3EK8A

Calcium-saturated gcamp2 t116v/g87r mutant monomer
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
408
structure length
393
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDRGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 129
structure length 393
sequence length 408
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek8A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek8A02
4KGFA 1IJ5A 3EVVA 4J89A 4ZINA 2Z1OA 1LA0A 1BLQA 2CNPA 5DY6A 1EJ3A 2LP2A 1WY9A 4KW4A 4R1EA 1WRKA 1F4QA 3BQ3A 1RM9A 4GAOA 1QASA 2WCBA 1EL4A 4JFGA 1XMZA 2KAYA 2RGIA 2Z6XA 3CB9A 1SBJA 1C07A 2VVHA 3I5GC 1NX0A 2BECA 1ODBA 3SVSA 1FPWA 4W6SA 1YR5A 1UISA 2H8QA 1BU3A 1AJ5A 3TDZA 1ZOTB 1BOCA 1MUXA 1YRUB 1TNXA 1K96A 2Y5IA 4J8AA 4N1FA 1IJ6A 4LJBA 1G8IA 4ZF5A 1QJTA 3OB2B 1BT6A 2ZO6A 3NEDA 2HGDA 4PHNA 1CDMA 1DJIA 4OJ0A 1ZGQA 3RWAA 1U5IA 3LLEA 1KWOC 2QACA 1OMDA 2OTEA 4JF9A 1CKKA 4W6FA 2POXA 1Q4BA 5D7FA 2L0PA 3UG0A 5EHUA 1HQVA 4ZCVA 3OHMB 1DTLA 4HVFA 1TCOB 1TCFA 1KWOB 4GPLB 1W7UA 1OQPA 1Y1XA 3ST3A 5EB7A 2AWJA 3I5IC 4I5JA 4DXPA 2V4EC 2ZN8A 1DF0B 1SL7A 3RM1A 4Z4KA 2KQ6A 2LUXA 1XQMA 5TNCA 1OMRA 1K9KA 5B8IB 4AQIA 2RH7A 1EXRA 3TUYB 2WCEA 3I5IB 1B8CA 2V4EB 1F4OA 3SVRA 2TN4A 4JPZB 4W7AA 4YGDB 2VZXA 3DQKA 1ZFSA 2BBNA 5HGEA 5I2QA 2AHAA 2K7OA 5HKZA 3U0MA 4DXQA 2H5OA 4P1QA 3DVMA 3NT3A 3SG4A 1QATA 1ZGOA 1KFXS 2DUEA 1G4YR 1S5GY 1GGWA 2MAZA 1A4PA 2KYCA 4ETOA 3DQJA 2JPTA 3DVKA 1QX7A 1Y0VH 1S6CA 3PM8A 1CDNA 2F2PA 3BUWB 5HLVA 2E6WA 1RRXA 4IL1A 4XVPA 3ZNIA 1BR1B 5BTTA 2AWLA 1ZGPA 3GL4A 1KK7Y 3ZULA 4Q7UA 4N3DA 3CGAA 4BY5A 2Y1MA 1EMBA 1SCMB 1M31A 3CGLA 5GQQC 1NWDA 5FYXA 4W6LA 3DF0B 2IS9A 2BE6A 2IE2A 4DKMA 1EMCA 2FCDA 1LXFC 3DQ4A 1QYFA 4DRWA 1SKTA 2F33A 2JULA 3NXAA 4EN1A 2JWWA 1TOPA 2JTTA 1YUSA 4DCKA 1YUTA 3DQ1A 4N1GA 1XSSA 3CD9A 1DT7B 1CLBA 3CS1A 1YX8A 4Q7TA 4ZF4A 2LCPA 2R2IA 2V53A 1KSOA 1K2HA 1K9PA 4W6UA 2MBXA 1QYOA 3CR5X 3KHEA 4XOVA 3CTNA 3GJ1A 2JZIA 1CV7A 2Y4QA 4H3LA 4UPGA 3SVCA 1M63B 1IQ5A 3ZUJA 1NSHA 2ZNDA 3K21A 2WSNA 2I2RE 3PJ5A 2CT9A 3VICA 3O6BA 2KSPA 4W6AA 4ORNA 3WXAA 2VRGA 1KYPA 3SSLA 1PULA 1MOUA 2BKHB 1OXFA 2CXJA 2LHLA 3I5FC 1CMGA 4M2QA 4HREE 4DXIA 3BX9A 4H48A 5LTPA 3P28A 4W6DA 1EMGA 3DQ3A 2K7CA 5DKNA 3U0KA 3I5FB 1UHIA 4YGEB 3D10A 2H9WA 1SK6D 5KTGA 3SRYA 2GGMA 5HZUA 1NCZA 1F09A 1BODA 1ZACA 3BXCA 3SIAA 4RYSA 5HYDA 2HQKA 2JXCA 1XO5A 1EG4A 1F55A 2Y1NA 2DUGA 3DQ9A 4NWSA 3VRPA 1YHIA 5PALA 1B7TZ 2HQ8A 3DQEA 3VHTA 4YI9A 1Q4DA 2BCXA 3OP0A 3EKHA 2VAEA 3LVCA 1SMGA 3U8CA 1CLLA 2CCMA 1LA3A 5IBWA 1RFJA 3JTDC 3O2PA 1WRLA 1H8BA 2BTJA 2KI4C 4Z4MA 4W6NA 3SJSA 1BG1A 3PN7C 1Q4AA 2ARLA 1Y1AA 2K2FA 3SV5A 5LTQA 3SSPA 3JTDB 1YX7A 2F8PA 2KI4B 4PE4A 5EB6A 4XJKA 4C0JA 1XK4C 1CLMA 4C0KA 1W7TA 2L5XB 4PHKA 1H4UA 5BT0A 4ICBA 1NCXA 1A29A 1UHKA 5CPVA 4W7XA 1PALA 1CNPA 2O60A 2DD7A 1PRWA 1YVHA 3AI4A 1OSAA 2GV5A 1J7PA 1CFPA 1QVIY 1AP4A 4GOBA 1KSMA 1C7VA 2G6XA 1XK4A 4ZCUA 2H6VA 1BR4B 4B5YA 1B9CA 4HQ9A 3OSRA 5DTXA 2KFHA 4JRBA 2O24A 1AK8A 1B9AA 1ALVA 2JNFA 1AVSA 2M0RA 4DXMA 1QXTA 1F54A 3EK7A 3EKJA 1IH0A 2K7BA 2I7AA 4I5KA 2NZ0A 1KFUS 2JQ6A 3PJBA 3DVEA 3F45A 1FI6A 4USLA 1UHJA 4AOMA 2CTNA 4QJ4B 5HW9A 3O78A 1AJ4A 2HRSA 4MVFA 2B3PA 1GGZA 1CDPA 4MZLA 1Z1PA 1MWNA 3NT9A 2PXWA 4R6DA 1MHOA 3VRRA 1KCYA 3SVUA 1CFCA 2AWKA 2CBLA 4DUQA 3W1DA 2ZFDA 2MRDA 3PALA 3CWGA 2H5QA 1CM1A 2OKWA 3GK2A 4MBEA 2YE1A 2ZMUA 1JSAA 2G9BA 1Z1QA 3DQNA 3DQ5A 3DPXA 4L13A 2M97A 3DQMA 3NSLA 1JC1A 1EH2A 2HQWA 2LMUA 1BFPA 4DS7A 1JC0A 2F3ZA 4LW5A 1EMAA 4FQOA 3WHUB 3SG7A 1CFFA 4BY4A 1JF2A 1NPQA 3PSRA 5DTZA 4OGSA 2QU1A 3DVJA 1QS7A 1QY3A 1SR6C 3DQUA 2DDDA 5FVFA 3VK1A 5KSZA 1EMEA 4IK5A 3SSYA 1K95A 4W6GA 1L2OC 5CSIA 1Q73A 1QYQA 4EULA 1XFYO 4WQ2A 1SR6B 1AHRA 2LMVA 1U5IB 3I5GB 5HZSA 2FWQA 3E5TA 2AUCA 1N0YA 5JJGA 3H4SE 3CR2A 1V1FA 1J55A 2M1UA 3EK4A 4IK9A 3DQ2A 4IK1A 2BL0C 4J88A 3ST0A 2MLFC 3WNXB 1YTZC 4CPVA 3D0YA 2G3DB 2NLNA 3LL8B 4RYWA 3SVNA 3M0WA 3TMTA 1DVIA 2BL0B 1V1GA 3CFFA 2H5PA 4LQTA 4LJDA 2A46A 2WOSA 3DD4A 2QT2A 3DQOA 5AFPA 1WDCC 3SSHA 1W7IB 4W6KA 1XFVO 1OZSA 2MJWB 1OOJA 2FZUA 4PFEA 1F0BA 1GGXA 1TNQA 4B30A 3LA1A 4HQ8A 2PALA 2JC2A 1RMOA 4E68A 1WDCB 1D1OA 1SL9A 1XAEA 1WLMA 2ZMWA 4AR7A 2KBIA 1YURA 4L1IA 2WHSA 4U2VA 4QJ5B 2OPOA 2WURA 2LE9B 5T3IA 3W1CA 4N5XA 1OZOA 2DUFA 3BYAA 4I5NB 3ST4A 3H1RA 1QX2A 3KCSA 2ZNEA 2A4JA 2Q4UA 2WHUA 3ZWHA 1QV0A 1NX1A 4OQWA 4W6CA 2AMIA 2LUCA 4R6BA 2M9GA 5DRGA 5BTTB 4YI8A 2KQYA 3O77A 3KCTA 1FI5A 1RWYA 1UHHA 2KBMA 5DPGA 2COLB 4GESB 5EXCI 3IQOA 3SIBA 5HBDA 1RMPA 3AI5A 2MHHA 4W6HA 1QTXA 4CFQA 3KO0A 1J7RA 2ZO7A 1Q4CA 2Q57A 5EJUA 3ZUFA 2JRFA 3FWCA 1MF8B 3U0NA 1XFWO 4MN0A 3TMRA 1XFZO 4OHSA 1K8UA 2LVIA 4KPIA 2A47A 2WNDA 4P76A 3FIAA 3DQIA 5I2LA 1BMOA 1C7WA 3PFVA 2HJOA 2Y0GA 3EVUA 3GK4X 1RROA 3U8AA 2GX0A 3M22A 3IQQA 3H1OA 1WLZA 4YGBB 2WSOA 3DPZA 5DKRA 1UURA 2LVVA 3SS0A 3KEVA 4MZJA 2KAVA 5CSNA 2C9IA 2LVKA 5H87A 1QXPA 2LHIA 2VADA 1J7OA 3KF9A 3TDUA 5I2OA 4AQJA 2DUIA 4PE7A 2SASA 1UWOA 3E5WA 4P2YB 3BUNB 2NCOA 2JOJA 5G08A 5HLOA 3SG3A 2FL1A 5HZTA 4PE0A 3AAJA 3U8PA 3AKBA 2LAPA 2LANA 1HUYA 3PATA 2HETA 3JVTC 5H89A 3SG2A 2B3QA 1CMFA 2KGRA 1JFKA 2KNEA 1JWDA 2LC5A 1CFDA 1B1GA 4HE4A 3E3RA 2G5ZB 2PSRA 3LF3A 2ZRSA 3JVTB 4JWQA 2JT0A 4DXNA 1GL4A 2EHBA 5F9GA 2M8UA 1G7KA 4W75A 2FJUB 4NDCA 1JBYA 3DQ6A 3CD1A 1R2UA 1CB1A 3A8RA 1ZUZA 2QZ0A 1C4FA 4OCIA 3BXBA 1JUOA 3OGOA 4TZGA 4CLNA 2KYFA 3GB3A 2PASA 3SVBA 2EC6C 3IR8A 2BCAA 4W6RA 1S36A 2AH8A 3VHTB 1LKJA 2A54B 2BCBA 2AAOA 1TNWA 1S3PA 2MA2A 2EC6B 2H61A 1AUIB 3NSKA 1JFJA 2H2KA 2Z6YA 5HKYA 4ZF3A 1EMMA 1A75A 2DUHA 1SYMA 1DJZA 1H4BA 2YE0A 2O5GA 3DQCA 1BF5A 1W7JB 2LLUA 1XVJA 4BDUA 4W7CA 1NX2A 4XYNA 4LQUA 1EMFA 1HCJA 2MLEC 4M2OA 4KW9A 1SPYA 1B47A 1CDLA 4XJKB 2JTZA 2KGBC 1OXEA 4EDSA 2NCPA 1YJ2A 4H47A 3LS3A 1ALWA 3TS5C 1N65A 1FF1A 5EXBA 3IP2A 2GW3A 3LCPC 1B7TY 3PN7B 3DPWA 1LVCD 1J1EA 2GX2A 4AS8A 1NUBA 4KF5A 1S6JA 4PPLA 2OJKA 3RLZA 3WHTB 3TS5B 5I8NA 3SSKA 1BJFA 3K1KA 3AKOA 4C0LA 2JT8A 3NF0A 1Q80A 4NDDA 4TZAA 3A4UB 4GGFA 1Y1UA 5FVIA 3MSEB 3TZ1A 1ZUXA 2HQZA 1GJYA 4Q7RA 2EMDA 1DJGA 2BKIB 5AQBB 4ANJA 1W7SA 5J2OA 5AXIA 4PHJA 1RECA 2OGRA 5AERA 2WORA 4W69A 2YFPA 2B1UA 1NIWA 3AAKA 1EMKA 4WQ3A 4W6JA 2QLIA 5HKWA 5DPIA 4EDOA 2HCGA 5ER5A 4ZIOA 3LVDA 3LSAA 2OS8C 2JADA 2HPSA 3BUMB 2OTBA 3GEXA 3SVDA 2JU0A 1B8LA 5DPJA 1QIVA 3SVOA 3SG5A 1PSRA 2OS8B 3ICBA 1JF0A 1H6RA 3LK0A 2A50B 2KFGA 4IZNA 4Q9WA 1A2XA 3TDIA 3OX6A 3P8UA 4ORAB 5EBJA 5D69A 4MZKA 3DQFA 4EMQA 3BUXB 1IRJA 2WHTA 2A48A 4W6TA 3BOWA 1YVLA 4PHMA 2G6EA 1CM4A 5LTRA 4PDZA 4A4CA 2D8NA 4W73A 1RTP1 2JT3A 3PIBA 3S05A 4ORBB 3PLFB 1DJXA 5FHVA 1FBVA 2KDHA 4MRYA 1Y6WA 4IK4A 2QLEA 3PJ7A 4W7RA 1OXDA 1MYWA 2ICRA 4ZBLA 4CIDA 2LM5A 4GF6B 1S6ZA 4W72A 3GJ2A 1N2DA 2HPWA 1YJFA 3D0YB 3QRXA 4IK3A 1XA5A 2QLGB 1L2OB 3EK8A 1UHNA 4LJDC 3U0LA 1IQ3A 2L98A 4IK8A 2ZKMX 2DDCA 4NDBA 2LLSA 2FCEA 4WRIA 2QLGA 2BBMA 4D1EA 5CSFA 1DGVA 3KPXA 4Q04A 3OX5A 4KF4A 2AWMA 2WC8A 2PVBA 4W6PA 5DPHA 2OKYA 1QX5B 2DD9A 3DQ8A 4W74A 2G6YA 2IB6A 4KGEA 1QV1A 2OTGC 2M29A 2K61A 4W77A 1KFXL 3TUYC 4B30B 2ZN9A 2A53B 5HZOA 3RWTA 2KFFA 3NEZA 1DF0A 1QIWA 2OTGB 3SG6A 2NXQA 1PVAA 1S5GZ 3ZTFA 4YRUA 1XYDA 3I19A 3LF4B 1Q4EA 1MXEA 2V4EA 4JQ0D 2G16B 3ST2A 4PE1A 5JOLA 2LV7A 4L12A 4HRHA 5LK4A 1L7ZA 3SSVA 3EVRA 3EVPA 1SL8A 2L4HA 2Q91A 5EXUA 1KK7Z 2EGDA 2IB5A 4KW8A 4P5OE 5DQMA 1K90D 3GK1A 2G2BA 2ZRTA 2I18A 1DJYA 2P6BB 5KTYA 4A4BA 2PMYA 4PALA 1GFLA 2KHNA 2F2OA 2K7DA 3CR4X 3GOFA 1M39A 3HX4A 5DTYA 1KQVA 1MXLC 4DKNA 4MRXA 1SCMC 1B4CA 3VROA 2E30A 2KOTA 2EMOA 1NYAA 3VRNA 2H5RA 4OKHA 1PSBA 5AEQA 2BE4A 4W7EA 3WCKA 3IF7A 2WCFA 2LP3A 1KYRA 4XOWA 2K8MB 1K9UA 2M1KB 2Q6PA 1MQ1A 4ZB1A 3DQAA 5CSJA 4PCWA 2JNXA 1A03A 1RK9A 5BQLA 4XL5A 2KI6D 1OMVA 4GFTA 1SRAA 1M45A 4PPKA 2KAXA 3DF0A 1NP8A 2SCPA 2I94A 2QLHA 3LK1A 1DJWA 4KA9A 1DMOA 3O4YA 3NSOA 4Q9XA 1TIZA 2LNKA 1IGVA 4ZFSA 1F8HA 2LLTA 3WLCA 3SSTA 2EMNA 1YUUA 1PVBA 1KQMC 4JC2A 4GUKA 1SNLA 5DTLA 3CLNA 1SW8A 1YHGA 1TN4A 3DQ7A 1YRTB 4DIRA 3VGOA 4NQGA 4OY4A 1IG5A 1UUSA 1SCVA 2HFCA 4MEWA 1JC2A 4W7DA 1B8RA 2YDZA 4RTCA 1KQMB 3AKAA 1QLKA 3MGFA 4OR9B 4HSZA 1KYSA 4OVNF 3E5VA 4QJ3B 4GGNA 4UTSA 1J1DA 4M2PA 1TRFA 1ZMZA 2O29A 1EG3A 4TNCA 5DU0A 1QLSA 5DRFA 1R6PA 2HGYA 3UFZA 4YBHB 4YGAA 4I2YA 2A52B 1YHHA 2IOVA 1M46A 1PK0D 4W6MA 3ED8A 2H61C 2VVIA 3OB1B 5AANA 3WLDA 1TTXA 4DXOA 4W76A 3NSIA 1WRZA 1YZWA 2VVJA 2L4IA 3DQDA 1DGUA 4HQCA 1IWQA 3VRQA 1RMMA 3CFHA 4JEOA 1JBAA 3BXKA 1A75B 4JGEA 2ISDA 1NCYA 1YFPA 1F71A 2M7LA 2KI6C 2LMTA 2QRFA 1NX3A 3DQHA 1MOVA 4KF5C 4MSPA 3CFAA 5FVGA 5F6TA 1S1EA 5BPJA 1RJVA 1E8AA 5DQBA 2DOQA 4KEXA 1JBZA 1F70A 5DKQA 1XFXO 4ORCB 3C1VA 2GGZA 1EMLA 2C9JA 2K0JA 4F0ZB 5KU1A 1X02A 2GW4B 3LVAA 1K93D 2QPTA 4GGFC 1S26D 3OSQA 3A8SA 1QVIZ 4I5LB 2L51A 2FOTA 4CFRA 1G33A 4GBAA 5J3XA 4U8DA 5K89A 4LJCA 1KFUL 1CTRA 1XA9A 2A56B 4H3MA 5H88A 2PXSA 4YGCB 3FS7A 3HCMA 3SVEA 4MLWA 4PPJA 3V3DA 4L9MA 3CBEA 2G3OA 3ADFA 4KAGA 1S6IA 3I5HC 4W6BA 2M49B 1KK8C 4XGYA 3M24A 5ER4X 2K2AA 4W6IA 1HT9A 2F3YA 1J7QA 1IKUA 2G2SB 1KP5A 3I5HB 2WIQA 4W7FA 3BXAA 3G9AA 1KK8B 1FW4A 1LINA 1XFUO 2L50A 4HRGA 4OV2A 2HF5A 1VRKA 1OE9B 2Z6ZA 2JXLA 2WISA 1MR8A 1UP5A 1SY9A 3DQLA 4FTGA 2M7NA 3FWBA 2M3WA 1DJHA 2P4MA 3CZTX 2LVJA 2PRUA 3BUOB 1TNPA 1GQMA 1K94A 4GNKB 2O2BA 4W6OA 4H3NA 2L2EA 3BOWB
chains in the Genus database with same CATH superfamily
4KGFA 1IJ5A 3EVVA 4J89A 4ZINA 2PQLA 2Z1OA 1LA0A 4PT1A 2P70A 1BLQA 2CNPA 2ERBA 5DY6A 1EJ3A 2LP2A 1WY9A 4KW4A 4R1EA 1WRKA 1F4QA 3BQ3A 1RM9A 4GAOA 1QASA 2WCBA 1EL4A 4JFGA 1XMZA 2KAYA 1DC1A 2RGIA 2Z6XA 3CB9A 1SBJA 1C07A 2VVHA 3I5GC 1NX0A 2BECA 1ODBA 3SVSA 1FPWA 4W6SA 1YR5A 1UISA 2H8QA 1BU3A 1AJ5A 3TDZA 1ZOTB 1BOCA 1MUXA 1YRUB 1TNXA 1K96A 2Y5IA 4J8AA 4N1FA 1IJ6A 4LJBA 1G8IA 4ZF5A 1QJTA 3OB2B 1BT6A 2ZO6A 3NEDA 2HGDA 4PHNA 1CDMA 1DJIA 4F7FA 4OJ0A 1ZGQA 3RWAA 1U5IA 3LLEA 1KWOC 2QACA 1OMDA 2OTEA 4JF9A 1CKKA 4W6FA 2POXA 1Q4BA 5D7FA 2L0PA 3UG0A 5EHUA 1HQVA 4ZCVA 3OHMB 1DTLA 4HVFA 1TCOB 1TCFA 1KWOB 4GPLB 1W7UA 3CZ2A 1OQPA 1Y1XA 3ST3A 5EB7A 2AWJA 3I5IC 2QEHA 4I5JA 4DXPA 2V4EC 2ZN8A 1DF0B 1SL7A 3RM1A 4Z4KA 2KQ6A 2LUXA 1XQMA 5TNCA 1OMRA 1K9KA 5B8IB 4AQIA 2RH7A 1EXRA 3TUYB 2WCEA 3I5IB 1B8CA 2V4EB 2K60A 1F4OA 3SVRA 2TN4A 4JPZB 4W7AA 4YGDB 2VZXA 3DQKA 1ZFSA 2BBNA 5HGEA 5I2QA 2AHAA 3D76A 2K7OA 5HKZA 3U0MA 4DXQA 2H5OA 4P1QA 3DVMA 3DY9A 3NT3A 3B87A 3SG4A 1QATA 1ZGOA 1KFXS 2DUEA 1C3ZA 1G4YR 1S5GY 1GGWA 2MAZA 3OGNA 1A4PA 2KYCA 4ETOA 3DQJA 2JPTA 2KLEA 3DVKA 1QX7A 1Y0VH 1S6CA 3PM8A 5HL1A 1CDNA 2F2PA 3BUWB 5HLVA 2E6WA 1RRXA 4FQTA 4IL1A 4XVPA 3ZNIA 1BR1B 5BTTA 2AWLA 1ZGPA 3GL4A 1KK7Y 3SS3A 3ZULA 4Q7UA 4N3DA 1W9ZA 3CGAA 4BY5A 2Y1MA 1EMBA 1SCMB 1M31A 3CGLA 5GQQC 1NWDA 5FYXA 4W6LA 3DF0B 2IS9A 2BE6A 2IE2A 4DKMA 1EMCA 2FCDA 1LXFC 3DQ4A 1QYFA 4DRWA 1SKTA 2F33A 2JULA 3NXAA 4EN1A 2JWWA 1TOPA 2JTTA 2WC5A 1YUSA 4DCKA 1YUTA 3DQ1A 4N1GA 1XSSA 4JKTA 3CD9A 1DT7B 1CLBA 3CS1A 1YX8A 4Q7TA 4ZF4A 2LCPA 2R2IA 2V53A 1KSOA 1K2HA 1K9PA 4W6UA 2MBXA 1QYOA 3CR5X 3KHEA 4XOVA 3CTNA 3GJ1A 2JZIA 1CV7A 2Y4QA 4H3LA 4UPGA 3SVCA 5DICA 3SS4A 1M63B 1IQ5A 3ZUJA 1NSHA 2ZNDA 3K21A 2WSNA 2I2RE 3PJ5A 2CT9A 3VICA 3O6BA 2KSPA 4W6AA 4ORNA 3WXAA 2VRGA 1KYPA 3SSLA 1PULA 1MOUA 2BKHB 1OXFA 2CXJA 2LHLA 3I5FC 3R1PA 1CMGA 4M2QA 4HREE 1Z4HA 4DXIA 3BX9A 4H48A 5LTPA 2JPOA 3P28A 4W6DA 1EMGA 5D3OA 1DEKA 3DQ3A 2K7CA 5DKNA 3U0KA 3I5FB 1UHIA 4YGEB 3D10A 2H9WA 1SK6D 5KTGA 3SRYA 2GGMA 5HZUA 1NCZA 5EL2A 1F09A 1BODA 1ZACA 3BXCA 3SIAA 4RYSA 5HYDA 2HQKA 2JXCA 3EG5B 3FE9A 1XO5A 1EG4A 1F55A 2Y1NA 2DUGA 3DQ9A 4NWSA 2QDIA 3VRPA 1YHIA 5PALA 1B7TZ 2HQ8A 3DQEA 3VHTA 4YI9A 1Q4DA 2BCXA 3OP0A 3EKHA 2VAEA 3CZ1A 3UO9A 1LS8A 3LVCA 1SMGA 3U8CA 1CLLA 2CCMA 1LA3A 5IBWA 1RFJA 3JTDC 3O2PA 3V2LA 1WRLA 1H8BA 2BTJA 2KI4C 4Z4MA 4W6NA 3SJSA 1BG1A 3PN7C 1Q4AA 2ARLA 1Y1AA 2K2FA 3L4LA 3SV5A 5LTQA 3SSPA 3JTDB 1YX7A 2F8PA 2KI4B 4PE4A 5EB6A 4XJKA 4C0JA 1XK4C 1CLMA 3DZTA 4C0KA 1W7TA 2L5XB 4PHKA 1H4UA 5BT0A 4ICBA 1NCXA 1A29A 1UHKA 5CPVA 4W7XA 1PALA 1CNPA 2O60A 2DD7A 1PRWA 1YVHA 3AI4A 1OSAA 2GV5A 1J7PA 1CFPA 1QVIY 1AP4A 4GOBA 1KSMA 1C7VA 2G6XA 1XK4A 4ZCUA 2H6VA 1BR4B 3K1EA 4B5YA 1B9CA 4HQ9A 3OSRA 5DTXA 2KFHA 4JRBA 2O24A 1AK8A 1B9AA 2KPHA 1ALVA 2JNFA 1AVSA 2M0RA 4DXMA 1QXTA 1F54A 3EK7A 3EKJA 3PJIA 1IH0A 2K7BA 2I7AA 4I5KA 2NZ0A 1KFUS 2JQ6A 3BJHA 3PJBA 3DVEA 3F45A 1FI6A 1Z2CB 4USLA 1UHJA 4AOMA 2CTNA 4QJ4B 5HW9A 3O78A 1AJ4A 2HRSA 4MVFA 2B3PA 1GGZA 1CDPA 4MZLA 1Z1PA 1MWNA 3NT9A 2PXWA 4R6DA 1MHOA 3VRRA 1KCYA 3SVUA 2AWKA 1CFCA 2FJYA 2CBLA 4DUQA 3W1DA 2ZFDA 2MRDA 3PALA 3CWGA 2H5QA 1CM1A 2OKWA 3GK2A 4MBEA 2YE1A 2ZMUA 1JSAA 2G9BA 1Z1QA 1GM0A 3DQNA 3DQ5A 3DPXA 4L13A 2M97A 3DQMA 1C3YA 3NSLA 1JC1A 1EH2A 2HQWA 2LMUA 1BFPA 4DS7A 1JC0A 2F3ZA 3Q8IA 4LW5A 1EMAA 4FQOA 3WHUB 3SG7A 1CFFA 4BY4A 1JF2A 1NPQA 3PSRA 5DTZA 4OGSA 2QU1A 3DVJA 1QS7A 1QY3A 1SR6C 3DQUA 2DDDA 5FVFA 3VK1A 2H8VA 5KSZA 1EMEA 4IK5A 3SSYA 1K95A 4W6GA 1L2OC 5CSIA 1Q73A 1QYQA 2YGUA 4EULA 1XFYO 4WQ2A 1SR6B 1AHRA 2LMVA 1U5IB 3I5GB 5HZSA 2FWQA 3E5TA 2AUCA 1N0YA 5JJGA 3H4SE 3CR2A 1V1FA 1J55A 2M1UA 3EK4A 4IK9A 3DQ2A 4IK1A 2BL0C 4J88A 3ST0A 2MLFC 3WNXB 1YTZC 4CPVA 3D0YA 2G3DB 2NLNA 2WCHA 3LL8B 4RYWA 3SVNA 3M0WA 3TMTA 1DVIA 2BL0B 1V1GA 3CFFA 2H5PA 3IVTA 4LQTA 4LJDA 2A46A 2WOSA 3DD4A 2QT2A 1XFRA 3DQOA 5AFPA 1WDCC 3SSHA 1W7IB 2WCMA 3S0EA 4W6KA 1XFVO 1OZSA 2MJWB 1OOJA 2FZUA 4PFEA 1F0BA 1GGXA 1TNQA 4B30A 3LA1A 4HQ8A 2PALA 3B6XA 2JC2A 1RMOA 4E68A 3NHTA 1WDCB 1D1OA 3BFAA 1SL9A 1XAEA 1WLMA 2ZMWA 4AR7A 2KBIA 1YURA 4L1IA 2WHSA 4U2VA 4QJ5B 2OPOA 2WURA 3R72A 2LE9B 5T3IA 3W1CA 4N5XA 1OZOA 2DUFA 3BYAA 4I5NB 3ST4A 3B86A 1TUZA 3H1RA 1QX2A 2BNXA 3KCSA 3S0DA 3FE8A 2ZNEA 2A4JA 2Q4UA 2WHUA 3ZWHA 1T14A 1QV0A 1NX1A 4OQWA 4W6CA 2AMIA 2LUCA 4R6BA 3S0GA 2M9GA 5DRGA 5BTTB 4YI8A 2KQYA 3O77A 2WCJA 3KCTA 1FI5A 1RWYA 1UHHA 2KBMA 5DPGA 2COLB 4GESB 5EXCI 3IQOA 3SIBA 5HBDA 1RMPA 3AI5A 2MHHA 4W6HA 1QTXA 4CFQA 3KO0A 1J7RA 2ZO7A 1Q4CA 2Q57A 5EJUA 3ZUFA 2JRFA 3FWCA 1MF8B 3U0NA 1XFWO 4MN0A 3TMRA 1XFZO 4OHSA 1K8UA 2LVIA 4KPIA 2A47A 1OOIX 2WNDA 4P76A 3FIAA 3DQIA 5I2LA 1BMOA 1C7WA 3PFVA 2HJOA 2Y0GA 3EVUA 3GK4X 1RROA 2QEOA 3U8AA 2GX0A 3M22A 3S0BA 3IQQA 3H1OA 1WLZA 4YGBB 2WSOA 3DPZA 5DKRA 1UURA 2LVVA 3SS0A 3KEVA 4MZJA 2KAVA 5CSNA 2C9IA 2LVKA 5H87A 1QXPA 2LHIA 2VADA 1J7OA 3KF9A 3TDUA 5I2OA 4AQJA 2DUIA 4PE7A 2SASA 1UWOA 3E5WA 4P2YB 3BUNB 2NCOA 2JOJA 5G08A 5HLOA 3SG3A 2FL1A 5HZTA 4PE0A 3AAJA 3U8PA 3AKBA 2LAPA 1OOGA 2LANA 1HUYA 3PATA 2HETA 3JVTC 5H89A 3SG2A 2B3QA 1CMFA 2KGRA 1JFKA 2KNEA 1JWDA 3CYZA 1OOFA 2LC5A 1CFDA 1B1GA 4HE4A 3E3RA 1OW4A 2G5ZB 2PSRA 3LF3A 2ZRSA 3N7HA 3JVTB 4JWQA 2JT0A 4DXNA 1GL4A 2EHBA 5F9GA 2M8UA 1G7KA 4W75A 2FJUB 4NDCA 1JBYA 3OBVA 3DQ6A 3CD1A 3D78A 1R2UA 1CB1A 3A8RA 1ZUZA 2QZ0A 1C4FA 4OCIA 5FI6A 3BXBA 1JUOA 3OGOA 4TZGA 4CLNA 2KYFA 3GB3A 3L4AA 2PASA 3SVBA 2EC6C 3IR8A 2BCAA 5I94A 4W6RA 1S36A 2BAPA 2AH8A 3VHTB 1LKJA 2A54B 2BCBA 2AAOA 1TNWA 1S3PA 2MA2A 2EC6B 2H61A 1AUIB 3NSKA 1JFJA 2H2KA 2Z6YA 5HKYA 4ZF3A 1EMMA 1A75A 1OOHA 1SYMA 2DUHA 1DJZA 1H4BA 2YE0A 2O5GA 3DQCA 1BF5A 1W7JB 2LLUA 1XVJA 4BDUA 4W7CA 1NX2A 4XYNA 4LQUA 1EMFA 1HCJA 2MLEC 4M2OA 4KW9A 1SPYA 1B47A 1CDLA 4XJKB 2JTZA 2KGBC 1OXEA 4EDSA 2NCPA 1YJ2A 4H47A 3LS3A 1ALWA 3TS5C 1N65A 1FF1A 5EXBA 3IP2A 2GW3A 3LCPC 1B7TY 3PN7B 3DPWA 1LVCD 3R1VA 1J1EA 2GX2A 4AS8A 1NUBA 4KF5A 1S6JA 4PPLA 2OJKA 3RLZA 3WHTB 3TS5B 5I8NA 3SSKA 4INWA 1BJFA 3K1KA 3AKOA 4C0LA 2JT8A 3NF0A 1Q80A 4NDDA 4TZAA 3A4UB 4GGFA 1Y1UA 5FVIA 3MSEB 3TZ1A 1ZUXA 2HQZA 1GJYA 4Q7RA 2EMDA 1DJGA 2BKIB 5AQBB 4ANJA 1W7SA 5J2OA 5AXIA 4PHJA 3SS5A 1DELA 1RECA 2OGRA 5AERA 2WORA 4W69A 2YFPA 2B1UA 1NIWA 3AAKA 1EMKA 4WQ3A 4W6JA 2QLIA 5HKWA 5DPIA 4EDOA 2HCGA 5ER5A 3O4XA 4OZDA 4ZIOA 3LVDA 3LSAA 3S0FA 2OS8C 2JADA 2HPSA 5FI2A 3BUMB 2OTBA 3GEXA 3SVDA 2JU0A 1B8LA 5DPJA 1QIVA 3SVOA 1ORGA 3SG5A 1PSRA 2OS8B 3ICBA 1JF0A 1H6RA 3LK0A 2A50B 2KFGA 4IZNA 4Q9WA 1A2XA 3TDIA 3OX6A 3P8UA 4ORAB 5EBJA 5D69A 4MZKA 3DQFA 4EMQA 2L2CA 3BUXB 1IRJA 2WHTA 2A48A 4W6TA 3BOWA 1YVLA 4PHMA 2G6EA 1CM4A 5LTRA 1DQEA 4PDZA 4A4CA 2D8NA 4W73A 1RTP1 2JT3A 3PIBA 3S05A 4ORBB 3PLFB 2PYQA 1DJXA 5FHVA 1FBVA 2KDHA 4MRYA 1Y6WA 4IK4A 2QLEA 3PJ7A 4W7RA 5FI7A 1OXDA 1MYWA 2ICRA 4ZBLA 4CIDA 2LM5A 4GF6B 1S6ZA 4W72A 3GJ2A 1N2DA 2HPWA 1YJFA 3D0YB 3QRXA 4IK3A 1XA5A 2QLGB 1L2OB 3EK8A 1UHNA 4LJDC 3U0LA 1IQ3A 2L98A 4IK8A 2ZKMX 2DDCA 4NDBA 2LLSA 2FCEA 4WRIA 2QLGA 2BBMA 4D1EA 5CSFA 1DGVA 3KPXA 4Q04A 3OX5A 4KF4A 2AWMA 2WC8A 2PVBA 4W6PA 5DPHA 2OKYA 1QX5B 2DD9A 3DQ8A 1TUJA 4W74A 2G6YA 2IB6A 4KGEA 1QV1A 2OTGC 2M29A 2K61A 4W77A 1KFXL 3TUYC 4B30B 2ZN9A 2A53B 5HZOA 3RWTA 2KFFA 3NEZA 1DF0A 1QIWA 2OTGB 3SG6A 2NXQA 1PVAA 1S5GZ 3ZTFA 4YRUA 1XYDA 3I19A 3LF4B 1Q4EA 3L47A 1MXEA 3B88A 2V4EA 4JQ0D 2G16B 3ST2A 4PE1A 5JOLA 2LV7A 4L12A 4HRHA 5LK4A 1L7ZA 3SSVA 3EVRA 3D73A 3EVPA 1SL8A 2L4HA 2Q91A 5EXUA 1KK7Z 2EGDA 2IB5A 4KW8A 4P5OE 5DQMA 1K90D 3GK1A 2G2BA 2ZRTA 2I18A 3PM2A 1DJYA 2P6BB 5KTYA 3NGVA 4A4BA 2PMYA 4PALA 2QEVA 1GFLA 2KHNA 2F2OA 3CZ0A 2WC6A 2K7DA 3CR4X 3GOFA 3D74A 3S0AA 1M39A 3HX4A 5DTYA 1KQVA 1MXLC 4DKNA 4MRXA 1SCMC 1B4CA 3VROA 2E30A 2KLDA 2KOTA 2EMOA 1NYAA 3VRNA 2H5RA 4OKHA 1PSBA 5AEQA 2BE4A 4W7EA 3WCKA 3IF7A 2WCFA 2LP3A 1KYRA 4XOWA 2K8MB 3VB1A 1K9UA 2M1KB 2Q6PA 1MQ1A 4ZB1A 1TWOA 3DQAA 5CSJA 4PCWA 2JNXA 1A03A 1RK9A 5BQLA 4XL5A 2KI6D 1OMVA 4GFTA 3RZSA 1SRAA 1M45A 4PPKA 2KAXA 3DF0A 1NP8A 2SCPA 2QEBA 2I94A 3D77A 2QLHA 3LK1A 1DJWA 4KA9A 1DMOA 3O4YA 3NSOA 4Q9XA 1TIZA 2LNKA 3DYEA 1IGVA 4ZFSA 1F8HA 3DXLA 2LLTA 3WLCA 3SSTA 2EMNA 1YUUA 1PVBA 1KQMC 4JC2A 4GUKA 1SNLA 5DTLA 3B7AA 4IJ7A 3CLNA 1SW8A 1YHGA 1TN4A 1SSEB 3DQ7A 1YRTB 4DIRA 3VGOA 4NQGA 4OY4A 1IG5A 1UUSA 1SCVA 2HFCA 4MEWA 1JC2A 4W7DA 1B8RA 2YDZA 4RTCA 1KQMB 3AKAA 1QLKA 3MGFA 4OR9B 4HSZA 1KYSA 4OVNF 3E5VA 4QJ3B 4GGNA 4UTSA 1J1DA 4M2PA 1TRFA 1ZMZA 2O29A 1EG3A 4TNCA 5DU0A 1QLSA 3CABA 1P28A 3R1OA 5DRFA 1R6PA 2HGYA 3UFZA 4YBHB 4YGAA 1IIOA 4I2YA 2A52B 1YHHA 2IOVA 1M46A 1PK0D 4W6MA 3ED8A 2H61C 2VVIA 3OB1B 5AANA 3WLDA 1TTXA 4DXOA 4W76A 3NSIA 4INXA 1WRZA 1YZWA 2VVJA 2L4IA 3DQDA 1DGUA 4HQCA 1IWQA 3VRQA 1RMMA 3CFHA 4JEOA 3BFHA 1JBAA 3BXKA 1A75B 4JGEA 2ISDA 1NCYA 1YFPA 1F71A 2M7LA 2KI6C 2LMTA 2QRFA 1NX3A 3DQHA 1MOVA 4KF5C 4MSPA 3CFAA 5FVGA 5F6TA 1S1EA 5BPJA 1RJVA 1E8AA 2GTEA 5DQBA 2DOQA 4KEXA 1JBZA 3BFBA 3D75A 1F70A 5DKQA 2P71A 1XFXO 4ORCB 3C1VA 2GGZA 1EMLA 2C9JA 2K0JA 4F0ZB 5KU1A 1X02A 2GW4B 4JD9A 3LVAA 1K93D 2QPTA 4GGFC 3CDNA 1S26D 3OSQA 3A8SA 1QVIZ 4I5LB 2L51A 4KYNA 3QMEA 2FOTA 4CFRA 1G33A 4GBAA 5J3XA 4U8DA 5K89A 4LJCA 1KFUL 1CTRA 1XA9A 2A56B 4H3MA 5H88A 2PXSA 4YGCB 3FS7A 3HCMA 3SVEA 4MLWA 4PPJA 3V3DA 2WCKA 4L9MA 3NHIA 3CBEA 2G3OA 3ADFA 4KAGA 1S6IA 3I5HC 4W6BA 2L5YA 2M49B 1KK8C 4XGYA 3M24A 5ER4X 2K2AA 4W6IA 1HT9A 2F3YA 1J7QA 1IKUA 2G2SB 1KP5A 3I5HB 2WIQA 4W7FA 3BXAA 3G9AA 1KK8B 1FW4A 1LINA 1XFUO 2L50A 4HRGA 4OV2A 2HF5A 1VRKA 1OE9B 2Z6ZA 2JXLA 2WISA 1MR8A 1UP5A 1SY9A 3DQLA 4FTGA 2M7NA 2WCLA 3FWBA 2M3WA 1DJHA 2P4MA 3CZTX 2LVJA 3FE6A 2PRUA 1QWVA 3BUOB 3UNWA 1TNPA 1GQMA 1K94A 4GNKB 2O2BA 4W6OA 4H3NA 2L2EA 3BOWB
chains in the Genus database with same CATH topology
4KGFA 1IJ5A 3EVVA 4J89A 4ZINA 2Z1OA 1LA0A 1BLQA 2CNPA 5DY6A 1EJ3A 2LP2A 1WY9A 4KW4A 4R1EA 1WRKA 1F4QA 3BQ3A 1RM9A 4GAOA 1QASA 2WCBA 1EL4A 4JFGA 1XMZA 2KAYA 2RGIA 2Z6XA 3CB9A 1SBJA 1C07A 2VVHA 3I5GC 1NX0A 2BECA 1ODBA 3SVSA 1FPWA 4W6SA 1YR5A 1UISA 2H8QA 1BU3A 1AJ5A 3TDZA 1ZOTB 1BOCA 1MUXA 1YRUB 1TNXA 1K96A 2Y5IA 4J8AA 4N1FA 1IJ6A 4LJBA 1G8IA 4ZF5A 1QJTA 3OB2B 1BT6A 2ZO6A 3NEDA 2HGDA 4PHNA 1CDMA 1DJIA 4OJ0A 1ZGQA 3RWAA 1U5IA 3LLEA 1KWOC 2QACA 1OMDA 2OTEA 4JF9A 1CKKA 4W6FA 2POXA 1Q4BA 5D7FA 2L0PA 3UG0A 5EHUA 1HQVA 4ZCVA 3OHMB 1DTLA 4HVFA 1TCOB 1TCFA 1KWOB 4GPLB 1W7UA 1OQPA 1Y1XA 3ST3A 5EB7A 2AWJA 3I5IC 4I5JA 4DXPA 2V4EC 2ZN8A 1DF0B 1SL7A 3RM1A 4Z4KA 2KQ6A 2LUXA 1XQMA 5TNCA 1OMRA 1K9KA 5B8IB 4AQIA 2RH7A 1EXRA 3TUYB 2WCEA 3I5IB 1B8CA 2V4EB 1F4OA 3SVRA 2TN4A 4JPZB 4W7AA 4YGDB 2VZXA 3DQKA 1ZFSA 2BBNA 5HGEA 5I2QA 2AHAA 2K7OA 5HKZA 3U0MA 4DXQA 2H5OA 4P1QA 3DVMA 3NT3A 3SG4A 1QATA 1ZGOA 1KFXS 2DUEA 1G4YR 1S5GY 1GGWA 2MAZA 1A4PA 2KYCA 4ETOA 3DQJA 2JPTA 3DVKA 1QX7A 1Y0VH 1S6CA 3PM8A 1CDNA 2F2PA 3BUWB 5HLVA 2E6WA 1RRXA 4IL1A 4XVPA 3ZNIA 1BR1B 5BTTA 2AWLA 1ZGPA 3GL4A 1KK7Y 3ZULA 4Q7UA 4N3DA 3CGAA 4BY5A 2Y1MA 1EMBA 1SCMB 1M31A 3CGLA 5GQQC 1NWDA 5FYXA 4W6LA 3DF0B 2IS9A 2BE6A 2IE2A 4DKMA 1EMCA 2FCDA 1LXFC 3DQ4A 1QYFA 4DRWA 1SKTA 2F33A 2JULA 3NXAA 4EN1A 2JWWA 1TOPA 2JTTA 1YUSA 4DCKA 1YUTA 3DQ1A 4N1GA 1XSSA 3CD9A 1DT7B 1CLBA 3CS1A 1YX8A 4Q7TA 4ZF4A 2LCPA 2R2IA 2V53A 1KSOA 1K2HA 1K9PA 4W6UA 2MBXA 1QYOA 3CR5X 3KHEA 4XOVA 3CTNA 3GJ1A 2JZIA 1CV7A 2Y4QA 4H3LA 4UPGA 3SVCA 1M63B 1IQ5A 3ZUJA 1NSHA 2ZNDA 3K21A 2WSNA 2I2RE 3PJ5A 2CT9A 3VICA 3O6BA 2KSPA 4W6AA 4ORNA 3WXAA 2VRGA 1KYPA 3SSLA 1PULA 1MOUA 2BKHB 1OXFA 2CXJA 2LHLA 3I5FC 1CMGA 4M2QA 4HREE 4DXIA 3BX9A 4H48A 5LTPA 3P28A 4W6DA 1EMGA 3DQ3A 2K7CA 5DKNA 3U0KA 3I5FB 1UHIA 4YGEB 3D10A 2H9WA 1SK6D 5KTGA 3SRYA 2GGMA 5HZUA 1NCZA 1F09A 1BODA 1ZACA 3BXCA 3SIAA 4RYSA 5HYDA 2HQKA 2JXCA 1XO5A 1EG4A 1F55A 2Y1NA 2DUGA 3DQ9A 4NWSA 3VRPA 1YHIA 5PALA 1B7TZ 2HQ8A 3DQEA 3VHTA 4YI9A 1Q4DA 2BCXA 3OP0A 3EKHA 2VAEA 3LVCA 1SMGA 3U8CA 1CLLA 2CCMA 1LA3A 5IBWA 1RFJA 3JTDC 3O2PA 1WRLA 1H8BA 2BTJA 2KI4C 4Z4MA 4W6NA 3SJSA 1BG1A 3PN7C 1Q4AA 2ARLA 1Y1AA 2K2FA 3SV5A 5LTQA 3SSPA 3JTDB 1YX7A 2F8PA 2KI4B 4PE4A 5EB6A 4XJKA 4C0JA 1XK4C 1CLMA 4C0KA 1W7TA 2L5XB 4PHKA 1H4UA 5BT0A 4ICBA 1NCXA 1A29A 1UHKA 5CPVA 4W7XA 1PALA 1CNPA 2O60A 2DD7A 1PRWA 1YVHA 3AI4A 1OSAA 2GV5A 1J7PA 1CFPA 1QVIY 1AP4A 4GOBA 1KSMA 1C7VA 2G6XA 1XK4A 4ZCUA 2H6VA 1BR4B 4B5YA 1B9CA 4HQ9A 3OSRA 5DTXA 2KFHA 4JRBA 2O24A 1AK8A 1B9AA 1ALVA 2JNFA 1AVSA 2M0RA 4DXMA 1QXTA 1F54A 3EK7A 3EKJA 1IH0A 2K7BA 2I7AA 4I5KA 2NZ0A 1KFUS 2JQ6A 3PJBA 3DVEA 3F45A 1FI6A 4USLA 1UHJA 4AOMA 2CTNA 4QJ4B 5HW9A 3O78A 1AJ4A 2HRSA 4MVFA 2B3PA 1GGZA 1CDPA 4MZLA 1Z1PA 1MWNA 3NT9A 2PXWA 4R6DA 1MHOA 3VRRA 1KCYA 3SVUA 1CFCA 2AWKA 2CBLA 4DUQA 3W1DA 2ZFDA 2MRDA 3PALA 3CWGA 2H5QA 1CM1A 2OKWA 3GK2A 4MBEA 2YE1A 2ZMUA 1JSAA 2G9BA 1Z1QA 3DQNA 3DQ5A 3DPXA 4L13A 2M97A 3DQMA 3NSLA 1JC1A 1EH2A 2HQWA 2LMUA 1BFPA 4DS7A 1JC0A 2F3ZA 4LW5A 1EMAA 4FQOA 3WHUB 3SG7A 1CFFA 4BY4A 1JF2A 1NPQA 3PSRA 5DTZA 4OGSA 2QU1A 3DVJA 1QS7A 1QY3A 1SR6C 3DQUA 2DDDA 5FVFA 3VK1A 5KSZA 1EMEA 4IK5A 3SSYA 1K95A 4W6GA 1L2OC 5CSIA 1Q73A 1QYQA 4EULA 1XFYO 4WQ2A 1SR6B 1AHRA 2LMVA 1U5IB 3I5GB 5HZSA 2FWQA 3E5TA 2AUCA 1N0YA 5JJGA 3H4SE 3CR2A 1V1FA 1J55A 2M1UA 3EK4A 4IK9A 3DQ2A 4IK1A 2BL0C 4J88A 3ST0A 2MLFC 3WNXB 1YTZC 4CPVA 3D0YA 2G3DB 2NLNA 3LL8B 4RYWA 3SVNA 3M0WA 3TMTA 1DVIA 2BL0B 1V1GA 3CFFA 2H5PA 4LQTA 4LJDA 2A46A 2WOSA 3DD4A 2QT2A 3DQOA 5AFPA 1WDCC 3SSHA 1W7IB 4W6KA 1XFVO 1OZSA 2MJWB 1OOJA 2FZUA 4PFEA 1F0BA 1GGXA 1TNQA 4B30A 3LA1A 4HQ8A 2PALA 2JC2A 1RMOA 4E68A 1WDCB 1D1OA 1SL9A 1XAEA 1WLMA 2ZMWA 4AR7A 2KBIA 1YURA 4L1IA 2WHSA 4U2VA 4QJ5B 2OPOA 2WURA 2LE9B 5T3IA 3W1CA 4N5XA 1OZOA 2DUFA 3BYAA 4I5NB 3ST4A 3H1RA 1QX2A 3KCSA 2ZNEA 2A4JA 2Q4UA 2WHUA 3ZWHA 1QV0A 1NX1A 4OQWA 4W6CA 2AMIA 2LUCA 4R6BA 2M9GA 5DRGA 5BTTB 4YI8A 2KQYA 3O77A 3KCTA 1FI5A 1RWYA 1UHHA 2KBMA 5DPGA 2COLB 4GESB 5EXCI 3IQOA 3SIBA 5HBDA 1RMPA 3AI5A 2MHHA 4W6HA 1QTXA 4CFQA 3KO0A 1J7RA 2ZO7A 1Q4CA 2Q57A 5EJUA 3ZUFA 2JRFA 3FWCA 1MF8B 3U0NA 1XFWO 4MN0A 3TMRA 1XFZO 4OHSA 1K8UA 2LVIA 4KPIA 2A47A 2WNDA 4P76A 3FIAA 3DQIA 5I2LA 1BMOA 1C7WA 3PFVA 2HJOA 2Y0GA 3EVUA 3GK4X 1RROA 3U8AA 2GX0A 3M22A 3IQQA 3H1OA 1WLZA 4YGBB 2WSOA 3DPZA 5DKRA 1UURA 2LVVA 3SS0A 3KEVA 4MZJA 2KAVA 5CSNA 2C9IA 2LVKA 5H87A 1QXPA 2LHIA 2VADA 1J7OA 3KF9A 3TDUA 5I2OA 4AQJA 2DUIA 4PE7A 2SASA 1UWOA 3E5WA 4P2YB 3BUNB 2NCOA 2JOJA 5G08A 5HLOA 3SG3A 2FL1A 5HZTA 4PE0A 3AAJA 3U8PA 3AKBA 2LAPA 2LANA 1HUYA 3PATA 2HETA 3JVTC 5H89A 3SG2A 2B3QA 1CMFA 2KGRA 1JFKA 2KNEA 1JWDA 2LC5A 1CFDA 1B1GA 4HE4A 3E3RA 2G5ZB 2PSRA 3LF3A 2ZRSA 3JVTB 4JWQA 2JT0A 4DXNA 1GL4A 2EHBA 5F9GA 2M8UA 1G7KA 4W75A 2FJUB 4NDCA 1JBYA 3DQ6A 3CD1A 1R2UA 1CB1A 3A8RA 1ZUZA 2QZ0A 1C4FA 4OCIA 3BXBA 1JUOA 3OGOA 4TZGA 4CLNA 2KYFA 3GB3A 2PASA 3SVBA 2EC6C 3IR8A 2BCAA 4W6RA 1S36A 2AH8A 3VHTB 1LKJA 2A54B 2BCBA 2AAOA 1TNWA 1S3PA 2MA2A 2EC6B 2H61A 1AUIB 3NSKA 1JFJA 2H2KA 2Z6YA 5HKYA 4ZF3A 1EMMA 1A75A 2DUHA 1SYMA 1DJZA 1H4BA 2YE0A 2O5GA 3DQCA 1BF5A 1W7JB 2LLUA 1XVJA 4BDUA 4W7CA 1NX2A 4XYNA 4LQUA 1EMFA 1HCJA 2MLEC 4M2OA 4KW9A 1SPYA 1B47A 1CDLA 4XJKB 2JTZA 2KGBC 1OXEA 4EDSA 2NCPA 1YJ2A 4H47A 3LS3A 1ALWA 3TS5C 1N65A 1FF1A 5EXBA 3IP2A 2GW3A 3LCPC 1B7TY 3PN7B 3DPWA 1LVCD 1J1EA 2GX2A 4AS8A 1NUBA 4KF5A 1S6JA 4PPLA 2OJKA 3RLZA 3WHTB 3TS5B 5I8NA 3SSKA 1BJFA 3K1KA 3AKOA 4C0LA 2JT8A 3NF0A 1Q80A 4NDDA 4TZAA 3A4UB 4GGFA 1Y1UA 5FVIA 3MSEB 3TZ1A 1ZUXA 2HQZA 1GJYA 4Q7RA 2EMDA 1DJGA 2BKIB 5AQBB 4ANJA 1W7SA 5J2OA 5AXIA 4PHJA 1RECA 2OGRA 5AERA 2WORA 4W69A 2YFPA 2B1UA 1NIWA 3AAKA 1EMKA 4WQ3A 4W6JA 2QLIA 5HKWA 5DPIA 4EDOA 2HCGA 5ER5A 4ZIOA 3LVDA 3LSAA 2OS8C 2JADA 2HPSA 3BUMB 2OTBA 3GEXA 3SVDA 2JU0A 1B8LA 5DPJA 1QIVA 3SVOA 3SG5A 1PSRA 2OS8B 3ICBA 1JF0A 1H6RA 3LK0A 2A50B 2KFGA 4IZNA 4Q9WA 1A2XA 3TDIA 3OX6A 3P8UA 4ORAB 5EBJA 5D69A 4MZKA 3DQFA 4EMQA 3BUXB 1IRJA 2WHTA 2A48A 4W6TA 3BOWA 1YVLA 4PHMA 2G6EA 1CM4A 5LTRA 4PDZA 4A4CA 2D8NA 4W73A 1RTP1 2JT3A 3PIBA 3S05A 4ORBB 3PLFB 1DJXA 5FHVA 1FBVA 2KDHA 4MRYA 1Y6WA 4IK4A 2QLEA 3PJ7A 4W7RA 1OXDA 1MYWA 2ICRA 4ZBLA 4CIDA 2LM5A 4GF6B 1S6ZA 4W72A 3GJ2A 1N2DA 2HPWA 1YJFA 3D0YB 3QRXA 4IK3A 1XA5A 2QLGB 1L2OB 3EK8A 1UHNA 4LJDC 3U0LA 1IQ3A 2L98A 4IK8A 2ZKMX 2DDCA 4NDBA 2LLSA 2FCEA 4WRIA 2QLGA 2BBMA 4D1EA 5CSFA 1DGVA 3KPXA 4Q04A 3OX5A 4KF4A 2AWMA 2WC8A 2PVBA 4W6PA 5DPHA 2OKYA 1QX5B 2DD9A 3DQ8A 4W74A 2G6YA 2IB6A 4KGEA 1QV1A 2OTGC 2M29A 2K61A 4W77A 1KFXL 3TUYC 4B30B 2ZN9A 2A53B 5HZOA 3RWTA 2KFFA 3NEZA 1DF0A 1QIWA 2OTGB 3SG6A 2NXQA 1PVAA 1S5GZ 3ZTFA 4YRUA 1XYDA 3I19A 3LF4B 1Q4EA 1MXEA 2V4EA 4JQ0D 2G16B 3ST2A 4PE1A 5JOLA 2LV7A 4L12A 4HRHA 5LK4A 1L7ZA 3SSVA 3EVRA 3EVPA 1SL8A 2L4HA 2Q91A 5EXUA 1KK7Z 2EGDA 2IB5A 4KW8A 4P5OE 5DQMA 1K90D 3GK1A 2G2BA 2ZRTA 2I18A 1DJYA 2P6BB 5KTYA 4A4BA 2PMYA 4PALA 1GFLA 2KHNA 2F2OA 2K7DA 3CR4X 3GOFA 1M39A 3HX4A 5DTYA 1KQVA 1MXLC 4DKNA 4MRXA 1SCMC 1B4CA 3VROA 2E30A 2KOTA 2EMOA 1NYAA 3VRNA 2H5RA 4OKHA 1PSBA 5AEQA 2BE4A 4W7EA 3WCKA 3IF7A 2WCFA 2LP3A 1KYRA 4XOWA 2K8MB 1K9UA 2M1KB 2Q6PA 1MQ1A 4ZB1A 3DQAA 5CSJA 4PCWA 2JNXA 1A03A 1RK9A 5BQLA 4XL5A 2KI6D 1OMVA 4GFTA 1SRAA 1M45A 4PPKA 2KAXA 3DF0A 1NP8A 2SCPA 2I94A 2QLHA 3LK1A 1DJWA 4KA9A 1DMOA 3O4YA 3NSOA 4Q9XA 1TIZA 2LNKA 1IGVA 4ZFSA 1F8HA 2LLTA 3WLCA 3SSTA 2EMNA 1YUUA 1PVBA 1KQMC 4JC2A 4GUKA 1SNLA 5DTLA 3CLNA 1SW8A 1YHGA 1TN4A 3DQ7A 1YRTB 4DIRA 3VGOA 4NQGA 4OY4A 1IG5A 1UUSA 1SCVA 2HFCA 4MEWA 1JC2A 4W7DA 1B8RA 2YDZA 4RTCA 1KQMB 3AKAA 1QLKA 3MGFA 4OR9B 4HSZA 1KYSA 4OVNF 3E5VA 4QJ3B 4GGNA 4UTSA 1J1DA 4M2PA 1TRFA 1ZMZA 2O29A 1EG3A 4TNCA 5DU0A 1QLSA 5DRFA 1R6PA 2HGYA 3UFZA 4YBHB 4YGAA 4I2YA 2A52B 1YHHA 2IOVA 1M46A 1PK0D 4W6MA 3ED8A 2H61C 2VVIA 3OB1B 5AANA 3WLDA 1TTXA 4DXOA 4W76A 3NSIA 1WRZA 1YZWA 2VVJA 2L4IA 3DQDA 1DGUA 4HQCA 1IWQA 3VRQA 1RMMA 3CFHA 4JEOA 1JBAA 3BXKA 1A75B 4JGEA 2ISDA 1NCYA 1YFPA 1F71A 2M7LA 2KI6C 2LMTA 2QRFA 1NX3A 3DQHA 1MOVA 4KF5C 4MSPA 3CFAA 5FVGA 5F6TA 1S1EA 5BPJA 1RJVA 1E8AA 5DQBA 2DOQA 4KEXA 1JBZA 1F70A 5DKQA 1XFXO 4ORCB 3C1VA 2GGZA 1EMLA 2C9JA 2K0JA 4F0ZB 5KU1A 1X02A 2GW4B 3LVAA 1K93D 2QPTA 4GGFC 1S26D 3OSQA 3A8SA 1QVIZ 4I5LB 2L51A 2FOTA 4CFRA 1G33A 4GBAA 5J3XA 4U8DA 5K89A 4LJCA 1KFUL 1CTRA 1XA9A 2A56B 4H3MA 5H88A 2PXSA 4YGCB 3FS7A 3HCMA 3SVEA 4MLWA 4PPJA 3V3DA 4L9MA 3CBEA 2G3OA 3ADFA 4KAGA 1S6IA 3I5HC 4W6BA 2M49B 1KK8C 4XGYA 3M24A 5ER4X 2K2AA 4W6IA 1HT9A 2F3YA 1J7QA 1IKUA 2G2SB 1KP5A 3I5HB 2WIQA 4W7FA 3BXAA 3G9AA 1KK8B 1FW4A 1LINA 1XFUO 2L50A 4HRGA 4OV2A 2HF5A 1VRKA 1OE9B 2Z6ZA 2JXLA 2WISA 1MR8A 1UP5A 1SY9A 3DQLA 4FTGA 2M7NA 3FWBA 2M3WA 1DJHA 2P4MA 3CZTX 2LVJA 2PRUA 3BUOB 1TNPA 1GQMA 1K94A 4GNKB 2O2BA 4W6OA 4H3NA 2L2EA 3BOWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGF A;  1IJ5 A;  3EVV A;  4J89 A;  4ZIN A;  2Z1O A;  1LA0 A;  1BLQ A;  2CNP A;  5DY6 A;  1EJ3 A;  2LP2 A;  1WY9 A;  4KW4 A;  4R1E A;  1WRK A;  1F4Q A;  3BQ3 A;  1RM9 A;  4GAO A;  1QAS A;  2WCB A;  1EL4 A;  4JFG A;  1XMZ A;  2KAY A;  2RGI A;  2Z6X A;  3CB9 A;  1SBJ A;  1C07 A;  2VVH A;  3I5G C;  1NX0 A;  2BEC A;  1ODB A;  3SVS A;  1FPW A;  4W6S A;  1YR5 A;  1UIS A;  2H8Q A;  1BU3 A;  1AJ5 A;  3TDZ A;  1ZOT B;  1BOC A;  1MUX A;  1YRU B;  1TNX A;  1K96 A;  2Y5I A;  4J8A A;  4N1F A;  1IJ6 A;  4LJB A;  1G8I A;  4ZF5 A;  1QJT A;  3OB2 B;  1BT6 A;  2ZO6 A;  3NED A;  2HGD A;  4PHN A;  1CDM A;  1DJI A;  4OJ0 A;  1ZGQ A;  3RWA A;  1U5I A;  3LLE A;  1KWO C;  2QAC A;  1OMD A;  2OTE A;  4JF9 A;  1CKK A;  4W6F A;  2POX A;  1Q4B A;  5D7F A;  2L0P A;  3UG0 A;  5EHU A;  1HQV A;  4ZCV A;  3OHM B;  1DTL A;  4HVF A;  1TCO B;  1TCF A;  1KWO B;  4GPL B;  1W7U A;  1OQP A;  1Y1X A;  3ST3 A;  5EB7 A;  2AWJ A;  3I5I C;  4I5J A;  4DXP A;  2V4E C;  2ZN8 A;  1DF0 B;  1SL7 A;  3RM1 A;  4Z4K A;  2KQ6 A;  2LUX A;  1XQM A;  5TNC A;  1OMR A;  1K9K A;  5B8I B;  4AQI A;  2RH7 A;  1EXR A;  3TUY B;  2WCE A;  3I5I B;  1B8C A;  2V4E B;  1F4O A;  3SVR A;  2TN4 A;  4JPZ B;  4W7A A;  4YGD B;  2VZX A;  3DQK A;  1ZFS A;  2BBN A;  5HGE A;  5I2Q A;  2AHA A;  2K7O A;  5HKZ A;  3U0M A;  4DXQ A;  2H5O A;  4P1Q A;  3DVM A;  3NT3 A;  3SG4 A;  1QAT A;  1ZGO A;  1KFX S;  2DUE A;  1G4Y R;  1S5G Y;  1GGW A;  2MAZ A;  1A4P A;  2KYC A;  4ETO A;  3DQJ A;  2JPT A;  3DVK A;  1QX7 A;  1Y0V H;  1S6C A;  3PM8 A;  1CDN A;  2F2P A;  3BUW B;  5HLV A;  2E6W A;  1RRX A;  4IL1 A;  4XVP A;  3ZNI A;  1BR1 B;  5BTT A;  2AWL A;  1ZGP A;  3GL4 A;  1KK7 Y;  3ZUL A;  4Q7U A;  4N3D A;  3CGA A;  4BY5 A;  2Y1M A;  1EMB A;  1SCM B;  1M31 A;  3CGL A;  5GQQ C;  1NWD A;  5FYX A;  4W6L A;  3DF0 B;  2IS9 A;  2BE6 A;  2IE2 A;  4DKM A;  1EMC A;  2FCD A;  1LXF C;  3DQ4 A;  1QYF A;  4DRW A;  1SKT A;  2F33 A;  2JUL A;  3NXA A;  4EN1 A;  2JWW A;  1TOP A;  2JTT A;  1YUS A;  4DCK A;  1YUT A;  3DQ1 A;  4N1G A;  1XSS A;  3CD9 A;  1DT7 B;  1CLB A;  3CS1 A;  1YX8 A;  4Q7T A;  4ZF4 A;  2LCP A;  2R2I A;  2V53 A;  1KSO A;  1K2H A;  1K9P A;  4W6U A;  2MBX A;  1QYO A;  3CR5 X;  3KHE A;  4XOV A;  3CTN A;  3GJ1 A;  2JZI A;  1CV7 A;  2Y4Q A;  4H3L A;  4UPG A;  3SVC A;  1M63 B;  1IQ5 A;  3ZUJ A;  1NSH A;  2ZND A;  3K21 A;  2WSN A;  2I2R E;  3PJ5 A;  2CT9 A;  3VIC A;  3O6B A;  2KSP A;  4W6A A;  4ORN A;  3WXA A;  2VRG A;  1KYP A;  3SSL A;  1PUL A;  1MOU A;  2BKH B;  1OXF A;  2CXJ A;  2LHL A;  3I5F C;  1CMG A;  4M2Q A;  4HRE E;  4DXI A;  3BX9 A;  4H48 A;  5LTP A;  3P28 A;  4W6D A;  1EMG A;  3DQ3 A;  2K7C A;  5DKN A;  3U0K A;  3I5F B;  1UHI A;  4YGE B;  3D10 A;  2H9W A;  1SK6 D;  5KTG A;  3SRY A;  2GGM A;  5HZU A;  1NCZ A;  1F09 A;  1BOD A;  1ZAC A;  3BXC A;  3SIA A;  4RYS A;  5HYD A;  2HQK A;  2JXC A;  1XO5 A;  1EG4 A;  1F55 A;  2Y1N A;  2DUG A;  3DQ9 A;  4NWS A;  3VRP A;  1YHI A;  5PAL A;  1B7T Z;  2HQ8 A;  3DQE A;  3VHT A;  4YI9 A;  1Q4D A;  2BCX A;  3OP0 A;  3EKH A;  2VAE A;  3LVC A;  1SMG A;  3U8C A;  1CLL A;  2CCM A;  1LA3 A;  5IBW A;  1RFJ A;  3JTD C;  3O2P A;  1WRL A;  1H8B A;  2BTJ A;  2KI4 C;  4Z4M A;  4W6N A;  3SJS A;  1BG1 A;  3PN7 C;  1Q4A A;  2ARL A;  1Y1A A;  2K2F A;  3SV5 A;  5LTQ A;  3SSP A;  3JTD B;  1YX7 A;  2F8P A;  2KI4 B;  4PE4 A;  5EB6 A;  4XJK A;  4C0J A;  1XK4 C;  1CLM A;  4C0K A;  1W7T A;  2L5X B;  4PHK A;  1H4U A;  5BT0 A;  4ICB A;  1NCX A;  1A29 A;  1UHK A;  5CPV A;  4W7X A;  1PAL A;  1CNP A;  2O60 A;  2DD7 A;  1PRW A;  1YVH A;  3AI4 A;  1OSA A;  2GV5 A;  1J7P A;  1CFP A;  1QVI Y;  1AP4 A;  4GOB A;  1KSM A;  1C7V A;  2G6X A;  1XK4 A;  4ZCU A;  2H6V A;  1BR4 B;  4B5Y A;  1B9C A;  4HQ9 A;  3OSR A;  5DTX A;  2KFH A;  4JRB A;  2O24 A;  1AK8 A;  1B9A A;  1ALV A;  2JNF A;  1AVS A;  2M0R A;  4DXM A;  1QXT A;  1F54 A;  3EK7 A;  3EKJ A;  1IH0 A;  2K7B A;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2JQ6 A;  3PJB A;  3DVE A;  3F45 A;  1FI6 A;  4USL A;  1UHJ A;  4AOM A;  2CTN A;  4QJ4 B;  5HW9 A;  3O78 A;  1AJ4 A;  2HRS A;  4MVF A;  2B3P A;  1GGZ A;  1CDP A;  4MZL A;  1Z1P A;  1MWN A;  3NT9 A;  2PXW A;  4R6D A;  1MHO A;  3VRR A;  1KCY A;  3SVU A;  1CFC A;  2AWK A;  2CBL A;  4DUQ A;  3W1D A;  2ZFD A;  2MRD A;  3PAL A;  3CWG A;  2H5Q A;  1CM1 A;  2OKW A;  3GK2 A;  4MBE A;  2YE1 A;  2ZMU A;  1JSA A;  2G9B A;  1Z1Q A;  3DQN A;  3DQ5 A;  3DPX A;  4L13 A;  2M97 A;  3DQM A;  3NSL A;  1JC1 A;  1EH2 A;  2HQW A;  2LMU A;  1BFP A;  4DS7 A;  1JC0 A;  2F3Z A;  4LW5 A;  1EMA A;  4FQO A;  3WHU B;  3SG7 A;  1CFF A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  5DTZ A;  4OGS A;  2QU1 A;  3DVJ A;  1QS7 A;  1QY3 A;  1SR6 C;  3DQU A;  2DDD A;  5FVF A;  3VK1 A;  5KSZ A;  1EME A;  4IK5 A;  3SSY A;  1K95 A;  4W6G A;  1L2O C;  5CSI A;  1Q73 A;  1QYQ A;  4EUL A;  1XFY O;  4WQ2 A;  1SR6 B;  1AHR A;  2LMV A;  1U5I B;  3I5G B;  5HZS A;  2FWQ A;  3E5T A;  2AUC A;  1N0Y A;  5JJG A;  3H4S E;  3CR2 A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4IK9 A;  3DQ2 A;  4IK1 A;  2BL0 C;  4J88 A;  3ST0 A;  2MLF C;  3WNX B;  1YTZ C;  4CPV A;  3D0Y A;  2G3D B;  2NLN A;  3LL8 B;  4RYW A;  3SVN A;  3M0W A;  3TMT A;  1DVI A;  2BL0 B;  1V1G A;  3CFF A;  2H5P A;  4LQT A;  4LJD A;  2A46 A;  2WOS A;  3DD4 A;  2QT2 A;  3DQO A;  5AFP A;  1WDC C;  3SSH A;  1W7I B;  4W6K A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  2FZU A;  4PFE A;  1F0B A;  1GGX A;  1TNQ A;  4B30 A;  3LA1 A;  4HQ8 A;  2PAL A;  2JC2 A;  1RMO A;  4E68 A;  1WDC B;  1D1O A;  1SL9 A;  1XAE A;  1WLM A;  2ZMW A;  4AR7 A;  2KBI A;  1YUR A;  4L1I A;  2WHS A;  4U2V A;  4QJ5 B;  2OPO A;  2WUR A;  2LE9 B;  5T3I A;  3W1C A;  4N5X A;  1OZO A;  2DUF A;  3BYA A;  4I5N B;  3ST4 A;  3H1R A;  1QX2 A;  3KCS A;  2ZNE A;  2A4J A;  2Q4U A;  2WHU A;  3ZWH A;  1QV0 A;  1NX1 A;  4OQW A;  4W6C A;  2AMI A;  2LUC A;  4R6B A;  2M9G A;  5DRG A;  5BTT B;  4YI8 A;  2KQY A;  3O77 A;  3KCT A;  1FI5 A;  1RWY A;  1UHH A;  2KBM A;  5DPG A;  2COL B;  4GES B;  5EXC I;  3IQO A;  3SIB A;  5HBD A;  1RMP A;  3AI5 A;  2MHH A;  4W6H A;  1QTX A;  4CFQ A;  3KO0 A;  1J7R A;  2ZO7 A;  1Q4C A;  2Q57 A;  5EJU A;  3ZUF A;  2JRF A;  3FWC A;  1MF8 B;  3U0N A;  1XFW O;  4MN0 A;  3TMR A;  1XFZ O;  4OHS A;  1K8U A;  2LVI A;  4KPI A;  2A47 A;  2WND A;  4P76 A;  3FIA A;  3DQI A;  5I2L A;  1BMO A;  1C7W A;  3PFV A;  2HJO A;  2Y0G A;  3EVU A;  3GK4 X;  1RRO A;  3U8A A;  2GX0 A;  3M22 A;  3IQQ A;  3H1O A;  1WLZ A;  4YGB B;  2WSO A;  3DPZ A;  5DKR A;  1UUR A;  2LVV A;  3SS0 A;  3KEV A;  4MZJ A;  2KAV A;  5CSN A;  2C9I A;  2LVK A;  5H87 A;  1QXP A;  2LHI A;  2VAD A;  1J7O A;  3KF9 A;  3TDU A;  5I2O A;  4AQJ A;  2DUI A;  4PE7 A;  2SAS A;  1UWO A;  3E5W A;  4P2Y B;  3BUN B;  2NCO A;  2JOJ A;  5G08 A;  5HLO A;  3SG3 A;  2FL1 A;  5HZT A;  4PE0 A;  3AAJ A;  3U8P A;  3AKB A;  2LAP A;  2LAN A;  1HUY A;  3PAT A;  2HET A;  3JVT C;  5H89 A;  3SG2 A;  2B3Q A;  1CMF A;  2KGR A;  1JFK A;  2KNE A;  1JWD A;  2LC5 A;  1CFD A;  1B1G A;  4HE4 A;  3E3R A;  2G5Z B;  2PSR A;  3LF3 A;  2ZRS A;  3JVT B;  4JWQ A;  2JT0 A;  4DXN A;  1GL4 A;  2EHB A;  5F9G A;  2M8U A;  1G7K A;  4W75 A;  2FJU B;  4NDC A;  1JBY A;  3DQ6 A;  3CD1 A;  1R2U A;  1CB1 A;  3A8R A;  1ZUZ A;  2QZ0 A;  1C4F A;  4OCI A;  3BXB A;  1JUO A;  3OGO A;  4TZG A;  4CLN A;  2KYF A;  3GB3 A;  2PAS A;  3SVB A;  2EC6 C;  3IR8 A;  2BCA A;  4W6R A;  1S36 A;  2AH8 A;  3VHT B;  1LKJ A;  2A54 B;  2BCB A;  2AAO A;  1TNW A;  1S3P A;  2MA2 A;  2EC6 B;  2H61 A;  1AUI B;  3NSK A;  1JFJ A;  2H2K A;  2Z6Y A;  5HKY A;  4ZF3 A;  1EMM A;  1A75 A;  2DUH A;  1SYM A;  1DJZ A;  1H4B A;  2YE0 A;  2O5G A;  3DQC A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  4BDU A;  4W7C A;  1NX2 A;  4XYN A;  4LQU A;  1EMF A;  1HCJ A;  2MLE C;  4M2O A;  4KW9 A;  1SPY A;  1B47 A;  1CDL A;  4XJK B;  2JTZ A;  2KGB C;  1OXE A;  4EDS A;  2NCP A;  1YJ2 A;  4H47 A;  3LS3 A;  1ALW A;  3TS5 C;  1N65 A;  1FF1 A;  5EXB A;  3IP2 A;  2GW3 A;  3LCP C;  1B7T Y;  3PN7 B;  3DPW A;  1LVC D;  1J1E A;  2GX2 A;  4AS8 A;  1NUB A;  4KF5 A;  1S6J A;  4PPL A;  2OJK A;  3RLZ A;  3WHT B;  3TS5 B;  5I8N A;  3SSK A;  1BJF A;  3K1K A;  3AKO A;  4C0L A;  2JT8 A;  3NF0 A;  1Q80 A;  4NDD A;  4TZA A;  3A4U B;  4GGF A;  1Y1U A;  5FVI A;  3MSE B;  3TZ1 A;  1ZUX A;  2HQZ A;  1GJY A;  4Q7R A;  2EMD A;  1DJG A;  2BKI B;  5AQB B;  4ANJ A;  1W7S A;  5J2O A;  5AXI A;  4PHJ A;  1REC A;  2OGR A;  5AER A;  2WOR A;  4W69 A;  2YFP A;  2B1U A;  1NIW A;  3AAK A;  1EMK A;  4WQ3 A;  4W6J A;  2QLI A;  5HKW A;  5DPI A;  4EDO A;  2HCG A;  5ER5 A;  4ZIO A;  3LVD A;  3LSA A;  2OS8 C;  2JAD A;  2HPS A;  3BUM B;  2OTB A;  3GEX A;  3SVD A;  2JU0 A;  1B8L A;  5DPJ A;  1QIV A;  3SVO A;  3SG5 A;  1PSR A;  2OS8 B;  3ICB A;  1JF0 A;  1H6R A;  3LK0 A;  2A50 B;  2KFG A;  4IZN A;  4Q9W A;  1A2X A;  3TDI A;  3OX6 A;  3P8U A;  4ORA B;  5EBJ A;  5D69 A;  4MZK A;  3DQF A;  4EMQ A;  3BUX B;  1IRJ A;  2WHT A;  2A48 A;  4W6T A;  3BOW A;  1YVL A;  4PHM A;  2G6E A;  1CM4 A;  5LTR A;  4PDZ A;  4A4C A;  2D8N A;  4W73 A;  1RTP 1;  2JT3 A;  3PIB A;  3S05 A;  4ORB B;  3PLF B;  1DJX A;  5FHV A;  1FBV A;  2KDH A;  4MRY A;  1Y6W A;  4IK4 A;  2QLE A;  3PJ7 A;  4W7R A;  1OXD A;  1MYW A;  2ICR A;  4ZBL A;  4CID A;  2LM5 A;  4GF6 B;  1S6Z A;  4W72 A;  3GJ2 A;  1N2D A;  2HPW A;  1YJF A;  3D0Y B;  3QRX A;  4IK3 A;  1XA5 A;  2QLG B;  1L2O B;  3EK8 A;  1UHN A;  4LJD C;  3U0L A;  1IQ3 A;  2L98 A;  4IK8 A;  2ZKM X;  2DDC A;  4NDB A;  2LLS A;  2FCE A;  4WRI A;  2QLG A;  2BBM A;  4D1E A;  5CSF A;  1DGV A;  3KPX A;  4Q04 A;  3OX5 A;  4KF4 A;  2AWM A;  2WC8 A;  2PVB A;  4W6P A;  5DPH A;  2OKY A;  1QX5 B;  2DD9 A;  3DQ8 A;  4W74 A;  2G6Y A;  2IB6 A;  4KGE A;  1QV1 A;  2OTG C;  2M29 A;  2K61 A;  4W77 A;  1KFX L;  3TUY C;  4B30 B;  2ZN9 A;  2A53 B;  5HZO A;  3RWT A;  2KFF A;  3NEZ A;  1DF0 A;  1QIW A;  2OTG B;  3SG6 A;  2NXQ A;  1PVA A;  1S5G Z;  3ZTF A;  4YRU A;  1XYD A;  3I19 A;  3LF4 B;  1Q4E A;  1MXE A;  2V4E A;  4JQ0 D;  2G16 B;  3ST2 A;  4PE1 A;  5JOL A;  2LV7 A;  4L12 A;  4HRH A;  5LK4 A;  1L7Z A;  3SSV A;  3EVR A;  3EVP A;  1SL8 A;  2L4H A;  2Q91 A;  5EXU A;  1KK7 Z;  2EGD A;  2IB5 A;  4KW8 A;  4P5O E;  5DQM A;  1K90 D;  3GK1 A;  2G2B A;  2ZRT A;  2I18 A;  1DJY A;  2P6B B;  5KTY A;  4A4B A;  2PMY A;  4PAL A;  1GFL A;  2KHN A;  2F2O A;  2K7D A;  3CR4 X;  3GOF A;  1M39 A;  3HX4 A;  5DTY A;  1KQV A;  1MXL C;  4DKN A;  4MRX A;  1SCM C;  1B4C A;  3VRO A;  2E30 A;  2KOT A;  2EMO A;  1NYA A;  3VRN A;  2H5R A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  4W7E A;  3WCK A;  3IF7 A;  2WCF A;  2LP3 A;  1KYR A;  4XOW A;  2K8M B;  1K9U A;  2M1K B;  2Q6P A;  1MQ1 A;  4ZB1 A;  3DQA A;  5CSJ A;  4PCW A;  2JNX A;  1A03 A;  1RK9 A;  5BQL A;  4XL5 A;  2KI6 D;  1OMV A;  4GFT A;  1SRA A;  1M45 A;  4PPK A;  2KAX A;  3DF0 A;  1NP8 A;  2SCP A;  2I94 A;  2QLH A;  3LK1 A;  1DJW A;  4KA9 A;  1DMO A;  3O4Y A;  3NSO A;  4Q9X A;  1TIZ A;  2LNK A;  1IGV A;  4ZFS A;  1F8H A;  2LLT A;  3WLC A;  3SST A;  2EMN A;  1YUU A;  1PVB A;  1KQM C;  4JC2 A;  4GUK A;  1SNL A;  5DTL A;  3CLN A;  1SW8 A;  1YHG A;  1TN4 A;  3DQ7 A;  1YRT B;  4DIR A;  3VGO A;  4NQG A;  4OY4 A;  1IG5 A;  1UUS A;  1SCV A;  2HFC A;  4MEW A;  1JC2 A;  4W7D A;  1B8R A;  2YDZ A;  4RTC A;  1KQM B;  3AKA A;  1QLK A;  3MGF A;  4OR9 B;  4HSZ A;  1KYS A;  4OVN F;  3E5V A;  4QJ3 B;  4GGN A;  4UTS A;  1J1D A;  4M2P A;  1TRF A;  1ZMZ A;  2O29 A;  1EG3 A;  4TNC A;  5DU0 A;  1QLS A;  5DRF A;  1R6P A;  2HGY A;  3UFZ A;  4YBH B;  4YGA A;  4I2Y A;  2A52 B;  1YHH A;  2IOV A;  1M46 A;  1PK0 D;  4W6M A;  3ED8 A;  2H61 C;  2VVI A;  3OB1 B;  5AAN A;  3WLD A;  1TTX A;  4DXO A;  4W76 A;  3NSI A;  1WRZ A;  1YZW A;  2VVJ A;  2L4I A;  3DQD A;  1DGU A;  4HQC A;  1IWQ A;  3VRQ A;  1RMM A;  3CFH A;  4JEO A;  1JBA A;  3BXK A;  1A75 B;  4JGE A;  2ISD A;  1NCY A;  1YFP A;  1F71 A;  2M7L A;  2KI6 C;  2LMT A;  2QRF A;  1NX3 A;  3DQH A;  1MOV A;  4KF5 C;  4MSP A;  3CFA A;  5FVG A;  5F6T A;  1S1E A;  5BPJ A;  1RJV A;  1E8A A;  5DQB A;  2DOQ A;  4KEX A;  1JBZ A;  1F70 A;  5DKQ A;  1XFX O;  4ORC B;  3C1V A;  2GGZ A;  1EML A;  2C9J A;  2K0J A;  4F0Z B;  5KU1 A;  1X02 A;  2GW4 B;  3LVA A;  1K93 D;  2QPT A;  4GGF C;  1S26 D;  3OSQ A;  3A8S A;  1QVI Z;  4I5L B;  2L51 A;  2FOT A;  4CFR A;  1G33 A;  4GBA A;  5J3X A;  4U8D A;  5K89 A;  4LJC A;  1KFU L;  1CTR A;  1XA9 A;  2A56 B;  4H3M A;  5H88 A;  2PXS A;  4YGC B;  3FS7 A;  3HCM A;  3SVE A;  4MLW A;  4PPJ A;  3V3D A;  4L9M A;  3CBE A;  2G3O A;  3ADF A;  4KAG A;  1S6I A;  3I5H C;  4W6B A;  2M49 B;  1KK8 C;  4XGY A;  3M24 A;  5ER4 X;  2K2A A;  4W6I A;  1HT9 A;  2F3Y A;  1J7Q A;  1IKU A;  2G2S B;  1KP5 A;  3I5H B;  2WIQ A;  4W7F A;  3BXA A;  3G9A A;  1KK8 B;  1FW4 A;  1LIN A;  1XFU O;  2L50 A;  4HRG A;  4OV2 A;  2HF5 A;  1VRK A;  1OE9 B;  2Z6Z A;  2JXL A;  2WIS A;  1MR8 A;  1UP5 A;  1SY9 A;  3DQL A;  4FTG A;  2M7N A;  3FWB A;  2M3W A;  1DJH A;  2P4M A;  3CZT X;  2LVJ A;  2PRU A;  3BUO B;  1TNP A;  1GQM A;  1K94 A;  4GNK B;  2O2B A;  4W6O A;  4H3N A;  2L2E A;  3BOW B; 
#chains in the Genus database with same CATH topology
 4KGF A;  1IJ5 A;  3EVV A;  4J89 A;  4ZIN A;  2PQL A;  2Z1O A;  1LA0 A;  4PT1 A;  2P70 A;  1BLQ A;  2CNP A;  2ERB A;  5DY6 A;  1EJ3 A;  2LP2 A;  1WY9 A;  4KW4 A;  4R1E A;  1WRK A;  1F4Q A;  3BQ3 A;  1RM9 A;  4GAO A;  1QAS A;  2WCB A;  1EL4 A;  4JFG A;  1XMZ A;  2KAY A;  1DC1 A;  2RGI A;  2Z6X A;  3CB9 A;  1SBJ A;  1C07 A;  2VVH A;  3I5G C;  1NX0 A;  2BEC A;  1ODB A;  3SVS A;  1FPW A;  4W6S A;  1YR5 A;  1UIS A;  2H8Q A;  1BU3 A;  1AJ5 A;  3TDZ A;  1ZOT B;  1BOC A;  1MUX A;  1YRU B;  1TNX A;  1K96 A;  2Y5I A;  4J8A A;  4N1F A;  1IJ6 A;  4LJB A;  1G8I A;  4ZF5 A;  1QJT A;  3OB2 B;  1BT6 A;  2ZO6 A;  3NED A;  2HGD A;  4PHN A;  1CDM A;  1DJI A;  4F7F A;  4OJ0 A;  1ZGQ A;  3RWA A;  1U5I A;  3LLE A;  1KWO C;  2QAC A;  1OMD A;  2OTE A;  4JF9 A;  1CKK A;  4W6F A;  2POX A;  1Q4B A;  5D7F A;  2L0P A;  3UG0 A;  5EHU A;  1HQV A;  4ZCV A;  3OHM B;  1DTL A;  4HVF A;  1TCO B;  1TCF A;  1KWO B;  4GPL B;  1W7U A;  3CZ2 A;  1OQP A;  1Y1X A;  3ST3 A;  5EB7 A;  2AWJ A;  3I5I C;  2QEH A;  4I5J A;  4DXP A;  2V4E C;  2ZN8 A;  1DF0 B;  1SL7 A;  3RM1 A;  4Z4K A;  2KQ6 A;  2LUX A;  1XQM A;  5TNC A;  1OMR A;  1K9K A;  5B8I B;  4AQI A;  2RH7 A;  1EXR A;  3TUY B;  2WCE A;  3I5I B;  1B8C A;  2V4E B;  2K60 A;  1F4O A;  3SVR A;  2TN4 A;  4JPZ B;  4W7A A;  4YGD B;  2VZX A;  3DQK A;  1ZFS A;  2BBN A;  5HGE A;  5I2Q A;  2AHA A;  3D76 A;  2K7O A;  5HKZ A;  3U0M A;  4DXQ A;  2H5O A;  4P1Q A;  3DVM A;  3DY9 A;  3NT3 A;  3B87 A;  3SG4 A;  1QAT A;  1ZGO A;  1KFX S;  2DUE A;  1C3Z A;  1G4Y R;  1S5G Y;  1GGW A;  2MAZ A;  3OGN A;  1A4P A;  2KYC A;  4ETO A;  3DQJ A;  2JPT A;  2KLE A;  3DVK A;  1QX7 A;  1Y0V H;  1S6C A;  3PM8 A;  5HL1 A;  1CDN A;  2F2P A;  3BUW B;  5HLV A;  2E6W A;  1RRX A;  4FQT A;  4IL1 A;  4XVP A;  3ZNI A;  1BR1 B;  5BTT A;  2AWL A;  1ZGP A;  3GL4 A;  1KK7 Y;  3SS3 A;  3ZUL A;  4Q7U A;  4N3D A;  1W9Z A;  3CGA A;  4BY5 A;  2Y1M A;  1EMB A;  1SCM B;  1M31 A;  3CGL A;  5GQQ C;  1NWD A;  5FYX A;  4W6L A;  3DF0 B;  2IS9 A;  2BE6 A;  2IE2 A;  4DKM A;  1EMC A;  2FCD A;  1LXF C;  3DQ4 A;  1QYF A;  4DRW A;  1SKT A;  2F33 A;  2JUL A;  3NXA A;  4EN1 A;  2JWW A;  1TOP A;  2JTT A;  2WC5 A;  1YUS A;  4DCK A;  1YUT A;  3DQ1 A;  4N1G A;  1XSS A;  4JKT A;  3CD9 A;  1DT7 B;  1CLB A;  3CS1 A;  1YX8 A;  4Q7T A;  4ZF4 A;  2LCP A;  2R2I A;  2V53 A;  1KSO A;  1K2H A;  1K9P A;  4W6U A;  2MBX A;  1QYO A;  3CR5 X;  3KHE A;  4XOV A;  3CTN A;  3GJ1 A;  2JZI A;  1CV7 A;  2Y4Q A;  4H3L A;  4UPG A;  3SVC A;  5DIC A;  3SS4 A;  1M63 B;  1IQ5 A;  3ZUJ A;  1NSH A;  2ZND A;  3K21 A;  2WSN A;  2I2R E;  3PJ5 A;  2CT9 A;  3VIC A;  3O6B A;  2KSP A;  4W6A A;  4ORN A;  3WXA A;  2VRG A;  1KYP A;  3SSL A;  1PUL A;  1MOU A;  2BKH B;  1OXF A;  2CXJ A;  2LHL A;  3I5F C;  3R1P A;  1CMG A;  4M2Q A;  4HRE E;  1Z4H A;  4DXI A;  3BX9 A;  4H48 A;  5LTP A;  2JPO A;  3P28 A;  4W6D A;  1EMG A;  5D3O A;  1DEK A;  3DQ3 A;  2K7C A;  5DKN A;  3U0K A;  3I5F B;  1UHI A;  4YGE B;  3D10 A;  2H9W A;  1SK6 D;  5KTG A;  3SRY A;  2GGM A;  5HZU A;  1NCZ A;  5EL2 A;  1F09 A;  1BOD A;  1ZAC A;  3BXC A;  3SIA A;  4RYS A;  5HYD A;  2HQK A;  2JXC A;  3EG5 B;  3FE9 A;  1XO5 A;  1EG4 A;  1F55 A;  2Y1N A;  2DUG A;  3DQ9 A;  4NWS A;  2QDI A;  3VRP A;  1YHI A;  5PAL A;  1B7T Z;  2HQ8 A;  3DQE A;  3VHT A;  4YI9 A;  1Q4D A;  2BCX A;  3OP0 A;  3EKH A;  2VAE A;  3CZ1 A;  3UO9 A;  1LS8 A;  3LVC A;  1SMG A;  3U8C A;  1CLL A;  2CCM A;  1LA3 A;  5IBW A;  1RFJ A;  3JTD C;  3O2P A;  3V2L A;  1WRL A;  1H8B A;  2BTJ A;  2KI4 C;  4Z4M A;  4W6N A;  3SJS A;  1BG1 A;  3PN7 C;  1Q4A A;  2ARL A;  1Y1A A;  2K2F A;  3L4L A;  3SV5 A;  5LTQ A;  3SSP A;  3JTD B;  1YX7 A;  2F8P A;  2KI4 B;  4PE4 A;  5EB6 A;  4XJK A;  4C0J A;  1XK4 C;  1CLM A;  3DZT A;  4C0K A;  1W7T A;  2L5X B;  4PHK A;  1H4U A;  5BT0 A;  4ICB A;  1NCX A;  1A29 A;  1UHK A;  5CPV A;  4W7X A;  1PAL A;  1CNP A;  2O60 A;  2DD7 A;  1PRW A;  1YVH A;  3AI4 A;  1OSA A;  2GV5 A;  1J7P A;  1CFP A;  1QVI Y;  1AP4 A;  4GOB A;  1KSM A;  1C7V A;  2G6X A;  1XK4 A;  4ZCU A;  2H6V A;  1BR4 B;  3K1E A;  4B5Y A;  1B9C A;  4HQ9 A;  3OSR A;  5DTX A;  2KFH A;  4JRB A;  2O24 A;  1AK8 A;  1B9A A;  2KPH A;  1ALV A;  2JNF A;  1AVS A;  2M0R A;  4DXM A;  1QXT A;  1F54 A;  3EK7 A;  3EKJ A;  3PJI A;  1IH0 A;  2K7B A;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2JQ6 A;  3BJH A;  3PJB A;  3DVE A;  3F45 A;  1FI6 A;  1Z2C B;  4USL A;  1UHJ A;  4AOM A;  2CTN A;  4QJ4 B;  5HW9 A;  3O78 A;  1AJ4 A;  2HRS A;  4MVF A;  2B3P A;  1GGZ A;  1CDP A;  4MZL A;  1Z1P A;  1MWN A;  3NT9 A;  2PXW A;  4R6D A;  1MHO A;  3VRR A;  1KCY A;  3SVU A;  2AWK A;  1CFC A;  2FJY A;  2CBL A;  4DUQ A;  3W1D A;  2ZFD A;  2MRD A;  3PAL A;  3CWG A;  2H5Q A;  1CM1 A;  2OKW A;  3GK2 A;  4MBE A;  2YE1 A;  2ZMU A;  1JSA A;  2G9B A;  1Z1Q A;  1GM0 A;  3DQN A;  3DQ5 A;  3DPX A;  4L13 A;  2M97 A;  3DQM A;  1C3Y A;  3NSL A;  1JC1 A;  1EH2 A;  2HQW A;  2LMU A;  1BFP A;  4DS7 A;  1JC0 A;  2F3Z A;  3Q8I A;  4LW5 A;  1EMA A;  4FQO A;  3WHU B;  3SG7 A;  1CFF A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  5DTZ A;  4OGS A;  2QU1 A;  3DVJ A;  1QS7 A;  1QY3 A;  1SR6 C;  3DQU A;  2DDD A;  5FVF A;  3VK1 A;  2H8V A;  5KSZ A;  1EME A;  4IK5 A;  3SSY A;  1K95 A;  4W6G A;  1L2O C;  5CSI A;  1Q73 A;  1QYQ A;  2YGU A;  4EUL A;  1XFY O;  4WQ2 A;  1SR6 B;  1AHR A;  2LMV A;  1U5I B;  3I5G B;  5HZS A;  2FWQ A;  3E5T A;  2AUC A;  1N0Y A;  5JJG A;  3H4S E;  3CR2 A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4IK9 A;  3DQ2 A;  4IK1 A;  2BL0 C;  4J88 A;  3ST0 A;  2MLF C;  3WNX B;  1YTZ C;  4CPV A;  3D0Y A;  2G3D B;  2NLN A;  2WCH A;  3LL8 B;  4RYW A;  3SVN A;  3M0W A;  3TMT A;  1DVI A;  2BL0 B;  1V1G A;  3CFF A;  2H5P A;  3IVT A;  4LQT A;  4LJD A;  2A46 A;  2WOS A;  3DD4 A;  2QT2 A;  1XFR A;  3DQO A;  5AFP A;  1WDC C;  3SSH A;  1W7I B;  2WCM A;  3S0E A;  4W6K A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  2FZU A;  4PFE A;  1F0B A;  1GGX A;  1TNQ A;  4B30 A;  3LA1 A;  4HQ8 A;  2PAL A;  3B6X A;  2JC2 A;  1RMO A;  4E68 A;  3NHT A;  1WDC B;  1D1O A;  3BFA A;  1SL9 A;  1XAE A;  1WLM A;  2ZMW A;  4AR7 A;  2KBI A;  1YUR A;  4L1I A;  2WHS A;  4U2V A;  4QJ5 B;  2OPO A;  2WUR A;  3R72 A;  2LE9 B;  5T3I A;  3W1C A;  4N5X A;  1OZO A;  2DUF A;  3BYA A;  4I5N B;  3ST4 A;  3B86 A;  1TUZ A;  3H1R A;  1QX2 A;  2BNX A;  3KCS A;  3S0D A;  3FE8 A;  2ZNE A;  2A4J A;  2Q4U A;  2WHU A;  3ZWH A;  1T14 A;  1QV0 A;  1NX1 A;  4OQW A;  4W6C A;  2AMI A;  2LUC A;  4R6B A;  3S0G A;  2M9G A;  5DRG A;  5BTT B;  4YI8 A;  2KQY A;  3O77 A;  2WCJ A;  3KCT A;  1FI5 A;  1RWY A;  1UHH A;  2KBM A;  5DPG A;  2COL B;  4GES B;  5EXC I;  3IQO A;  3SIB A;  5HBD A;  1RMP A;  3AI5 A;  2MHH A;  4W6H A;  1QTX A;  4CFQ A;  3KO0 A;  1J7R A;  2ZO7 A;  1Q4C A;  2Q57 A;  5EJU A;  3ZUF A;  2JRF A;  3FWC A;  1MF8 B;  3U0N A;  1XFW O;  4MN0 A;  3TMR A;  1XFZ O;  4OHS A;  1K8U A;  2LVI A;  4KPI A;  2A47 A;  1OOI X;  2WND A;  4P76 A;  3FIA A;  3DQI A;  5I2L A;  1BMO A;  1C7W A;  3PFV A;  2HJO A;  2Y0G A;  3EVU A;  3GK4 X;  1RRO A;  2QEO A;  3U8A A;  2GX0 A;  3M22 A;  3S0B A;  3IQQ A;  3H1O A;  1WLZ A;  4YGB B;  2WSO A;  3DPZ A;  5DKR A;  1UUR A;  2LVV A;  3SS0 A;  3KEV A;  4MZJ A;  2KAV A;  5CSN A;  2C9I A;  2LVK A;  5H87 A;  1QXP A;  2LHI A;  2VAD A;  1J7O A;  3KF9 A;  3TDU A;  5I2O A;  4AQJ A;  2DUI A;  4PE7 A;  2SAS A;  1UWO A;  3E5W A;  4P2Y B;  3BUN B;  2NCO A;  2JOJ A;  5G08 A;  5HLO A;  3SG3 A;  2FL1 A;  5HZT A;  4PE0 A;  3AAJ A;  3U8P A;  3AKB A;  2LAP A;  1OOG A;  2LAN A;  1HUY A;  3PAT A;  2HET A;  3JVT C;  5H89 A;  3SG2 A;  2B3Q A;  1CMF A;  2KGR A;  1JFK A;  2KNE A;  1JWD A;  3CYZ A;  1OOF A;  2LC5 A;  1CFD A;  1B1G A;  4HE4 A;  3E3R A;  1OW4 A;  2G5Z B;  2PSR A;  3LF3 A;  2ZRS A;  3N7H A;  3JVT B;  4JWQ A;  2JT0 A;  4DXN A;  1GL4 A;  2EHB A;  5F9G A;  2M8U A;  1G7K A;  4W75 A;  2FJU B;  4NDC A;  1JBY A;  3OBV A;  3DQ6 A;  3CD1 A;  3D78 A;  1R2U A;  1CB1 A;  3A8R A;  1ZUZ A;  2QZ0 A;  1C4F A;  4OCI A;  5FI6 A;  3BXB A;  1JUO A;  3OGO A;  4TZG A;  4CLN A;  2KYF A;  3GB3 A;  3L4A A;  2PAS A;  3SVB A;  2EC6 C;  3IR8 A;  2BCA A;  5I94 A;  4W6R A;  1S36 A;  2BAP A;  2AH8 A;  3VHT B;  1LKJ A;  2A54 B;  2BCB A;  2AAO A;  1TNW A;  1S3P A;  2MA2 A;  2EC6 B;  2H61 A;  1AUI B;  3NSK A;  1JFJ A;  2H2K A;  2Z6Y A;  5HKY A;  4ZF3 A;  1EMM A;  1A75 A;  1OOH A;  1SYM A;  2DUH A;  1DJZ A;  1H4B A;  2YE0 A;  2O5G A;  3DQC A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  4BDU A;  4W7C A;  1NX2 A;  4XYN A;  4LQU A;  1EMF A;  1HCJ A;  2MLE C;  4M2O A;  4KW9 A;  1SPY A;  1B47 A;  1CDL A;  4XJK B;  2JTZ A;  2KGB C;  1OXE A;  4EDS A;  2NCP A;  1YJ2 A;  4H47 A;  3LS3 A;  1ALW A;  3TS5 C;  1N65 A;  1FF1 A;  5EXB A;  3IP2 A;  2GW3 A;  3LCP C;  1B7T Y;  3PN7 B;  3DPW A;  1LVC D;  3R1V A;  1J1E A;  2GX2 A;  4AS8 A;  1NUB A;  4KF5 A;  1S6J A;  4PPL A;  2OJK A;  3RLZ A;  3WHT B;  3TS5 B;  5I8N A;  3SSK A;  4INW A;  1BJF A;  3K1K A;  3AKO A;  4C0L A;  2JT8 A;  3NF0 A;  1Q80 A;  4NDD A;  4TZA A;  3A4U B;  4GGF A;  1Y1U A;  5FVI A;  3MSE B;  3TZ1 A;  1ZUX A;  2HQZ A;  1GJY A;  4Q7R A;  2EMD A;  1DJG A;  2BKI B;  5AQB B;  4ANJ A;  1W7S A;  5J2O A;  5AXI A;  4PHJ A;  3SS5 A;  1DEL A;  1REC A;  2OGR A;  5AER A;  2WOR A;  4W69 A;  2YFP A;  2B1U A;  1NIW A;  3AAK A;  1EMK A;  4WQ3 A;  4W6J A;  2QLI A;  5HKW A;  5DPI A;  4EDO A;  2HCG A;  5ER5 A;  3O4X A;  4OZD A;  4ZIO A;  3LVD A;  3LSA A;  3S0F A;  2OS8 C;  2JAD A;  2HPS A;  5FI2 A;  3BUM B;  2OTB A;  3GEX A;  3SVD A;  2JU0 A;  1B8L A;  5DPJ A;  1QIV A;  3SVO A;  1ORG A;  3SG5 A;  1PSR A;  2OS8 B;  3ICB A;  1JF0 A;  1H6R A;  3LK0 A;  2A50 B;  2KFG A;  4IZN A;  4Q9W A;  1A2X A;  3TDI A;  3OX6 A;  3P8U A;  4ORA B;  5EBJ A;  5D69 A;  4MZK A;  3DQF A;  4EMQ A;  2L2C A;  3BUX B;  1IRJ A;  2WHT A;  2A48 A;  4W6T A;  3BOW A;  1YVL A;  4PHM A;  2G6E A;  1CM4 A;  5LTR A;  1DQE A;  4PDZ A;  4A4C A;  2D8N A;  4W73 A;  1RTP 1;  2JT3 A;  3PIB A;  3S05 A;  4ORB B;  3PLF B;  2PYQ A;  1DJX A;  5FHV A;  1FBV A;  2KDH A;  4MRY A;  1Y6W A;  4IK4 A;  2QLE A;  3PJ7 A;  4W7R A;  5FI7 A;  1OXD A;  1MYW A;  2ICR A;  4ZBL A;  4CID A;  2LM5 A;  4GF6 B;  1S6Z A;  4W72 A;  3GJ2 A;  1N2D A;  2HPW A;  1YJF A;  3D0Y B;  3QRX A;  4IK3 A;  1XA5 A;  2QLG B;  1L2O B;  3EK8 A;  1UHN A;  4LJD C;  3U0L A;  1IQ3 A;  2L98 A;  4IK8 A;  2ZKM X;  2DDC A;  4NDB A;  2LLS A;  2FCE A;  4WRI A;  2QLG A;  2BBM A;  4D1E A;  5CSF A;  1DGV A;  3KPX A;  4Q04 A;  3OX5 A;  4KF4 A;  2AWM A;  2WC8 A;  2PVB A;  4W6P A;  5DPH A;  2OKY A;  1QX5 B;  2DD9 A;  3DQ8 A;  1TUJ A;  4W74 A;  2G6Y A;  2IB6 A;  4KGE A;  1QV1 A;  2OTG C;  2M29 A;  2K61 A;  4W77 A;  1KFX L;  3TUY C;  4B30 B;  2ZN9 A;  2A53 B;  5HZO A;  3RWT A;  2KFF A;  3NEZ A;  1DF0 A;  1QIW A;  2OTG B;  3SG6 A;  2NXQ A;  1PVA A;  1S5G Z;  3ZTF A;  4YRU A;  1XYD A;  3I19 A;  3LF4 B;  1Q4E A;  3L47 A;  1MXE A;  3B88 A;  2V4E A;  4JQ0 D;  2G16 B;  3ST2 A;  4PE1 A;  5JOL A;  2LV7 A;  4L12 A;  4HRH A;  5LK4 A;  1L7Z A;  3SSV A;  3EVR A;  3D73 A;  3EVP A;  1SL8 A;  2L4H A;  2Q91 A;  5EXU A;  1KK7 Z;  2EGD A;  2IB5 A;  4KW8 A;  4P5O E;  5DQM A;  1K90 D;  3GK1 A;  2G2B A;  2ZRT A;  2I18 A;  3PM2 A;  1DJY A;  2P6B B;  5KTY A;  3NGV A;  4A4B A;  2PMY A;  4PAL A;  2QEV A;  1GFL A;  2KHN A;  2F2O A;  3CZ0 A;  2WC6 A;  2K7D A;  3CR4 X;  3GOF A;  3D74 A;  3S0A A;  1M39 A;  3HX4 A;  5DTY A;  1KQV A;  1MXL C;  4DKN A;  4MRX A;  1SCM C;  1B4C A;  3VRO A;  2E30 A;  2KLD A;  2KOT A;  2EMO A;  1NYA A;  3VRN A;  2H5R A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  4W7E A;  3WCK A;  3IF7 A;  2WCF A;  2LP3 A;  1KYR A;  4XOW A;  2K8M B;  3VB1 A;  1K9U A;  2M1K B;  2Q6P A;  1MQ1 A;  4ZB1 A;  1TWO A;  3DQA A;  5CSJ A;  4PCW A;  2JNX A;  1A03 A;  1RK9 A;  5BQL A;  4XL5 A;  2KI6 D;  1OMV A;  4GFT A;  3RZS A;  1SRA A;  1M45 A;  4PPK A;  2KAX A;  3DF0 A;  1NP8 A;  2SCP A;  2QEB A;  2I94 A;  3D77 A;  2QLH A;  3LK1 A;  1DJW A;  4KA9 A;  1DMO A;  3O4Y A;  3NSO A;  4Q9X A;  1TIZ A;  2LNK A;  3DYE A;  1IGV A;  4ZFS A;  1F8H A;  3DXL A;  2LLT A;  3WLC A;  3SST A;  2EMN A;  1YUU A;  1PVB A;  1KQM C;  4JC2 A;  4GUK A;  1SNL A;  5DTL A;  3B7A A;  4IJ7 A;  3CLN A;  1SW8 A;  1YHG A;  1TN4 A;  1SSE B;  3DQ7 A;  1YRT B;  4DIR A;  3VGO A;  4NQG A;  4OY4 A;  1IG5 A;  1UUS A;  1SCV A;  2HFC A;  4MEW A;  1JC2 A;  4W7D A;  1B8R A;  2YDZ A;  4RTC A;  1KQM B;  3AKA A;  1QLK A;  3MGF A;  4OR9 B;  4HSZ A;  1KYS A;  4OVN F;  3E5V A;  4QJ3 B;  4GGN A;  4UTS A;  1J1D A;  4M2P A;  1TRF A;  1ZMZ A;  2O29 A;  1EG3 A;  4TNC A;  5DU0 A;  1QLS A;  3CAB A;  1P28 A;  3R1O A;  5DRF A;  1R6P A;  2HGY A;  3UFZ A;  4YBH B;  4YGA A;  1IIO A;  4I2Y A;  2A52 B;  1YHH A;  2IOV A;  1M46 A;  1PK0 D;  4W6M A;  3ED8 A;  2H61 C;  2VVI A;  3OB1 B;  5AAN A;  3WLD A;  1TTX A;  4DXO A;  4W76 A;  3NSI A;  4INX A;  1WRZ A;  1YZW A;  2VVJ A;  2L4I A;  3DQD A;  1DGU A;  4HQC A;  1IWQ A;  3VRQ A;  1RMM A;  3CFH A;  4JEO A;  3BFH A;  1JBA A;  3BXK A;  1A75 B;  4JGE A;  2ISD A;  1NCY A;  1YFP A;  1F71 A;  2M7L A;  2KI6 C;  2LMT A;  2QRF A;  1NX3 A;  3DQH A;  1MOV A;  4KF5 C;  4MSP A;  3CFA A;  5FVG A;  5F6T A;  1S1E A;  5BPJ A;  1RJV A;  1E8A A;  2GTE A;  5DQB A;  2DOQ A;  4KEX A;  1JBZ A;  3BFB A;  3D75 A;  1F70 A;  5DKQ A;  2P71 A;  1XFX O;  4ORC B;  3C1V A;  2GGZ A;  1EML A;  2C9J A;  2K0J A;  4F0Z B;  5KU1 A;  1X02 A;  2GW4 B;  4JD9 A;  3LVA A;  1K93 D;  2QPT A;  4GGF C;  3CDN A;  1S26 D;  3OSQ A;  3A8S A;  1QVI Z;  4I5L B;  2L51 A;  4KYN A;  3QME A;  2FOT A;  4CFR A;  1G33 A;  4GBA A;  5J3X A;  4U8D A;  5K89 A;  4LJC A;  1KFU L;  1CTR A;  1XA9 A;  2A56 B;  4H3M A;  5H88 A;  2PXS A;  4YGC B;  3FS7 A;  3HCM A;  3SVE A;  4MLW A;  4PPJ A;  3V3D A;  2WCK A;  4L9M A;  3NHI A;  3CBE A;  2G3O A;  3ADF A;  4KAG A;  1S6I A;  3I5H C;  4W6B A;  2L5Y A;  2M49 B;  1KK8 C;  4XGY A;  3M24 A;  5ER4 X;  2K2A A;  4W6I A;  1HT9 A;  2F3Y A;  1J7Q A;  1IKU A;  2G2S B;  1KP5 A;  3I5H B;  2WIQ A;  4W7F A;  3BXA A;  3G9A A;  1KK8 B;  1FW4 A;  1LIN A;  1XFU O;  2L50 A;  4HRG A;  4OV2 A;  2HF5 A;  1VRK A;  1OE9 B;  2Z6Z A;  2JXL A;  2WIS A;  1MR8 A;  1UP5 A;  1SY9 A;  3DQL A;  4FTG A;  2M7N A;  2WCL A;  3FWB A;  2M3W A;  1DJH A;  2P4M A;  3CZT X;  2LVJ A;  3FE6 A;  2PRU A;  1QWV A;  3BUO B;  3UNW A;  1TNP A;  1GQM A;  1K94 A;  4GNK B;  2O2B A;  4W6O A;  4H3N A;  2L2E A;  3BOW B; 
#chains in the Genus database with same CATH homology
 4KGF A;  1IJ5 A;  3EVV A;  4J89 A;  4ZIN A;  2Z1O A;  1LA0 A;  1BLQ A;  2CNP A;  5DY6 A;  1EJ3 A;  2LP2 A;  1WY9 A;  4KW4 A;  4R1E A;  1WRK A;  1F4Q A;  3BQ3 A;  1RM9 A;  4GAO A;  1QAS A;  2WCB A;  1EL4 A;  4JFG A;  1XMZ A;  2KAY A;  2RGI A;  2Z6X A;  3CB9 A;  1SBJ A;  1C07 A;  2VVH A;  3I5G C;  1NX0 A;  2BEC A;  1ODB A;  3SVS A;  1FPW A;  4W6S A;  1YR5 A;  1UIS A;  2H8Q A;  1BU3 A;  1AJ5 A;  3TDZ A;  1ZOT B;  1BOC A;  1MUX A;  1YRU B;  1TNX A;  1K96 A;  2Y5I A;  4J8A A;  4N1F A;  1IJ6 A;  4LJB A;  1G8I A;  4ZF5 A;  1QJT A;  3OB2 B;  1BT6 A;  2ZO6 A;  3NED A;  2HGD A;  4PHN A;  1CDM A;  1DJI A;  4OJ0 A;  1ZGQ A;  3RWA A;  1U5I A;  3LLE A;  1KWO C;  2QAC A;  1OMD A;  2OTE A;  4JF9 A;  1CKK A;  4W6F A;  2POX A;  1Q4B A;  5D7F A;  2L0P A;  3UG0 A;  5EHU A;  1HQV A;  4ZCV A;  3OHM B;  1DTL A;  4HVF A;  1TCO B;  1TCF A;  1KWO B;  4GPL B;  1W7U A;  1OQP A;  1Y1X A;  3ST3 A;  5EB7 A;  2AWJ A;  3I5I C;  4I5J A;  4DXP A;  2V4E C;  2ZN8 A;  1DF0 B;  1SL7 A;  3RM1 A;  4Z4K A;  2KQ6 A;  2LUX A;  1XQM A;  5TNC A;  1OMR A;  1K9K A;  5B8I B;  4AQI A;  2RH7 A;  1EXR A;  3TUY B;  2WCE A;  3I5I B;  1B8C A;  2V4E B;  1F4O A;  3SVR A;  2TN4 A;  4JPZ B;  4W7A A;  4YGD B;  2VZX A;  3DQK A;  1ZFS A;  2BBN A;  5HGE A;  5I2Q A;  2AHA A;  2K7O A;  5HKZ A;  3U0M A;  4DXQ A;  2H5O A;  4P1Q A;  3DVM A;  3NT3 A;  3SG4 A;  1QAT A;  1ZGO A;  1KFX S;  2DUE A;  1G4Y R;  1S5G Y;  1GGW A;  2MAZ A;  1A4P A;  2KYC A;  4ETO A;  3DQJ A;  2JPT A;  3DVK A;  1QX7 A;  1Y0V H;  1S6C A;  3PM8 A;  1CDN A;  2F2P A;  3BUW B;  5HLV A;  2E6W A;  1RRX A;  4IL1 A;  4XVP A;  3ZNI A;  1BR1 B;  5BTT A;  2AWL A;  1ZGP A;  3GL4 A;  1KK7 Y;  3ZUL A;  4Q7U A;  4N3D A;  3CGA A;  4BY5 A;  2Y1M A;  1EMB A;  1SCM B;  1M31 A;  3CGL A;  5GQQ C;  1NWD A;  5FYX A;  4W6L A;  3DF0 B;  2IS9 A;  2BE6 A;  2IE2 A;  4DKM A;  1EMC A;  2FCD A;  1LXF C;  3DQ4 A;  1QYF A;  4DRW A;  1SKT A;  2F33 A;  2JUL A;  3NXA A;  4EN1 A;  2JWW A;  1TOP A;  2JTT A;  1YUS A;  4DCK A;  1YUT A;  3DQ1 A;  4N1G A;  1XSS A;  3CD9 A;  1DT7 B;  1CLB A;  3CS1 A;  1YX8 A;  4Q7T A;  4ZF4 A;  2LCP A;  2R2I A;  2V53 A;  1KSO A;  1K2H A;  1K9P A;  4W6U A;  2MBX A;  1QYO A;  3CR5 X;  3KHE A;  4XOV A;  3CTN A;  3GJ1 A;  2JZI A;  1CV7 A;  2Y4Q A;  4H3L A;  4UPG A;  3SVC A;  1M63 B;  1IQ5 A;  3ZUJ A;  1NSH A;  2ZND A;  3K21 A;  2WSN A;  2I2R E;  3PJ5 A;  2CT9 A;  3VIC A;  3O6B A;  2KSP A;  4W6A A;  4ORN A;  3WXA A;  2VRG A;  1KYP A;  3SSL A;  1PUL A;  1MOU A;  2BKH B;  1OXF A;  2CXJ A;  2LHL A;  3I5F C;  1CMG A;  4M2Q A;  4HRE E;  4DXI A;  3BX9 A;  4H48 A;  5LTP A;  3P28 A;  4W6D A;  1EMG A;  3DQ3 A;  2K7C A;  5DKN A;  3U0K A;  3I5F B;  1UHI A;  4YGE B;  3D10 A;  2H9W A;  1SK6 D;  5KTG A;  3SRY A;  2GGM A;  5HZU A;  1NCZ A;  1F09 A;  1BOD A;  1ZAC A;  3BXC A;  3SIA A;  4RYS A;  5HYD A;  2HQK A;  2JXC A;  1XO5 A;  1EG4 A;  1F55 A;  2Y1N A;  2DUG A;  3DQ9 A;  4NWS A;  3VRP A;  1YHI A;  5PAL A;  1B7T Z;  2HQ8 A;  3DQE A;  3VHT A;  4YI9 A;  1Q4D A;  2BCX A;  3OP0 A;  3EKH A;  2VAE A;  3LVC A;  1SMG A;  3U8C A;  1CLL A;  2CCM A;  1LA3 A;  5IBW A;  1RFJ A;  3JTD C;  3O2P A;  1WRL A;  1H8B A;  2BTJ A;  2KI4 C;  4Z4M A;  4W6N A;  3SJS A;  1BG1 A;  3PN7 C;  1Q4A A;  2ARL A;  1Y1A A;  2K2F A;  3SV5 A;  5LTQ A;  3SSP A;  3JTD B;  1YX7 A;  2F8P A;  2KI4 B;  4PE4 A;  5EB6 A;  4XJK A;  4C0J A;  1XK4 C;  1CLM A;  4C0K A;  1W7T A;  2L5X B;  4PHK A;  1H4U A;  5BT0 A;  4ICB A;  1NCX A;  1A29 A;  1UHK A;  5CPV A;  4W7X A;  1PAL A;  1CNP A;  2O60 A;  2DD7 A;  1PRW A;  1YVH A;  3AI4 A;  1OSA A;  2GV5 A;  1J7P A;  1CFP A;  1QVI Y;  1AP4 A;  4GOB A;  1KSM A;  1C7V A;  2G6X A;  1XK4 A;  4ZCU A;  2H6V A;  1BR4 B;  4B5Y A;  1B9C A;  4HQ9 A;  3OSR A;  5DTX A;  2KFH A;  4JRB A;  2O24 A;  1AK8 A;  1B9A A;  1ALV A;  2JNF A;  1AVS A;  2M0R A;  4DXM A;  1QXT A;  1F54 A;  3EK7 A;  3EKJ A;  1IH0 A;  2K7B A;  2I7A A;  4I5K A;  2NZ0 A;  1KFU S;  2JQ6 A;  3PJB A;  3DVE A;  3F45 A;  1FI6 A;  4USL A;  1UHJ A;  4AOM A;  2CTN A;  4QJ4 B;  5HW9 A;  3O78 A;  1AJ4 A;  2HRS A;  4MVF A;  2B3P A;  1GGZ A;  1CDP A;  4MZL A;  1Z1P A;  1MWN A;  3NT9 A;  2PXW A;  4R6D A;  1MHO A;  3VRR A;  1KCY A;  3SVU A;  1CFC A;  2AWK A;  2CBL A;  4DUQ A;  3W1D A;  2ZFD A;  2MRD A;  3PAL A;  3CWG A;  2H5Q A;  1CM1 A;  2OKW A;  3GK2 A;  4MBE A;  2YE1 A;  2ZMU A;  1JSA A;  2G9B A;  1Z1Q A;  3DQN A;  3DQ5 A;  3DPX A;  4L13 A;  2M97 A;  3DQM A;  3NSL A;  1JC1 A;  1EH2 A;  2HQW A;  2LMU A;  1BFP A;  4DS7 A;  1JC0 A;  2F3Z A;  4LW5 A;  1EMA A;  4FQO A;  3WHU B;  3SG7 A;  1CFF A;  4BY4 A;  1JF2 A;  1NPQ A;  3PSR A;  5DTZ A;  4OGS A;  2QU1 A;  3DVJ A;  1QS7 A;  1QY3 A;  1SR6 C;  3DQU A;  2DDD A;  5FVF A;  3VK1 A;  5KSZ A;  1EME A;  4IK5 A;  3SSY A;  1K95 A;  4W6G A;  1L2O C;  5CSI A;  1Q73 A;  1QYQ A;  4EUL A;  1XFY O;  4WQ2 A;  1SR6 B;  1AHR A;  2LMV A;  1U5I B;  3I5G B;  5HZS A;  2FWQ A;  3E5T A;  2AUC A;  1N0Y A;  5JJG A;  3H4S E;  3CR2 A;  1V1F A;  1J55 A;  2M1U A;  3EK4 A;  4IK9 A;  3DQ2 A;  4IK1 A;  2BL0 C;  4J88 A;  3ST0 A;  2MLF C;  3WNX B;  1YTZ C;  4CPV A;  3D0Y A;  2G3D B;  2NLN A;  3LL8 B;  4RYW A;  3SVN A;  3M0W A;  3TMT A;  1DVI A;  2BL0 B;  1V1G A;  3CFF A;  2H5P A;  4LQT A;  4LJD A;  2A46 A;  2WOS A;  3DD4 A;  2QT2 A;  3DQO A;  5AFP A;  1WDC C;  3SSH A;  1W7I B;  4W6K A;  1XFV O;  1OZS A;  2MJW B;  1OOJ A;  2FZU A;  4PFE A;  1F0B A;  1GGX A;  1TNQ A;  4B30 A;  3LA1 A;  4HQ8 A;  2PAL A;  2JC2 A;  1RMO A;  4E68 A;  1WDC B;  1D1O A;  1SL9 A;  1XAE A;  1WLM A;  2ZMW A;  4AR7 A;  2KBI A;  1YUR A;  4L1I A;  2WHS A;  4U2V A;  4QJ5 B;  2OPO A;  2WUR A;  2LE9 B;  5T3I A;  3W1C A;  4N5X A;  1OZO A;  2DUF A;  3BYA A;  4I5N B;  3ST4 A;  3H1R A;  1QX2 A;  3KCS A;  2ZNE A;  2A4J A;  2Q4U A;  2WHU A;  3ZWH A;  1QV0 A;  1NX1 A;  4OQW A;  4W6C A;  2AMI A;  2LUC A;  4R6B A;  2M9G A;  5DRG A;  5BTT B;  4YI8 A;  2KQY A;  3O77 A;  3KCT A;  1FI5 A;  1RWY A;  1UHH A;  2KBM A;  5DPG A;  2COL B;  4GES B;  5EXC I;  3IQO A;  3SIB A;  5HBD A;  1RMP A;  3AI5 A;  2MHH A;  4W6H A;  1QTX A;  4CFQ A;  3KO0 A;  1J7R A;  2ZO7 A;  1Q4C A;  2Q57 A;  5EJU A;  3ZUF A;  2JRF A;  3FWC A;  1MF8 B;  3U0N A;  1XFW O;  4MN0 A;  3TMR A;  1XFZ O;  4OHS A;  1K8U A;  2LVI A;  4KPI A;  2A47 A;  2WND A;  4P76 A;  3FIA A;  3DQI A;  5I2L A;  1BMO A;  1C7W A;  3PFV A;  2HJO A;  2Y0G A;  3EVU A;  3GK4 X;  1RRO A;  3U8A A;  2GX0 A;  3M22 A;  3IQQ A;  3H1O A;  1WLZ A;  4YGB B;  2WSO A;  3DPZ A;  5DKR A;  1UUR A;  2LVV A;  3SS0 A;  3KEV A;  4MZJ A;  2KAV A;  5CSN A;  2C9I A;  2LVK A;  5H87 A;  1QXP A;  2LHI A;  2VAD A;  1J7O A;  3KF9 A;  3TDU A;  5I2O A;  4AQJ A;  2DUI A;  4PE7 A;  2SAS A;  1UWO A;  3E5W A;  4P2Y B;  3BUN B;  2NCO A;  2JOJ A;  5G08 A;  5HLO A;  3SG3 A;  2FL1 A;  5HZT A;  4PE0 A;  3AAJ A;  3U8P A;  3AKB A;  2LAP A;  2LAN A;  1HUY A;  3PAT A;  2HET A;  3JVT C;  5H89 A;  3SG2 A;  2B3Q A;  1CMF A;  2KGR A;  1JFK A;  2KNE A;  1JWD A;  2LC5 A;  1CFD A;  1B1G A;  4HE4 A;  3E3R A;  2G5Z B;  2PSR A;  3LF3 A;  2ZRS A;  3JVT B;  4JWQ A;  2JT0 A;  4DXN A;  1GL4 A;  2EHB A;  5F9G A;  2M8U A;  1G7K A;  4W75 A;  2FJU B;  4NDC A;  1JBY A;  3DQ6 A;  3CD1 A;  1R2U A;  1CB1 A;  3A8R A;  1ZUZ A;  2QZ0 A;  1C4F A;  4OCI A;  3BXB A;  1JUO A;  3OGO A;  4TZG A;  4CLN A;  2KYF A;  3GB3 A;  2PAS A;  3SVB A;  2EC6 C;  3IR8 A;  2BCA A;  4W6R A;  1S36 A;  2AH8 A;  3VHT B;  1LKJ A;  2A54 B;  2BCB A;  2AAO A;  1TNW A;  1S3P A;  2MA2 A;  2EC6 B;  2H61 A;  1AUI B;  3NSK A;  1JFJ A;  2H2K A;  2Z6Y A;  5HKY A;  4ZF3 A;  1EMM A;  1A75 A;  2DUH A;  1SYM A;  1DJZ A;  1H4B A;  2YE0 A;  2O5G A;  3DQC A;  1BF5 A;  1W7J B;  2LLU A;  1XVJ A;  4BDU A;  4W7C A;  1NX2 A;  4XYN A;  4LQU A;  1EMF A;  1HCJ A;  2MLE C;  4M2O A;  4KW9 A;  1SPY A;  1B47 A;  1CDL A;  4XJK B;  2JTZ A;  2KGB C;  1OXE A;  4EDS A;  2NCP A;  1YJ2 A;  4H47 A;  3LS3 A;  1ALW A;  3TS5 C;  1N65 A;  1FF1 A;  5EXB A;  3IP2 A;  2GW3 A;  3LCP C;  1B7T Y;  3PN7 B;  3DPW A;  1LVC D;  1J1E A;  2GX2 A;  4AS8 A;  1NUB A;  4KF5 A;  1S6J A;  4PPL A;  2OJK A;  3RLZ A;  3WHT B;  3TS5 B;  5I8N A;  3SSK A;  1BJF A;  3K1K A;  3AKO A;  4C0L A;  2JT8 A;  3NF0 A;  1Q80 A;  4NDD A;  4TZA A;  3A4U B;  4GGF A;  1Y1U A;  5FVI A;  3MSE B;  3TZ1 A;  1ZUX A;  2HQZ A;  1GJY A;  4Q7R A;  2EMD A;  1DJG A;  2BKI B;  5AQB B;  4ANJ A;  1W7S A;  5J2O A;  5AXI A;  4PHJ A;  1REC A;  2OGR A;  5AER A;  2WOR A;  4W69 A;  2YFP A;  2B1U A;  1NIW A;  3AAK A;  1EMK A;  4WQ3 A;  4W6J A;  2QLI A;  5HKW A;  5DPI A;  4EDO A;  2HCG A;  5ER5 A;  4ZIO A;  3LVD A;  3LSA A;  2OS8 C;  2JAD A;  2HPS A;  3BUM B;  2OTB A;  3GEX A;  3SVD A;  2JU0 A;  1B8L A;  5DPJ A;  1QIV A;  3SVO A;  3SG5 A;  1PSR A;  2OS8 B;  3ICB A;  1JF0 A;  1H6R A;  3LK0 A;  2A50 B;  2KFG A;  4IZN A;  4Q9W A;  1A2X A;  3TDI A;  3OX6 A;  3P8U A;  4ORA B;  5EBJ A;  5D69 A;  4MZK A;  3DQF A;  4EMQ A;  3BUX B;  1IRJ A;  2WHT A;  2A48 A;  4W6T A;  3BOW A;  1YVL A;  4PHM A;  2G6E A;  1CM4 A;  5LTR A;  4PDZ A;  4A4C A;  2D8N A;  4W73 A;  1RTP 1;  2JT3 A;  3PIB A;  3S05 A;  4ORB B;  3PLF B;  1DJX A;  5FHV A;  1FBV A;  2KDH A;  4MRY A;  1Y6W A;  4IK4 A;  2QLE A;  3PJ7 A;  4W7R A;  1OXD A;  1MYW A;  2ICR A;  4ZBL A;  4CID A;  2LM5 A;  4GF6 B;  1S6Z A;  4W72 A;  3GJ2 A;  1N2D A;  2HPW A;  1YJF A;  3D0Y B;  3QRX A;  4IK3 A;  1XA5 A;  2QLG B;  1L2O B;  3EK8 A;  1UHN A;  4LJD C;  3U0L A;  1IQ3 A;  2L98 A;  4IK8 A;  2ZKM X;  2DDC A;  4NDB A;  2LLS A;  2FCE A;  4WRI A;  2QLG A;  2BBM A;  4D1E A;  5CSF A;  1DGV A;  3KPX A;  4Q04 A;  3OX5 A;  4KF4 A;  2AWM A;  2WC8 A;  2PVB A;  4W6P A;  5DPH A;  2OKY A;  1QX5 B;  2DD9 A;  3DQ8 A;  4W74 A;  2G6Y A;  2IB6 A;  4KGE A;  1QV1 A;  2OTG C;  2M29 A;  2K61 A;  4W77 A;  1KFX L;  3TUY C;  4B30 B;  2ZN9 A;  2A53 B;  5HZO A;  3RWT A;  2KFF A;  3NEZ A;  1DF0 A;  1QIW A;  2OTG B;  3SG6 A;  2NXQ A;  1PVA A;  1S5G Z;  3ZTF A;  4YRU A;  1XYD A;  3I19 A;  3LF4 B;  1Q4E A;  1MXE A;  2V4E A;  4JQ0 D;  2G16 B;  3ST2 A;  4PE1 A;  5JOL A;  2LV7 A;  4L12 A;  4HRH A;  5LK4 A;  1L7Z A;  3SSV A;  3EVR A;  3EVP A;  1SL8 A;  2L4H A;  2Q91 A;  5EXU A;  1KK7 Z;  2EGD A;  2IB5 A;  4KW8 A;  4P5O E;  5DQM A;  1K90 D;  3GK1 A;  2G2B A;  2ZRT A;  2I18 A;  1DJY A;  2P6B B;  5KTY A;  4A4B A;  2PMY A;  4PAL A;  1GFL A;  2KHN A;  2F2O A;  2K7D A;  3CR4 X;  3GOF A;  1M39 A;  3HX4 A;  5DTY A;  1KQV A;  1MXL C;  4DKN A;  4MRX A;  1SCM C;  1B4C A;  3VRO A;  2E30 A;  2KOT A;  2EMO A;  1NYA A;  3VRN A;  2H5R A;  4OKH A;  1PSB A;  5AEQ A;  2BE4 A;  4W7E A;  3WCK A;  3IF7 A;  2WCF A;  2LP3 A;  1KYR A;  4XOW A;  2K8M B;  1K9U A;  2M1K B;  2Q6P A;  1MQ1 A;  4ZB1 A;  3DQA A;  5CSJ A;  4PCW A;  2JNX A;  1A03 A;  1RK9 A;  5BQL A;  4XL5 A;  2KI6 D;  1OMV A;  4GFT A;  1SRA A;  1M45 A;  4PPK A;  2KAX A;  3DF0 A;  1NP8 A;  2SCP A;  2I94 A;  2QLH A;  3LK1 A;  1DJW A;  4KA9 A;  1DMO A;  3O4Y A;  3NSO A;  4Q9X A;  1TIZ A;  2LNK A;  1IGV A;  4ZFS A;  1F8H A;  2LLT A;  3WLC A;  3SST A;  2EMN A;  1YUU A;  1PVB A;  1KQM C;  4JC2 A;  4GUK A;  1SNL A;  5DTL A;  3CLN A;  1SW8 A;  1YHG A;  1TN4 A;  3DQ7 A;  1YRT B;  4DIR A;  3VGO A;  4NQG A;  4OY4 A;  1IG5 A;  1UUS A;  1SCV A;  2HFC A;  4MEW A;  1JC2 A;  4W7D A;  1B8R A;  2YDZ A;  4RTC A;  1KQM B;  3AKA A;  1QLK A;  3MGF A;  4OR9 B;  4HSZ A;  1KYS A;  4OVN F;  3E5V A;  4QJ3 B;  4GGN A;  4UTS A;  1J1D A;  4M2P A;  1TRF A;  1ZMZ A;  2O29 A;  1EG3 A;  4TNC A;  5DU0 A;  1QLS A;  5DRF A;  1R6P A;  2HGY A;  3UFZ A;  4YBH B;  4YGA A;  4I2Y A;  2A52 B;  1YHH A;  2IOV A;  1M46 A;  1PK0 D;  4W6M A;  3ED8 A;  2H61 C;  2VVI A;  3OB1 B;  5AAN A;  3WLD A;  1TTX A;  4DXO A;  4W76 A;  3NSI A;  1WRZ A;  1YZW A;  2VVJ A;  2L4I A;  3DQD A;  1DGU A;  4HQC A;  1IWQ A;  3VRQ A;  1RMM A;  3CFH A;  4JEO A;  1JBA A;  3BXK A;  1A75 B;  4JGE A;  2ISD A;  1NCY A;  1YFP A;  1F71 A;  2M7L A;  2KI6 C;  2LMT A;  2QRF A;  1NX3 A;  3DQH A;  1MOV A;  4KF5 C;  4MSP A;  3CFA A;  5FVG A;  5F6T A;  1S1E A;  5BPJ A;  1RJV A;  1E8A A;  5DQB A;  2DOQ A;  4KEX A;  1JBZ A;  1F70 A;  5DKQ A;  1XFX O;  4ORC B;  3C1V A;  2GGZ A;  1EML A;  2C9J A;  2K0J A;  4F0Z B;  5KU1 A;  1X02 A;  2GW4 B;  3LVA A;  1K93 D;  2QPT A;  4GGF C;  1S26 D;  3OSQ A;  3A8S A;  1QVI Z;  4I5L B;  2L51 A;  2FOT A;  4CFR A;  1G33 A;  4GBA A;  5J3X A;  4U8D A;  5K89 A;  4LJC A;  1KFU L;  1CTR A;  1XA9 A;  2A56 B;  4H3M A;  5H88 A;  2PXS A;  4YGC B;  3FS7 A;  3HCM A;  3SVE A;  4MLW A;  4PPJ A;  3V3D A;  4L9M A;  3CBE A;  2G3O A;  3ADF A;  4KAG A;  1S6I A;  3I5H C;  4W6B A;  2M49 B;  1KK8 C;  4XGY A;  3M24 A;  5ER4 X;  2K2A A;  4W6I A;  1HT9 A;  2F3Y A;  1J7Q A;  1IKU A;  2G2S B;  1KP5 A;  3I5H B;  2WIQ A;  4W7F A;  3BXA A;  3G9A A;  1KK8 B;  1FW4 A;  1LIN A;  1XFU O;  2L50 A;  4HRG A;  4OV2 A;  2HF5 A;  1VRK A;  1OE9 B;  2Z6Z A;  2JXL A;  2WIS A;  1MR8 A;  1UP5 A;  1SY9 A;  3DQL A;  4FTG A;  2M7N A;  3FWB A;  2M3W A;  1DJH A;  2P4M A;  3CZT X;  2LVJ A;  2PRU A;  3BUO B;  1TNP A;  1GQM A;  1K94 A;  4GNK B;  2O2B A;  4W6O A;  4H3N A;  2L2E A;  3BOW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...