  1S6I A;  2H8V A;  1K96 A;  2BNX A;  1K93 D;  1EMG A;  4ORB B;  1H6R A;  2LAN A;  3I5F C;  3CFA A;  4E68 A;  2M3W A;  3IP2 A;  4MN0 A;  1NIW A;  4B5Y A;  1Q4B A;  1F71 A;  2L0P A;  2H2K A;  1CB1 A;  3DQ3 A;  4PE4 A;  2VVI A;  2EMN A;  4WQ2 A;  3ADF A;  4ZIO A;  2D8N A;  1YHG A;  1CTR A;  1MQ1 A;  2OKW A;  1KFU L;  5CSN A;  1QYF A;  2V53 A;  1YUU A;  1EMA A;  3CDN A;  3RLZ A;  3CS1 A;  2KI6 D;  4MEW A;  5EJU A;  3OX5 A;  3NED A;  1OE9 B;  4RYW A;  2WSO A;  2M1K B;  2Z6X A;  1QJT A;  4DUQ A;  3PJB A;  4MRY A;  4H3N A;  2KAV A;  3DQ5 A;  2NXQ A;  3O77 A;  1IJ5 A;  4YGD B;  4W6F A;  4DXM A;  2FCE A;  2M1U A;  2L2E A;  2L5X B;  1OOF A;  1B9A A;  2V4E A;  2PXS A;  4Z4K A;  2JNF A;  3ED8 A;  2Z6Y A;  2IS9 A;  1YJ2 A;  3LF4 B;  1DC1 A;  4RYS A;  3HCM A;  4JKT A;  2O29 A;  1UUS A;  4W6D A;  3SIB A;  2A53 B;  3GJ1 A;  3SRY A;  4IZN A;  3U8P A;  1BOD A;  3SS4 A;  5DPJ A;  3DQ8 A;  1SK6 D;  1Y0V H;  3BOW A;  2JUL A;  4IK9 A;  2OS8 C;  5EHU A;  3DY9 A;  1GGZ A;  3DQK A;  3DQ1 A;  1FI5 A;  3TDI A;  4KAG A;  2JZI A;  5HZU A;  5HL1 A;  1KQV A;  1UUR A;  2BCB A;  4MVF A;  1QXP A;  2JTZ A;  1DTL A;  1XA9 A;  2KAY A;  4PE7 A;  4Q7R A;  2K7D A;  2VVH A;  4W7C A;  2WOS A;  4NDB A;  4ZCV A;  4C0J A;  3WHT B;  4OKH A;  2DUF A;  1GGW A;  1J7P A;  2HQ8 A;  5HLO A;  3NXA A;  1SPY A;  1Q4A A;  3TUY B;  2HGD A;  3OX6 A;  2LP2 A;  1W7J B;  4XJK B;  4Q04 A;  3AKO A;  2MA2 A;  1KK7 Z;  1JC0 A;  1XFV O;  1XO5 A;  1KFU S;  4YI8 A;  3I5G C;  2POX A;  2Z6Z A;  4DIR A;  1IQ5 A;  1OMR A;  4AR7 A;  1L7Z A;  2KLD A;  1CV7 A;  2DDC A;  1QX2 A;  4J88 A;  4LQT A;  3CR5 X;  4OR9 B;  4H48 A;  5FYX A;  3U0L A;  4OVN F;  2O2B A;  2KNE A;  2EC6 B;  2AWJ A;  4JD9 A;  4OY4 A;  1OMV A;  4LJB A;  4JF9 A;  3SST A;  1RRO A;  3EK4 A;  3LVD A;  4L9M A;  4D1E A;  1KSM A;  2I94 A;  1AP4 A;  4KPI A;  3SVO A;  3P28 A;  3WLD A;  4W6M A;  2K2A A;  3SVB A;  1BF5 A;  1OXD A;  4HRH A;  2LM5 A;  3DVM A;  4WQ3 A;  2V4E C;  2Y0G A;  2PMY A;  4J8A A;  1P28 A;  4LJD C;  1OXF A;  2KFG A;  1KK7 Y;  3WLC A;  3B6X A;  4DXO A;  2C9J A;  3SVE A;  2FZU A;  3LSA A;  3LCP C;  3D10 A;  2B3Q A;  4YI9 A;  4GNK B;  1QVI Z;  3SG7 A;  3U0M A;  4ZF3 A;  3TMT A;  1T14 A;  1M46 A;  3LVA A;  1LS8 A;  3L4A A;  1JC2 A;  5HZT A;  2P4M A;  2JPT A;  4NQG A;  5I8N A;  1KSO A;  3NEZ A;  1CLB A;  3PJ5 A;  2A48 A;  3U8A A;  1ZAC A;  1RTP 1;  2WND A;  3SSV A;  2WHT A;  4FQO A;  1H4U A;  3EKH A;  3ZTF A;  4GOB A;  4OV2 A;  1WY9 A;  1C4F A;  1TWO A;  4ZB1 A;  3D0Y B;  3FWC A;  4N3D A;  4PHM A;  3PIB A;  5I2Q A;  2YE0 A;  1W9Z A;  1R6P A;  3ST0 A;  5G08 A;  1C3Z A;  5TNC A;  2KGR A;  3VRO A;  3ST4 A;  1OMD A;  2JC2 A;  3RM1 A;  3EK8 A;  1QVI Y;  2H5R A;  2GV5 A;  1GGX A;  2K7O A;  3PM2 A;  5DPI A;  1K90 D;  3D76 A;  1PK0 D;  1SYM A;  4OHS A;  1DJZ A;  2K0J A;  3KEV A;  1Y6W A;  2KQY A;  3AI5 A;  2DD9 A;  2KOT A;  4W6I A;  1XFZ O;  2G5Z B;  2SCP A;  2KFH A;  2JXC A;  2I2R E;  2YFP A;  3GK2 A;  1U5I A;  4N1G A;  1ZMZ A;  1B9C A;  3ICB A;  1JBA A;  4FQT A;  5FVI A;  2FJY A;  4MZK A;  1F0B A;  3BFA A;  3DYE A;  3SSP A;  3DQ6 A;  2BEC A;  2GGZ A;  2BBN A;  3DQO A;  1PSB A;  3I5I C;  3WCK A;  1K2H A;  2WCL A;  1J7O A;  4LJD A;  2ZFD A;  1WLM A;  3OBV A;  5PAL A;  4CID A;  2BAP A;  3O6B A;  2VAD A;  1B1G A;  1MYW A;  2CXJ A;  3ST3 A;  2QEH A;  4WRI A;  1N0Y A;  1SNL A;  3QRX A;  5FVF A;  3R1P A;  2KGB C;  1SMG A;  1J7Q A;  1AHR A;  1SL8 A;  1UHN A;  1XSS A;  1G8I A;  5D7F A;  4L1I A;  3U8C A;  2AMI A;  1YX7 A;  2ZRT A;  4IL1 A;  5HW9 A;  2A50 B;  4I5J A;  4CFR A;  1PUL A;  4NDC A;  1S6J A;  1B8L A;  1MF8 B;  1QLK A;  2PSR A;  3I5G B;  5T3I A;  3OGN A;  1OZS A;  5DTZ A;  2BE6 A;  2LMU A;  1VRK A;  2PXW A;  1K9U A;  1J1E A;  3DVK A;  3FE6 A;  3EVV A;  1OOG A;  3CFH A;  1YZW A;  4W6U A;  1SR6 C;  5HYD A;  1D1O A;  4EN1 A;  2I7A A;  1SW8 A;  3S0A A;  3QME A;  5LTR A;  4ORN A;  1GM0 A;  1RWY A;  3BUO B;  2G6Y A;  2NZ0 A;  4W74 A;  3PN7 B;  5AEQ A;  3S0B A;  4W6J A;  3DQD A;  2VVJ A;  3TUY C;  3RZS A;  1F09 A;  4PCW A;  1YTZ C;  3GK1 A;  2WCH A;  1RM9 A;  4W69 A;  4B30 A;  1QX5 B;  2IB6 A;  2QEB A;  4M2Q A;  5I2L A;  2KYF A;  3E3R A;  3R1V A;  3LS3 A;  1A2X A;  1MWN A;  1YRU B;  1JWD A;  1WDC C;  4NWS A;  1RK9 A;  4Q9X A;  3DQF A;  4I5N B;  1BJF A;  3PAT A;  2JU0 A;  2M7L A;  2IB5 A;  1DF0 A;  1ALW A;  5BT0 A;  3CZ2 A;  3DZT A;  1YR5 A;  1M31 A;  2WC6 A;  1FW4 A;  3KCS A;  5LK4 A;  1H4B A;  1IJ6 A;  2KLE A;  4QJ3 B;  3BX9 A;  3CD9 A;  4MRX A;  3CZ0 A;  2H5P A;  2GW3 A;  1XK4 C;  2AWM A;  3DXL A;  5F9G A;  1EG3 A;  4W77 A;  2ERB A;  4KEX A;  3SVR A;  4FTG A;  5DTL A;  3VRN A;  1HUY A;  4W6C A;  4DXP A;  2LE9 B;  3SVS A;  2WIQ A;  3SG2 A;  3JVT B;  1W7I B;  4W75 A;  2QRF A;  1XFW O;  3A8S A;  1MXL C;  4OGS A;  3RWT A;  1JC1 A;  2PAS A;  3K21 A;  5FI2 A;  2PRU A;  4C0K A;  1QIV A;  5D3O A;  3NHT A;  1PVB A;  1YUS A;  1CFC A;  2WCF A;  3DD4 A;  2A56 B;  1M45 A;  2VAE A;  3CZ1 A;  3NSO A;  1DEK A;  3UG0 A;  4W7R A;  3WHU B;  1Q4D A;  4DXN A;  4W6O A;  3B7A A;  3W1D A;  2FCD A;  3CR4 X;  2MLE C;  3GB3 A;  3PFV A;  3D77 A;  2Q91 A;  4W6P A;  4F7F A;  2Y1N A;  2I18 A;  3U0N A;  1B7T Y;  5LTQ A;  3NT9 A;  2LLT A;  1XYD A;  1WLZ A;  3S0F A;  4HQC A;  3O78 A;  5CPV A;  2BTJ A;  1DJX A;  3BUX B;  2G2S B;  5ER5 A;  3E5V A;  2G6X A;  2AAO A;  2G3D B;  4XVP A;  4HQ8 A;  3BOW B;  2K8M B;  3LF3 A;  3DQA A;  1MUX A;  4M2P A;  2Q4U A;  1OSA A;  1OXE A;  3D0Y A;  4I5L B;  1QYQ A;  1BG1 A;  1MOU A;  5J3X A;  3RWA A;  4KW9 A;  2BL0 C;  4JGE A;  1RMP A;  1DVI A;  4HRE E;  4GGF A;  1CM1 A;  5DKN A;  2LMT A;  2A4J A;  2WCB A;  2O5G A;  1FBV A;  1TN4 A;  1UHI A;  3NSI A;  1AVS A;  1M63 B;  2LLU A;  2PQL A;  1A75 A;  1RMO A;  1J1D A;  2L4I A;  3DPW A;  4Q7T A;  1PAL A;  1BOC A;  5BPJ A;  3OB2 B;  2QPT A;  1YHH A;  1MHO A;  3SS5 A;  2B1U A;  2DUG A;  1MR8 A;  5AFP A;  1RMM A;  3EG5 B;  1R2U A;  1NX1 A;  1JFK A;  3LLE A;  3DF0 B;  4KF5 C;  1JF2 A;  4KGE A;  4XJK A;  1NX0 A;  3D73 A;  4W76 A;  1Z4H A;  3S0E A;  3EKJ A;  5HBD A;  2QLI A;  1GQM A;  5GQQ C;  2A54 B;  3DPZ A;  1OOI X;  1CFP A;  3VHT B;  1DGU A;  2LAP A;  3SVD A;  3L4L A;  5F6T A;  1MXE A;  2Y5I A;  1XMZ A;  1NCZ A;  1J7R A;  3BXA A;  3VK1 A;  1YHI A;  1JBY A;  1KFX S;  1AJ5 A;  3SVN A;  5I94 A;  2DOQ A;  2GTE A;  4ZCU A;  4P2Y B;  2M29 A;  1K9K A;  2ZN8 A;  1EH2 A;  4N5X A;  3SJS A;  1BR1 B;  1CDL A;  1GJY A;  3KPX A;  3DQ7 A;  1FI6 A;  2ZND A;  1EL4 A;  4PFE A;  1UHJ A;  1Q73 A;  2B3P A;  4QJ5 B;  5EXU A;  1TUZ A;  2DDD A;  1DGV A;  2ZMW A;  3I19 A;  2HPW A;  1UWO A;  2WCM A;  2JWW A;  2MJW B;  3SG3 A;  3H1R A;  1TNP A;  2LCP A;  2HFC A;  1ZUZ A;  4PAL A;  2G3O A;  3D74 A;  1CNP A;  3CD1 A;  4L13 A;  2JT8 A;  4KYN A;  1C7V A;  3SVU A;  2V4E B;  4Q9W A;  4DKM A;  1SL7 A;  3PAL A;  3H1O A;  3OGO A;  1EMM A;  4GAO A;  1IWQ A;  2JPO A;  1QX7 A;  2GW4 B;  3PN7 C;  4ETO A;  2R2I A;  3FS7 A;  3DQN A;  2F33 A;  2ZKM X;  1KP5 A;  3SSL A;  5BTT A;  2E6W A;  5H88 A;  3IQO A;  1MOV A;  2GX0 A;  5HKZ A;  4DKN A;  2K2F A;  2Q6P A;  1EME A;  1B47 A; 
#chains in the Genus database with same CATH homology
 2JXL A;  4J89 A;  2HGY A;  2KSP A;  3AKA A;  2JQ6 A;  2HQZ A;  2WSN A;  1Z1Q A;  5H87 A;  3W1C A;  4AQI A;  2HJO A;  2LMV A;  1SKT A;  1JF0 A;  2LV7 A;  4XL5 A;  1PVA A;  3PM8 A;  4PHK A;  3TZ1 A;  4N1F A;  3DVE A;  2A52 B;  5DTY A;  3ZWH A;  2K7B A;  1YFP A;  1EXR A;  3BUN B;  2ZRS A;  4CFQ A;  3I5F B;  2KI6 C;  2O24 A;  3UFZ A;  2F2O A;  4W7E A;  3JTD C;  5HZO A;  4AS8 A;  2OTG B;  2KI4 C;  1BR4 B;  2QLG B;  2JAD A;  4JQ0 D;  4Z4M A;  2Y4Q A;  1B8C A;  1RRX A;  4NDD A;  3G9A A;  2WOR A;  2ZMU A;  3ZUF A;  2LHI A;  1U5I B;  3E5W A;  2LP3 A;  4DRW A;  3NT3 A;  1C07 A;  1FF1 A;  2KBM A;  1YVH A;  2GGM A;  2MHH A;  2K7C A;  5KTY A;  1LXF C;  1S26 D;  4ORA B;  2OTB A;  5H89 A;  3KF9 A;  4W7F A;  2HPS A;  3SG5 A;  5KTG A;  2NLN A;  3LK1 A;  4TNC A;  3AAJ A;  1QIW A;  2OTG C;  1QTX A;  5KSZ A;  3F45 A;  1NX3 A;  3BXB A;  1BFP A;  2ZO6 A;  1SY9 A;  1E8A A;  5D69 A;  1IRJ A;  4R6B A;  1SRA A;  2WIS A;  2A47 A;  1Y1X A;  3M22 A;  3OB1 B;  2KDH A;  3K1K A;  1TIZ A;  1K95 A;  1TCO B;  4DCK A;  1SR6 B;  2MAZ A;  4OJ0 A;  1JUO A;  4GF6 B;  4PDZ A;  4ICB A;  3DQI A;  4GES B;  1SCM C;  2FJU B;  2ISD A;  2HCG A;  1F8H A;  1S5G Z;  4W7D A;  4JEO A;  4JRB A;  1EG4 A;  3SIA A;  4W6H A;  1YVL A;  4GGN A;  2DD7 A;  5DTX A;  4GPL B;  5EXC I;  1CM4 A;  1NCY A;  2L51 A;  2M7N A;  2OTE A;  4P1Q A;  2A46 A;  2WUR A;  4PHN A;  1LIN A;  3DVJ A;  3NF0 A;  2SAS A;  1NPQ A;  3LA1 A;  2LVJ A;  5B8I B;  3LVC A;  1CDP A;  1S36 A;  3EVP A;  1BU3 A;  4H3M A;  4ZFS A;  3DF0 A;  4HE4 A;  2LLS A;  1W7T A;  3SG4 A;  5FVG A;  2FWQ A;  3BYA A;  2JT3 A;  4LW5 A;  2LUC A;  2H5O A;  2NCP A;  5J2O A;  4IK5 A;  4XYN A;  1M39 A;  4YGC B;  4H3L A;  2P6B B;  1QAT A;  3CR2 A;  4Q7U A;  1ALV A;  4I2Y A;  3JTD B;  3CBE A;  1Q4E A;  2CT9 A;  3DQ9 A;  1A75 B;  3DQC A;  3ZUL A;  3CB9 A;  1KQM B;  1SCV A;  4IK1 A;  5HKY A;  5JJG A;  3CLN A;  1WRK A;  5EB7 A;  1GFL A;  3SSK A;  2AWL A;  1IG5 A;  1KK8 C;  3VGO A;  2ZO7 A;  5AAN A;  1A4P A;  1CMF A;  1K8U A;  2O60 A;  4OCI A;  1CLL A;  3C1V A;  1LA3 A;  4W6N A;  3M24 A;  3CGA A;  1AUI B;  3O2P A;  1S3P A;  1ZGP A;  2FOT A;  1V1G A;  4ZBL A;  1YRT B;  3TDZ A;  4AQJ A;  4C0L A;  4BDU A;  2OPO A;  4ZIN A;  1F4Q A;  1BT6 A;  2FL1 A;  1WRZ A;  4W7A A;  2M8U A;  2MRD A;  2JNX A;  4YBH B;  2CBL A;  2G6E A;  1IH0 A;  2OGR A;  3IQQ A;  1DJW A;  3SS0 A;  4R6D A;  3DQE A;  1TNX A;  4W6L A;  1DJG A;  1QLS A;  2KFF A;  1QV0 A;  2HQK A;  5EBJ A;  4PE1 A;  2KAX A;  4UPG A;  2H6V A;  3BXC A;  3GEX A;  3PLF B;  1F54 A;  3AAK A;  1ZUX A;  1TNQ A;  1Q80 A;  2BL0 B;  1BMO A;  1ZGQ A;  1ZOT B;  3CTN A;  1YJF A;  1G7K A;  3ST2 A;  4GGF C;  4U2V A;  2DUI A;  1REC A;  5BQL A;  2QLE A;  3I5H C;  3OSR A;  2Q57 A;  5DQB A;  2LC5 A;  2CNP A;  3GL4 A;  3TDU A;  4LQU A;  3DQM A;  2Z1O A;  2HF5 A;  5AQB B;  3PJ7 A;  5HLV A;  1XAE A;  2F3Z A;  4YRU A;  1CLM A;  4JPZ B;  5LTP A;  4JFG A;  1Y1A A;  1PRW A;  2OJK A;  1YUT A;  4YGE B;  1PSR A;  2WC8 A;  3MGF A;  4KF5 A;  2QT2 A;  2CCM A;  1HT9 A;  3H4S E;  4HSZ A;  2BKH B;  1KWO B;  1OQP A;  1KYS A;  1L2O B;  4W7X A;  5HKW A;  2JTT A;  2LUX A;  1A29 A;  5CSJ A;  5HGE A;  2G2B A;  4GBA A;  3IR8 A;  1L2O C;  1HCJ A;  1KFX L;  4W6S A;  1LVC D;  1DJH A;  4AOM A;  3EK7 A;  3OSQ A;  5DQM A;  1OZO A;  1NCX A;  2ARL A;  4W6A A;  1KQM C;  1DMO A;  3KHE A;  2RGI A;  1X02 A;  1DJI A;  1BLQ A;  5DKQ A;  2JOJ A;  3BQ3 A;  2QLH A;  4KA9 A;  4U8D A;  3VIC A;  4CLN A;  2H9W A;  3I5H B;  1YX8 A;  2HET A;  2H5Q A;  2QLG A;  2ZNE A;  4EUL A;  2KBI A;  2IOV A;  2VZX A;  4YGB B;  1K94 A;  4IK4 A;  2KHN A;  2AHA A;  5BTT B;  1XFY O;  5DRF A;  2QU1 A;  5DPG A;  1UIS A;  2E30 A;  1QYO A;  1XFX O;  2Y1M A;  2G9B A;  5JOL A;  1WRL A;  3FWB A;  3E5T A;  4HVF A;  1IQ3 A;  1EMF A;  2MLF C;  5DKR A;  4W6R A;  1DJY A;  2F3Y A;  1WDC B;  5DRG A;  4W72 A;  2EGD A;  1B4C A;  3TS5 B;  1S6C A;  3VHT A;  4IK8 A;  4MSP A;  2OS8 B;  3NSL A;  5DU0 A;  3SG6 A;  2BCX A;  1CKK A;  2LNK A;  4DXQ A;  4EDO A;  4TZA A;  4USL A;  3M0W A;  2H61 A;  3DQU A;  2QAC A;  1SCM B;  2G16 B;  2YDZ A;  2C9I A;  4A4C A;  4JC2 A;  4B30 B;  4BY4 A;  3GK4 X;  1XVJ A;  2BKI B;  3SSH A;  5ER4 X;  1AJ4 A;  5EB6 A;  1ZFS A;  3HX4 A;  2EMD A;  1GL4 A;  3SSY A;  1JBZ A;  1S1E A;  4PPL A;  2LVI A;  4W6B A;  4HQ9 A;  3ZNI A;  1XA5 A;  4XOW A;  3GJ2 A;  4RTC A;  3DQL A;  5DPH A;  4ORC B;  2M0R A;  4PE0 A;  3JVT C;  1ZGO A;  2RH7 A;  4MZJ A;  2MBX A;  2NCO A;  4JWQ A;  4DXI A;  4MBE A;  3SVC A;  2ICR A;  1G4Y R;  2IE2 A;  1JSA A;  5AXI A;  1KK8 B;  1J55 A;  1XFU O;  2LVV A;  4KF4 A;  1DT7 B;  3A8R A;  3DQ2 A;  3A4U B;  1EML A;  1NYA A;  5DY6 A;  2L50 A;  3O4Y A;  4I5K A;  4F0Z B;  2M97 A;  2M9G A;  4ANJ A;  1CMG A;  4ZF4 A;  4P5O E;  2EMO A;  1TTX A;  1NX2 A;  1QV1 A;  1B8R A;  1H8B A;  2QZ0 A;  5CSI A;  1TNW A;  1V1F A;  4GUK A;  1F55 A;  3VRP A;  1S5G Y;  2WHU A;  4L12 A;  2F8P A;  3CZT X;  1KYR A;  2PAL A;  4M2O A;  2EHB A;  4KW4 A;  1TCF A;  4HRG A;  2YE1 A;  1KWO C;  3S05 A;  1EMC A;  1SBJ A;  2VRG A;  2AWK A;  1CDN A;  2KQ6 A;  4BY5 A;  3TS5 C;  2M49 B;  3IF7 A;  1F70 A;  3P8U A;  2DUH A;  2JRF A;  3BUM B;  3AKB A;  1K9P A;  5CSF A;  3FIA A;  2BBM A;  4ZF5 A;  4W6T A;  3ZUJ A;  4OQW A;  4W73 A;  2LVK A;  3SV5 A;  1G33 A;  4UTS A;  2K61 A;  4QJ4 B;  2PVB A;  1XK4 A;  2ZN9 A;  4H47 A;  1LKJ A;  1HQV A;  1SL9 A;  5KU1 A;  1W7U A;  4KW8 A;  2OKY A;  2COL B;  2WCE A;  2KI4 B;  1OOJ A;  2BE4 A;  1QS7 A;  1EMB A;  4LJC A;  2TN4 A;  3AI4 A;  1QY3 A;  3EVU A;  5K89 A;  4GFT A;  1NSH A;  1ODB A;  1LA0 A;  3WXA A;  1CFF A;  2AUC A;  1N65 A;  1QAS A;  4KGF A;  3I5I B;  3VRR A;  3DQJ A;  1NWD A;  3VRQ A;  1CDM A;  5EXB A;  1Q4C A;  1C7W A;  2CTN A;  5IBW A;  3CWG A;  4P76 A;  2L98 A;  2HRS A;  1W7S A;  3OHM B;  1B7T Z;  4R1E A;  2EC6 C;  1Y1U A;  1UP5 A;  5HZS A;  1N2D A;  3EVR A;  3KO0 A;  4TZG A;  3U0K A;  4EMQ A;  4CPV A;  4MZL A;  3NSK A;  4W6K A;  3CGL A;  3LL8 B;  2BCA A;  1RFJ A;  1RJV A;  4DS7 A;  5I2O A;  4PPJ A;  1S6Z A;  4EDS A;  5AER A;  3MSE B;  1A03 A;  1UHK A;  2KYC A;  4IK3 A;  1KYP A;  2LHL A;  2JT0 A;  1Z1P A;  1AK8 A;  1JFJ A;  3KCT A;  3LK0 A;  4PPK A;  1TOP A;  3DQH A;  4W6G A;  5FHV A;  2F2P A;  1UHH A;  1KCY A;  3BXK A;  1DF0 B;  1IKU A;  2AH8 A;  1NUB A;  3PSR A;  3GOF A;  3V3D A;  3WNX B;  2WHS A;  4XOV A;  1FPW A;  1IGV A;  4XGY A;  1TRF A;  3CFF A;  1NP8 A;  1XQM A;  1QXT A;  2L4H A;  4MLW A;  2GX2 A;  2H8Q A;  3TMR A;  2HQW A;  4PHJ A;  1EMK A;  2H61 C;  1YUR A;  1CFD A;  4YGA A;  1EJ3 A;  3DPX A;  3OP0 A;  3DQ4 A;  4A4B A;  2DUE A;  1F4O A;  3BUW B;  1S6I A;  1K96 A;  1K93 D;  1EMG A;  4ORB B;  1H6R A;  2LAN A;  3I5F C;  3CFA A;  4E68 A;  2M3W A;  3IP2 A;  4MN0 A;  1NIW A;  4B5Y A;  1Q4B A;  1F71 A;  2L0P A;  2H2K A;  1CB1 A;  3DQ3 A;  4PE4 A;  2VVI A;  2EMN A;  4WQ2 A;  3ADF A;  4ZIO A;  2D8N A;  1YHG A;  1CTR A;  1MQ1 A;  2OKW A;  1KFU L;  5CSN A;  1QYF A;  2V53 A;  1YUU A;  1EMA A;  3RLZ A;  3CS1 A;  2KI6 D;  4MEW A;  5EJU A;  3OX5 A;  3NED A;  1OE9 B;  4RYW A;  2WSO A;  2M1K B;  2Z6X A;  1QJT A;  4DUQ A;  3PJB A;  4MRY A;  4H3N A;  2KAV A;  3DQ5 A;  2NXQ A;  3O77 A;  1IJ5 A;  4YGD B;  4W6F A;  4DXM A;  2FCE A;  2M1U A;  2L2E A;  2L5X B;  1B9A A;  2V4E A;  2PXS A;  4Z4K A;  2JNF A;  3ED8 A;  2Z6Y A;  2IS9 A;  1YJ2 A;  3LF4 B;  4RYS A;  3HCM A;  2O29 A;  1UUS A;  4W6D A;  3SIB A;  2A53 B;  3GJ1 A;  3SRY A;  4IZN A;  3U8P A;  1BOD A;  5DPJ A;  3DQ8 A;  1SK6 D;  1Y0V H;  3BOW A;  2JUL A;  4IK9 A;  2OS8 C;  5EHU A;  1GGZ A;  3DQK A;  3DQ1 A;  1FI5 A;  3TDI A;  4KAG A;  2JZI A;  5HZU A;  1KQV A;  1UUR A;  2BCB A;  4MVF A;  1QXP A;  2JTZ A;  1DTL A;  1XA9 A;  2KAY A;  4PE7 A;  4Q7R A;  2K7D A;  2VVH A;  4W7C A;  2WOS A;  4NDB A;  4ZCV A;  4C0J A;  3WHT B;  4OKH A;  2DUF A;  1GGW A;  1J7P A;  2HQ8 A;  5HLO A;  3NXA A;  1SPY A;  1Q4A A;  3TUY B;  2HGD A;  3OX6 A;  2LP2 A;  1W7J B;  4XJK B;  4Q04 A;  3AKO A;  2MA2 A;  1KK7 Z;  1JC0 A;  1XFV O;  1XO5 A;  1KFU S;  4YI8 A;  3I5G C;  2POX A;  2Z6Z A;  4DIR A;  1IQ5 A;  1OMR A;  4AR7 A;  1L7Z A;  2DDC A;  1CV7 A;  1QX2 A;  4J88 A;  4LQT A;  3CR5 X;  4OR9 B;  4H48 A;  5FYX A;  3U0L A;  4OVN F;  2O2B A;  2KNE A;  2EC6 B;  2AWJ A;  1OMV A;  4OY4 A;  4LJB A;  4JF9 A;  3SST A;  1RRO A;  3EK4 A;  3LVD A;  4L9M A;  4D1E A;  1KSM A;  2I94 A;  1AP4 A;  4KPI A;  3SVO A;  3P28 A;  3WLD A;  4W6M A;  2K2A A;  3SVB A;  1BF5 A;  1OXD A;  4HRH A;  2LM5 A;  3DVM A;  4WQ3 A;  2V4E C;  2Y0G A;  2PMY A;  4J8A A;  4LJD C;  1OXF A;  2KFG A;  1KK7 Y;  3WLC A;  4DXO A;  2C9J A;  3SVE A;  2FZU A;  3LSA A;  3LCP C;  3D10 A;  2B3Q A;  4YI9 A;  4GNK B;  1QVI Z;  3SG7 A;  3U0M A;  4ZF3 A;  3TMT A;  1M46 A;  3LVA A;  1JC2 A;  5HZT A;  2P4M A;  2JPT A;  4NQG A;  5I8N A;  1KSO A;  3NEZ A;  1CLB A;  3PJ5 A;  2A48 A;  3U8A A;  1ZAC A;  1RTP 1;  2WND A;  3SSV A;  2WHT A;  4FQO A;  1H4U A;  3EKH A;  3ZTF A;  4GOB A;  4OV2 A;  1WY9 A;  1C4F A;  4ZB1 A;  3D0Y B;  3FWC A;  4N3D A;  4PHM A;  3PIB A;  5I2Q A;  2YE0 A;  1R6P A;  3ST0 A;  5G08 A;  5TNC A;  2KGR A;  3VRO A;  3ST4 A;  1OMD A;  2JC2 A;  3RM1 A;  3EK8 A;  1QVI Y;  2H5R A;  2GV5 A;  1GGX A;  2K7O A;  5DPI A;  1K90 D;  1PK0 D;  1SYM A;  4OHS A;  1DJZ A;  2K0J A;  3KEV A;  1Y6W A;  2KQY A;  3AI5 A;  2DD9 A;  2KOT A;  4W6I A;  1XFZ O;  2G5Z B;  2SCP A;  2KFH A;  2JXC A;  2I2R E;  2YFP A;  3GK2 A;  1U5I A;  4N1G A;  1ZMZ A;  1B9C A;  3ICB A;  1JBA A;  5FVI A;  4MZK A;  1F0B A;  3SSP A;  3DQ6 A;  2BEC A;  2GGZ A;  2BBN A;  3DQO A;  1PSB A;  3I5I C;  3WCK A;  1K2H A;  1J7O A;  4LJD A;  2ZFD A;  1WLM A;  5PAL A;  4CID A;  3O6B A;  2VAD A;  1B1G A;  1MYW A;  2CXJ A;  3ST3 A;  4WRI A;  1N0Y A;  1SNL A;  3QRX A;  5FVF A;  2KGB C;  1SMG A;  1J7Q A;  1AHR A;  1SL8 A;  1UHN A;  1XSS A;  1G8I A;  5D7F A;  4L1I A;  3U8C A;  2AMI A;  1YX7 A;  2ZRT A;  4IL1 A;  5HW9 A;  2A50 B;  4I5J A;  4CFR A;  1PUL A;  4NDC A;  1S6J A;  1B8L A;  1MF8 B;  1QLK A;  2PSR A;  3I5G B;  5T3I A;  1OZS A;  5DTZ A;  2BE6 A;  2LMU A;  1VRK A;  2PXW A;  1K9U A;  1J1E A;  3DVK A;  3EVV A;  3CFH A;  1YZW A;  4W6U A;  1SR6 C;  5HYD A;  1D1O A;  4EN1 A;  2I7A A;  1SW8 A;  5LTR A;  4ORN A;  1RWY A;  3BUO B;  2G6Y A;  2NZ0 A;  4W74 A;  3PN7 B;  5AEQ A;  4W6J A;  3DQD A;  2VVJ A;  3TUY C;  1F09 A;  4PCW A;  1YTZ C;  3GK1 A;  1RM9 A;  4W69 A;  4B30 A;  1QX5 B;  2IB6 A;  4M2Q A;  5I2L A;  2KYF A;  3E3R A;  3LS3 A;  1A2X A;  1MWN A;  1YRU B;  1JWD A;  1WDC C;  4NWS A;  1RK9 A;  4Q9X A;  3DQF A;  4I5N B;  1BJF A;  3PAT A;  2JU0 A;  2M7L A;  2IB5 A;  1DF0 A;  1ALW A;  5BT0 A;  1YR5 A;  1M31 A;  1FW4 A;  3KCS A;  5LK4 A;  1H4B A;  1IJ6 A;  4QJ3 B;  3BX9 A;  3CD9 A;  4MRX A;  2H5P A;  2GW3 A;  1XK4 C;  2AWM A;  5F9G A;  1EG3 A;  4W77 A;  4KEX A;  3SVR A;  4FTG A;  5DTL A;  3VRN A;  1HUY A;  4W6C A;  4DXP A;  2LE9 B;  3SVS A;  2WIQ A;  3SG2 A;  3JVT B;  1W7I B;  4W75 A;  2QRF A;  1XFW O;  3A8S A;  1MXL C;  4OGS A;  3RWT A;  1JC1 A;  2PAS A;  3K21 A;  2PRU A;  4C0K A;  1QIV A;  1PVB A;  1YUS A;  1CFC A;  2WCF A;  3DD4 A;  2A56 B;  1M45 A;  2VAE A;  3NSO A;  3UG0 A;  4W7R A;  3WHU B;  1Q4D A;  4DXN A;  4W6O A;  3W1D A;  2FCD A;  3CR4 X;  2MLE C;  3GB3 A;  3PFV A;  2Q91 A;  4W6P A;  2Y1N A;  2I18 A;  3U0N A;  1B7T Y;  5LTQ A;  2LLT A;  3NT9 A;  1XYD A;  1WLZ A;  4HQC A;  3O78 A;  5CPV A;  2BTJ A;  1DJX A;  3BUX B;  2G2S B;  5ER5 A;  3E5V A;  2G6X A;  2AAO A;  2G3D B;  4XVP A;  4HQ8 A;  3BOW B;  2K8M B;  3LF3 A;  3DQA A;  1MUX A;  4M2P A;  2Q4U A;  1OSA A;  1OXE A;  3D0Y A;  4I5L B;  1QYQ A;  1BG1 A;  1MOU A;  5J3X A;  3RWA A;  4KW9 A;  2BL0 C;  4JGE A;  1RMP A;  1DVI A;  4HRE E;  4GGF A;  1CM1 A;  5DKN A;  2LMT A;  2A4J A;  2WCB A;  2O5G A;  1FBV A;  1TN4 A;  1UHI A;  3NSI A;  1AVS A;  1M63 B;  2LLU A;  1A75 A;  1RMO A;  1J1D A;  2L4I A;  3DPW A;  4Q7T A;  1PAL A;  1BOC A;  5BPJ A;  3OB2 B;  2QPT A;  1YHH A;  1MHO A;  2B1U A;  2DUG A;  1MR8 A;  5AFP A;  1RMM A;  1R2U A;  1NX1 A;  1JFK A;  3LLE A;  3DF0 B;  4KF5 C;  1JF2 A;  4KGE A;  4XJK A;  1NX0 A;  4W76 A;  5HBD A;  3EKJ A;  2QLI A;  1GQM A;  5GQQ C;  2A54 B;  3DPZ A;  1CFP A;  3VHT B;  1DGU A;  2LAP A;  3SVD A;  5F6T A;  1MXE A;  2Y5I A;  1XMZ A;  1NCZ A;  1J7R A;  3BXA A;  3VK1 A;  1YHI A;  1JBY A;  1KFX S;  1AJ5 A;  3SVN A;  2DOQ A;  4ZCU A;  4P2Y B;  2M29 A;  1K9K A;  2ZN8 A;  1EH2 A;  4N5X A;  3SJS A;  1BR1 B;  1CDL A;  1GJY A;  3KPX A;  3DQ7 A;  1FI6 A;  2ZND A;  1EL4 A;  4PFE A;  1UHJ A;  1Q73 A;  2B3P A;  4QJ5 B;  5EXU A;  2DDD A;  1DGV A;  2ZMW A;  3I19 A;  2HPW A;  1UWO A;  2JWW A;  2MJW B;  3SG3 A;  3H1R A;  1TNP A;  2LCP A;  2HFC A;  1ZUZ A;  4PAL A;  2G3O A;  1CNP A;  3CD1 A;  4L13 A;  2JT8 A;  1C7V A;  3SVU A;  2V4E B;  4Q9W A;  4DKM A;  1SL7 A;  3PAL A;  3H1O A;  3OGO A;  1EMM A;  4GAO A;  1IWQ A;  1QX7 A;  2GW4 B;  3PN7 C;  4ETO A;  2R2I A;  3FS7 A;  3DQN A;  2F33 A;  2ZKM X;  1KP5 A;  3SSL A;  5BTT A;  2E6W A;  5H88 A;  3IQO A;  1MOV A;  2GX0 A;  5HKZ A;  4DKN A;  2K2F A;  2Q6P A;  1EME A;  1B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...