3EK8A

Calcium-saturated gcamp2 t116v/g87r mutant monomer
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
408
structure length
393
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDRGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
total genus 129
structure length 393
sequence length 408
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek8A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek8A02
4H48A 3CZTX 2KQYA 2ZKMX 1CTRA 2O24A 1PSBA 4IK1A 1ZGQA 1N0YA 2WHUA 1M31A 3NEDA 2M7LA 2F2PA 3I5IC 4AQIA 3IQQA 3BUWB 2YDZA 1X02A 2QLGA 4EDOA 3M24A 4ICBA 1V1GA 1F4QA 3A8RA 1XFZO 4R1EA 1YZWA 2HFCA 1F55A 1WDCB 3VRQA 1QYFA 1QYQA 2M7NA 3VRPA 1XFYO 3OHMB 2A46A 1SCVA 4GFTA 4PCWA 1K90D 3WHUB 2QT2A 3SSYA 2H5RA 1NX3A 2YE0A 4CFRA 3RWAA 1J7RA 2LNKA 1YHGA 2L2EA 2I2RE 2HQZA 4LQUA 3GJ2A 2YE1A 1FW4A 2LVKA 4PE0A 1H4BA 2PVBA 1RMPA 5DTZA 3ZUFA 4UPGA 1HQVA 3U0KA 3ADFA 2DD9A 2A47A 1VRKA 3AAJA 3LK0A 5DPHA 1OOJA 3SVDA 2FL1A 4GF6B 1L7ZA 3D0YB 2ZRTA 2BKIB 1BOCA 3SIAA 3AAKA 4W6TA 1OXDA 4N1FA 4AS8A 1G8IA 1H8BA 3NSIA 5BT0A 5EBJA 3SVNA 1EMFA 4W6LA 1BG1A 1GGZA 2FCDA 5FHVA 4MZKA 1KYRA 1NP8A 2KGRA 1CDMA 2MLFC 1PULA 1EL4A 2KOTA 2LLUA 1XYDA 1OE9B 2DUIA 1KFUL 4PPLA 1QX5B 1QATA 4DKMA 1NX2A 2JU0A 5J2OA 4MSPA 4KW9A 1QX7A 3A4UB 1GJYA 2WCFA 3G9AA 3DVKA 4PPJA 1AP4A 3CGAA 1GFLA 4KEXA 2LP3A 1YVLA 1Y1AA 1B8LA 5LK4A 2KSPA 1GGWA 1KSOA 3AKAA 1PVAA 5DQBA 1KYPA 1XA5A 2H61C 1QXPA 4R6DA 2CXJA 2H5OA 1TIZA 1QY3A 5AERA 4JFGA 5CSFA 1UHKA 2VRGA 2K7BA 2DUHA 1GGXA 1DF0A 2AH8A 2KHNA 2NZ0A 1K94A 1IGVA 4QJ4B 3OB1B 5F6TA 1RM9A 2LAPA 1UHJA 2H6VA 2JT0A 2HF5A 3MSEB 4PE1A 3TMTA 2ZMWA 1TOPA 1KFXS 2MLEC 3CR2A 1JC1A 3AI4A 2JZIA 2Q91A 2E6WA 4I5NB 1QIVA 1JF0A 4Q7UA 1B4CA 1YHIA 2C9JA 5CSNA 4DUQA 2KFHA 5KSZA 4M2QA 4TNCA 1XFWO 5K89A 3UFZA 3M0WA 1Z1PA 4N3DA 1FPWA 5F9GA 1XAEA 3BQ3A 4PDZA 1YUTA 4GAOA 5HBDA 4RTCA 1CMFA 2QU1A 4B30B 3OX6A 3SG4A 2NCPA 2WSNA 2DOQA 1EMBA 1XFVO 4KGFA 3DQ4A 2HCGA 1SPYA 4RYSA 1PK0D 3IF7A 2Y4QA 1YTZC 2QRFA 4IK3A 2AWKA 1IJ5A 3LLEA 4W7EA 2QLGB 5DY6A 4DKNA 1TTXA 4EMQA 1KK8C 1JUOA 2K7DA 4MN0A 1SL7A 4XL5A 1QS7A 3SG6A 1DJYA 2OKWA 5LTRA 1ZGPA 1NCYA 4GGFA 1JBAA 4MLWA 1F0BA 1ZUXA 2M29A 3IR8A 1DJIA 1TN4A 1CDNA 4W6FA 1TNWA 2R2IA 1B1GA 2OS8C 3AI5A 3SSVA 1FI5A 1B7TZ 3SSTA 1EMLA 2V53A 2BKHB 2NCOA 3JTDB 1RK9A 2M8UA 1MR8A 4W6RA 1BF5A 4NDBA 5EHUA 4Z4KA 3SVSA 3NT9A 3H1OA 2OJKA 1IJ6A 2LVIA 1OZSA 4W6GA 1ZFSA 2EMNA 2Q6PA 2K2AA 1NX0A 4XOVA 2AWMA 3KCSA 4OQWA 2G2SB 1KCYA 3E5TA 1A75A 2LMUA 5KU1A 1KK8B 1CFCA 2NLNA 2JNXA 4A4CA 1J7QA 5DPIA 2CTNA 1CFPA 3DQCA 4DS7A 1SNLA 1OMVA 2EC6C 4W6JA 1QV1A 1LVCD 2NXQA 5AFPA 1YR5A 5DTXA 1K8UA 3O4YA 5DU0A 1SW8A 3OSRA 4OGSA 5DQMA 3OP0A 2OS8B 4BDUA 3SV5A 1CFFA 1UHIA 1YJFA 4KPIA 3VICA 2KI4C 2WC8A 3DQJA 2FZUA 1ODBA 4ORNA 2L0PA 4M2PA 1DJZA 1JBYA 2G3DB 1CB1A 2ZRSA 3PN7C 2WCEA 3FS7A 1XA9A 3DQ7A 2Q57A 4WRIA 4Q7RA 1EG3A 2ZMUA 2HGDA 1WRLA 4GUKA 2LLSA 3WCKA 2IE2A 1M63B 3DF0A 3GK2A 3PM8A 3WXAA 1K9UA 4Q7TA 3PLFB 5CSJA 4W7FA 1YVHA 3TUYC 3H4SE 3U0LA 2VADA 4M2OA 2HJOA 2GW4B 3GK1A 3PSRA 3LSAA 1DF0B 2MA2A 1MF8B 3V3DA 2LUXA 4U8DA 2BCAA 1K2HA 2WOSA 2O5GA 2OPOA 1Q4CA 2B3QA 4HQCA 1SR6C 2KFFA 5DPJA 4W6UA 3IP2A 2MBXA 2H5QA 4W7RA 3SSPA 2EC6B 2WHSA 4W6KA 1M46A 4W6IA 5EXCI 3EK4A 3PJ5A 4HQ8A 4EULA 1KK7Y 4OCIA 2BTJA 4PPKA 2WHTA 1SK6D 2DUFA 4W69A 1XFUO 1SY9A 3LVCA 2K2FA 4GGFC 4FQOA 2FWQA 3BUMB 4RYWA 3PN7B 1ALVA 5H87A 4HQ9A 2LHIA 1NCXA 5FYXA 4HREE 4W72A 3SS0A 2KAVA 4W6MA 1TCOB 2LCPA 1QV0A 2Z6XA 1FBVA 5EXUA 1K96A 1W7IB 2LMTA 4WQ3A 4Q9XA 3TUYB 4DXIA 1F70A 4JRBA 4CPVA 4YGBB 4YI9A 1MOVA 3CFAA 2L4IA 1SL8A 3E5VA 4U2VA 4PHKA 4JC2A 2JT3A 4EDSA 3O6BA 4W7AA 4YGDB 1LINA 3LCPC 4ZF4A 2GGMA 3HX4A 5EB7A 1NCZA 1XSSA 2H8QA 1BR1B 4W6DA 3DQ9A 4PHNA 2K0JA 2QPTA 2BL0B 3EVPA 1Q80A 3PFVA 2RGIA 1S6IA 5H89A 1BU3A 4JWQA 4MEWA 5ER4X 3CGLA 1IKUA 2H2KA 1EJ3A 1IWQA 5T3IA 4D1EA 3DQUA 2F2OA 5IBWA 1YURA 5DTLA 1SL9A 1W7SA 3K1KA 2KYFA 2JQ6A 2GX2A 1CM4A 4YRUA 2JXLA 3HCMA 1QVIY 2P4MA 1YFPA 4ZBLA 4HSZA 1QX2A 1Q4BA 1YRTB 4PE7A 4JQ0D 4KA9A 4GPLB 4W6NA 1GL4A 1KFXL 3I5IB 3E3RA 1AK8A 3P28A 3KEVA 1ZACA 1Y0VH 2A4JA 3I5HC 4PALA 3SIBA 2ZO7A 4FTGA 1A75B 2KNEA 4KGEA 3OGOA 1MUXA 4W76A 3LVDA 3GJ1A 4E68A 2HQ8A 1MHOA 4KF4A 2L4HA 1EMEA 1C07A 3DQLA 4W73A 1KYSA 1Y1XA 2LV7A 3SG2A 2LUCA 5EXBA 1QLSA 1OXEA 2DDDA 4MZJA 3NXAA 4ZB1A 2KI6D 5JOLA 4JGEA 2JC2A 1TCFA 3BUOB 4C0LA 5DKQA 4IL1A 3ZUJA 3GB3A 3SG7A 4XVPA 3GEXA 4N1GA 1Y6WA 3BXKA 1F4OA 2BCXA 2CT9A 3S05A 3NT3A 1CFDA 3CLNA 1RFJA 2WCBA 5BTTA 5I2OA 4XOWA 4C0JA 4BY4A 2WISA 3TDZA 1EMCA 3SSKA 3OX5A 3KPXA 1S6ZA 1GQMA 2VVJA 3ST2A 4NWSA 3KO0A 1SRAA 5D69A 5EJUA 1D1OA 2MHHA 3DQ6A 2A56B 3SVEA 3DQ8A 2C9IA 1KP5A 2O60A 2LE9B 3WHTB 4P2YB 1IH0A 3KF9A 2GX0A 1M45A 2VVHA 3DQFA 3EVVA 2HETA 2SASA 1RWYA 2L51A 4N5XA 3WNXB 2GGZA 1J7OA 1KQVA 1G7KA 5ER5A 4ZF3A 3BOWA 2EGDA 4EN1A 4KAGA 4OJ0A 3VHTA 1MOUA 5HZUA 2Z6YA 3DQAA 3LK1A 1JC0A 3U0NA 4H3MA 4CFQA 3DQ1A 1RTP1 1U5IA 3LVAA 3JVTC 2BECA 5EB6A 1KWOC 1RMOA 4BY5A 1PRWA 3WLCA 1WLMA 2KFGA 1LA0A 2A54B 2AWJA 4LJBA 4YGCB 4P5OE 2K7OA 1V1FA 2TN4A 2G9BA 1K9KA 2FCEA 1IQ5A 4ZIOA 4W75A 5G08A 1EMKA 4KW4A 2VVIA 2CCMA 3DQ5A 2ISDA 1TRFA 1S26D 2HPSA 5FVIA 4J89A 2M1UA 1RJVA 4MVFA 5HYDA 1TNPA 4DXPA 1CLMA 4ETOA 4OY4A 5I2QA 3CD1A 5D7FA 5TNCA 2L50A 1S6JA 4GBAA 2LP2A 2EHBA 5DKRA 3KHEA 3DQ2A 3RM1A 3CB9A 2HRSA 4GNKB 1W7UA 2OTGC 3NSOA 2KYCA 3P8UA 3DVJA 2KBMA 1SCMC 2JTZA 3JVTB 5HKYA 1A29A 1YUSA 4IK4A 2WNDA 3VRRA 4GGNA 3DQMA 1EH2A 1NYAA 3PIBA 1UHNA 2PASA 3DVMA 3C1VA 1NSHA 4PE4A 5HGEA 4IZNA 3GL4A 2GW3A 1HT9A 2BE6A 4ZINA 1YX7A 1LXFC 3O78A 5GQQC 3ZNIA 2PRUA 1TNXA 3FIAA 2I94A 4NQGA 1H4UA 4W6PA 1NWDA 5HKWA 1EMGA 2DUGA 3I5GC 5CPVA 4ZFSA 1A03A 1Q4AA 1UISA 1YHHA 1C7WA 1G4YR 3IQOA 2IOVA 4XJKA 1S6CA 3I5FC 1MXLC 4OR9B 1KK7Z 2I7AA 4OV2A 3ST3A 1EMMA 1SCMB 2O2BA 1J7PA 4C0KA 3W1CA 1BODA 1B9CA 3DQNA 2LVVA 1OSAA 3DPWA 3DPZA 3DQHA 3O77A 5BTTB 4QJ3B 5B8IB 4IK8A 4DXOA 4AR7A 1A4PA 4W6BA 2G6EA 3U8PA 1WY9A 1CDLA 4Z4MA 4I2YA 1S5GY 3PJBA 1DT7B 3ST4A 1CLBA 2B3PA 5FVGA 2QZ0A 1IQ3A 1OZOA 1CM1A 5DKNA 1QASA 5KTYA 3U0MA 2KQ6A 4DRWA 4P1QA 2Z6ZA 5DRFA 4ORAB 1OXFA 2KI4B 3I5FB 2JNFA 1IRJA 4HVFA 2V4EA 4W74A 2KBIA 3FWCA 1UWOA 2PXWA 4JEOA 1IG5A 5HZOA 1K93D 2JT8A 2A50B 2F33A 3BOWB 1F54A 2K7CA 3DD4A 3TDIA 3VHTB 1FI6A 2RH7A 1CV7A 3VRNA 2Y5IA 1CNPA 1U5IB 1QLKA 3SSLA 1CKKA 4LJCA 4B30A 3AKBA 4CIDA 4PFEA 1PALA 1NX1A 1QVIZ 1S3PA 3DQ3A 3SVCA 2QACA 1C7VA 3BUNB 1BMOA 5HZSA 4KF5A 2K61A 2OTEA 1B47A 1SR6B 3SG3A 2ICRA 2OGRA 4P76A 4MZLA 2JPTA 2GV5A 2AHAA 1DGVA 3MGFA 2BCBA 5BPJA 1DGUA 3EKHA 1L2OC 3SSHA 1Q4EA 2CNPA 5HKZA 1J1EA 2AAOA 3LF3A 2LM5A 4MRXA 4WQ2A 4ANJA 5AXIA 4L13A 1SBJA 2EMOA 4DXQA 1J55A 3CTNA 2BBMA 4NDDA 1C4FA 3ICBA 1B8CA 2KGBC 4LJDA 4I5JA 1JFJA 2F3ZA 1EMAA 3PALA 3LS3A 2G3OA 3EKJA 1BLQA 2JWWA 4YGEB 1MXEA 2YFPA 3BX9A 4ORBB 2G5ZB 1R6PA 1WLZA 4I5LB 1XK4C 1H6RA 3OSQA 3TZ1A 3VGOA 4UTSA 1NPQA 3ZTFA 1W7TA 3DVEA 2JULA 3CS1A 3BXCA 4AOMA 2A48A 3QRXA 1ZOTB 1F71A 4Q04A 4DXMA 1B8RA 1YUUA 3EVUA 3O2PA 1YJ2A 4H3LA 4IK9A 4A4BA 4W6SA 1L2OB 4YBHB 3CFHA 1RROA 2KAXA 1CMGA 4HE4A 1BR4B 2PXSA 1EXRA 2PALA 4W7CA 1G33A 5AEQA 1AJ5A 1HUYA 1MQ1A 3RWTA 2FJUB 1B9AA 1F8HA 4OKHA 4XJKB 1W7JB 4GESB 2JOJA 1DJXA 2MRDA 2QLHA 1XMZA 2V4EC 3ZWHA 2JXCA 3F45A 1XVJA 3U8AA 3I19A 3DQDA 4XGYA 3TMRA 4LW5A 3WLDA 2LMVA 1OMDA 2M1KB 5H88A 1UHHA 4PHMA 1DMOA 1CLLA 2I18A 3BUXB 2LC5A 3DF0B 1J1DA 1JFKA 2DD7A 3LL8B 3BXAA 4W6HA 2CBLA 3I5HB 1S36A 1QIWA 4J8AA 3VROA 1CDPA 2D8NA 3E5WA 1F09A 1E8AA 4B5YA 1DTLA 1DJGA 2OTBA 3GK4X 1OMRA 3VK1A 2A53B 2HGYA 2AMIA 4KF5C 2ZNEA 3M22A 3NSKA 3NF0A 1DJHA 4NDCA 2ZN9A 5DRGA 2KDHA 3TS5C 2LANA 5FVFA 1KSMA 1DJWA 4PHJA 2Y1MA 2VAEA 2OKYA 2M49B 3U8CA 4GOBA 2V4EB 1A2XA 2WORA 2P6BB 3SVBA 3PJ7A 1S1EA 3CR5X 5HLOA 3CR4X 4DXNA 2QLEA 4F0ZB 5HLVA 1KFUS 4R6BA 3W1DA 2JADA 4LJDC 3FWBA 2FOTA 4MRYA 1N2DA 2JRFA 3EVRA 2F3YA 3JTDC 2AWLA 1YX8A 2G6XA 3A8SA 1LKJA 2DUEA 3CD9A 2SCPA 3OB2B 1JBZA 2M3WA 4L9MA 1JWDA 4OVNF 4I5KA 2MAZA 5KTGA 1Q4DA 1OQPA 1LA3A 5J3XA 3TDUA 3LF4B 1ZMZA 3TS5B 4ZCUA 3PATA 2IB5A 4QJ5B 3EK8A 5I8NA 2H9WA 3ED8A 1YRUB 5LTPA 1XQMA 3DQOA 3LA1A 2HQKA 2O29A 1WRZA 5JJGA 1SMGA 2M97A 2Y0GA 2WURA 1QYOA 4DIRA 3GOFA 3CFFA 1FF1A 2LHLA 1RECA 3H1RA 1KWOB 4W6CA 4AQJA 2G16B 1UP5A 5AQBB 1ZGOA 2ZNDA 2QLIA 1M39A 1JC2A 2G6YA 1SYMA 3SVRA 1R2UA 4Q9WA 3D0YA 3BXBA 3EK7A 4W7DA 4W6OA 1Y1UA 2F8PA 1BT6A 4YI8A 5PALA 3RLZA 4W7XA 1AHRA 4TZAA 3DPXA 4ZF5A 2LLTA 3ZULA 1N65A 4USLA 5I2LA 2B1UA 1KQMC 2PMYA 1JSAA 1WRKA 5HW9A 3CWGA 2H5PA 1S5GZ 2ARLA 1XFXO 2PSRA 1Z1QA 2ZFDA 2ZO6A 1B7TY 3DQIA 3K21A 2A52B 5DPGA 2OTGB 3DQEA 2G2BA 1UUSA 1K95A 1QJTA 1QXTA 4KW8A 1AUIB 4H3NA 1EG4A 2EMDA 3UG0A 4YGAA 1RRXA 3BYAA 1XK4A 5AANA 4W6AA 1BJFA 2ZN8A 2IS9A 2Y1NA 4L1IA 4MBEA 3SVUA 5LTQA 2VZXA 1BFPA 2POXA 1UURA 1NIWA 4L12A 2MJWB 1AJ4A 4J88A 2Q4UA 3I5GB 3D10A 2M9GA 1SKTA 1TNQA 2COLB 2L98A 3SRYA 1RMMA 1ZUZA 1KQMB 5CSIA 2LVJA 3DQKA 4ZCVA 1QTXA 2WIQA 2IB6A 1Q73A 2E30A 1JF2A 1WDCC 3NSLA 1HCJA 2KI6C 2Z1OA 1AVSA 2BBNA 1MYWA 5HZTA 4HRHA 1PVBA 4TZGA 2HPWA 4IK5A 2BL0C 2K8MB 4LQTA 1XO5A 2BE4A 1DVIA 4CLNA 1PSRA 2JTTA 4HRGA 2DDCA 4OHSA 1MWNA 2AUCA 5DTYA 2HQWA 2L5XB 5BQLA 4W77A 3SVOA 1K9PA 4H47A 4DCKA 1ALWA 3SJSA 2M0RA 4JF9A 2H61A 4ORCB 3ST0A 2KAYA 2WSOA 3SG5A 3CBEA 3KCTA 4XYNA 3NEZA 4JPZB 3AKOA 1NUBA
chains in the Genus database with same CATH superfamily
4H48A 3CZTX 2KQYA 2ZKMX 1CTRA 2O24A 1PSBA 4IK1A 1ZGQA 1N0YA 2WHUA 1M31A 3NEDA 2M7LA 2F2PA 3D75A 3I5IC 4AQIA 3IQQA 3BUWB 2YDZA 1X02A 2QLGA 4EDOA 3M24A 4ICBA 1V1GA 1F4QA 3A8RA 1XFZO 4R1EA 1YZWA 3S0EA 2HFCA 1F55A 1WDCB 3VRQA 1QYFA 1QYQA 2M7NA 3VRPA 1XFYO 3OHMB 2A46A 1ORGA 1SCVA 4GFTA 4PCWA 1K90D 3WHUB 2QT2A 3SS4A 3SSYA 2H5RA 1NX3A 2YE0A 4CFRA 3RWAA 1J7RA 2LNKA 1YHGA 2L2EA 2I2RE 2HQZA 4LQUA 3GJ2A 2YE1A 1FW4A 2LVKA 4PE0A 1H4BA 2PVBA 1RMPA 5DTZA 3ZUFA 4UPGA 1HQVA 3U0KA 3ADFA 2DD9A 2A47A 1VRKA 3AAJA 3LK0A 5DPHA 1OOJA 3SVDA 2FL1A 4GF6B 1L7ZA 3D0YB 2ZRTA 2BKIB 1BOCA 3SIAA 3AAKA 4W6TA 1OXDA 4N1FA 4AS8A 5DICA 1G8IA 1H8BA 3NSIA 5BT0A 5EBJA 3SVNA 1EMFA 4W6LA 1BG1A 1GGZA 2FCDA 3CZ1A 5FHVA 4MZKA 1KYRA 1NP8A 2KGRA 1CDMA 2MLFC 1PULA 1EL4A 2KOTA 1P28A 2LLUA 1XYDA 1OE9B 2FJYA 2DUIA 1KFUL 4PPLA 1QX5B 1QATA 4DKMA 1NX2A 2JU0A 5J2OA 1QWVA 4MSPA 4KW9A 1QX7A 3A4UB 1GJYA 2WCFA 3G9AA 3DVKA 4PPJA 1AP4A 3CGAA 3RZSA 1GFLA 4KEXA 3FE8A 2LP3A 1YVLA 1Y1AA 1B8LA 5LK4A 2KSPA 1GGWA 1KSOA 3AKAA 1PVAA 5DQBA 1KYPA 1XA5A 2H61C 2QEBA 1QXPA 4R6DA 2CXJA 2H5OA 1TIZA 1QY3A 5AERA 4JFGA 5CSFA 1UHKA 2VRGA 2K7BA 2DUHA 1GGXA 1DF0A 2AH8A 2KHNA 2NZ0A 1K94A 1IGVA 4QJ4B 3OB1B 5F6TA 1RM9A 2LAPA 1UHJA 2H6VA 2JT0A 2HF5A 3MSEB 4PE1A 3TMTA 2ZMWA 1TOPA 1KFXS 1OOFA 5FI2A 2MLEC 3CR2A 1JC1A 3AI4A 2JZIA 2Q91A 2E6WA 4I5NB 1QIVA 1JF0A 4Q7UA 1SSEB 1B4CA 3SS5A 1YHIA 2C9JA 3D73A 5CSNA 4DUQA 2KFHA 5KSZA 4M2QA 4TNCA 1XFWO 5K89A 3UFZA 3M0WA 1Z1PA 4N3DA 1FPWA 5F9GA 1XAEA 3BQ3A 4PDZA 1YUTA 4GAOA 5HBDA 4RTCA 1CMFA 2QU1A 4B30B 3OX6A 3SG4A 2NCPA 2WSNA 2DOQA 4OZDA 1EMBA 1C3YA 1XFVO 4KGFA 3DQ4A 4INXA 2HCGA 1SPYA 4RYSA 1PK0D 3IF7A 2Y4QA 1YTZC 2QRFA 3PJIA 4IK3A 2AWKA 1IJ5A 3LLEA 1OOIX 4W7EA 2QLGB 5DY6A 4DKNA 1TTXA 3R1OA 4EMQA 1KK8C 1JUOA 2K7DA 4MN0A 1SL7A 4XL5A 1QS7A 3SG6A 1DJYA 2OKWA 2PQLA 5LTRA 1ZGPA 1NCYA 4GGFA 1JBAA 4MLWA 1F0BA 1ZUXA 2M29A 3IR8A 1DJIA 1TN4A 1CDNA 4W6FA 1OW4A 1TNWA 2R2IA 1B1GA 2OS8C 3AI5A 3SSVA 1FI5A 1B7TZ 3SSTA 1EMLA 2V53A 2BKHB 2NCOA 3JTDB 1RK9A 2M8UA 1MR8A 4W6RA 1BF5A 4NDBA 5EHUA 4Z4KA 3SVSA 3NT9A 3H1OA 4IJ7A 2OJKA 1IJ6A 2LVIA 1OZSA 3O4XA 4W6GA 5EL2A 1ZFSA 1TWOA 2EMNA 2Q6PA 2K2AA 1NX0A 3CZ0A 4XOVA 2AWMA 3KCSA 3NHTA 4OQWA 2G2SB 1KCYA 3E5TA 5KU1A 1A75A 2LMUA 1KK8B 3D77A 1CFCA 2NLNA 2JNXA 4A4CA 1J7QA 5DPIA 2CTNA 1CFPA 3DQCA 4DS7A 1SNLA 1OMVA 2EC6C 4W6JA 1QV1A 1LVCD 2NXQA 5AFPA 1YR5A 5DTXA 1K8UA 3O4YA 5DU0A 1SW8A 3OSRA 4OGSA 5DQMA 1DQEA 3OP0A 2OS8B 4BDUA 3SV5A 1CFFA 1UHIA 1YJFA 4KPIA 3VICA 2KI4C 2WC8A 3DQJA 2FZUA 1ODBA 3DY9A 4ORNA 2L0PA 4M2PA 1DJZA 1JBYA 2G3DB 1CB1A 2ZRSA 3PN7C 2WCEA 3FS7A 1XA9A 3DQ7A 2Q57A 2K60A 4WRIA 4Q7RA 1EG3A 2ZMUA 2HGDA 1WRLA 1T14A 4GUKA 2LLSA 3WCKA 2IE2A 1M63B 3DF0A 3GK2A 3PM8A 3WXAA 1K9UA 4Q7TA 3PLFB 5CSJA 4W7FA 1YVHA 3TUYC 3H4SE 3U0LA 2VADA 4M2OA 2HJOA 2GW4B 3GK1A 3PSRA 3LSAA 1DF0B 2MA2A 1MF8B 3V3DA 2LUXA 3BFHA 4U8DA 2BCAA 3CYZA 3S0AA 1K2HA 2WOSA 2O5GA 2OPOA 1Q4CA 2B3QA 4HQCA 1SR6C 2KFFA 5DPJA 4W6UA 3IP2A 2MBXA 2H5QA 4W7RA 3SSPA 2EC6B 2WHSA 3B88A 4W6KA 1M46A 4W6IA 5EXCI 3EK4A 3PJ5A 4HQ8A 4EULA 1KK7Y 4OCIA 2BTJA 4PPKA 2WHTA 1SK6D 2DUFA 4W69A 1XFUO 1SY9A 3LVCA 4JD9A 2K2FA 4GGFC 4FQOA 2FWQA 3BUMB 4RYWA 3PN7B 1ALVA 5H87A 4HQ9A 2LHIA 3D78A 1NCXA 5FYXA 4HREE 4W72A 3SS0A 2KAVA 4W6MA 3D74A 1TCOB 2LCPA 1QV0A 2Z6XA 1FBVA 5EXUA 1K96A 1W7IB 2LMTA 4WQ3A 4Q9XA 3TUYB 4DXIA 1F70A 3D76A 4JRBA 4CPVA 4YGBB 4YI9A 1MOVA 3CFAA 2L4IA 1SL8A 3E5VA 4U2VA 4PHKA 4JC2A 2JT3A 4EDSA 3O6BA 4W7AA 4YGDB 1LINA 3R1VA 3LCPC 4ZF4A 2GGMA 3HX4A 5EB7A 1NCZA 1XSSA 2H8QA 1BR1B 4W6DA 3DQ9A 4PHNA 2K0JA 2QPTA 2BL0B 3EVPA 1Q80A 3PFVA 2RGIA 1S6IA 5H89A 1BU3A 3CZ2A 4JWQA 4MEWA 5ER4X 3CGLA 1IKUA 2H2KA 1EJ3A 1IWQA 5T3IA 1TUJA 1OOHA 4D1EA 3DQUA 2F2OA 5IBWA 1YURA 5DTLA 1SL9A 1W7SA 1W9ZA 3K1KA 2KYFA 2JQ6A 3S0FA 2GX2A 1CM4A 4YRUA 2JXLA 3HCMA 1QVIY 2P4MA 1YFPA 4ZBLA 4HSZA 1QX2A 1Q4BA 1YRTB 4PE7A 4JQ0D 4KA9A 4GPLB 4W6NA 1GL4A 1KFXL 3I5IB 3E3RA 1AK8A 3P28A 3KEVA 1ZACA 1LS8A 1Y0VH 2A4JA 3I5HC 4PALA 3SIBA 2ZO7A 3B7AA 4FTGA 1A75B 2KNEA 4KGEA 3OGOA 4INWA 1MUXA 4W76A 3LVDA 3GJ1A 4E68A 2HQ8A 1MHOA 4KF4A 3S0DA 2L4HA 1EMEA 1C07A 3DQLA 2WCMA 4W73A 1KYSA 1Y1XA 2LV7A 3SG2A 2LUCA 5EXBA 1QLSA 1OXEA 2DDDA 4MZJA 3NXAA 4ZB1A 2KI6D 5JOLA 4JGEA 2JC2A 1TCFA 3BUOB 4C0LA 5DKQA 4IL1A 3ZUJA 3GB3A 3SG7A 4XVPA 3GEXA 4N1GA 1Y6WA 3BXKA 1F4OA 2ERBA 2BCXA 2CT9A 2QDIA 3S05A 3NT3A 1CFDA 3CLNA 1RFJA 2WCBA 5BTTA 5I2OA 4XOWA 4C0JA 4BY4A 2WISA 3TDZA 1EMCA 3SSKA 3OX5A 3KPXA 1S6ZA 1GQMA 2BAPA 2VVJA 3ST2A 4NWSA 3KO0A 1SRAA 1Z4HA 5D69A 5EJUA 1D1OA 2MHHA 3DQ6A 2A56B 3SVEA 3DQ8A 2C9IA 1KP5A 2O60A 3R1PA 2LE9B 3WHTB 4P2YB 1IH0A 3KF9A 4F7FA 2GX0A 1M45A 2VVHA 3DQFA 3EVVA 2HETA 2SASA 1RWYA 2L51A 4N5XA 3WNXB 2GGZA 1J7OA 1KQVA 1G7KA 5ER5A 4ZF3A 3BOWA 2EGDA 4EN1A 4KAGA 2QEHA 4OJ0A 3VHTA 1MOUA 5HZUA 2Z6YA 3DQAA 3LK1A 1JC0A 3U0NA 4H3MA 4CFQA 3DQ1A 1RTP1 1U5IA 3LVAA 3JVTC 2BECA 5EB6A 1GM0A 3FE9A 1KWOC 1RMOA 4BY5A 1PRWA 3WLCA 2WCKA 3UNWA 1WLMA 2KFGA 1LA0A 2A54B 2AWJA 4LJBA 4YGCB 4P5OE 2K7OA 1V1FA 2TN4A 2G9BA 1K9KA 2FCEA 1IQ5A 4ZIOA 4W75A 5G08A 1EMKA 4KW4A 3L4AA 2VVIA 2CCMA 3DQ5A 2ISDA 1TRFA 1S26D 2HPSA 5FVIA 4J89A 2M1UA 1RJVA 4MVFA 5HYDA 1TNPA 4DXPA 1CLMA 4ETOA 4OY4A 2P71A 5I2QA 3CD1A 5D7FA 2KLDA 5TNCA 2L50A 1S6JA 4GBAA 2LP2A 2EHBA 3SS3A 5DKRA 3S0BA 3KHEA 3DQ2A 3RM1A 3CB9A 2HRSA 4GNKB 1W7UA 2OTGC 3NSOA 2KYCA 3P8UA 3DVJA 2KBMA 1SCMC 2JTZA 3JVTB 5HKYA 1A29A 1YUSA 4IK4A 2WNDA 3VRRA 4GGNA 3DQMA 1EH2A 3R72A 1NYAA 3PIBA 1UHNA 2PASA 3DVMA 3C1VA 1NSHA 4PE4A 5HGEA 4IZNA 3GL4A 2GW3A 1HT9A 2BE6A 4ZINA 1YX7A 1LXFC 3O78A 5GQQC 3ZNIA 2PRUA 1TNXA 3FIAA 2I94A 2L2CA 4NQGA 1H4UA 4W6PA 2L5YA 1NWDA 5HKWA 1EMGA 2DUGA 1DEKA 3I5GC 5CPVA 4ZFSA 1A03A 1Q4AA 1UISA 1YHHA 1C7WA 1G4YR 1Z2CB 2QEOA 3IQOA 2IOVA 4XJKA 1S6CA 3I5FC 2WCHA 1MXLC 4OR9B 1KK7Z 2I7AA 4OV2A 3ST3A 1EMMA 1SCMB 2O2BA 1J7PA 4C0KA 3W1CA 1BODA 2JPOA 1B9CA 3DQNA 5FI6A 2LVVA 1OSAA 4FQTA 3DPWA 3DPZA 3DQHA 3O77A 5BTTB 4QJ3B 5B8IB 4IK8A 4DXOA 4AR7A 1A4PA 4W6BA 2G6EA 1IIOA 3U8PA 1WY9A 1CDLA 4Z4MA 4I2YA 1S5GY 3PJBA 1DT7B 3ST4A 1CLBA 5D3OA 2B3PA 5FVGA 2QZ0A 1IQ3A 1OZOA 1CM1A 5DKNA 1QASA 5KTYA 3U0MA 2KQ6A 4DRWA 4P1QA 2Z6ZA 5DRFA 2P70A 4ORAB 1OXFA 2KI4B 3I5FB 2JNFA 1IRJA 4HVFA 2V4EA 4W74A 2WC6A 2KBIA 3FWCA 2QEVA 1UWOA 2PXWA 4JEOA 1IG5A 3L4LA 1K93D 2PYQA 5HZOA 2JT8A 3CDNA 2A50B 2F33A 3BOWB 1F54A 2K7CA 3DD4A 3TDIA 3VHTB 3BJHA 1FI6A 3FE6A 2RH7A 1CV7A 3VRNA 2Y5IA 1CNPA 1U5IB 1QLKA 3SSLA 1CKKA 4LJCA 4B30A 3AKBA 4CIDA 1C3ZA 4PFEA 3B86A 1PALA 1NX1A 1QVIZ 1S3PA 3DQ3A 3SVCA 2QACA 1C7VA 3BUNB 1BMOA 5HZSA 4KF5A 2K61A 2OTEA 3UO9A 1B47A 1SR6B 3SG3A 2ICRA 2OGRA 4P76A 4MZLA 2JPTA 3EG5B 2GV5A 2AHAA 1DGVA 3MGFA 2BCBA 5BPJA 1DGUA 3EKHA 1L2OC 3SSHA 1Q4EA 2CNPA 5HKZA 1J1EA 2AAOA 3LF3A 2LM5A 4MRXA 4WQ2A 4ANJA 5AXIA 4L13A 1SBJA 2EMOA 4DXQA 1J55A 3CTNA 2BBMA 4NDDA 1C4FA 3ICBA 1B8CA 2KGBC 4LJDA 4I5JA 1JFJA 2F3ZA 1EMAA 3PALA 3LS3A 2G3OA 3BFAA 3EKJA 1BLQA 2JWWA 4YGEB 1MXEA 2YFPA 3BX9A 4ORBB 2G5ZB 1R6PA 1WLZA 4I5LB 1XK4C 1H6RA 3K1EA 3OSQA 3TZ1A 3VGOA 1DC1A 4UTSA 1NPQA 3ZTFA 1W7TA 3DVEA 2JULA 3CS1A 3BXCA 4AOMA 2A48A 3QRXA 1ZOTB 1F71A 4Q04A 4DXMA 1B8RA 1YUUA 3EVUA 3O2PA 1YJ2A 3L47A 4H3LA 4IK9A 4A4BA 4W6SA 1L2OB 4YBHB 4KYNA 2GTEA 3CFHA 1RROA 2KAXA 1CMGA 4HE4A 1BR4B 2PXSA 1EXRA 2PALA 4W7CA 1G33A 4JKTA 1XFRA 5AEQA 1AJ5A 1HUYA 1MQ1A 3RWTA 2FJUB 1B9AA 1F8HA 4OKHA 4XJKB 1W7JB 4GESB 2JOJA 1DJXA 2MRDA 3B6XA 2QLHA 1XMZA 2V4EC 3ZWHA 2JXCA 3F45A 1XVJA 3U8AA 3I19A 3DQDA 4XGYA 3TMRA 4LW5A 3WLDA 2LMVA 1OMDA 2M1KB 5H88A 3S0GA 1UHHA 4PHMA 1DMOA 1CLLA 4PT1A 2I18A 3BUXB 2LC5A 3DF0B 1J1DA 1JFKA 2DD7A 3LL8B 3BXAA 3DXLA 4W6HA 2CBLA 3I5HB 1S36A 1QIWA 4J8AA 3VROA 1CDPA 2D8NA 3E5WA 1F09A 1E8AA 4B5YA 1DTLA 1DJGA 2OTBA 3GK4X 1OMRA 3VK1A 2A53B 2HGYA 2AMIA 4KF5C 2ZNEA 3M22A 3NSKA 3NF0A 1DJHA 4NDCA 2ZN9A 5DRGA 2KDHA 3TS5C 2LANA 5FVFA 5FI7A 1KSMA 1DJWA 4PHJA 2Y1MA 2VAEA 2OKYA 2M49B 3U8CA 4GOBA 2V4EB 1A2XA 2WORA 2P6BB 3N7HA 3SVBA 3PJ7A 1S1EA 3CR5X 5HLOA 3CR4X 2YGUA 4DXNA 2QLEA 4F0ZB 5HLVA 1KFUS 4R6BA 3W1DA 2JADA 4LJDC 2H8VA 3FWBA 2FOTA 4MRYA 1N2DA 2JRFA 3EVRA 2F3YA 3JTDC 2AWLA 1YX8A 2G6XA 3A8SA 1LKJA 3OGNA 2DUEA 3CD9A 2SCPA 3OB2B 1JBZA 2M3WA 4L9MA 1JWDA 3IVTA 4OVNF 3BFBA 4I5KA 2KLEA 2MAZA 5KTGA 1Q4DA 1OQPA 5I94A 1LA3A 5J3XA 3TDUA 3LF4B 1ZMZA 3TS5B 2WCLA 4ZCUA 3PATA 2IB5A 4QJ5B 3EK8A 5I8NA 2H9WA 3ED8A 1YRUB 5LTPA 1XQMA 3DQOA 3LA1A 2HQKA 2O29A 1WRZA 5JJGA 1SMGA 2M97A 2Y0GA 2WURA 1QYOA 4DIRA 3GOFA 3CFFA 3VB1A 1FF1A 2LHLA 1RECA 3H1RA 1KWOB 4W6CA 4AQJA 2G16B 1UP5A 5AQBB 1ZGOA 2ZNDA 2QLIA 1M39A 1JC2A 2G6YA 1SYMA 3SVRA 1R2UA 4Q9WA 3D0YA 3OBVA 3BXBA 3EK7A 4W7DA 4W6OA 1Y1UA 2F8PA 1BT6A 4YI8A 5PALA 3RLZA 4W7XA 1AHRA 4TZAA 3DPXA 4ZF5A 2LLTA 2KPHA 3ZULA 1N65A 4USLA 5I2LA 2B1UA 1KQMC 2PMYA 1JSAA 1WRKA 5HW9A 3CWGA 2H5PA 1S5GZ 3B87A 2ARLA 1XFXO 2PSRA 1Z1QA 2ZFDA 2ZO6A 1B7TY 3DQIA 3K21A 2A52B 5DPGA 2OTGB 3DQEA 2G2BA 1OOGA 1UUSA 3QMEA 1K95A 1QJTA 1QXTA 4KW8A 1AUIB 4H3NA 1EG4A 2EMDA 3UG0A 4YGAA 1RRXA 3BYAA 1XK4A 5AANA 4W6AA 1BJFA 2ZN8A 3CABA 3V2LA 2IS9A 2Y1NA 4L1IA 4MBEA 3SVUA 5LTQA 2VZXA 1BFPA 2POXA 1UURA 2BNXA 1NIWA 4L12A 2MJWB 1AJ4A 4J88A 2Q4UA 3I5GB 3D10A 2M9GA 1SKTA 1TNQA 2COLB 2L98A 3SRYA 3NHIA 1RMMA 1ZUZA 1KQMB 5CSIA 2LVJA 3DQKA 4ZCVA 1QTXA 2WIQA 2IB6A 5HL1A 1Q73A 2E30A 1JF2A 1WDCC 1DELA 3NSLA 1HCJA 3DYEA 2KI6C 2Z1OA 1AVSA 2BBNA 1MYWA 5HZTA 4HRHA 1PVBA 4TZGA 2HPWA 4IK5A 2BL0C 2K8MB 4LQTA 1XO5A 2WC5A 2BE4A 1DVIA 3NGVA 4CLNA 1PSRA 2JTTA 4HRGA 2DDCA 4OHSA 1MWNA 2AUCA 5DTYA 2HQWA 2L5XB 5BQLA 4W77A 3SVOA 1K9PA 2WCJA 3Q8IA 4H47A 4DCKA 1ALWA 1TUZA 3SJSA 3PM2A 2M0RA 4JF9A 2H61A 4ORCB 3ST0A 2KAYA 2WSOA 3SG5A 3CBEA 3KCTA 4XYNA 3NEZA 4JPZB 3AKOA 3DZTA 1NUBA
chains in the Genus database with same CATH topology
4H48A 3CZTX 2KQYA 2ZKMX 1CTRA 2O24A 1PSBA 4IK1A 1ZGQA 1N0YA 2WHUA 1M31A 3NEDA 2M7LA 2F2PA 3I5IC 4AQIA 3IQQA 3BUWB 2YDZA 1X02A 2QLGA 4EDOA 3M24A 4ICBA 1V1GA 1F4QA 3A8RA 1XFZO 4R1EA 1YZWA 2HFCA 1F55A 1WDCB 3VRQA 1QYFA 1QYQA 2M7NA 3VRPA 1XFYO 3OHMB 2A46A 1SCVA 4GFTA 4PCWA 1K90D 3WHUB 2QT2A 3SSYA 2H5RA 1NX3A 2YE0A 4CFRA 3RWAA 1J7RA 2LNKA 1YHGA 2L2EA 2I2RE 2HQZA 4LQUA 3GJ2A 2YE1A 1FW4A 2LVKA 4PE0A 1H4BA 2PVBA 1RMPA 5DTZA 3ZUFA 4UPGA 1HQVA 3U0KA 3ADFA 2DD9A 2A47A 1VRKA 3AAJA 3LK0A 5DPHA 1OOJA 3SVDA 2FL1A 4GF6B 1L7ZA 3D0YB 2ZRTA 2BKIB 1BOCA 3SIAA 3AAKA 4W6TA 1OXDA 4N1FA 4AS8A 1G8IA 1H8BA 3NSIA 5BT0A 5EBJA 3SVNA 1EMFA 4W6LA 1BG1A 1GGZA 2FCDA 5FHVA 4MZKA 1KYRA 1NP8A 2KGRA 1CDMA 2MLFC 1PULA 1EL4A 2KOTA 2LLUA 1XYDA 1OE9B 2DUIA 1KFUL 4PPLA 1QX5B 1QATA 4DKMA 1NX2A 2JU0A 5J2OA 4MSPA 4KW9A 1QX7A 3A4UB 1GJYA 2WCFA 3G9AA 3DVKA 4PPJA 1AP4A 3CGAA 1GFLA 4KEXA 2LP3A 1YVLA 1Y1AA 1B8LA 5LK4A 2KSPA 1GGWA 1KSOA 3AKAA 1PVAA 5DQBA 1KYPA 1XA5A 2H61C 1QXPA 4R6DA 2CXJA 2H5OA 1TIZA 1QY3A 5AERA 4JFGA 5CSFA 1UHKA 2VRGA 2K7BA 2DUHA 1GGXA 1DF0A 2AH8A 2KHNA 2NZ0A 1K94A 1IGVA 4QJ4B 3OB1B 5F6TA 1RM9A 2LAPA 1UHJA 2H6VA 2JT0A 2HF5A 3MSEB 4PE1A 3TMTA 2ZMWA 1TOPA 1KFXS 2MLEC 3CR2A 1JC1A 3AI4A 2JZIA 2Q91A 2E6WA 4I5NB 1QIVA 1JF0A 4Q7UA 1B4CA 1YHIA 2C9JA 5CSNA 4DUQA 2KFHA 5KSZA 4M2QA 4TNCA 1XFWO 5K89A 3UFZA 3M0WA 1Z1PA 4N3DA 1FPWA 5F9GA 1XAEA 3BQ3A 4PDZA 1YUTA 4GAOA 5HBDA 4RTCA 1CMFA 2QU1A 4B30B 3OX6A 3SG4A 2NCPA 2WSNA 2DOQA 1EMBA 1XFVO 4KGFA 3DQ4A 2HCGA 1SPYA 4RYSA 1PK0D 3IF7A 2Y4QA 1YTZC 2QRFA 4IK3A 2AWKA 1IJ5A 3LLEA 4W7EA 2QLGB 5DY6A 4DKNA 1TTXA 4EMQA 1KK8C 1JUOA 2K7DA 4MN0A 1SL7A 4XL5A 1QS7A 3SG6A 1DJYA 2OKWA 5LTRA 1ZGPA 1NCYA 4GGFA 1JBAA 4MLWA 1F0BA 1ZUXA 2M29A 3IR8A 1DJIA 1TN4A 1CDNA 4W6FA 1TNWA 2R2IA 1B1GA 2OS8C 3AI5A 3SSVA 1FI5A 1B7TZ 3SSTA 1EMLA 2V53A 2BKHB 2NCOA 3JTDB 1RK9A 2M8UA 1MR8A 4W6RA 1BF5A 4NDBA 5EHUA 4Z4KA 3SVSA 3NT9A 3H1OA 2OJKA 1IJ6A 2LVIA 1OZSA 4W6GA 1ZFSA 2EMNA 2Q6PA 2K2AA 1NX0A 4XOVA 2AWMA 3KCSA 4OQWA 2G2SB 1KCYA 3E5TA 1A75A 2LMUA 5KU1A 1KK8B 1CFCA 2NLNA 2JNXA 4A4CA 1J7QA 5DPIA 2CTNA 1CFPA 3DQCA 4DS7A 1SNLA 1OMVA 2EC6C 4W6JA 1QV1A 1LVCD 2NXQA 5AFPA 1YR5A 5DTXA 1K8UA 3O4YA 5DU0A 1SW8A 3OSRA 4OGSA 5DQMA 3OP0A 2OS8B 4BDUA 3SV5A 1CFFA 1UHIA 1YJFA 4KPIA 3VICA 2KI4C 2WC8A 3DQJA 2FZUA 1ODBA 4ORNA 2L0PA 4M2PA 1DJZA 1JBYA 2G3DB 1CB1A 2ZRSA 3PN7C 2WCEA 3FS7A 1XA9A 3DQ7A 2Q57A 4WRIA 4Q7RA 1EG3A 2ZMUA 2HGDA 1WRLA 4GUKA 2LLSA 3WCKA 2IE2A 1M63B 3DF0A 3GK2A 3PM8A 3WXAA 1K9UA 4Q7TA 3PLFB 5CSJA 4W7FA 1YVHA 3TUYC 3H4SE 3U0LA 2VADA 4M2OA 2HJOA 2GW4B 3GK1A 3PSRA 3LSAA 1DF0B 2MA2A 1MF8B 3V3DA 2LUXA 4U8DA 2BCAA 1K2HA 2WOSA 2O5GA 2OPOA 1Q4CA 2B3QA 4HQCA 1SR6C 2KFFA 5DPJA 4W6UA 3IP2A 2MBXA 2H5QA 4W7RA 3SSPA 2EC6B 2WHSA 4W6KA 1M46A 4W6IA 5EXCI 3EK4A 3PJ5A 4HQ8A 4EULA 1KK7Y 4OCIA 2BTJA 4PPKA 2WHTA 1SK6D 2DUFA 4W69A 1XFUO 1SY9A 3LVCA 2K2FA 4GGFC 4FQOA 2FWQA 3BUMB 4RYWA 3PN7B 1ALVA 5H87A 4HQ9A 2LHIA 1NCXA 5FYXA 4HREE 4W72A 3SS0A 2KAVA 4W6MA 1TCOB 2LCPA 1QV0A 2Z6XA 1FBVA 5EXUA 1K96A 1W7IB 2LMTA 4WQ3A 4Q9XA 3TUYB 4DXIA 1F70A 4JRBA 4CPVA 4YGBB 4YI9A 1MOVA 3CFAA 2L4IA 1SL8A 3E5VA 4U2VA 4PHKA 4JC2A 2JT3A 4EDSA 3O6BA 4W7AA 4YGDB 1LINA 3LCPC 4ZF4A 2GGMA 3HX4A 5EB7A 1NCZA 1XSSA 2H8QA 1BR1B 4W6DA 3DQ9A 4PHNA 2K0JA 2QPTA 2BL0B 3EVPA 1Q80A 3PFVA 2RGIA 1S6IA 5H89A 1BU3A 4JWQA 4MEWA 5ER4X 3CGLA 1IKUA 2H2KA 1EJ3A 1IWQA 5T3IA 4D1EA 3DQUA 2F2OA 5IBWA 1YURA 5DTLA 1SL9A 1W7SA 3K1KA 2KYFA 2JQ6A 2GX2A 1CM4A 4YRUA 2JXLA 3HCMA 1QVIY 2P4MA 1YFPA 4ZBLA 4HSZA 1QX2A 1Q4BA 1YRTB 4PE7A 4JQ0D 4KA9A 4GPLB 4W6NA 1GL4A 1KFXL 3I5IB 3E3RA 1AK8A 3P28A 3KEVA 1ZACA 1Y0VH 2A4JA 3I5HC 4PALA 3SIBA 2ZO7A 4FTGA 1A75B 2KNEA 4KGEA 3OGOA 1MUXA 4W76A 3LVDA 3GJ1A 4E68A 2HQ8A 1MHOA 4KF4A 2L4HA 1EMEA 1C07A 3DQLA 4W73A 1KYSA 1Y1XA 2LV7A 3SG2A 2LUCA 5EXBA 1QLSA 1OXEA 2DDDA 4MZJA 3NXAA 4ZB1A 2KI6D 5JOLA 4JGEA 2JC2A 1TCFA 3BUOB 4C0LA 5DKQA 4IL1A 3ZUJA 3GB3A 3SG7A 4XVPA 3GEXA 4N1GA 1Y6WA 3BXKA 1F4OA 2BCXA 2CT9A 3S05A 3NT3A 1CFDA 3CLNA 1RFJA 2WCBA 5BTTA 5I2OA 4XOWA 4C0JA 4BY4A 2WISA 3TDZA 1EMCA 3SSKA 3OX5A 3KPXA 1S6ZA 1GQMA 2VVJA 3ST2A 4NWSA 3KO0A 1SRAA 5D69A 5EJUA 1D1OA 2MHHA 3DQ6A 2A56B 3SVEA 3DQ8A 2C9IA 1KP5A 2O60A 2LE9B 3WHTB 4P2YB 1IH0A 3KF9A 2GX0A 1M45A 2VVHA 3DQFA 3EVVA 2HETA 2SASA 1RWYA 2L51A 4N5XA 3WNXB 2GGZA 1J7OA 1KQVA 1G7KA 5ER5A 4ZF3A 3BOWA 2EGDA 4EN1A 4KAGA 4OJ0A 3VHTA 1MOUA 5HZUA 2Z6YA 3DQAA 3LK1A 1JC0A 3U0NA 4H3MA 4CFQA 3DQ1A 1RTP1 1U5IA 3LVAA 3JVTC 2BECA 5EB6A 1KWOC 1RMOA 4BY5A 1PRWA 3WLCA 1WLMA 2KFGA 1LA0A 2A54B 2AWJA 4LJBA 4YGCB 4P5OE 2K7OA 1V1FA 2TN4A 2G9BA 1K9KA 2FCEA 1IQ5A 4ZIOA 4W75A 5G08A 1EMKA 4KW4A 2VVIA 2CCMA 3DQ5A 2ISDA 1TRFA 1S26D 2HPSA 5FVIA 4J89A 2M1UA 1RJVA 4MVFA 5HYDA 1TNPA 4DXPA 1CLMA 4ETOA 4OY4A 5I2QA 3CD1A 5D7FA 5TNCA 2L50A 1S6JA 4GBAA 2LP2A 2EHBA 5DKRA 3KHEA 3DQ2A 3RM1A 3CB9A 2HRSA 4GNKB 1W7UA 2OTGC 3NSOA 2KYCA 3P8UA 3DVJA 2KBMA 1SCMC 2JTZA 3JVTB 5HKYA 1A29A 1YUSA 4IK4A 2WNDA 3VRRA 4GGNA 3DQMA 1EH2A 1NYAA 3PIBA 1UHNA 2PASA 3DVMA 3C1VA 1NSHA 4PE4A 5HGEA 4IZNA 3GL4A 2GW3A 1HT9A 2BE6A 4ZINA 1YX7A 1LXFC 3O78A 5GQQC 3ZNIA 2PRUA 1TNXA 3FIAA 2I94A 4NQGA 1H4UA 4W6PA 1NWDA 5HKWA 1EMGA 2DUGA 3I5GC 5CPVA 4ZFSA 1A03A 1Q4AA 1UISA 1YHHA 1C7WA 1G4YR 3IQOA 2IOVA 4XJKA 1S6CA 3I5FC 1MXLC 4OR9B 1KK7Z 2I7AA 4OV2A 3ST3A 1EMMA 1SCMB 2O2BA 1J7PA 4C0KA 3W1CA 1BODA 1B9CA 3DQNA 2LVVA 1OSAA 3DPWA 3DPZA 3DQHA 3O77A 5BTTB 4QJ3B 5B8IB 4IK8A 4DXOA 4AR7A 1A4PA 4W6BA 2G6EA 3U8PA 1WY9A 1CDLA 4Z4MA 4I2YA 1S5GY 3PJBA 1DT7B 3ST4A 1CLBA 2B3PA 5FVGA 2QZ0A 1IQ3A 1OZOA 1CM1A 5DKNA 1QASA 5KTYA 3U0MA 2KQ6A 4DRWA 4P1QA 2Z6ZA 5DRFA 4ORAB 1OXFA 2KI4B 3I5FB 2JNFA 1IRJA 4HVFA 2V4EA 4W74A 2KBIA 3FWCA 1UWOA 2PXWA 4JEOA 1IG5A 5HZOA 1K93D 2JT8A 2A50B 2F33A 3BOWB 1F54A 2K7CA 3DD4A 3TDIA 3VHTB 1FI6A 2RH7A 1CV7A 3VRNA 2Y5IA 1CNPA 1U5IB 1QLKA 3SSLA 1CKKA 4LJCA 4B30A 3AKBA 4CIDA 4PFEA 1PALA 1NX1A 1QVIZ 1S3PA 3DQ3A 3SVCA 2QACA 1C7VA 3BUNB 1BMOA 5HZSA 4KF5A 2K61A 2OTEA 1B47A 1SR6B 3SG3A 2ICRA 2OGRA 4P76A 4MZLA 2JPTA 2GV5A 2AHAA 1DGVA 3MGFA 2BCBA 5BPJA 1DGUA 3EKHA 1L2OC 3SSHA 1Q4EA 2CNPA 5HKZA 1J1EA 2AAOA 3LF3A 2LM5A 4MRXA 4WQ2A 4ANJA 5AXIA 4L13A 1SBJA 2EMOA 4DXQA 1J55A 3CTNA 2BBMA 4NDDA 1C4FA 3ICBA 1B8CA 2KGBC 4LJDA 4I5JA 1JFJA 2F3ZA 1EMAA 3PALA 3LS3A 2G3OA 3EKJA 1BLQA 2JWWA 4YGEB 1MXEA 2YFPA 3BX9A 4ORBB 2G5ZB 1R6PA 1WLZA 4I5LB 1XK4C 1H6RA 3OSQA 3TZ1A 3VGOA 4UTSA 1NPQA 3ZTFA 1W7TA 3DVEA 2JULA 3CS1A 3BXCA 4AOMA 2A48A 3QRXA 1ZOTB 1F71A 4Q04A 4DXMA 1B8RA 1YUUA 3EVUA 3O2PA 1YJ2A 4H3LA 4IK9A 4A4BA 4W6SA 1L2OB 4YBHB 3CFHA 1RROA 2KAXA 1CMGA 4HE4A 1BR4B 2PXSA 1EXRA 2PALA 4W7CA 1G33A 5AEQA 1AJ5A 1HUYA 1MQ1A 3RWTA 2FJUB 1B9AA 1F8HA 4OKHA 4XJKB 1W7JB 4GESB 2JOJA 1DJXA 2MRDA 2QLHA 1XMZA 2V4EC 3ZWHA 2JXCA 3F45A 1XVJA 3U8AA 3I19A 3DQDA 4XGYA 3TMRA 4LW5A 3WLDA 2LMVA 1OMDA 2M1KB 5H88A 1UHHA 4PHMA 1DMOA 1CLLA 2I18A 3BUXB 2LC5A 3DF0B 1J1DA 1JFKA 2DD7A 3LL8B 3BXAA 4W6HA 2CBLA 3I5HB 1S36A 1QIWA 4J8AA 3VROA 1CDPA 2D8NA 3E5WA 1F09A 1E8AA 4B5YA 1DTLA 1DJGA 2OTBA 3GK4X 1OMRA 3VK1A 2A53B 2HGYA 2AMIA 4KF5C 2ZNEA 3M22A 3NSKA 3NF0A 1DJHA 4NDCA 2ZN9A 5DRGA 2KDHA 3TS5C 2LANA 5FVFA 1KSMA 1DJWA 4PHJA 2Y1MA 2VAEA 2OKYA 2M49B 3U8CA 4GOBA 2V4EB 1A2XA 2WORA 2P6BB 3SVBA 3PJ7A 1S1EA 3CR5X 5HLOA 3CR4X 4DXNA 2QLEA 4F0ZB 5HLVA 1KFUS 4R6BA 3W1DA 2JADA 4LJDC 3FWBA 2FOTA 4MRYA 1N2DA 2JRFA 3EVRA 2F3YA 3JTDC 2AWLA 1YX8A 2G6XA 3A8SA 1LKJA 2DUEA 3CD9A 2SCPA 3OB2B 1JBZA 2M3WA 4L9MA 1JWDA 4OVNF 4I5KA 2MAZA 5KTGA 1Q4DA 1OQPA 1LA3A 5J3XA 3TDUA 3LF4B 1ZMZA 3TS5B 4ZCUA 3PATA 2IB5A 4QJ5B 3EK8A 5I8NA 2H9WA 3ED8A 1YRUB 5LTPA 1XQMA 3DQOA 3LA1A 2HQKA 2O29A 1WRZA 5JJGA 1SMGA 2M97A 2Y0GA 2WURA 1QYOA 4DIRA 3GOFA 3CFFA 1FF1A 2LHLA 1RECA 3H1RA 1KWOB 4W6CA 4AQJA 2G16B 1UP5A 5AQBB 1ZGOA 2ZNDA 2QLIA 1M39A 1JC2A 2G6YA 1SYMA 3SVRA 1R2UA 4Q9WA 3D0YA 3BXBA 3EK7A 4W7DA 4W6OA 1Y1UA 2F8PA 1BT6A 4YI8A 5PALA 3RLZA 4W7XA 1AHRA 4TZAA 3DPXA 4ZF5A 2LLTA 3ZULA 1N65A 4USLA 5I2LA 2B1UA 1KQMC 2PMYA 1JSAA 1WRKA 5HW9A 3CWGA 2H5PA 1S5GZ 2ARLA 1XFXO 2PSRA 1Z1QA 2ZFDA 2ZO6A 1B7TY 3DQIA 3K21A 2A52B 5DPGA 2OTGB 3DQEA 2G2BA 1UUSA 1K95A 1QJTA 1QXTA 4KW8A 1AUIB 4H3NA 1EG4A 2EMDA 3UG0A 4YGAA 1RRXA 3BYAA 1XK4A 5AANA 4W6AA 1BJFA 2ZN8A 2IS9A 2Y1NA 4L1IA 4MBEA 3SVUA 5LTQA 2VZXA 1BFPA 2POXA 1UURA 1NIWA 4L12A 2MJWB 1AJ4A 4J88A 2Q4UA 3I5GB 3D10A 2M9GA 1SKTA 1TNQA 2COLB 2L98A 3SRYA 1RMMA 1ZUZA 1KQMB 5CSIA 2LVJA 3DQKA 4ZCVA 1QTXA 2WIQA 2IB6A 1Q73A 2E30A 1JF2A 1WDCC 3NSLA 1HCJA 2KI6C 2Z1OA 1AVSA 2BBNA 1MYWA 5HZTA 4HRHA 1PVBA 4TZGA 2HPWA 4IK5A 2BL0C 2K8MB 4LQTA 1XO5A 2BE4A 1DVIA 4CLNA 1PSRA 2JTTA 4HRGA 2DDCA 4OHSA 1MWNA 2AUCA 5DTYA 2HQWA 2L5XB 5BQLA 4W77A 3SVOA 1K9PA 4H47A 4DCKA 1ALWA 3SJSA 2M0RA 4JF9A 2H61A 4ORCB 3ST0A 2KAYA 2WSOA 3SG5A 3CBEA 3KCTA 4XYNA 3NEZA 4JPZB 3AKOA 1NUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H48 A;  3CZT X;  2KQY A;  2ZKM X;  1CTR A;  2O24 A;  1PSB A;  4IK1 A;  1ZGQ A;  1N0Y A;  2WHU A;  1M31 A;  3NED A;  2M7L A;  2F2P A;  3I5I C;  4AQI A;  3IQQ A;  3BUW B;  2YDZ A;  1X02 A;  2QLG A;  4EDO A;  3M24 A;  4ICB A;  1V1G A;  1F4Q A;  3A8R A;  1XFZ O;  4R1E A;  1YZW A;  2HFC A;  1F55 A;  1WDC B;  3VRQ A;  1QYF A;  1QYQ A;  2M7N A;  3VRP A;  1XFY O;  3OHM B;  2A46 A;  1SCV A;  4GFT A;  4PCW A;  1K90 D;  3WHU B;  2QT2 A;  3SSY A;  2H5R A;  1NX3 A;  2YE0 A;  4CFR A;  3RWA A;  1J7R A;  2LNK A;  1YHG A;  2L2E A;  2I2R E;  2HQZ A;  4LQU A;  3GJ2 A;  2YE1 A;  1FW4 A;  2LVK A;  4PE0 A;  1H4B A;  2PVB A;  1RMP A;  5DTZ A;  3ZUF A;  4UPG A;  1HQV A;  3U0K A;  3ADF A;  2DD9 A;  2A47 A;  1VRK A;  3AAJ A;  3LK0 A;  5DPH A;  1OOJ A;  3SVD A;  2FL1 A;  4GF6 B;  1L7Z A;  3D0Y B;  2ZRT A;  2BKI B;  1BOC A;  3SIA A;  3AAK A;  4W6T A;  1OXD A;  4N1F A;  4AS8 A;  1G8I A;  1H8B A;  3NSI A;  5BT0 A;  5EBJ A;  3SVN A;  1EMF A;  4W6L A;  1BG1 A;  1GGZ A;  2FCD A;  5FHV A;  4MZK A;  1KYR A;  1NP8 A;  2KGR A;  1CDM A;  2MLF C;  1PUL A;  1EL4 A;  2KOT A;  2LLU A;  1XYD A;  1OE9 B;  2DUI A;  1KFU L;  4PPL A;  1QX5 B;  1QAT A;  4DKM A;  1NX2 A;  2JU0 A;  5J2O A;  4MSP A;  4KW9 A;  1QX7 A;  3A4U B;  1GJY A;  2WCF A;  3G9A A;  3DVK A;  4PPJ A;  1AP4 A;  3CGA A;  1GFL A;  4KEX A;  2LP3 A;  1YVL A;  1Y1A A;  1B8L A;  5LK4 A;  2KSP A;  1GGW A;  1KSO A;  3AKA A;  1PVA A;  5DQB A;  1KYP A;  1XA5 A;  2H61 C;  1QXP A;  4R6D A;  2CXJ A;  2H5O A;  1TIZ A;  1QY3 A;  5AER A;  4JFG A;  5CSF A;  1UHK A;  2VRG A;  2K7B A;  2DUH A;  1GGX A;  1DF0 A;  2AH8 A;  2KHN A;  2NZ0 A;  1K94 A;  1IGV A;  4QJ4 B;  3OB1 B;  5F6T A;  1RM9 A;  2LAP A;  1UHJ A;  2H6V A;  2JT0 A;  2HF5 A;  3MSE B;  4PE1 A;  3TMT A;  2ZMW A;  1TOP A;  1KFX S;  2MLE C;  3CR2 A;  1JC1 A;  3AI4 A;  2JZI A;  2Q91 A;  2E6W A;  4I5N B;  1QIV A;  1JF0 A;  4Q7U A;  1B4C A;  1YHI A;  2C9J A;  5CSN A;  4DUQ A;  2KFH A;  5KSZ A;  4M2Q A;  4TNC A;  1XFW O;  5K89 A;  3UFZ A;  3M0W A;  1Z1P A;  4N3D A;  1FPW A;  5F9G A;  1XAE A;  3BQ3 A;  4PDZ A;  1YUT A;  4GAO A;  5HBD A;  4RTC A;  1CMF A;  2QU1 A;  4B30 B;  3OX6 A;  3SG4 A;  2NCP A;  2WSN A;  2DOQ A;  1EMB A;  1XFV O;  4KGF A;  3DQ4 A;  2HCG A;  1SPY A;  4RYS A;  1PK0 D;  3IF7 A;  2Y4Q A;  1YTZ C;  2QRF A;  4IK3 A;  2AWK A;  1IJ5 A;  3LLE A;  4W7E A;  2QLG B;  5DY6 A;  4DKN A;  1TTX A;  4EMQ A;  1KK8 C;  1JUO A;  2K7D A;  4MN0 A;  1SL7 A;  4XL5 A;  1QS7 A;  3SG6 A;  1DJY A;  2OKW A;  5LTR A;  1ZGP A;  1NCY A;  4GGF A;  1JBA A;  4MLW A;  1F0B A;  1ZUX A;  2M29 A;  3IR8 A;  1DJI A;  1TN4 A;  1CDN A;  4W6F A;  1TNW A;  2R2I A;  1B1G A;  2OS8 C;  3AI5 A;  3SSV A;  1FI5 A;  1B7T Z;  3SST A;  1EML A;  2V53 A;  2BKH B;  2NCO A;  3JTD B;  1RK9 A;  2M8U A;  1MR8 A;  4W6R A;  1BF5 A;  4NDB A;  5EHU A;  4Z4K A;  3SVS A;  3NT9 A;  3H1O A;  2OJK A;  1IJ6 A;  2LVI A;  1OZS A;  4W6G A;  1ZFS A;  2EMN A;  2Q6P A;  2K2A A;  1NX0 A;  4XOV A;  2AWM A;  3KCS A;  4OQW A;  2G2S B;  1KCY A;  3E5T A;  1A75 A;  2LMU A;  5KU1 A;  1KK8 B;  1CFC A;  2NLN A;  2JNX A;  4A4C A;  1J7Q A;  5DPI A;  2CTN A;  1CFP A;  3DQC A;  4DS7 A;  1SNL A;  1OMV A;  2EC6 C;  4W6J A;  1QV1 A;  1LVC D;  2NXQ A;  5AFP A;  1YR5 A;  5DTX A;  1K8U A;  3O4Y A;  5DU0 A;  1SW8 A;  3OSR A;  4OGS A;  5DQM A;  3OP0 A;  2OS8 B;  4BDU A;  3SV5 A;  1CFF A;  1UHI A;  1YJF A;  4KPI A;  3VIC A;  2KI4 C;  2WC8 A;  3DQJ A;  2FZU A;  1ODB A;  4ORN A;  2L0P A;  4M2P A;  1DJZ A;  1JBY A;  2G3D B;  1CB1 A;  2ZRS A;  3PN7 C;  2WCE A;  3FS7 A;  1XA9 A;  3DQ7 A;  2Q57 A;  4WRI A;  4Q7R A;  1EG3 A;  2ZMU A;  2HGD A;  1WRL A;  4GUK A;  2LLS A;  3WCK A;  2IE2 A;  1M63 B;  3DF0 A;  3GK2 A;  3PM8 A;  3WXA A;  1K9U A;  4Q7T A;  3PLF B;  5CSJ A;  4W7F A;  1YVH A;  3TUY C;  3H4S E;  3U0L A;  2VAD A;  4M2O A;  2HJO A;  2GW4 B;  3GK1 A;  3PSR A;  3LSA A;  1DF0 B;  2MA2 A;  1MF8 B;  3V3D A;  2LUX A;  4U8D A;  2BCA A;  1K2H A;  2WOS A;  2O5G A;  2OPO A;  1Q4C A;  2B3Q A;  4HQC A;  1SR6 C;  2KFF A;  5DPJ A;  4W6U A;  3IP2 A;  2MBX A;  2H5Q A;  4W7R A;  3SSP A;  2EC6 B;  2WHS A;  4W6K A;  1M46 A;  4W6I A;  5EXC I;  3EK4 A;  3PJ5 A;  4HQ8 A;  4EUL A;  1KK7 Y;  4OCI A;  2BTJ A;  4PPK A;  2WHT A;  1SK6 D;  2DUF A;  4W69 A;  1XFU O;  1SY9 A;  3LVC A;  2K2F A;  4GGF C;  4FQO A;  2FWQ A;  3BUM B;  4RYW A;  3PN7 B;  1ALV A;  5H87 A;  4HQ9 A;  2LHI A;  1NCX A;  5FYX A;  4HRE E;  4W72 A;  3SS0 A;  2KAV A;  4W6M A;  1TCO B;  2LCP A;  1QV0 A;  2Z6X A;  1FBV A;  5EXU A;  1K96 A;  1W7I B;  2LMT A;  4WQ3 A;  4Q9X A;  3TUY B;  4DXI A;  1F70 A;  4JRB A;  4CPV A;  4YGB B;  4YI9 A;  1MOV A;  3CFA A;  2L4I A;  1SL8 A;  3E5V A;  4U2V A;  4PHK A;  4JC2 A;  2JT3 A;  4EDS A;  3O6B A;  4W7A A;  4YGD B;  1LIN A;  3LCP C;  4ZF4 A;  2GGM A;  3HX4 A;  5EB7 A;  1NCZ A;  1XSS A;  2H8Q A;  1BR1 B;  4W6D A;  3DQ9 A;  4PHN A;  2K0J A;  2QPT A;  2BL0 B;  3EVP A;  1Q80 A;  3PFV A;  2RGI A;  1S6I A;  5H89 A;  1BU3 A;  4JWQ A;  4MEW A;  5ER4 X;  3CGL A;  1IKU A;  2H2K A;  1EJ3 A;  1IWQ A;  5T3I A;  4D1E A;  3DQU A;  2F2O A;  5IBW A;  1YUR A;  5DTL A;  1SL9 A;  1W7S A;  3K1K A;  2KYF A;  2JQ6 A;  2GX2 A;  1CM4 A;  4YRU A;  2JXL A;  3HCM A;  1QVI Y;  2P4M A;  1YFP A;  4ZBL A;  4HSZ A;  1QX2 A;  1Q4B A;  1YRT B;  4PE7 A;  4JQ0 D;  4KA9 A;  4GPL B;  4W6N A;  1GL4 A;  1KFX L;  3I5I B;  3E3R A;  1AK8 A;  3P28 A;  3KEV A;  1ZAC A;  1Y0V H;  2A4J A;  3I5H C;  4PAL A;  3SIB A;  2ZO7 A;  4FTG A;  1A75 B;  2KNE A;  4KGE A;  3OGO A;  1MUX A;  4W76 A;  3LVD A;  3GJ1 A;  4E68 A;  2HQ8 A;  1MHO A;  4KF4 A;  2L4H A;  1EME A;  1C07 A;  3DQL A;  4W73 A;  1KYS A;  1Y1X A;  2LV7 A;  3SG2 A;  2LUC A;  5EXB A;  1QLS A;  1OXE A;  2DDD A;  4MZJ A;  3NXA A;  4ZB1 A;  2KI6 D;  5JOL A;  4JGE A;  2JC2 A;  1TCF A;  3BUO B;  4C0L A;  5DKQ A;  4IL1 A;  3ZUJ A;  3GB3 A;  3SG7 A;  4XVP A;  3GEX A;  4N1G A;  1Y6W A;  3BXK A;  1F4O A;  2BCX A;  2CT9 A;  3S05 A;  3NT3 A;  1CFD A;  3CLN A;  1RFJ A;  2WCB A;  5BTT A;  5I2O A;  4XOW A;  4C0J A;  4BY4 A;  2WIS A;  3TDZ A;  1EMC A;  3SSK A;  3OX5 A;  3KPX A;  1S6Z A;  1GQM A;  2VVJ A;  3ST2 A;  4NWS A;  3KO0 A;  1SRA A;  5D69 A;  5EJU A;  1D1O A;  2MHH A;  3DQ6 A;  2A56 B;  3SVE A;  3DQ8 A;  2C9I A;  1KP5 A;  2O60 A;  2LE9 B;  3WHT B;  4P2Y B;  1IH0 A;  3KF9 A;  2GX0 A;  1M45 A;  2VVH A;  3DQF A;  3EVV A;  2HET A;  2SAS A;  1RWY A;  2L51 A;  4N5X A;  3WNX B;  2GGZ A;  1J7O A;  1KQV A;  1G7K A;  5ER5 A;  4ZF3 A;  3BOW A;  2EGD A;  4EN1 A;  4KAG A;  4OJ0 A;  3VHT A;  1MOU A;  5HZU A;  2Z6Y A;  3DQA A;  3LK1 A;  1JC0 A;  3U0N A;  4H3M A;  4CFQ A;  3DQ1 A;  1RTP 1;  1U5I A;  3LVA A;  3JVT C;  2BEC A;  5EB6 A;  1KWO C;  1RMO A;  4BY5 A;  1PRW A;  3WLC A;  1WLM A;  2KFG A;  1LA0 A;  2A54 B;  2AWJ A;  4LJB A;  4YGC B;  4P5O E;  2K7O A;  1V1F A;  2TN4 A;  2G9B A;  1K9K A;  2FCE A;  1IQ5 A;  4ZIO A;  4W75 A;  5G08 A;  1EMK A;  4KW4 A;  2VVI A;  2CCM A;  3DQ5 A;  2ISD A;  1TRF A;  1S26 D;  2HPS A;  5FVI A;  4J89 A;  2M1U A;  1RJV A;  4MVF A;  5HYD A;  1TNP A;  4DXP A;  1CLM A;  4ETO A;  4OY4 A;  5I2Q A;  3CD1 A;  5D7F A;  5TNC A;  2L50 A;  1S6J A;  4GBA A;  2LP2 A;  2EHB A;  5DKR A;  3KHE A;  3DQ2 A;  3RM1 A;  3CB9 A;  2HRS A;  4GNK B;  1W7U A;  2OTG C;  3NSO A;  2KYC A;  3P8U A;  3DVJ A;  2KBM A;  1SCM C;  2JTZ A;  3JVT B;  5HKY A;  1A29 A;  1YUS A;  4IK4 A;  2WND A;  3VRR A;  4GGN A;  3DQM A;  1EH2 A;  1NYA A;  3PIB A;  1UHN A;  2PAS A;  3DVM A;  3C1V A;  1NSH A;  4PE4 A;  5HGE A;  4IZN A;  3GL4 A;  2GW3 A;  1HT9 A;  2BE6 A;  4ZIN A;  1YX7 A;  1LXF C;  3O78 A;  5GQQ C;  3ZNI A;  2PRU A;  1TNX A;  3FIA A;  2I94 A;  4NQG A;  1H4U A;  4W6P A;  1NWD A;  5HKW A;  1EMG A;  2DUG A;  3I5G C;  5CPV A;  4ZFS A;  1A03 A;  1Q4A A;  1UIS A;  1YHH A;  1C7W A;  1G4Y R;  3IQO A;  2IOV A;  4XJK A;  1S6C A;  3I5F C;  1MXL C;  4OR9 B;  1KK7 Z;  2I7A A;  4OV2 A;  3ST3 A;  1EMM A;  1SCM B;  2O2B A;  1J7P A;  4C0K A;  3W1C A;  1BOD A;  1B9C A;  3DQN A;  2LVV A;  1OSA A;  3DPW A;  3DPZ A;  3DQH A;  3O77 A;  5BTT B;  4QJ3 B;  5B8I B;  4IK8 A;  4DXO A;  4AR7 A;  1A4P A;  4W6B A;  2G6E A;  3U8P A;  1WY9 A;  1CDL A;  4Z4M A;  4I2Y A;  1S5G Y;  3PJB A;  1DT7 B;  3ST4 A;  1CLB A;  2B3P A;  5FVG A;  2QZ0 A;  1IQ3 A;  1OZO A;  1CM1 A;  5DKN A;  1QAS A;  5KTY A;  3U0M A;  2KQ6 A;  4DRW A;  4P1Q A;  2Z6Z A;  5DRF A;  4ORA B;  1OXF A;  2KI4 B;  3I5F B;  2JNF A;  1IRJ A;  4HVF A;  2V4E A;  4W74 A;  2KBI A;  3FWC A;  1UWO A;  2PXW A;  4JEO A;  1IG5 A;  5HZO A;  1K93 D;  2JT8 A;  2A50 B;  2F33 A;  3BOW B;  1F54 A;  2K7C A;  3DD4 A;  3TDI A;  3VHT B;  1FI6 A;  2RH7 A;  1CV7 A;  3VRN A;  2Y5I A;  1CNP A;  1U5I B;  1QLK A;  3SSL A;  1CKK A;  4LJC A;  4B30 A;  3AKB A;  4CID A;  4PFE A;  1PAL A;  1NX1 A;  1QVI Z;  1S3P A;  3DQ3 A;  3SVC A;  2QAC A;  1C7V A;  3BUN B;  1BMO A;  5HZS A;  4KF5 A;  2K61 A;  2OTE A;  1B47 A;  1SR6 B;  3SG3 A;  2ICR A;  2OGR A;  4P76 A;  4MZL A;  2JPT A;  2GV5 A;  2AHA A;  1DGV A;  3MGF A;  2BCB A;  5BPJ A;  1DGU A;  3EKH A;  1L2O C;  3SSH A;  1Q4E A;  2CNP A;  5HKZ A;  1J1E A;  2AAO A;  3LF3 A;  2LM5 A;  4MRX A;  4WQ2 A;  4ANJ A;  5AXI A;  4L13 A;  1SBJ A;  2EMO A;  4DXQ A;  1J55 A;  3CTN A;  2BBM A;  4NDD A;  1C4F A;  3ICB A;  1B8C A;  2KGB C;  4LJD A;  4I5J A;  1JFJ A;  2F3Z A;  1EMA A;  3PAL A;  3LS3 A;  2G3O A;  3EKJ A;  1BLQ A;  2JWW A;  4YGE B;  1MXE A;  2YFP A;  3BX9 A;  4ORB B;  2G5Z B;  1R6P A;  1WLZ A;  4I5L B;  1XK4 C;  1H6R A;  3OSQ A;  3TZ1 A;  3VGO A;  4UTS A;  1NPQ A;  3ZTF A;  1W7T A;  3DVE A;  2JUL A;  3CS1 A;  3BXC A;  4AOM A;  2A48 A;  3QRX A;  1ZOT B;  1F71 A;  4Q04 A;  4DXM A;  1B8R A;  1YUU A;  3EVU A;  3O2P A;  1YJ2 A;  4H3L A;  4IK9 A;  4A4B A;  4W6S A;  1L2O B;  4YBH B;  3CFH A;  1RRO A;  2KAX A;  1CMG A;  4HE4 A;  1BR4 B;  2PXS A;  1EXR A;  2PAL A;  4W7C A;  1G33 A;  5AEQ A;  1AJ5 A;  1HUY A;  1MQ1 A;  3RWT A;  2FJU B;  1B9A A;  1F8H A;  4OKH A;  4XJK B;  1W7J B;  4GES B;  2JOJ A;  1DJX A;  2MRD A;  2QLH A;  1XMZ A;  2V4E C;  3ZWH A;  2JXC A;  3F45 A;  1XVJ A;  3U8A A;  3I19 A;  3DQD A;  4XGY A;  3TMR A;  4LW5 A;  3WLD A;  2LMV A;  1OMD A;  2M1K B;  5H88 A;  1UHH A;  4PHM A;  1DMO A;  1CLL A;  2I18 A;  3BUX B;  2LC5 A;  3DF0 B;  1J1D A;  1JFK A;  2DD7 A;  3LL8 B;  3BXA A;  4W6H A;  2CBL A;  3I5H B;  1S36 A;  1QIW A;  4J8A A;  3VRO A;  1CDP A;  2D8N A;  3E5W A;  1F09 A;  1E8A A;  4B5Y A;  1DTL A;  1DJG A;  2OTB A;  3GK4 X;  1OMR A;  3VK1 A;  2A53 B;  2HGY A;  2AMI A;  4KF5 C;  2ZNE A;  3M22 A;  3NSK A;  3NF0 A;  1DJH A;  4NDC A;  2ZN9 A;  5DRG A;  2KDH A;  3TS5 C;  2LAN A;  5FVF A;  1KSM A;  1DJW A;  4PHJ A;  2Y1M A;  2VAE A;  2OKY A;  2M49 B;  3U8C A;  4GOB A;  2V4E B;  1A2X A;  2WOR A;  2P6B B;  3SVB A;  3PJ7 A;  1S1E A;  3CR5 X;  5HLO A;  3CR4 X;  4DXN A;  2QLE A;  4F0Z B;  5HLV A;  1KFU S;  4R6B A;  3W1D A;  2JAD A;  4LJD C;  3FWB A;  2FOT A;  4MRY A;  1N2D A;  2JRF A;  3EVR A;  2F3Y A;  3JTD C;  2AWL A;  1YX8 A;  2G6X A;  3A8S A;  1LKJ A;  2DUE A;  3CD9 A;  2SCP A;  3OB2 B;  1JBZ A;  2M3W A;  4L9M A;  1JWD A;  4OVN F;  4I5K A;  2MAZ A;  5KTG A;  1Q4D A;  1OQP A;  1LA3 A;  5J3X A;  3TDU A;  3LF4 B;  1ZMZ A;  3TS5 B;  4ZCU A;  3PAT A;  2IB5 A;  4QJ5 B;  3EK8 A;  5I8N A;  2H9W A;  3ED8 A;  1YRU B;  5LTP A;  1XQM A;  3DQO A;  3LA1 A;  2HQK A;  2O29 A;  1WRZ A;  5JJG A;  1SMG A;  2M97 A;  2Y0G A;  2WUR A;  1QYO A;  4DIR A;  3GOF A;  3CFF A;  1FF1 A;  2LHL A;  1REC A;  3H1R A;  1KWO B;  4W6C A;  4AQJ A;  2G16 B;  1UP5 A;  5AQB B;  1ZGO A;  2ZND A;  2QLI A;  1M39 A;  1JC2 A;  2G6Y A;  1SYM A;  3SVR A;  1R2U A;  4Q9W A;  3D0Y A;  3BXB A;  3EK7 A;  4W7D A;  4W6O A;  1Y1U A;  2F8P A;  1BT6 A;  4YI8 A;  5PAL A;  3RLZ A;  4W7X A;  1AHR A;  4TZA A;  3DPX A;  4ZF5 A;  2LLT A;  3ZUL A;  1N65 A;  4USL A;  5I2L A;  2B1U A;  1KQM C;  2PMY A;  1JSA A;  1WRK A;  5HW9 A;  3CWG A;  2H5P A;  1S5G Z;  2ARL A;  1XFX O;  2PSR A;  1Z1Q A;  2ZFD A;  2ZO6 A;  1B7T Y;  3DQI A;  3K21 A;  2A52 B;  5DPG A;  2OTG B;  3DQE A;  2G2B A;  1UUS A;  1K95 A;  1QJT A;  1QXT A;  4KW8 A;  1AUI B;  4H3N A;  1EG4 A;  2EMD A;  3UG0 A;  4YGA A;  1RRX A;  3BYA A;  1XK4 A;  5AAN A;  4W6A A;  1BJF A;  2ZN8 A;  2IS9 A;  2Y1N A;  4L1I A;  4MBE A;  3SVU A;  5LTQ A;  2VZX A;  1BFP A;  2POX A;  1UUR A;  1NIW A;  4L12 A;  2MJW B;  1AJ4 A;  4J88 A;  2Q4U A;  3I5G B;  3D10 A;  2M9G A;  1SKT A;  1TNQ A;  2COL B;  2L98 A;  3SRY A;  1RMM A;  1ZUZ A;  1KQM B;  5CSI A;  2LVJ A;  3DQK A;  4ZCV A;  1QTX A;  2WIQ A;  2IB6 A;  1Q73 A;  2E30 A;  1JF2 A;  1WDC C;  3NSL A;  1HCJ A;  2KI6 C;  2Z1O A;  1AVS A;  2BBN A;  1MYW A;  5HZT A;  4HRH A;  1PVB A;  4TZG A;  2HPW A;  4IK5 A;  2BL0 C;  2K8M B;  4LQT A;  1XO5 A;  2BE4 A;  1DVI A;  4CLN A;  1PSR A;  2JTT A;  4HRG A;  2DDC A;  4OHS A;  1MWN A;  2AUC A;  5DTY A;  2HQW A;  2L5X B;  5BQL A;  4W77 A;  3SVO A;  1K9P A;  4H47 A;  4DCK A;  1ALW A;  3SJS A;  2M0R A;  4JF9 A;  2H61 A;  4ORC B;  3ST0 A;  2KAY A;  2WSO A;  3SG5 A;  3CBE A;  3KCT A;  4XYN A;  3NEZ A;  4JPZ B;  3AKO A;  1NUB A; 
#chains in the Genus database with same CATH topology
 4H48 A;  3CZT X;  2KQY A;  2ZKM X;  1CTR A;  2O24 A;  1PSB A;  4IK1 A;  1ZGQ A;  1N0Y A;  2WHU A;  1M31 A;  3NED A;  2M7L A;  2F2P A;  3D75 A;  3I5I C;  4AQI A;  3IQQ A;  3BUW B;  2YDZ A;  1X02 A;  2QLG A;  4EDO A;  3M24 A;  4ICB A;  1V1G A;  1F4Q A;  3A8R A;  1XFZ O;  4R1E A;  1YZW A;  3S0E A;  2HFC A;  1F55 A;  1WDC B;  3VRQ A;  1QYF A;  1QYQ A;  2M7N A;  3VRP A;  1XFY O;  3OHM B;  2A46 A;  1ORG A;  1SCV A;  4GFT A;  4PCW A;  1K90 D;  3WHU B;  2QT2 A;  3SS4 A;  3SSY A;  2H5R A;  1NX3 A;  2YE0 A;  4CFR A;  3RWA A;  1J7R A;  2LNK A;  1YHG A;  2L2E A;  2I2R E;  2HQZ A;  4LQU A;  3GJ2 A;  2YE1 A;  1FW4 A;  2LVK A;  4PE0 A;  1H4B A;  2PVB A;  1RMP A;  5DTZ A;  3ZUF A;  4UPG A;  1HQV A;  3U0K A;  3ADF A;  2DD9 A;  2A47 A;  1VRK A;  3AAJ A;  3LK0 A;  5DPH A;  1OOJ A;  3SVD A;  2FL1 A;  4GF6 B;  1L7Z A;  3D0Y B;  2ZRT A;  2BKI B;  1BOC A;  3SIA A;  3AAK A;  4W6T A;  1OXD A;  4N1F A;  4AS8 A;  5DIC A;  1G8I A;  1H8B A;  3NSI A;  5BT0 A;  5EBJ A;  3SVN A;  1EMF A;  4W6L A;  1BG1 A;  1GGZ A;  2FCD A;  3CZ1 A;  5FHV A;  4MZK A;  1KYR A;  1NP8 A;  2KGR A;  1CDM A;  2MLF C;  1PUL A;  1EL4 A;  2KOT A;  1P28 A;  2LLU A;  1XYD A;  1OE9 B;  2FJY A;  2DUI A;  1KFU L;  4PPL A;  1QX5 B;  1QAT A;  4DKM A;  1NX2 A;  2JU0 A;  5J2O A;  1QWV A;  4MSP A;  4KW9 A;  1QX7 A;  3A4U B;  1GJY A;  2WCF A;  3G9A A;  3DVK A;  4PPJ A;  1AP4 A;  3CGA A;  3RZS A;  1GFL A;  4KEX A;  3FE8 A;  2LP3 A;  1YVL A;  1Y1A A;  1B8L A;  5LK4 A;  2KSP A;  1GGW A;  1KSO A;  3AKA A;  1PVA A;  5DQB A;  1KYP A;  1XA5 A;  2H61 C;  2QEB A;  1QXP A;  4R6D A;  2CXJ A;  2H5O A;  1TIZ A;  1QY3 A;  5AER A;  4JFG A;  5CSF A;  1UHK A;  2VRG A;  2K7B A;  2DUH A;  1GGX A;  1DF0 A;  2AH8 A;  2KHN A;  2NZ0 A;  1K94 A;  1IGV A;  4QJ4 B;  3OB1 B;  5F6T A;  1RM9 A;  2LAP A;  1UHJ A;  2H6V A;  2JT0 A;  2HF5 A;  3MSE B;  4PE1 A;  3TMT A;  2ZMW A;  1TOP A;  1KFX S;  1OOF A;  5FI2 A;  2MLE C;  3CR2 A;  1JC1 A;  3AI4 A;  2JZI A;  2Q91 A;  2E6W A;  4I5N B;  1QIV A;  1JF0 A;  4Q7U A;  1SSE B;  1B4C A;  3SS5 A;  1YHI A;  2C9J A;  3D73 A;  5CSN A;  4DUQ A;  2KFH A;  5KSZ A;  4M2Q A;  4TNC A;  1XFW O;  5K89 A;  3UFZ A;  3M0W A;  1Z1P A;  4N3D A;  1FPW A;  5F9G A;  1XAE A;  3BQ3 A;  4PDZ A;  1YUT A;  4GAO A;  5HBD A;  4RTC A;  1CMF A;  2QU1 A;  4B30 B;  3OX6 A;  3SG4 A;  2NCP A;  2WSN A;  2DOQ A;  4OZD A;  1EMB A;  1C3Y A;  1XFV O;  4KGF A;  3DQ4 A;  4INX A;  2HCG A;  1SPY A;  4RYS A;  1PK0 D;  3IF7 A;  2Y4Q A;  1YTZ C;  2QRF A;  3PJI A;  4IK3 A;  2AWK A;  1IJ5 A;  3LLE A;  1OOI X;  4W7E A;  2QLG B;  5DY6 A;  4DKN A;  1TTX A;  3R1O A;  4EMQ A;  1KK8 C;  1JUO A;  2K7D A;  4MN0 A;  1SL7 A;  4XL5 A;  1QS7 A;  3SG6 A;  1DJY A;  2OKW A;  2PQL A;  5LTR A;  1ZGP A;  1NCY A;  4GGF A;  1JBA A;  4MLW A;  1F0B A;  1ZUX A;  2M29 A;  3IR8 A;  1DJI A;  1TN4 A;  1CDN A;  4W6F A;  1OW4 A;  1TNW A;  2R2I A;  1B1G A;  2OS8 C;  3AI5 A;  3SSV A;  1FI5 A;  1B7T Z;  3SST A;  1EML A;  2V53 A;  2BKH B;  2NCO A;  3JTD B;  1RK9 A;  2M8U A;  1MR8 A;  4W6R A;  1BF5 A;  4NDB A;  5EHU A;  4Z4K A;  3SVS A;  3NT9 A;  3H1O A;  4IJ7 A;  2OJK A;  1IJ6 A;  2LVI A;  1OZS A;  3O4X A;  4W6G A;  5EL2 A;  1ZFS A;  1TWO A;  2EMN A;  2Q6P A;  2K2A A;  1NX0 A;  3CZ0 A;  4XOV A;  2AWM A;  3KCS A;  3NHT A;  4OQW A;  2G2S B;  1KCY A;  3E5T A;  5KU1 A;  1A75 A;  2LMU A;  1KK8 B;  3D77 A;  1CFC A;  2NLN A;  2JNX A;  4A4C A;  1J7Q A;  5DPI A;  2CTN A;  1CFP A;  3DQC A;  4DS7 A;  1SNL A;  1OMV A;  2EC6 C;  4W6J A;  1QV1 A;  1LVC D;  2NXQ A;  5AFP A;  1YR5 A;  5DTX A;  1K8U A;  3O4Y A;  5DU0 A;  1SW8 A;  3OSR A;  4OGS A;  5DQM A;  1DQE A;  3OP0 A;  2OS8 B;  4BDU A;  3SV5 A;  1CFF A;  1UHI A;  1YJF A;  4KPI A;  3VIC A;  2KI4 C;  2WC8 A;  3DQJ A;  2FZU A;  1ODB A;  3DY9 A;  4ORN A;  2L0P A;  4M2P A;  1DJZ A;  1JBY A;  2G3D B;  1CB1 A;  2ZRS A;  3PN7 C;  2WCE A;  3FS7 A;  1XA9 A;  3DQ7 A;  2Q57 A;  2K60 A;  4WRI A;  4Q7R A;  1EG3 A;  2ZMU A;  2HGD A;  1WRL A;  1T14 A;  4GUK A;  2LLS A;  3WCK A;  2IE2 A;  1M63 B;  3DF0 A;  3GK2 A;  3PM8 A;  3WXA A;  1K9U A;  4Q7T A;  3PLF B;  5CSJ A;  4W7F A;  1YVH A;  3TUY C;  3H4S E;  3U0L A;  2VAD A;  4M2O A;  2HJO A;  2GW4 B;  3GK1 A;  3PSR A;  3LSA A;  1DF0 B;  2MA2 A;  1MF8 B;  3V3D A;  2LUX A;  3BFH A;  4U8D A;  2BCA A;  3CYZ A;  3S0A A;  1K2H A;  2WOS A;  2O5G A;  2OPO A;  1Q4C A;  2B3Q A;  4HQC A;  1SR6 C;  2KFF A;  5DPJ A;  4W6U A;  3IP2 A;  2MBX A;  2H5Q A;  4W7R A;  3SSP A;  2EC6 B;  2WHS A;  3B88 A;  4W6K A;  1M46 A;  4W6I A;  5EXC I;  3EK4 A;  3PJ5 A;  4HQ8 A;  4EUL A;  1KK7 Y;  4OCI A;  2BTJ A;  4PPK A;  2WHT A;  1SK6 D;  2DUF A;  4W69 A;  1XFU O;  1SY9 A;  3LVC A;  4JD9 A;  2K2F A;  4GGF C;  4FQO A;  2FWQ A;  3BUM B;  4RYW A;  3PN7 B;  1ALV A;  5H87 A;  4HQ9 A;  2LHI A;  3D78 A;  1NCX A;  5FYX A;  4HRE E;  4W72 A;  3SS0 A;  2KAV A;  4W6M A;  3D74 A;  1TCO B;  2LCP A;  1QV0 A;  2Z6X A;  1FBV A;  5EXU A;  1K96 A;  1W7I B;  2LMT A;  4WQ3 A;  4Q9X A;  3TUY B;  4DXI A;  1F70 A;  3D76 A;  4JRB A;  4CPV A;  4YGB B;  4YI9 A;  1MOV A;  3CFA A;  2L4I A;  1SL8 A;  3E5V A;  4U2V A;  4PHK A;  4JC2 A;  2JT3 A;  4EDS A;  3O6B A;  4W7A A;  4YGD B;  1LIN A;  3R1V A;  3LCP C;  4ZF4 A;  2GGM A;  3HX4 A;  5EB7 A;  1NCZ A;  1XSS A;  2H8Q A;  1BR1 B;  4W6D A;  3DQ9 A;  4PHN A;  2K0J A;  2QPT A;  2BL0 B;  3EVP A;  1Q80 A;  3PFV A;  2RGI A;  1S6I A;  5H89 A;  1BU3 A;  3CZ2 A;  4JWQ A;  4MEW A;  5ER4 X;  3CGL A;  1IKU A;  2H2K A;  1EJ3 A;  1IWQ A;  5T3I A;  1TUJ A;  1OOH A;  4D1E A;  3DQU A;  2F2O A;  5IBW A;  1YUR A;  5DTL A;  1SL9 A;  1W7S A;  1W9Z A;  3K1K A;  2KYF A;  2JQ6 A;  3S0F A;  2GX2 A;  1CM4 A;  4YRU A;  2JXL A;  3HCM A;  1QVI Y;  2P4M A;  1YFP A;  4ZBL A;  4HSZ A;  1QX2 A;  1Q4B A;  1YRT B;  4PE7 A;  4JQ0 D;  4KA9 A;  4GPL B;  4W6N A;  1GL4 A;  1KFX L;  3I5I B;  3E3R A;  1AK8 A;  3P28 A;  3KEV A;  1ZAC A;  1LS8 A;  1Y0V H;  2A4J A;  3I5H C;  4PAL A;  3SIB A;  2ZO7 A;  3B7A A;  4FTG A;  1A75 B;  2KNE A;  4KGE A;  3OGO A;  4INW A;  1MUX A;  4W76 A;  3LVD A;  3GJ1 A;  4E68 A;  2HQ8 A;  1MHO A;  4KF4 A;  3S0D A;  2L4H A;  1EME A;  1C07 A;  3DQL A;  2WCM A;  4W73 A;  1KYS A;  1Y1X A;  2LV7 A;  3SG2 A;  2LUC A;  5EXB A;  1QLS A;  1OXE A;  2DDD A;  4MZJ A;  3NXA A;  4ZB1 A;  2KI6 D;  5JOL A;  4JGE A;  2JC2 A;  1TCF A;  3BUO B;  4C0L A;  5DKQ A;  4IL1 A;  3ZUJ A;  3GB3 A;  3SG7 A;  4XVP A;  3GEX A;  4N1G A;  1Y6W A;  3BXK A;  1F4O A;  2ERB A;  2BCX A;  2CT9 A;  2QDI A;  3S05 A;  3NT3 A;  1CFD A;  3CLN A;  1RFJ A;  2WCB A;  5BTT A;  5I2O A;  4XOW A;  4C0J A;  4BY4 A;  2WIS A;  3TDZ A;  1EMC A;  3SSK A;  3OX5 A;  3KPX A;  1S6Z A;  1GQM A;  2BAP A;  2VVJ A;  3ST2 A;  4NWS A;  3KO0 A;  1SRA A;  1Z4H A;  5D69 A;  5EJU A;  1D1O A;  2MHH A;  3DQ6 A;  2A56 B;  3SVE A;  3DQ8 A;  2C9I A;  1KP5 A;  2O60 A;  3R1P A;  2LE9 B;  3WHT B;  4P2Y B;  1IH0 A;  3KF9 A;  4F7F A;  2GX0 A;  1M45 A;  2VVH A;  3DQF A;  3EVV A;  2HET A;  2SAS A;  1RWY A;  2L51 A;  4N5X A;  3WNX B;  2GGZ A;  1J7O A;  1KQV A;  1G7K A;  5ER5 A;  4ZF3 A;  3BOW A;  2EGD A;  4EN1 A;  4KAG A;  2QEH A;  4OJ0 A;  3VHT A;  1MOU A;  5HZU A;  2Z6Y A;  3DQA A;  3LK1 A;  1JC0 A;  3U0N A;  4H3M A;  4CFQ A;  3DQ1 A;  1RTP 1;  1U5I A;  3LVA A;  3JVT C;  2BEC A;  5EB6 A;  1GM0 A;  3FE9 A;  1KWO C;  1RMO A;  4BY5 A;  1PRW A;  3WLC A;  2WCK A;  3UNW A;  1WLM A;  2KFG A;  1LA0 A;  2A54 B;  2AWJ A;  4LJB A;  4YGC B;  4P5O E;  2K7O A;  1V1F A;  2TN4 A;  2G9B A;  1K9K A;  2FCE A;  1IQ5 A;  4ZIO A;  4W75 A;  5G08 A;  1EMK A;  4KW4 A;  3L4A A;  2VVI A;  2CCM A;  3DQ5 A;  2ISD A;  1TRF A;  1S26 D;  2HPS A;  5FVI A;  4J89 A;  2M1U A;  1RJV A;  4MVF A;  5HYD A;  1TNP A;  4DXP A;  1CLM A;  4ETO A;  4OY4 A;  2P71 A;  5I2Q A;  3CD1 A;  5D7F A;  2KLD A;  5TNC A;  2L50 A;  1S6J A;  4GBA A;  2LP2 A;  2EHB A;  3SS3 A;  5DKR A;  3S0B A;  3KHE A;  3DQ2 A;  3RM1 A;  3CB9 A;  2HRS A;  4GNK B;  1W7U A;  2OTG C;  3NSO A;  2KYC A;  3P8U A;  3DVJ A;  2KBM A;  1SCM C;  2JTZ A;  3JVT B;  5HKY A;  1A29 A;  1YUS A;  4IK4 A;  2WND A;  3VRR A;  4GGN A;  3DQM A;  1EH2 A;  3R72 A;  1NYA A;  3PIB A;  1UHN A;  2PAS A;  3DVM A;  3C1V A;  1NSH A;  4PE4 A;  5HGE A;  4IZN A;  3GL4 A;  2GW3 A;  1HT9 A;  2BE6 A;  4ZIN A;  1YX7 A;  1LXF C;  3O78 A;  5GQQ C;  3ZNI A;  2PRU A;  1TNX A;  3FIA A;  2I94 A;  2L2C A;  4NQG A;  1H4U A;  4W6P A;  2L5Y A;  1NWD A;  5HKW A;  1EMG A;  2DUG A;  1DEK A;  3I5G C;  5CPV A;  4ZFS A;  1A03 A;  1Q4A A;  1UIS A;  1YHH A;  1C7W A;  1G4Y R;  1Z2C B;  2QEO A;  3IQO A;  2IOV A;  4XJK A;  1S6C A;  3I5F C;  2WCH A;  1MXL C;  4OR9 B;  1KK7 Z;  2I7A A;  4OV2 A;  3ST3 A;  1EMM A;  1SCM B;  2O2B A;  1J7P A;  4C0K A;  3W1C A;  1BOD A;  2JPO A;  1B9C A;  3DQN A;  5FI6 A;  2LVV A;  1OSA A;  4FQT A;  3DPW A;  3DPZ A;  3DQH A;  3O77 A;  5BTT B;  4QJ3 B;  5B8I B;  4IK8 A;  4DXO A;  4AR7 A;  1A4P A;  4W6B A;  2G6E A;  1IIO A;  3U8P A;  1WY9 A;  1CDL A;  4Z4M A;  4I2Y A;  1S5G Y;  3PJB A;  1DT7 B;  3ST4 A;  1CLB A;  5D3O A;  2B3P A;  5FVG A;  2QZ0 A;  1IQ3 A;  1OZO A;  1CM1 A;  5DKN A;  1QAS A;  5KTY A;  3U0M A;  2KQ6 A;  4DRW A;  4P1Q A;  2Z6Z A;  5DRF A;  2P70 A;  4ORA B;  1OXF A;  2KI4 B;  3I5F B;  2JNF A;  1IRJ A;  4HVF A;  2V4E A;  4W74 A;  2WC6 A;  2KBI A;  3FWC A;  2QEV A;  1UWO A;  2PXW A;  4JEO A;  1IG5 A;  3L4L A;  1K93 D;  2PYQ A;  5HZO A;  2JT8 A;  3CDN A;  2A50 B;  2F33 A;  3BOW B;  1F54 A;  2K7C A;  3DD4 A;  3TDI A;  3VHT B;  3BJH A;  1FI6 A;  3FE6 A;  2RH7 A;  1CV7 A;  3VRN A;  2Y5I A;  1CNP A;  1U5I B;  1QLK A;  3SSL A;  1CKK A;  4LJC A;  4B30 A;  3AKB A;  4CID A;  1C3Z A;  4PFE A;  3B86 A;  1PAL A;  1NX1 A;  1QVI Z;  1S3P A;  3DQ3 A;  3SVC A;  2QAC A;  1C7V A;  3BUN B;  1BMO A;  5HZS A;  4KF5 A;  2K61 A;  2OTE A;  3UO9 A;  1B47 A;  1SR6 B;  3SG3 A;  2ICR A;  2OGR A;  4P76 A;  4MZL A;  2JPT A;  3EG5 B;  2GV5 A;  2AHA A;  1DGV A;  3MGF A;  2BCB A;  5BPJ A;  1DGU A;  3EKH A;  1L2O C;  3SSH A;  1Q4E A;  2CNP A;  5HKZ A;  1J1E A;  2AAO A;  3LF3 A;  2LM5 A;  4MRX A;  4WQ2 A;  4ANJ A;  5AXI A;  4L13 A;  1SBJ A;  2EMO A;  4DXQ A;  1J55 A;  3CTN A;  2BBM A;  4NDD A;  1C4F A;  3ICB A;  1B8C A;  2KGB C;  4LJD A;  4I5J A;  1JFJ A;  2F3Z A;  1EMA A;  3PAL A;  3LS3 A;  2G3O A;  3BFA A;  3EKJ A;  1BLQ A;  2JWW A;  4YGE B;  1MXE A;  2YFP A;  3BX9 A;  4ORB B;  2G5Z B;  1R6P A;  1WLZ A;  4I5L B;  1XK4 C;  1H6R A;  3K1E A;  3OSQ A;  3TZ1 A;  3VGO A;  1DC1 A;  4UTS A;  1NPQ A;  3ZTF A;  1W7T A;  3DVE A;  2JUL A;  3CS1 A;  3BXC A;  4AOM A;  2A48 A;  3QRX A;  1ZOT B;  1F71 A;  4Q04 A;  4DXM A;  1B8R A;  1YUU A;  3EVU A;  3O2P A;  1YJ2 A;  3L47 A;  4H3L A;  4IK9 A;  4A4B A;  4W6S A;  1L2O B;  4YBH B;  4KYN A;  2GTE A;  3CFH A;  1RRO A;  2KAX A;  1CMG A;  4HE4 A;  1BR4 B;  2PXS A;  1EXR A;  2PAL A;  4W7C A;  1G33 A;  4JKT A;  1XFR A;  5AEQ A;  1AJ5 A;  1HUY A;  1MQ1 A;  3RWT A;  2FJU B;  1B9A A;  1F8H A;  4OKH A;  4XJK B;  1W7J B;  4GES B;  2JOJ A;  1DJX A;  2MRD A;  3B6X A;  2QLH A;  1XMZ A;  2V4E C;  3ZWH A;  2JXC A;  3F45 A;  1XVJ A;  3U8A A;  3I19 A;  3DQD A;  4XGY A;  3TMR A;  4LW5 A;  3WLD A;  2LMV A;  1OMD A;  2M1K B;  5H88 A;  3S0G A;  1UHH A;  4PHM A;  1DMO A;  1CLL A;  4PT1 A;  2I18 A;  3BUX B;  2LC5 A;  3DF0 B;  1J1D A;  1JFK A;  2DD7 A;  3LL8 B;  3BXA A;  3DXL A;  4W6H A;  2CBL A;  3I5H B;  1S36 A;  1QIW A;  4J8A A;  3VRO A;  1CDP A;  2D8N A;  3E5W A;  1F09 A;  1E8A A;  4B5Y A;  1DTL A;  1DJG A;  2OTB A;  3GK4 X;  1OMR A;  3VK1 A;  2A53 B;  2HGY A;  2AMI A;  4KF5 C;  2ZNE A;  3M22 A;  3NSK A;  3NF0 A;  1DJH A;  4NDC A;  2ZN9 A;  5DRG A;  2KDH A;  3TS5 C;  2LAN A;  5FVF A;  5FI7 A;  1KSM A;  1DJW A;  4PHJ A;  2Y1M A;  2VAE A;  2OKY A;  2M49 B;  3U8C A;  4GOB A;  2V4E B;  1A2X A;  2WOR A;  2P6B B;  3N7H A;  3SVB A;  3PJ7 A;  1S1E A;  3CR5 X;  5HLO A;  3CR4 X;  2YGU A;  4DXN A;  2QLE A;  4F0Z B;  5HLV A;  1KFU S;  4R6B A;  3W1D A;  2JAD A;  4LJD C;  2H8V A;  3FWB A;  2FOT A;  4MRY A;  1N2D A;  2JRF A;  3EVR A;  2F3Y A;  3JTD C;  2AWL A;  1YX8 A;  2G6X A;  3A8S A;  1LKJ A;  3OGN A;  2DUE A;  3CD9 A;  2SCP A;  3OB2 B;  1JBZ A;  2M3W A;  4L9M A;  1JWD A;  3IVT A;  4OVN F;  3BFB A;  4I5K A;  2KLE A;  2MAZ A;  5KTG A;  1Q4D A;  1OQP A;  5I94 A;  1LA3 A;  5J3X A;  3TDU A;  3LF4 B;  1ZMZ A;  3TS5 B;  2WCL A;  4ZCU A;  3PAT A;  2IB5 A;  4QJ5 B;  3EK8 A;  5I8N A;  2H9W A;  3ED8 A;  1YRU B;  5LTP A;  1XQM A;  3DQO A;  3LA1 A;  2HQK A;  2O29 A;  1WRZ A;  5JJG A;  1SMG A;  2M97 A;  2Y0G A;  2WUR A;  1QYO A;  4DIR A;  3GOF A;  3CFF A;  3VB1 A;  1FF1 A;  2LHL A;  1REC A;  3H1R A;  1KWO B;  4W6C A;  4AQJ A;  2G16 B;  1UP5 A;  5AQB B;  1ZGO A;  2ZND A;  2QLI A;  1M39 A;  1JC2 A;  2G6Y A;  1SYM A;  3SVR A;  1R2U A;  4Q9W A;  3D0Y A;  3OBV A;  3BXB A;  3EK7 A;  4W7D A;  4W6O A;  1Y1U A;  2F8P A;  1BT6 A;  4YI8 A;  5PAL A;  3RLZ A;  4W7X A;  1AHR A;  4TZA A;  3DPX A;  4ZF5 A;  2LLT A;  2KPH A;  3ZUL A;  1N65 A;  4USL A;  5I2L A;  2B1U A;  1KQM C;  2PMY A;  1JSA A;  1WRK A;  5HW9 A;  3CWG A;  2H5P A;  1S5G Z;  3B87 A;  2ARL A;  1XFX O;  2PSR A;  1Z1Q A;  2ZFD A;  2ZO6 A;  1B7T Y;  3DQI A;  3K21 A;  2A52 B;  5DPG A;  2OTG B;  3DQE A;  2G2B A;  1OOG A;  1UUS A;  3QME A;  1K95 A;  1QJT A;  1QXT A;  4KW8 A;  1AUI B;  4H3N A;  1EG4 A;  2EMD A;  3UG0 A;  4YGA A;  1RRX A;  3BYA A;  1XK4 A;  5AAN A;  4W6A A;  1BJF A;  2ZN8 A;  3CAB A;  3V2L A;  2IS9 A;  2Y1N A;  4L1I A;  4MBE A;  3SVU A;  5LTQ A;  2VZX A;  1BFP A;  2POX A;  1UUR A;  2BNX A;  1NIW A;  4L12 A;  2MJW B;  1AJ4 A;  4J88 A;  2Q4U A;  3I5G B;  3D10 A;  2M9G A;  1SKT A;  1TNQ A;  2COL B;  2L98 A;  3SRY A;  3NHI A;  1RMM A;  1ZUZ A;  1KQM B;  5CSI A;  2LVJ A;  3DQK A;  4ZCV A;  1QTX A;  2WIQ A;  2IB6 A;  5HL1 A;  1Q73 A;  2E30 A;  1JF2 A;  1WDC C;  1DEL A;  3NSL A;  1HCJ A;  3DYE A;  2KI6 C;  2Z1O A;  1AVS A;  2BBN A;  1MYW A;  5HZT A;  4HRH A;  1PVB A;  4TZG A;  2HPW A;  4IK5 A;  2BL0 C;  2K8M B;  4LQT A;  1XO5 A;  2WC5 A;  2BE4 A;  1DVI A;  3NGV A;  4CLN A;  1PSR A;  2JTT A;  4HRG A;  2DDC A;  4OHS A;  1MWN A;  2AUC A;  5DTY A;  2HQW A;  2L5X B;  5BQL A;  4W77 A;  3SVO A;  1K9P A;  2WCJ A;  3Q8I A;  4H47 A;  4DCK A;  1ALW A;  1TUZ A;  3SJS A;  3PM2 A;  2M0R A;  4JF9 A;  2H61 A;  4ORC B;  3ST0 A;  2KAY A;  2WSO A;  3SG5 A;  3CBE A;  3KCT A;  4XYN A;  3NEZ A;  4JPZ B;  3AKO A;  3DZT A;  1NUB A; 
#chains in the Genus database with same CATH homology
 4H48 A;  3CZT X;  2KQY A;  2ZKM X;  1CTR A;  2O24 A;  1PSB A;  4IK1 A;  1ZGQ A;  1N0Y A;  2WHU A;  1M31 A;  3NED A;  2M7L A;  2F2P A;  3I5I C;  4AQI A;  3IQQ A;  3BUW B;  2YDZ A;  1X02 A;  2QLG A;  4EDO A;  3M24 A;  4ICB A;  1V1G A;  1F4Q A;  3A8R A;  1XFZ O;  4R1E A;  1YZW A;  2HFC A;  1F55 A;  1WDC B;  3VRQ A;  1QYF A;  1QYQ A;  2M7N A;  3VRP A;  1XFY O;  3OHM B;  2A46 A;  1SCV A;  4GFT A;  4PCW A;  1K90 D;  3WHU B;  2QT2 A;  3SSY A;  2H5R A;  1NX3 A;  2YE0 A;  4CFR A;  3RWA A;  1J7R A;  2LNK A;  1YHG A;  2L2E A;  2I2R E;  2HQZ A;  4LQU A;  3GJ2 A;  2YE1 A;  1FW4 A;  2LVK A;  4PE0 A;  1H4B A;  2PVB A;  1RMP A;  5DTZ A;  3ZUF A;  4UPG A;  1HQV A;  3U0K A;  3ADF A;  2DD9 A;  2A47 A;  1VRK A;  3AAJ A;  3LK0 A;  5DPH A;  1OOJ A;  3SVD A;  2FL1 A;  4GF6 B;  1L7Z A;  3D0Y B;  2ZRT A;  2BKI B;  1BOC A;  3SIA A;  3AAK A;  4W6T A;  1OXD A;  4N1F A;  4AS8 A;  1G8I A;  1H8B A;  3NSI A;  5BT0 A;  5EBJ A;  3SVN A;  1EMF A;  4W6L A;  1BG1 A;  1GGZ A;  2FCD A;  5FHV A;  4MZK A;  1KYR A;  1NP8 A;  2KGR A;  1CDM A;  2MLF C;  1PUL A;  1EL4 A;  2KOT A;  2LLU A;  1XYD A;  1OE9 B;  2DUI A;  1KFU L;  4PPL A;  1QX5 B;  1QAT A;  4DKM A;  1NX2 A;  2JU0 A;  5J2O A;  4MSP A;  4KW9 A;  1QX7 A;  3A4U B;  1GJY A;  2WCF A;  3G9A A;  3DVK A;  4PPJ A;  1AP4 A;  3CGA A;  1GFL A;  4KEX A;  2LP3 A;  1YVL A;  1Y1A A;  1B8L A;  5LK4 A;  2KSP A;  1GGW A;  1KSO A;  3AKA A;  1PVA A;  5DQB A;  1KYP A;  1XA5 A;  2H61 C;  1QXP A;  4R6D A;  2CXJ A;  2H5O A;  1TIZ A;  1QY3 A;  5AER A;  4JFG A;  5CSF A;  1UHK A;  2VRG A;  2K7B A;  2DUH A;  1GGX A;  1DF0 A;  2AH8 A;  2KHN A;  2NZ0 A;  1K94 A;  1IGV A;  4QJ4 B;  3OB1 B;  5F6T A;  1RM9 A;  2LAP A;  1UHJ A;  2H6V A;  2JT0 A;  2HF5 A;  3MSE B;  4PE1 A;  3TMT A;  2ZMW A;  1TOP A;  1KFX S;  2MLE C;  3CR2 A;  1JC1 A;  3AI4 A;  2JZI A;  2Q91 A;  2E6W A;  4I5N B;  1QIV A;  1JF0 A;  4Q7U A;  1B4C A;  1YHI A;  2C9J A;  5CSN A;  4DUQ A;  2KFH A;  5KSZ A;  4M2Q A;  4TNC A;  1XFW O;  5K89 A;  3UFZ A;  3M0W A;  1Z1P A;  4N3D A;  1FPW A;  5F9G A;  1XAE A;  3BQ3 A;  4PDZ A;  1YUT A;  4GAO A;  5HBD A;  4RTC A;  1CMF A;  2QU1 A;  4B30 B;  3OX6 A;  3SG4 A;  2NCP A;  2WSN A;  2DOQ A;  1EMB A;  1XFV O;  4KGF A;  3DQ4 A;  2HCG A;  1SPY A;  4RYS A;  1PK0 D;  3IF7 A;  2Y4Q A;  1YTZ C;  2QRF A;  4IK3 A;  2AWK A;  1IJ5 A;  3LLE A;  4W7E A;  2QLG B;  5DY6 A;  4DKN A;  1TTX A;  4EMQ A;  1KK8 C;  1JUO A;  2K7D A;  4MN0 A;  1SL7 A;  4XL5 A;  1QS7 A;  3SG6 A;  1DJY A;  2OKW A;  5LTR A;  1ZGP A;  1NCY A;  4GGF A;  1JBA A;  4MLW A;  1F0B A;  1ZUX A;  2M29 A;  3IR8 A;  1DJI A;  1TN4 A;  1CDN A;  4W6F A;  1TNW A;  2R2I A;  1B1G A;  2OS8 C;  3AI5 A;  3SSV A;  1FI5 A;  1B7T Z;  3SST A;  1EML A;  2V53 A;  2BKH B;  2NCO A;  3JTD B;  1RK9 A;  2M8U A;  1MR8 A;  4W6R A;  1BF5 A;  4NDB A;  5EHU A;  4Z4K A;  3SVS A;  3NT9 A;  3H1O A;  2OJK A;  1IJ6 A;  2LVI A;  1OZS A;  4W6G A;  1ZFS A;  2EMN A;  2Q6P A;  2K2A A;  1NX0 A;  4XOV A;  2AWM A;  3KCS A;  4OQW A;  2G2S B;  1KCY A;  3E5T A;  1A75 A;  2LMU A;  5KU1 A;  1KK8 B;  1CFC A;  2NLN A;  2JNX A;  4A4C A;  1J7Q A;  5DPI A;  2CTN A;  1CFP A;  3DQC A;  4DS7 A;  1SNL A;  1OMV A;  2EC6 C;  4W6J A;  1QV1 A;  1LVC D;  2NXQ A;  5AFP A;  1YR5 A;  5DTX A;  1K8U A;  3O4Y A;  5DU0 A;  1SW8 A;  3OSR A;  4OGS A;  5DQM A;  3OP0 A;  2OS8 B;  4BDU A;  3SV5 A;  1CFF A;  1UHI A;  1YJF A;  4KPI A;  3VIC A;  2KI4 C;  2WC8 A;  3DQJ A;  2FZU A;  1ODB A;  4ORN A;  2L0P A;  4M2P A;  1DJZ A;  1JBY A;  2G3D B;  1CB1 A;  2ZRS A;  3PN7 C;  2WCE A;  3FS7 A;  1XA9 A;  3DQ7 A;  2Q57 A;  4WRI A;  4Q7R A;  1EG3 A;  2ZMU A;  2HGD A;  1WRL A;  4GUK A;  2LLS A;  3WCK A;  2IE2 A;  1M63 B;  3DF0 A;  3GK2 A;  3PM8 A;  3WXA A;  1K9U A;  4Q7T A;  3PLF B;  5CSJ A;  4W7F A;  1YVH A;  3TUY C;  3H4S E;  3U0L A;  2VAD A;  4M2O A;  2HJO A;  2GW4 B;  3GK1 A;  3PSR A;  3LSA A;  1DF0 B;  2MA2 A;  1MF8 B;  3V3D A;  2LUX A;  4U8D A;  2BCA A;  1K2H A;  2WOS A;  2O5G A;  2OPO A;  1Q4C A;  2B3Q A;  4HQC A;  1SR6 C;  2KFF A;  5DPJ A;  4W6U A;  3IP2 A;  2MBX A;  2H5Q A;  4W7R A;  3SSP A;  2EC6 B;  2WHS A;  4W6K A;  1M46 A;  4W6I A;  5EXC I;  3EK4 A;  3PJ5 A;  4HQ8 A;  4EUL A;  1KK7 Y;  4OCI A;  2BTJ A;  4PPK A;  2WHT A;  1SK6 D;  2DUF A;  4W69 A;  1XFU O;  1SY9 A;  3LVC A;  2K2F A;  4GGF C;  4FQO A;  2FWQ A;  3BUM B;  4RYW A;  3PN7 B;  1ALV A;  5H87 A;  4HQ9 A;  2LHI A;  1NCX A;  5FYX A;  4HRE E;  4W72 A;  3SS0 A;  2KAV A;  4W6M A;  1TCO B;  2LCP A;  1QV0 A;  2Z6X A;  1FBV A;  5EXU A;  1K96 A;  1W7I B;  2LMT A;  4WQ3 A;  4Q9X A;  3TUY B;  4DXI A;  1F70 A;  4JRB A;  4CPV A;  4YGB B;  4YI9 A;  1MOV A;  3CFA A;  2L4I A;  1SL8 A;  3E5V A;  4U2V A;  4PHK A;  4JC2 A;  2JT3 A;  4EDS A;  3O6B A;  4W7A A;  4YGD B;  1LIN A;  3LCP C;  4ZF4 A;  2GGM A;  3HX4 A;  5EB7 A;  1NCZ A;  1XSS A;  2H8Q A;  1BR1 B;  4W6D A;  3DQ9 A;  4PHN A;  2K0J A;  2QPT A;  2BL0 B;  3EVP A;  1Q80 A;  3PFV A;  2RGI A;  1S6I A;  5H89 A;  1BU3 A;  4JWQ A;  4MEW A;  5ER4 X;  3CGL A;  1IKU A;  2H2K A;  1EJ3 A;  1IWQ A;  5T3I A;  4D1E A;  3DQU A;  2F2O A;  5IBW A;  1YUR A;  5DTL A;  1SL9 A;  1W7S A;  3K1K A;  2KYF A;  2JQ6 A;  2GX2 A;  1CM4 A;  4YRU A;  2JXL A;  3HCM A;  1QVI Y;  2P4M A;  1YFP A;  4ZBL A;  4HSZ A;  1QX2 A;  1Q4B A;  1YRT B;  4PE7 A;  4JQ0 D;  4KA9 A;  4GPL B;  4W6N A;  1GL4 A;  1KFX L;  3I5I B;  3E3R A;  1AK8 A;  3P28 A;  3KEV A;  1ZAC A;  1Y0V H;  2A4J A;  3I5H C;  4PAL A;  3SIB A;  2ZO7 A;  4FTG A;  1A75 B;  2KNE A;  4KGE A;  3OGO A;  1MUX A;  4W76 A;  3LVD A;  3GJ1 A;  4E68 A;  2HQ8 A;  1MHO A;  4KF4 A;  2L4H A;  1EME A;  1C07 A;  3DQL A;  4W73 A;  1KYS A;  1Y1X A;  2LV7 A;  3SG2 A;  2LUC A;  5EXB A;  1QLS A;  1OXE A;  2DDD A;  4MZJ A;  3NXA A;  4ZB1 A;  2KI6 D;  5JOL A;  4JGE A;  2JC2 A;  1TCF A;  3BUO B;  4C0L A;  5DKQ A;  4IL1 A;  3ZUJ A;  3GB3 A;  3SG7 A;  4XVP A;  3GEX A;  4N1G A;  1Y6W A;  3BXK A;  1F4O A;  2BCX A;  2CT9 A;  3S05 A;  3NT3 A;  1CFD A;  3CLN A;  1RFJ A;  2WCB A;  5BTT A;  5I2O A;  4XOW A;  4C0J A;  4BY4 A;  2WIS A;  3TDZ A;  1EMC A;  3SSK A;  3OX5 A;  3KPX A;  1S6Z A;  1GQM A;  2VVJ A;  3ST2 A;  4NWS A;  3KO0 A;  1SRA A;  5D69 A;  5EJU A;  1D1O A;  2MHH A;  3DQ6 A;  2A56 B;  3SVE A;  3DQ8 A;  2C9I A;  1KP5 A;  2O60 A;  2LE9 B;  3WHT B;  4P2Y B;  1IH0 A;  3KF9 A;  2GX0 A;  1M45 A;  2VVH A;  3DQF A;  3EVV A;  2HET A;  2SAS A;  1RWY A;  2L51 A;  4N5X A;  3WNX B;  2GGZ A;  1J7O A;  1KQV A;  1G7K A;  5ER5 A;  4ZF3 A;  3BOW A;  2EGD A;  4EN1 A;  4KAG A;  4OJ0 A;  3VHT A;  1MOU A;  5HZU A;  2Z6Y A;  3DQA A;  3LK1 A;  1JC0 A;  3U0N A;  4H3M A;  4CFQ A;  3DQ1 A;  1RTP 1;  1U5I A;  3LVA A;  3JVT C;  2BEC A;  5EB6 A;  1KWO C;  1RMO A;  4BY5 A;  1PRW A;  3WLC A;  1WLM A;  2KFG A;  1LA0 A;  2A54 B;  2AWJ A;  4LJB A;  4YGC B;  4P5O E;  2K7O A;  1V1F A;  2TN4 A;  2G9B A;  1K9K A;  2FCE A;  1IQ5 A;  4ZIO A;  4W75 A;  5G08 A;  1EMK A;  4KW4 A;  2VVI A;  2CCM A;  3DQ5 A;  2ISD A;  1TRF A;  1S26 D;  2HPS A;  5FVI A;  4J89 A;  2M1U A;  1RJV A;  4MVF A;  5HYD A;  1TNP A;  4DXP A;  1CLM A;  4ETO A;  4OY4 A;  5I2Q A;  3CD1 A;  5D7F A;  5TNC A;  2L50 A;  1S6J A;  4GBA A;  2LP2 A;  2EHB A;  5DKR A;  3KHE A;  3DQ2 A;  3RM1 A;  3CB9 A;  2HRS A;  4GNK B;  1W7U A;  2OTG C;  3NSO A;  2KYC A;  3P8U A;  3DVJ A;  2KBM A;  1SCM C;  2JTZ A;  3JVT B;  5HKY A;  1A29 A;  1YUS A;  4IK4 A;  2WND A;  3VRR A;  4GGN A;  3DQM A;  1EH2 A;  1NYA A;  3PIB A;  1UHN A;  2PAS A;  3DVM A;  3C1V A;  1NSH A;  4PE4 A;  5HGE A;  4IZN A;  3GL4 A;  2GW3 A;  1HT9 A;  2BE6 A;  4ZIN A;  1YX7 A;  1LXF C;  3O78 A;  5GQQ C;  3ZNI A;  2PRU A;  1TNX A;  3FIA A;  2I94 A;  4NQG A;  1H4U A;  4W6P A;  1NWD A;  5HKW A;  1EMG A;  2DUG A;  3I5G C;  5CPV A;  4ZFS A;  1A03 A;  1Q4A A;  1UIS A;  1YHH A;  1C7W A;  1G4Y R;  3IQO A;  2IOV A;  4XJK A;  1S6C A;  3I5F C;  1MXL C;  4OR9 B;  1KK7 Z;  2I7A A;  4OV2 A;  3ST3 A;  1EMM A;  1SCM B;  2O2B A;  1J7P A;  4C0K A;  3W1C A;  1BOD A;  1B9C A;  3DQN A;  2LVV A;  1OSA A;  3DPW A;  3DPZ A;  3DQH A;  3O77 A;  5BTT B;  4QJ3 B;  5B8I B;  4IK8 A;  4DXO A;  4AR7 A;  1A4P A;  4W6B A;  2G6E A;  3U8P A;  1WY9 A;  1CDL A;  4Z4M A;  4I2Y A;  1S5G Y;  3PJB A;  1DT7 B;  3ST4 A;  1CLB A;  2B3P A;  5FVG A;  2QZ0 A;  1IQ3 A;  1OZO A;  1CM1 A;  5DKN A;  1QAS A;  5KTY A;  3U0M A;  2KQ6 A;  4DRW A;  4P1Q A;  2Z6Z A;  5DRF A;  4ORA B;  1OXF A;  2KI4 B;  3I5F B;  2JNF A;  1IRJ A;  4HVF A;  2V4E A;  4W74 A;  2KBI A;  3FWC A;  1UWO A;  2PXW A;  4JEO A;  1IG5 A;  5HZO A;  1K93 D;  2JT8 A;  2A50 B;  2F33 A;  3BOW B;  1F54 A;  2K7C A;  3DD4 A;  3TDI A;  3VHT B;  1FI6 A;  2RH7 A;  1CV7 A;  3VRN A;  2Y5I A;  1CNP A;  1U5I B;  1QLK A;  3SSL A;  1CKK A;  4LJC A;  4B30 A;  3AKB A;  4CID A;  4PFE A;  1PAL A;  1NX1 A;  1QVI Z;  1S3P A;  3DQ3 A;  3SVC A;  2QAC A;  1C7V A;  3BUN B;  1BMO A;  5HZS A;  4KF5 A;  2K61 A;  2OTE A;  1B47 A;  1SR6 B;  3SG3 A;  2ICR A;  2OGR A;  4P76 A;  4MZL A;  2JPT A;  2GV5 A;  2AHA A;  1DGV A;  3MGF A;  2BCB A;  5BPJ A;  1DGU A;  3EKH A;  1L2O C;  3SSH A;  1Q4E A;  2CNP A;  5HKZ A;  1J1E A;  2AAO A;  3LF3 A;  2LM5 A;  4MRX A;  4WQ2 A;  4ANJ A;  5AXI A;  4L13 A;  1SBJ A;  2EMO A;  4DXQ A;  1J55 A;  3CTN A;  2BBM A;  4NDD A;  1C4F A;  3ICB A;  1B8C A;  2KGB C;  4LJD A;  4I5J A;  1JFJ A;  2F3Z A;  1EMA A;  3PAL A;  3LS3 A;  2G3O A;  3EKJ A;  1BLQ A;  2JWW A;  4YGE B;  1MXE A;  2YFP A;  3BX9 A;  4ORB B;  2G5Z B;  1R6P A;  1WLZ A;  4I5L B;  1XK4 C;  1H6R A;  3OSQ A;  3TZ1 A;  3VGO A;  4UTS A;  1NPQ A;  3ZTF A;  1W7T A;  3DVE A;  2JUL A;  3CS1 A;  3BXC A;  4AOM A;  2A48 A;  3QRX A;  1ZOT B;  1F71 A;  4Q04 A;  4DXM A;  1B8R A;  1YUU A;  3EVU A;  3O2P A;  1YJ2 A;  4H3L A;  4IK9 A;  4A4B A;  4W6S A;  1L2O B;  4YBH B;  3CFH A;  1RRO A;  2KAX A;  1CMG A;  4HE4 A;  1BR4 B;  2PXS A;  1EXR A;  2PAL A;  4W7C A;  1G33 A;  5AEQ A;  1AJ5 A;  1HUY A;  1MQ1 A;  3RWT A;  2FJU B;  1B9A A;  1F8H A;  4OKH A;  4XJK B;  1W7J B;  4GES B;  2JOJ A;  1DJX A;  2MRD A;  2QLH A;  1XMZ A;  2V4E C;  3ZWH A;  2JXC A;  3F45 A;  1XVJ A;  3U8A A;  3I19 A;  3DQD A;  4XGY A;  3TMR A;  4LW5 A;  3WLD A;  2LMV A;  1OMD A;  2M1K B;  5H88 A;  1UHH A;  4PHM A;  1DMO A;  1CLL A;  2I18 A;  3BUX B;  2LC5 A;  3DF0 B;  1J1D A;  1JFK A;  2DD7 A;  3LL8 B;  3BXA A;  4W6H A;  2CBL A;  3I5H B;  1S36 A;  1QIW A;  4J8A A;  3VRO A;  1CDP A;  2D8N A;  3E5W A;  1F09 A;  1E8A A;  4B5Y A;  1DTL A;  1DJG A;  2OTB A;  3GK4 X;  1OMR A;  3VK1 A;  2A53 B;  2HGY A;  2AMI A;  4KF5 C;  2ZNE A;  3M22 A;  3NSK A;  3NF0 A;  1DJH A;  4NDC A;  2ZN9 A;  5DRG A;  2KDH A;  3TS5 C;  2LAN A;  5FVF A;  1KSM A;  1DJW A;  4PHJ A;  2Y1M A;  2VAE A;  2OKY A;  2M49 B;  3U8C A;  4GOB A;  2V4E B;  1A2X A;  2WOR A;  2P6B B;  3SVB A;  3PJ7 A;  1S1E A;  3CR5 X;  5HLO A;  3CR4 X;  4DXN A;  2QLE A;  4F0Z B;  5HLV A;  1KFU S;  4R6B A;  3W1D A;  2JAD A;  4LJD C;  3FWB A;  2FOT A;  4MRY A;  1N2D A;  2JRF A;  3EVR A;  2F3Y A;  3JTD C;  2AWL A;  1YX8 A;  2G6X A;  3A8S A;  1LKJ A;  2DUE A;  3CD9 A;  2SCP A;  3OB2 B;  1JBZ A;  2M3W A;  4L9M A;  1JWD A;  4OVN F;  4I5K A;  2MAZ A;  5KTG A;  1Q4D A;  1OQP A;  1LA3 A;  5J3X A;  3TDU A;  3LF4 B;  1ZMZ A;  3TS5 B;  4ZCU A;  3PAT A;  2IB5 A;  4QJ5 B;  3EK8 A;  5I8N A;  2H9W A;  3ED8 A;  1YRU B;  5LTP A;  1XQM A;  3DQO A;  3LA1 A;  2HQK A;  2O29 A;  1WRZ A;  5JJG A;  1SMG A;  2M97 A;  2Y0G A;  2WUR A;  1QYO A;  4DIR A;  3GOF A;  3CFF A;  1FF1 A;  2LHL A;  1REC A;  3H1R A;  1KWO B;  4W6C A;  4AQJ A;  2G16 B;  1UP5 A;  5AQB B;  1ZGO A;  2ZND A;  2QLI A;  1M39 A;  1JC2 A;  2G6Y A;  1SYM A;  3SVR A;  1R2U A;  4Q9W A;  3D0Y A;  3BXB A;  3EK7 A;  4W7D A;  4W6O A;  1Y1U A;  2F8P A;  1BT6 A;  4YI8 A;  5PAL A;  3RLZ A;  4W7X A;  1AHR A;  4TZA A;  3DPX A;  4ZF5 A;  2LLT A;  3ZUL A;  1N65 A;  4USL A;  5I2L A;  2B1U A;  1KQM C;  2PMY A;  1JSA A;  1WRK A;  5HW9 A;  3CWG A;  2H5P A;  1S5G Z;  2ARL A;  1XFX O;  2PSR A;  1Z1Q A;  2ZFD A;  2ZO6 A;  1B7T Y;  3DQI A;  3K21 A;  2A52 B;  5DPG A;  2OTG B;  3DQE A;  2G2B A;  1UUS A;  1K95 A;  1QJT A;  1QXT A;  4KW8 A;  1AUI B;  4H3N A;  1EG4 A;  2EMD A;  3UG0 A;  4YGA A;  1RRX A;  3BYA A;  1XK4 A;  5AAN A;  4W6A A;  1BJF A;  2ZN8 A;  2IS9 A;  2Y1N A;  4L1I A;  4MBE A;  3SVU A;  5LTQ A;  2VZX A;  1BFP A;  2POX A;  1UUR A;  1NIW A;  4L12 A;  2MJW B;  1AJ4 A;  4J88 A;  2Q4U A;  3I5G B;  3D10 A;  2M9G A;  1SKT A;  1TNQ A;  2COL B;  2L98 A;  3SRY A;  1RMM A;  1ZUZ A;  1KQM B;  5CSI A;  2LVJ A;  3DQK A;  4ZCV A;  1QTX A;  2WIQ A;  2IB6 A;  1Q73 A;  2E30 A;  1JF2 A;  1WDC C;  3NSL A;  1HCJ A;  2KI6 C;  2Z1O A;  1AVS A;  2BBN A;  1MYW A;  5HZT A;  4HRH A;  1PVB A;  4TZG A;  2HPW A;  4IK5 A;  2BL0 C;  2K8M B;  4LQT A;  1XO5 A;  2BE4 A;  1DVI A;  4CLN A;  1PSR A;  2JTT A;  4HRG A;  2DDC A;  4OHS A;  1MWN A;  2AUC A;  5DTY A;  2HQW A;  2L5X B;  5BQL A;  4W77 A;  3SVO A;  1K9P A;  4H47 A;  4DCK A;  1ALW A;  3SJS A;  2M0R A;  4JF9 A;  2H61 A;  4ORC B;  3ST0 A;  2KAY A;  2WSO A;  3SG5 A;  3CBE A;  3KCT A;  4XYN A;  3NEZ A;  4JPZ B;  3AKO A;  1NUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...