3EK8A

Calcium-saturated gcamp2 t116v/g87r mutant monomer
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
408
structure length
393
Chain Sequence
b'SRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDRGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 129
structure length 393
sequence length 408
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek8A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek8A02
3SIAA 3DQ8A 1SRAA 2PALA 3CZTX 1YX7A 3VRQA 2IE2A 4XGYA 3I5IC 2L51A 1H8BA 3K1KA 2LVVA 1NX0A 3IF7A 1Q73A 1N65A 2WSOA 5GQQC 2Y1MA 4AR7A 1EH2A 1DJHA 4W6TA 3IQOA 3SVSA 1G8IA 2ZFDA 3LVCA 2LUCA 4I5KA 3ZUFA 5J2OA 1H4BA 4KGFA 4ZF4A 1BT6A 3LK1A 4MZLA 1EL4A 2M0RA 1KFXS 4YGDB 1WLMA 5BT0A 4CIDA 4NDDA 1CB1A 2LVJA 1MYWA 2QLEA 2LHLA 2L50A 2HF5A 2L5XB 1WDCC 3EKHA 5BQLA 3EK8A 1ODBA 4HQ8A 4W69A 3OX5A 1OE9B 3DPZA 1M63B 1L2OB 4EDSA 3I5GC 4HRGA 2L2EA 1SBJA 3FS7A 3M22A 2WORA 2POXA 2K7OA 4XOVA 2GGMA 5JJGA 2PXSA 2MHHA 1RTP1 3U8CA 1TNXA 3DQ9A 1QTXA 2BL0C 1B9AA 1YJFA 2B3PA 2YFPA 4RTCA 4I5NB 4H3NA 1SR6C 4PCWA 1RMOA 1ZUZA 2Y5IA 4ZBLA 1F8HA 2A48A 3DQHA 1XFWO 2HPWA 1N0YA 4W6MA 1YUSA 2HRSA 3WLDA 2EC6B 4KGEA 1OXDA 3CR5X 1S5GZ 4JEOA 4AOMA 2AAOA 4GFTA 1OZSA 3TUYC 2OTGC 4KEXA 3NEDA 1A29A 1XFXO 1JF2A 1SKTA 1YVHA 3PM8A 4PHJA 1KYSA 1MQ1A 4PDZA 1S6ZA 3LF3A 3I5HC 5HBDA 2HFCA 2G2BA 2Q91A 1GJYA 4GGNA 2Z6XA 1SK6D 1WLZA 2HJOA 1NP8A 3KHEA 4LJDA 3GK2A 2K0JA 2WC8A 1YFPA 2F33A 2VRGA 3M24A 1RJVA 3SG4A 2LLUA 1J7RA 1J7PA 1NYAA 3OB1B 5AFPA 1JBAA 3DPWA 1PK0D 3VGOA 2M9GA 2Y4QA 4QJ4B 4WQ2A 3ZTFA 3FWCA 3DQ2A 2CTNA 3CB9A 3SSHA 3LS3A 3HX4A 1PVBA 1MOUA 4L1IA 1DMOA 2JADA 3RWAA 4M2PA 1RMMA 2HQZA 1L2OC 2B3QA 2F2PA 3MGFA 2V4EA 3GOFA 2Q4UA 2QT2A 2JWWA 2JQ6A 4ZCVA 1EG4A 1UISA 1D1OA 3SSKA 3SVEA 2JPTA 4B5YA 1DJGA 4I5JA 4PE7A 3GJ1A 3TMRA 1XAEA 4W73A 5DKQA 2BBNA 5I2QA 1IKUA 4N3DA 2G3DB 4JFGA 4JC2A 3DQMA 4MRXA 2WHTA 2HGYA 5DTZA 2EC6C 2JC2A 5FVIA 3BYAA 2LC5A 1YR5A 1DJYA 3RWTA 3AKOA 5FVFA 2V4EB 1TTXA 4TZGA 4YI8A 1OOJA 2QLHA 2DD9A 2D8NA 1B9CA 2L4IA 3BUOB 3NSKA 4LQTA 4A4CA 5T3IA 4PHKA 4W6RA 3E3RA 1E8AA 2B1UA 1YRTB 1QYQA 5B8IB 2ZRTA 3DF0A 4XYNA 1EMKA 3SV5A 1QASA 2OJKA 1R6PA 4HREE 3UFZA 3AKAA 1C07A 1IG5A 1SY9A 2OS8C 4W7DA 2ARLA 3CBEA 5BTTA 5F6TA 2VVIA 4GPLB 1CFPA 3DD4A 2QPTA 1TNPA 4D1EA 1FI6A 3I5IB 2M97A 5AERA 3A8RA 2NLNA 1QYOA 1R2UA 1J1DA 3DPXA 4DS7A 3WHTB 1FW4A 2JXCA 2KI4B 2BECA 1BU3A 2SCPA 4Q9WA 3O6BA 2I18A 3PN7B 2WSNA 1CMGA 2E30A 3WNXB 1PSBA 2BCXA 2LNKA 3DF0B 3HCMA 2DUEA 4OJ0A 3FIAA 4R6DA 2BTJA 1MWNA 5DQMA 3EK7A 1BODA 1M45A 1J7OA 4W77A 1IRJA 1PULA 4LJDC 1Q4BA 1ZUXA 3W1CA 3CFFA 1EMGA 1Q80A 3O2PA 3ED8A 4JF9A 3OX6A 5F9GA 3PSRA 5BTTB 1Q4DA 3I19A 1S1EA 1DF0A 5EBJA 3OP0A 1G7KA 3PIBA 4JGEA 2OTEA 2H5QA 2CNPA 4W7XA 1ALWA 1DTLA 3CS1A 2C9IA 1K90D 2ZN8A 3DQLA 1BOCA 1SYMA 4PPKA 1S5GY 4DXMA 3EVVA 4W7CA 2KAXA 4IK1A 4PE1A 2A53B 3O78A 3ZNIA 5CSIA 3NT3A 1XQMA 4DRWA 3ZUJA 2WIQA 1S6IA 2LMUA 3VK1A 1YTZC 2VZXA 1WRZA 2V4EC 3P28A 2NZ0A 4W75A 1NIWA 2DUGA 2VAEA 4W72A 4OR9B 2M7LA 4ORNA 4JPZB 5EXBA 2O5GA 2H61A 2A47A 1DF0B 1HT9A 2K2AA 1KK8B 1UP5A 2LLSA 1KCYA 3AAKA 3LLEA 1NCYA 5G08A 4KAGA 3SSVA 1SCMB 1JBYA 1BLQA 3D0YA 5EXUA 1QIVA 5HYDA 3UG0A 3WLCA 4GESB 3LK0A 2HQKA 4OY4A 3S05A 2AWJA 1B8RA 3LVDA 2L0PA 4I5LB 3SG7A 3E5TA 1F71A 2HQ8A 2LCPA 2KI4C 2WURA 2MAZA 3EVUA 1SNLA 4J89A 3CTNA 3IQQA 1S6CA 3PN7C 1ZGOA 4MN0A 3ST2A 2JNXA 1WRLA 3VHTA 4ZF3A 1XFYO 2JOJA 1C7WA 3V3DA 1Y0VH 1G4YR 1MUXA 4GGFA 1M39A 2BCAA 4WRIA 2ICRA 1TCFA 3KO0A 3DQ5A 1KSOA 1XSSA 2K7CA 1UHIA 3NT9A 1AVSA 1JC0A 1CFDA 2I94A 1HQVA 2K2FA 1GGWA 3D0YB 2CXJA 5FVGA 5JOLA 1GQMA 1KSMA 5AXIA 2NCOA 3AKBA 4DXQA 1IJ5A 1WRKA 1QIWA 2AHAA 1JBZA 1DGUA 4L9MA 4GF6B 3K21A 1LXFC 2HCGA 5LK4A 1TIZA 3W1DA 5D69A 3ICBA 2WCBA 2DDCA 1MXLC 3VRRA 4B30A 4NDCA 2Y0GA 1UURA 1XFVO 4P1QA 3OSQA 3A4UB 1KFUS 3SIBA 1YVLA 4W7AA 4YGBB 1Z1PA 2COLB 4H3MA 4W6AA 1DJIA 3VHTB 3GK4X 1W7JB 4IK5A 1WY9A 3CWGA 2DUIA 4KF4A 1CFFA 4IK4A 1AJ5A 2FL1A 1SPYA 2G9BA 5K89A 3DQUA 3RLZA 4W6CA 1B8CA 3WXAA 5KTYA 5DTLA 1QV0A 1S36A 5AQBB 1EJ3A 4W6NA 5DY6A 3H4SE 1B1GA 4W6FA 1YUTA 1AJ4A 2F8PA 4KW4A 2O29A 3SSTA 4W6DA 1KK8C 4GAOA 2MA2A 1EMCA 4Z4KA 1Q4EA 2TN4A 3SG6A 2OTBA 4KW8A 1SCMC 1DJWA 4CFRA 4JRBA 1CNPA 2ZNDA 3JVTB 1W7TA 5BPJA 1UHKA 4B30B 4P2YB 1CDNA 1QX2A 3OSRA 1Z1QA 5LTPA 4USLA 1EMAA 3O4YA 3NEZA 1YURA 3CGLA 2KFGA 2M3WA 2M1UA 2KAYA 4IK9A 1A75A 1U5IA 4PE4A 2MLEC 3GB3A 4XOWA 2OS8B 1M46A 3BUMB 1KYPA 4Q7UA 2A46A 3JTDB 1F54A 2RGIA 2MLFC 3TDUA 2ZN9A 1NX1A 4MZKA 1CFCA 4HVFA 3SS0A 4FTGA 4W6PA 2O2BA 2P4MA 5EB6A 2NXQA 2YE1A 2GX2A 3BOWA 2JTZA 4DUQA 2H61C 4Q04A 1CKKA 1S6JA 3I5FB 1OZOA 1CV7A 5ER4X 1BG1A 5LTRA 4W7FA 2FZUA 4GNKB 1K9UA 2NCPA 1NUBA 5HZUA 4Q7TA 4DXIA 4KA9A 1A75B 4W6JA 1U5IB 3IR8A 1OSAA 4ZB1A 1PSRA 1QS7A 3ST0A 1RWYA 4LJCA 3DQAA 1XYDA 2GW3A 5H87A 4DCKA 3U0KA 1QV1A 1OMDA 2PSRA 3BOWB 1XFUO 1QVIZ 4ZFSA 2DD7A 2ZMUA 5LTQA 5HGEA 1LVCD 1Q4AA 3NXAA 4YGCB 4OCIA 4DKMA 1LINA 2G16B 5DTYA 4CFQA 4CPVA 1W7UA 4W6SA 4FQOA 3DVKA 1MOVA 2EHBA 2Z6ZA 3DQOA 3TDZA 2FWQA 3EVPA 5DKNA 5H89A 3DQCA 1V1FA 5DKRA 2LLTA 1SL7A 2JULA 2HPSA 2YE0A 1KFXL 1CLMA 1NX3A 3JVTC 2EMDA 3DQ3A 2PXWA 2L4HA 1KK7Y 4LQUA 1XVJA 4IL1A 4M2QA 5FYXA 3E5VA 2KAVA 1W7SA 4AQJA 5I2LA 1TNWA 2HQWA 5DRGA 1XMZA 2JTTA 4W6UA 3ST3A 1K8UA 1IJ6A 1YHGA 3DVMA 1FI5A 2F2OA 3JTDC 1RMPA 3SG5A 2BKHB 4UPGA 4WQ3A 3CLNA 2KFHA 1JUOA 4H3LA 2WCEA 3FWBA 2MBXA 4MBEA 3IP2A 1CDMA 2M49B 1CM4A 3SSPA 4P76A 1EMBA 4HRHA 1H6RA 4Q7RA 3I5FC 4KW9A 3SRYA 3BXKA 2A4JA 1EMEA 2FJUB 1CLBA 4Q9XA 3ST4A 4I2YA 4R1EA 1W7IB 3SVUA 5HW9A 1ZGPA 1J55A 2A52B 3PJBA 1YX8A 3VRNA 1B47A 5HLVA 2FCDA 3PALA 4PALA 1UHJA 2O24A 5I2OA 3LVAA 4HSZA 4YGEB 4HQCA 3BUNB 4RYWA 1TN4A 2Y1NA 4RYSA 2LMTA 1EMFA 1SCVA 1CTRA 5CSJA 1QYFA 3DQ6A 2BE4A 1IQ3A 1J7QA 1ZMZA 2LP3A 4TZAA 1NX2A 2M1KB 2PVBA 3GJ2A 4IK8A 4CLNA 4L13A 2OKWA 2LM5A 3EK4A 1H4UA 4KF5A 1FF1A 2G3OA 2O60A 4GUKA 4BDUA 2IB5A 2Z1OA 3CFAA 3DQEA 1PALA 3M0WA 4PPJA 4PFEA 3SSYA 2JT0A 2H9WA 2FCEA 2M8UA 1IGVA 2BCBA 4DXOA 1AUIB 4OHSA 1EMLA 4KPIA 4J8AA 2KGBC 5ER5A 4MSPA 3MSEB 3SVDA 2JXLA 2ZMWA 3TZ1A 2KBMA 4HQ9A 1K2HA 1JF0A 2R2IA 2KHNA 4NDBA 3TDIA 3U0LA 4C0KA 1DT7B 5DPJA 1MF8B 5PALA 1IWQA 2BKIB 2H2KA 2M29A 4N5XA 3PJ7A 1KK7Z 2KBIA 1K93D 4BY4A 4W74A 1N2DA 1XA9A 3D10A 1YZWA 5HZSA 4W6GA 2DUHA 2BBMA 2LE9B 2L98A 4PHMA 2QLGA 1A03A 1AP4A 1RRXA 3LL8B 1MXEA 1QLKA 4DXPA 4MLWA 2LAPA 4JQ0D 1JSAA 2OGRA 5HKWA 2SASA 1SL8A 2ZNEA 1UHHA 1XK4A 2CT9A 3CGAA 4F0ZB 2WCFA 3PFVA 5TNCA 5EB7A 1QVIY 1BJFA 1B7TY 1SW8A 5FHVA 2HGDA 1QLSA 1K9KA 2JU0A 4YRUA 5CPVA 2WNDA 2JT3A 1JWDA 4J88A 3SVCA 5DPGA 2ZO7A 1CMFA 3DQIA 5EHUA 2KQ6A 1BMOA 2AWKA 4JWQA 2LVIA 4DXNA 3GEXA 2A50B 1KWOB 4W6HA 2G6XA 5H88A 1XA5A 2LP2A 3KCSA 2I2RE 2FOTA 3DQ1A 2QLGB 3TS5C 1C7VA 1OXEA 1OQPA 4PE0A 1ZOTB 2GX0A 3NSIA 4TNCA 4W6KA 1QY3A 4QJ3B 3TMTA 3BXAA 2K8MB 1JC2A 2JT8A 2H5PA 2G2SB 1QX5B 2QZ0A 4YGAA 1F0BA 2G6EA 1A2XA 3LA1A 2AUCA 1BFPA 5I8NA 4A4BA 2K61A 3VROA 2DUFA 1JFJA 1SL9A 2IS9A 4AQIA 4ZIOA 3SVBA 2KI6C 2LHIA 2E6WA 5CSFA 1Q4CA 2A56B 3ADFA 1F4QA 2LUXA 1L7ZA 1UUSA 4EMQA 1DGVA 5DQBA 1TRFA 4N1GA 1F70A 2AWLA 2EMOA 2H8QA 4LW5A 3EKJA 3WCKA 3DQFA 1RK9A 2MRDA 1ZGQA 5IBWA 3KPXA 3CFHA 1TNQA 1C4FA 4ORAB 2ZO6A 4NQGA 2PMYA 3SSLA 1ALVA 4KF5C 3LSAA 2JRFA 4U2VA 3LCPC 5KSZA 1CDPA 1G33A 3DVEA 3BX9A 1UWOA 1CLLA 4ZINA 3GL4A 2QRFA 5DPHA 2GW4B 2F3ZA 4N1FA 1X02A 3H1RA 1NCXA 4NWSA 1S3PA 4W6BA 4MZJA 4GOBA 1YRUB 1M31A 1V1GA 4U8DA 4W6IA 2AMIA 4ANJA 1KYRA 1TCOB 2P6BB 2VADA 1A4PA 4EDOA 2PASA 1RFJA 4IK3A 3E5WA 1RROA 1YUUA 2KSPA 1BR4B 1JC1A 5KTGA 2AWMA 3AAJA 2OPOA 5HZTA 1KQMB 3SVRA 3PLFB 1VRKA 2WHSA 1BR1B 1DVIA 1EXRA 2H6VA 2Q6PA 4LJBA 4DIRA 1KWOC 3BXBA 4EN1A 4C0LA 3VICA 1J1EA 1SMGA 3NSLA 2WISA 2DDDA 3RM1A 1ZACA 2AH8A 2H5OA 3AI4A 4GGFC 1B7TZ 4BY5A 2IOVA 4OQWA 5HZOA 1RM9A 1F55A 2RH7A 5HLOA 3PATA 3U0NA 1XK4C 2BE6A 3SVOA 2LV7A 1UHNA 1GL4A 3A8SA 3BUWB 5DRFA 3SJSA 1B4CA 2LMVA 2WOSA 2LANA 4OV2A 2A54B 2LVKA 3SVNA 3H1OA 1IQ5A 1MHOA 4XJKA 1FPWA 2KNEA 1EMMA 2C9JA 3KEVA 1Y6WA 4Z4MA 2KQYA 4W76A 4OKHA 3O77A 3ZWHA 1PRWA 1GFLA 5HKYA 4XVPA 1S26D 3CD9A 2GV5A 2JZIA 2DOQA 1B8LA 1XO5A 2QLIA 5DPIA 5EXCI 5EJUA 4ZF5A 2Z6YA 4MRYA 3EVRA 1HUYA 1CM1A 3U8AA 3P8UA 3DQ7A 4R6BA 1NPQA 2KGRA 1LKJA 4YBHB 4HE4A 1AK8A 2OKYA 1QXTA 2KYFA 1YHIA 5DTXA 3OB2B 1KP5A 2GGZA 1DJXA 4H48A 3OHMB 2M7NA 1KFUL 4PHNA 4YI9A 1AHRA 3OGOA 2ZKMX 4XJKB 1RECA 1XFZO 3U8PA 4W6LA 1GGXA 3DVJA 2KYCA 4ICBA 2CBLA 3KF9A 3AI5A 3CD1A 2EGDA 2YDZA 2F3YA 4GBAA 1KQMC 5CSNA 2HETA 1K95A 3BUXB 2EMNA 3VRPA 1KQVA 3GK1A 1TOPA 2V53A 4IZNA 2K7BA 3ZULA 1BF5A 2JNFA 5AANA 3KCTA 4ZCUA 1K9PA 1DJZA 1NSHA 3BXCA 1WDCB 4W7EA 2WHUA 4E68A 3NF0A 4L12A 4DKNA 2VVHA 3DQKA 2ZRSA 3DQ4A 1K94A 1NCZA 3I5GB 1F09A 2MJWB 4UTSA 1Y1UA 3SG2A 2KDHA 3CR4X 1QJTA 4OVNF 1NWDA 2PRUA 1PVAA 3LF4B 4H47A 2VVJA 1Y1XA 3TS5B 1LA0A 4P5OE 1GGZA 4ETOA 1IH0A 4QJ5B 2BL0B 2K7DA 5J3XA 2KFFA 1HCJA 1K96A 1OXFA 3NSOA 1MR8A 2QACA 2CCMA 1SR6B 4MEWA 4PPLA 3QRXA 3WHUB 1QATA 3SG3A 4W6OA 2H5RA 5KU1A 4XL5A 2I7AA 4C0JA 3DQJA 1YJ2A 2G5ZB 3C1VA 2Q57A 2ISDA 1EG3A 5D7FA 4W7RA 1OMRA 4MVFA 1OMVA 4M2OA 3TUYB 2OTGB 3G9AA 2IB6A 4ORCB 3DQNA 1JFKA 4EULA 3U0MA 1FBVA 1QXPA 2KI6D 5AEQA 2KOTA 2G6YA 5HKZA 1Y1AA 1QX7A 1YHHA 3CR2A 1ZFSA 1LA3A 4AS8A 3DQDA 3BQ3A 3PJ5A 5DU0A 2QU1A 1CDLA 4ORBB 4OGSA 1F4OA 3I5HB 3F45A
chains in the Genus database with same CATH superfamily
3SIAA 3DQ8A 1DEKA 1SRAA 2PALA 3CZTX 1YX7A 3VRQA 2IE2A 1SSEB 4XGYA 3O4XA 3I5IC 2L51A 2QEVA 1H8BA 3K1KA 2LVVA 3NHIA 1NX0A 3IF7A 1Q73A 1OOGA 1N65A 2WSOA 5GQQC 2Y1MA 3Q8IA 3SS3A 4AR7A 1EH2A 3B86A 1DJHA 4W6TA 3IQOA 3SVSA 1G8IA 2ZFDA 3LVCA 2LUCA 2GTEA 4I5KA 3ZUFA 5J2OA 1H4BA 4KGFA 4ZF4A 1BT6A 3LK1A 1C3ZA 4MZLA 1EL4A 2M0RA 1KFXS 4YGDB 1WLMA 5BT0A 4CIDA 4NDDA 1CB1A 2LVJA 1MYWA 2QLEA 2LHLA 2L50A 2HF5A 2L5XB 1WDCC 3EKHA 5BQLA 3EK8A 1ODBA 4HQ8A 4W69A 3OX5A 1OE9B 3DPZA 1M63B 1L2OB 4EDSA 3I5GC 4HRGA 2L2EA 1SBJA 3FS7A 2WCKA 3M22A 2WORA 2POXA 2K7OA 2BNXA 4XOVA 2GGMA 5JJGA 2PXSA 2MHHA 1RTP1 3U8CA 1TNXA 3DQ9A 1QTXA 2BL0C 1B9AA 1YJFA 2B3PA 2YFPA 4RTCA 2QEOA 4I5NB 4H3NA 1SR6C 4PCWA 1RMOA 1ZUZA 2Y5IA 4ZBLA 1F8HA 2A48A 3R72A 3DQHA 1XFWO 2HPWA 1N0YA 4W6MA 3OBVA 1YUSA 2HRSA 3WLDA 2EC6B 4KGEA 1OXDA 3CR5X 1S5GZ 4JEOA 3CZ1A 4AOMA 2AAOA 3L47A 4GFTA 1OZSA 3S0EA 2OTGC 3TUYC 4KEXA 3NEDA 1A29A 1XFXO 1JF2A 1SKTA 1YVHA 3PM8A 4PHJA 1KYSA 1MQ1A 4PDZA 3PJIA 1S6ZA 3LF3A 3I5HC 5HBDA 2HFCA 2G2BA 2Q91A 1GJYA 4GGNA 2Z6XA 1SK6D 3FE9A 1WLZA 2HJOA 1NP8A 3KHEA 4LJDA 3CZ2A 3GK2A 2K0JA 2WC8A 1YFPA 2F33A 2VRGA 3M24A 1OOIX 1RJVA 3SG4A 2LLUA 1J7RA 2WCMA 1J7PA 1NYAA 3OB1B 5AFPA 1JBAA 3DPWA 1PK0D 3VGOA 2M9GA 2Y4QA 4QJ4B 4WQ2A 3ZTFA 2KPHA 3FWCA 3DQ2A 3D77A 2CTNA 3CB9A 3SSHA 3LS3A 3HX4A 1PVBA 1MOUA 4L1IA 1DMOA 2JADA 3RWAA 4M2PA 1RMMA 2HQZA 1L2OC 2B3QA 3S0AA 2F2PA 3MGFA 2V4EA 3GOFA 2Q4UA 2QT2A 2JWWA 2JQ6A 4ZCVA 3CDNA 1EG4A 1UISA 1D1OA 3SSKA 3SVEA 2JPTA 4B5YA 1DJGA 4I5JA 4PE7A 3GJ1A 3TMRA 1XAEA 4W73A 5DKQA 2BBNA 5I2QA 2L5YA 1IKUA 4N3DA 2G3DB 4JFGA 4JC2A 3DQMA 1OOFA 2WC6A 1TUZA 4MRXA 2WHTA 2HGYA 5DTZA 2EC6C 2JC2A 3UO9A 5FVIA 1QWVA 3BYAA 3DZTA 3B6XA 2LC5A 1YR5A 1DJYA 1P28A 3RWTA 3AKOA 5FVFA 4IJ7A 2V4EB 1TTXA 4TZGA 4YI8A 1OOJA 2QLHA 2DD9A 2D8NA 1B9CA 2L4IA 3BUOB 3NSKA 4LQTA 4A4CA 5T3IA 4PHKA 4W6RA 3E3RA 1E8AA 2B1UA 1YRTB 1QYQA 5B8IB 2ZRTA 3DF0A 4XYNA 1EMKA 3SV5A 2JPOA 1QASA 2OJKA 1R6PA 4FQTA 4HREE 3UFZA 3AKAA 1C07A 1IG5A 1SY9A 2OS8C 2YGUA 4W7DA 2ARLA 3CBEA 5BTTA 5F6TA 2VVIA 4GPLB 1CFPA 3DD4A 2QPTA 1TNPA 4D1EA 1LS8A 1FI6A 3I5IB 2M97A 5AERA 3A8RA 2NLNA 1QYOA 1R2UA 1J1DA 3DPXA 4DS7A 3WHTB 1FW4A 2JXCA 2KI4B 2BECA 1BU3A 2SCPA 4Q9WA 3O6BA 2I18A 3PN7B 2WSNA 1CMGA 2E30A 3WNXB 1PSBA 2BCXA 2LNKA 3DF0B 3HCMA 2DUEA 4OJ0A 3FIAA 4R6DA 2BTJA 1MWNA 5DQMA 3B7AA 3EK7A 1BODA 1M45A 1J7OA 4W77A 1IRJA 1PULA 4LJDC 1Q4BA 1ZUXA 3W1CA 3CFFA 1EMGA 3BFAA 1Q80A 3O2PA 3ED8A 4JF9A 3OX6A 5F9GA 3PSRA 5BTTB 1Q4DA 3I19A 1S1EA 1DF0A 5EBJA 3OP0A 1G7KA 3PIBA 4JGEA 2OTEA 2H5QA 2CNPA 4W7XA 1ALWA 1DTLA 3CS1A 3VB1A 2C9IA 1K90D 2ZN8A 3DQLA 1BOCA 1SYMA 4PPKA 1S5GY 4DXMA 3EVVA 4W7CA 3S0BA 2KAXA 3OGNA 4IK1A 4PE1A 2A53B 3O78A 3ZNIA 5CSIA 3NT3A 1XQMA 4DRWA 3ZUJA 2WIQA 3RZSA 1S6IA 2LMUA 3VK1A 1YTZC 4PT1A 2VZXA 1WRZA 2V4EC 3P28A 2NZ0A 4W75A 1NIWA 2DUGA 2VAEA 4W72A 4OR9B 2M7LA 4ORNA 4JPZB 5EXBA 2O5GA 2H61A 2A47A 1DF0B 1HT9A 2K2AA 3D74A 1KK8B 1UP5A 2LLSA 1KCYA 3AAKA 3LLEA 1NCYA 5G08A 4KAGA 3SSVA 1SCMB 1JBYA 2WCJA 1BLQA 3D0YA 5EXUA 1QIVA 3D75A 5HYDA 3UG0A 3WLCA 4INWA 4GESB 3LK0A 2HQKA 4OY4A 5D3OA 3S05A 2AWJA 1B8RA 3LVDA 2L0PA 4I5LB 3SG7A 3E5TA 1F71A 2HQ8A 2LCPA 2KI4C 2WURA 2MAZA 3EVUA 1SNLA 4J89A 3CTNA 3IQQA 1S6CA 3PN7C 1ZGOA 4INXA 4MN0A 3ST2A 2JNXA 1WRLA 3VHTA 4ZF3A 1XFYO 2JOJA 1C7WA 3V3DA 1Y0VH 1G4YR 1MUXA 4GGFA 1M39A 2BCAA 4WRIA 2ICRA 1TCFA 3KO0A 3DQ5A 1KSOA 1XSSA 2K7CA 1UHIA 3NT9A 1AVSA 1JC0A 1CFDA 2I94A 1HQVA 2K2FA 1GGWA 3D0YB 2CXJA 5FVGA 5JOLA 1GQMA 1KSMA 5AXIA 2NCOA 3AKBA 4DXQA 1IJ5A 1WRKA 1QIWA 2AHAA 1JBZA 1DGUA 4L9MA 5DICA 3K21A 4GF6B 1LXFC 2HCGA 5LK4A 1TIZA 3W1DA 5D69A 3ICBA 2WCBA 2DDCA 1MXLC 3VRRA 4B30A 4NDCA 2Y0GA 1UURA 1XFVO 4P1QA 3OSQA 3A4UB 1KFUS 3SIBA 1YVLA 4W7AA 4YGBB 1Z1PA 2COLB 4H3MA 4W6AA 1DJIA 3VHTB 3GK4X 1W7JB 4IK5A 1WY9A 3CWGA 2DUIA 4KF4A 1CFFA 4IK4A 1AJ5A 2FL1A 1SPYA 1Z4HA 2G9BA 5K89A 3DQUA 3RLZA 4W6CA 1B8CA 3WXAA 5KTYA 5DTLA 1QV0A 1S36A 5AQBB 1EJ3A 4W6NA 5DY6A 3DXLA 3H4SE 1B1GA 4W6FA 1YUTA 1AJ4A 2F8PA 4KW4A 2O29A 3SSTA 4W6DA 1KK8C 4GAOA 2MA2A 1EMCA 4Z4KA 1Q4EA 2TN4A 3SG6A 2OTBA 4KW8A 1SCMC 1DJWA 4CFRA 4JRBA 1CNPA 2ZNDA 3JVTB 1W7TA 5BPJA 1UHKA 3D73A 4B30B 4P2YB 1CDNA 1QX2A 3OSRA 1Z1QA 5LTPA 4USLA 1EMAA 3O4YA 3NEZA 1YURA 3CGLA 2KFGA 5I94A 2M3WA 2M1UA 1OW4A 2KAYA 1A75A 4IK9A 1U5IA 4PE4A 3B88A 2MLEC 3GB3A 4XOWA 2OS8B 1M46A 3BUMB 3NGVA 1KYPA 4Q7UA 2WC5A 3JTDB 1F54A 2A46A 2RGIA 2BAPA 2MLFC 3TDUA 2ZN9A 1NX1A 4MZKA 1CFCA 4HVFA 3SS0A 4FTGA 1DELA 2PYQA 4W6PA 2O2BA 2P4MA 5EB6A 2NXQA 2YE1A 2GX2A 3BOWA 2JTZA 4DUQA 2H61C 4Q04A 1CKKA 1S6JA 3I5FB 1OZOA 1CV7A 5ER4X 1BG1A 5LTRA 4W7FA 2FZUA 4GNKB 1K9UA 2NCPA 1NUBA 5HZUA 4Q7TA 3D78A 3UNWA 4KA9A 4DXIA 1A75B 4W6JA 1U5IB 3IR8A 1OSAA 4ZB1A 1PSRA 1QS7A 3ST0A 1RWYA 4LJCA 3DQAA 1XYDA 2GW3A 5H87A 4DCKA 3U0KA 1QV1A 1OMDA 2PSRA 3BOWB 1XFUO 1QVIZ 5FI6A 4ZFSA 2DD7A 2ZMUA 5LTQA 5HGEA 1LVCD 1Q4AA 3NXAA 4YGCB 4OCIA 4DKMA 1LINA 2G16B 5DTYA 4CFQA 4CPVA 1W7UA 4W6SA 4FQOA 3DVKA 1MOVA 2EHBA 2Z6ZA 3DQOA 3TDZA 2FWQA 3EVPA 5DKNA 5H89A 3DQCA 1V1FA 5DKRA 2LLTA 1SL7A 3CZ0A 2JULA 2HPSA 2YE0A 5FI2A 1KFXL 1CLMA 1NX3A 3JVTC 2EMDA 3DQ3A 2PXWA 2L4HA 1KK7Y 4LQUA 1XVJA 1DQEA 4IL1A 4M2QA 5FYXA 3E5VA 2KAVA 5EL2A 1W7SA 4AQJA 5I2LA 1TNWA 2HQWA 5DRGA 1XMZA 2JTTA 4W6UA 3ST3A 1K8UA 1IJ6A 1YHGA 3DVMA 1FI5A 2K60A 2F2OA 3JTDC 3PM2A 1RMPA 3SG5A 2BKHB 4UPGA 1TWOA 4WQ3A 3CLNA 2KFHA 1JUOA 4H3LA 3SS4A 2WCEA 3FWBA 2MBXA 4MBEA 3IP2A 1CDMA 2M49B 1CM4A 1ORGA 3SSPA 4P76A 1XFRA 1EMBA 4HRHA 2P71A 1H6RA 4Q7RA 3I5FC 4KW9A 3SRYA 3BXKA 2A4JA 2QEHA 1EMEA 2FJUB 1CLBA 4Q9XA 3ST4A 4I2YA 4R1EA 1W7IB 3SVUA 5HW9A 1ZGPA 1J55A 2A52B 3PJBA 1YX8A 3VRNA 1B47A 5HLVA 2FCDA 3PALA 4PALA 5HL1A 1UHJA 2O24A 5I2OA 3LVAA 4HSZA 4YGEB 4HQCA 5FI7A 3BUNB 4RYWA 1TN4A 4KYNA 2Y1NA 4RYSA 2LMTA 1EMFA 1SCVA 1CTRA 1TUJA 3QMEA 5CSJA 1QYFA 3DQ6A 2BE4A 1IQ3A 4JKTA 1J7QA 1ZMZA 2LP3A 4TZAA 1NX2A 2M1KB 2PVBA 3GJ2A 4IK8A 4CLNA 4L13A 2OKWA 2LM5A 3EK4A 1H4UA 4KF5A 1FF1A 2G3OA 2O60A 4GUKA 4BDUA 2IB5A 2Z1OA 3CFAA 3DQEA 1PALA 3M0WA 4PPJA 4PFEA 3SSYA 2JT0A 3DYEA 3R1VA 2H9WA 2FCEA 2M8UA 1IGVA 2BCBA 4DXOA 1AUIB 4OHSA 1EMLA 1IIOA 4KPIA 4J8AA 2KGBC 5ER5A 4MSPA 3MSEB 3SVDA 2JXLA 2ZMWA 3TZ1A 2KBMA 4HQ9A 1K2HA 1JF0A 2KLDA 2R2IA 2KHNA 4NDBA 3TDIA 3U0LA 4C0KA 1DT7B 5DPJA 1MF8B 5PALA 1IWQA 2BKIB 2H2KA 2M29A 4N5XA 3PJ7A 1KK7Z 2KBIA 1K93D 4BY4A 4W74A 1N2DA 1XA9A 3D10A 1YZWA 5HZSA 4W6GA 2QDIA 2DUHA 2BBMA 2LE9B 2L98A 4PHMA 2QLGA 1A03A 1AP4A 1RRXA 3LL8B 1MXEA 1QLKA 4DXPA 4MLWA 2LAPA 4JQ0D 1JSAA 2OGRA 4F7FA 5HKWA 2SASA 1SL8A 2ZNEA 1UHHA 1XK4A 3DY9A 2CT9A 3CGAA 4F0ZB 1DC1A 2WCFA 3PFVA 5TNCA 5EB7A 1QVIY 1BJFA 3R1OA 1B7TY 2QEBA 1SW8A 5FHVA 1GM0A 2HGDA 1QLSA 1K9KA 2JU0A 4YRUA 5CPVA 2WNDA 2JT3A 1JWDA 4J88A 3SVCA 5DPGA 2ZO7A 1CMFA 3DQIA 5EHUA 2KQ6A 1BMOA 2AWKA 4JWQA 2LVIA 4DXNA 3GEXA 2A50B 1KWOB 4W6HA 2G6XA 5H88A 1XA5A 3BFHA 2LP2A 3KCSA 2I2RE 2FOTA 3DQ1A 2QLGB 3S0DA 3TS5C 1C7VA 1OXEA 1OQPA 4PE0A 1ZOTB 2GX0A 3NSIA 4TNCA 4W6KA 1QY3A 4QJ3B 3TMTA 3IVTA 3BXAA 2K8MB 1JC2A 2JT8A 2H5PA 2G2SB 1QX5B 2QZ0A 4YGAA 1F0BA 2G6EA 1A2XA 3LA1A 2AUCA 3FE8A 1BFPA 5I8NA 4A4BA 2K61A 3VROA 2DUFA 1JFJA 1SL9A 2IS9A 4AQIA 4ZIOA 3S0FA 3SVBA 2KI6C 2LHIA 1C3YA 2E6WA 5CSFA 1Q4CA 2A56B 3S0GA 3ADFA 3BFBA 1F4QA 2LUXA 1L7ZA 1UUSA 4EMQA 1DGVA 5DQBA 1TRFA 4N1GA 1F70A 2AWLA 2EMOA 2H8QA 4LW5A 3EKJA 3WCKA 3DQFA 1RK9A 2MRDA 1ZGQA 5IBWA 3KPXA 3CFHA 1TNQA 1C4FA 4ORAB 2ZO6A 4NQGA 2PMYA 3SSLA 2ERBA 2WCHA 1ALVA 1OOHA 4KF5C 3LSAA 2JRFA 2P70A 4U2VA 3LCPC 5KSZA 1CDPA 1G33A 3DVEA 3BX9A 1UWOA 1CLLA 4ZINA 3GL4A 2KLEA 2QRFA 5DPHA 2GW4B 2F3ZA 4N1FA 1X02A 3H1RA 1NCXA 4NWSA 1S3PA 1W9ZA 4W6BA 4MZJA 4GOBA 1YRUB 1M31A 1V1GA 2H8VA 4U8DA 4W6IA 2AMIA 4ANJA 1KYRA 1TCOB 2P6BB 2VADA 1A4PA 4EDOA 2PASA 1RFJA 4IK3A 3E5WA 1RROA 1YUUA 2KSPA 1BR4B 1JC1A 5KTGA 2AWMA 3AAJA 2OPOA 5HZTA 1KQMB 3SVRA 2PQLA 2FJYA 3PLFB 3NHTA 1VRKA 2WHSA 1BR1B 1DVIA 1EXRA 2H6VA 2Q6PA 4LJBA 4DIRA 1KWOC 3BXBA 4EN1A 4C0LA 3VICA 3BJHA 1J1EA 1SMGA 3K1EA 3NSLA 2WISA 2L2CA 2DDDA 3RM1A 1ZACA 2AH8A 2H5OA 3AI4A 4GGFC 1B7TZ 4BY5A 3V2LA 2IOVA 4OQWA 5HZOA 1RM9A 1F55A 2RH7A 5HLOA 3PATA 3U0NA 1XK4C 2BE6A 3SVOA 3SS5A 2LV7A 1UHNA 1GL4A 3A8SA 3BUWB 5DRFA 3SJSA 1B4CA 2LMVA 2WOSA 2LANA 4OV2A 2A54B 2LVKA 3FE6A 3SVNA 3H1OA 1IQ5A 1MHOA 4XJKA 1FPWA 2KNEA 1EMMA 2C9JA 3KEVA 1Y6WA 4Z4MA 2KQYA 4W76A 4OKHA 3O77A 3ZWHA 1PRWA 1GFLA 5HKYA 4XVPA 1S26D 3CD9A 4OZDA 2GV5A 2JZIA 2WCLA 1T14A 2DOQA 1B8LA 1XO5A 2QLIA 3CYZA 5DPIA 5EXCI 5EJUA 4ZF5A 2Z6YA 4MRYA 3EVRA 1HUYA 1CM1A 3U8AA 3P8UA 3DQ7A 1NPQA 2KGRA 4YBHB 1LKJA 4HE4A 4R6BA 1AK8A 2OKYA 3N7HA 3L4AA 1QXTA 2KYFA 1YHIA 5DTXA 4JD9A 3OB2B 1KP5A 2GGZA 1DJXA 4H48A 3OHMB 2M7NA 1KFUL 4PHNA 4YI9A 1AHRA 3OGOA 2ZKMX 4XJKB 3R1PA 1RECA 1XFZO 3U8PA 4W6LA 1Z2CB 1GGXA 3DVJA 2KYCA 4ICBA 2CBLA 3KF9A 3AI5A 3D76A 3CD1A 2EGDA 2YDZA 2F3YA 4GBAA 1KQMC 5CSNA 2HETA 1K95A 3BUXB 2EMNA 3VRPA 1KQVA 3GK1A 1TOPA 2V53A 4IZNA 2K7BA 3ZULA 1BF5A 2JNFA 5AANA 3KCTA 4ZCUA 1K9PA 1DJZA 1NSHA 3BXCA 1WDCB 4W7EA 2WHUA 4E68A 3NF0A 4L12A 4DKNA 2VVHA 3DQKA 2ZRSA 3DQ4A 1K94A 1NCZA 3I5GB 1F09A 2MJWB 4UTSA 1Y1UA 3SG2A 2KDHA 3B87A 3CR4X 1QJTA 4OVNF 1NWDA 2PRUA 1PVAA 3LF4B 4H47A 2VVJA 1Y1XA 3TS5B 1LA0A 4P5OE 3L4LA 1GGZA 4ETOA 1IH0A 4QJ5B 2BL0B 2K7DA 5J3XA 2KFFA 3CABA 1HCJA 1K96A 1OXFA 3NSOA 1MR8A 2QACA 2CCMA 1SR6B 4MEWA 4PPLA 3QRXA 3WHUB 1QATA 3SG3A 4W6OA 2H5RA 5KU1A 4XL5A 2I7AA 4C0JA 3DQJA 1YJ2A 2G5ZB 3C1VA 2Q57A 2ISDA 1EG3A 5D7FA 4W7RA 1OMRA 4MVFA 1OMVA 4M2OA 3TUYB 2OTGB 3G9AA 2IB6A 4ORCB 3DQNA 1JFKA 4EULA 3U0MA 1FBVA 1QXPA 2KI6D 5AEQA 2KOTA 2G6YA 3EG5B 5HKZA 1Y1AA 1QX7A 1YHHA 3CR2A 1ZFSA 1LA3A 4AS8A 3DQDA 3BQ3A 3PJ5A 5DU0A 2QU1A 1CDLA 4ORBB 4OGSA 1F4OA 3I5HB 3F45A
chains in the Genus database with same CATH topology
3SIAA 3DQ8A 1SRAA 2PALA 3CZTX 1YX7A 3VRQA 2IE2A 4XGYA 3I5IC 2L51A 1H8BA 3K1KA 2LVVA 1NX0A 3IF7A 1Q73A 1N65A 2WSOA 5GQQC 2Y1MA 4AR7A 1EH2A 1DJHA 4W6TA 3IQOA 3SVSA 1G8IA 2ZFDA 3LVCA 2LUCA 4I5KA 3ZUFA 5J2OA 1H4BA 4KGFA 4ZF4A 1BT6A 3LK1A 4MZLA 1EL4A 2M0RA 1KFXS 4YGDB 1WLMA 5BT0A 4CIDA 4NDDA 1CB1A 2LVJA 1MYWA 2QLEA 2LHLA 2L50A 2HF5A 2L5XB 1WDCC 3EKHA 5BQLA 3EK8A 1ODBA 4HQ8A 4W69A 3OX5A 1OE9B 3DPZA 1M63B 1L2OB 4EDSA 3I5GC 4HRGA 2L2EA 1SBJA 3FS7A 3M22A 2WORA 2POXA 2K7OA 4XOVA 2GGMA 5JJGA 2PXSA 2MHHA 1RTP1 3U8CA 1TNXA 3DQ9A 1QTXA 2BL0C 1B9AA 1YJFA 2B3PA 2YFPA 4RTCA 4I5NB 4H3NA 1SR6C 4PCWA 1RMOA 1ZUZA 2Y5IA 4ZBLA 1F8HA 2A48A 3DQHA 1XFWO 2HPWA 1N0YA 4W6MA 1YUSA 2HRSA 3WLDA 2EC6B 4KGEA 1OXDA 3CR5X 1S5GZ 4JEOA 4AOMA 2AAOA 4GFTA 1OZSA 3TUYC 2OTGC 4KEXA 3NEDA 1A29A 1XFXO 1JF2A 1SKTA 1YVHA 3PM8A 4PHJA 1KYSA 1MQ1A 4PDZA 1S6ZA 3LF3A 3I5HC 5HBDA 2HFCA 2G2BA 2Q91A 1GJYA 4GGNA 2Z6XA 1SK6D 1WLZA 2HJOA 1NP8A 3KHEA 4LJDA 3GK2A 2K0JA 2WC8A 1YFPA 2F33A 2VRGA 3M24A 1RJVA 3SG4A 2LLUA 1J7RA 1J7PA 1NYAA 3OB1B 5AFPA 1JBAA 3DPWA 1PK0D 3VGOA 2M9GA 2Y4QA 4QJ4B 4WQ2A 3ZTFA 3FWCA 3DQ2A 2CTNA 3CB9A 3SSHA 3LS3A 3HX4A 1PVBA 1MOUA 4L1IA 1DMOA 2JADA 3RWAA 4M2PA 1RMMA 2HQZA 1L2OC 2B3QA 2F2PA 3MGFA 2V4EA 3GOFA 2Q4UA 2QT2A 2JWWA 2JQ6A 4ZCVA 1EG4A 1UISA 1D1OA 3SSKA 3SVEA 2JPTA 4B5YA 1DJGA 4I5JA 4PE7A 3GJ1A 3TMRA 1XAEA 4W73A 5DKQA 2BBNA 5I2QA 1IKUA 4N3DA 2G3DB 4JFGA 4JC2A 3DQMA 4MRXA 2WHTA 2HGYA 5DTZA 2EC6C 2JC2A 5FVIA 3BYAA 2LC5A 1YR5A 1DJYA 3RWTA 3AKOA 5FVFA 2V4EB 1TTXA 4TZGA 4YI8A 1OOJA 2QLHA 2DD9A 2D8NA 1B9CA 2L4IA 3BUOB 3NSKA 4LQTA 4A4CA 5T3IA 4PHKA 4W6RA 3E3RA 1E8AA 2B1UA 1YRTB 1QYQA 5B8IB 2ZRTA 3DF0A 4XYNA 1EMKA 3SV5A 1QASA 2OJKA 1R6PA 4HREE 3UFZA 3AKAA 1C07A 1IG5A 1SY9A 2OS8C 4W7DA 2ARLA 3CBEA 5BTTA 5F6TA 2VVIA 4GPLB 1CFPA 3DD4A 2QPTA 1TNPA 4D1EA 1FI6A 3I5IB 2M97A 5AERA 3A8RA 2NLNA 1QYOA 1R2UA 1J1DA 3DPXA 4DS7A 3WHTB 1FW4A 2JXCA 2KI4B 2BECA 1BU3A 2SCPA 4Q9WA 3O6BA 2I18A 3PN7B 2WSNA 1CMGA 2E30A 3WNXB 1PSBA 2BCXA 2LNKA 3DF0B 3HCMA 2DUEA 4OJ0A 3FIAA 4R6DA 2BTJA 1MWNA 5DQMA 3EK7A 1BODA 1M45A 1J7OA 4W77A 1IRJA 1PULA 4LJDC 1Q4BA 1ZUXA 3W1CA 3CFFA 1EMGA 1Q80A 3O2PA 3ED8A 4JF9A 3OX6A 5F9GA 3PSRA 5BTTB 1Q4DA 3I19A 1S1EA 1DF0A 5EBJA 3OP0A 1G7KA 3PIBA 4JGEA 2OTEA 2H5QA 2CNPA 4W7XA 1ALWA 1DTLA 3CS1A 2C9IA 1K90D 2ZN8A 3DQLA 1BOCA 1SYMA 4PPKA 1S5GY 4DXMA 3EVVA 4W7CA 2KAXA 4IK1A 4PE1A 2A53B 3O78A 3ZNIA 5CSIA 3NT3A 1XQMA 4DRWA 3ZUJA 2WIQA 1S6IA 2LMUA 3VK1A 1YTZC 2VZXA 1WRZA 2V4EC 3P28A 2NZ0A 4W75A 1NIWA 2DUGA 2VAEA 4W72A 4OR9B 2M7LA 4ORNA 4JPZB 5EXBA 2O5GA 2H61A 2A47A 1DF0B 1HT9A 2K2AA 1KK8B 1UP5A 2LLSA 1KCYA 3AAKA 3LLEA 1NCYA 5G08A 4KAGA 3SSVA 1SCMB 1JBYA 1BLQA 3D0YA 5EXUA 1QIVA 5HYDA 3UG0A 3WLCA 4GESB 3LK0A 2HQKA 4OY4A 3S05A 2AWJA 1B8RA 3LVDA 2L0PA 4I5LB 3SG7A 3E5TA 1F71A 2HQ8A 2LCPA 2KI4C 2WURA 2MAZA 3EVUA 1SNLA 4J89A 3CTNA 3IQQA 1S6CA 3PN7C 1ZGOA 4MN0A 3ST2A 2JNXA 1WRLA 3VHTA 4ZF3A 1XFYO 2JOJA 1C7WA 3V3DA 1Y0VH 1G4YR 1MUXA 4GGFA 1M39A 2BCAA 4WRIA 2ICRA 1TCFA 3KO0A 3DQ5A 1KSOA 1XSSA 2K7CA 1UHIA 3NT9A 1AVSA 1JC0A 1CFDA 2I94A 1HQVA 2K2FA 1GGWA 3D0YB 2CXJA 5FVGA 5JOLA 1GQMA 1KSMA 5AXIA 2NCOA 3AKBA 4DXQA 1IJ5A 1WRKA 1QIWA 2AHAA 1JBZA 1DGUA 4L9MA 4GF6B 3K21A 1LXFC 2HCGA 5LK4A 1TIZA 3W1DA 5D69A 3ICBA 2WCBA 2DDCA 1MXLC 3VRRA 4B30A 4NDCA 2Y0GA 1UURA 1XFVO 4P1QA 3OSQA 3A4UB 1KFUS 3SIBA 1YVLA 4W7AA 4YGBB 1Z1PA 2COLB 4H3MA 4W6AA 1DJIA 3VHTB 3GK4X 1W7JB 4IK5A 1WY9A 3CWGA 2DUIA 4KF4A 1CFFA 4IK4A 1AJ5A 2FL1A 1SPYA 2G9BA 5K89A 3DQUA 3RLZA 4W6CA 1B8CA 3WXAA 5KTYA 5DTLA 1QV0A 1S36A 5AQBB 1EJ3A 4W6NA 5DY6A 3H4SE 1B1GA 4W6FA 1YUTA 1AJ4A 2F8PA 4KW4A 2O29A 3SSTA 4W6DA 1KK8C 4GAOA 2MA2A 1EMCA 4Z4KA 1Q4EA 2TN4A 3SG6A 2OTBA 4KW8A 1SCMC 1DJWA 4CFRA 4JRBA 1CNPA 2ZNDA 3JVTB 1W7TA 5BPJA 1UHKA 4B30B 4P2YB 1CDNA 1QX2A 3OSRA 1Z1QA 5LTPA 4USLA 1EMAA 3O4YA 3NEZA 1YURA 3CGLA 2KFGA 2M3WA 2M1UA 2KAYA 4IK9A 1A75A 1U5IA 4PE4A 2MLEC 3GB3A 4XOWA 2OS8B 1M46A 3BUMB 1KYPA 4Q7UA 2A46A 3JTDB 1F54A 2RGIA 2MLFC 3TDUA 2ZN9A 1NX1A 4MZKA 1CFCA 4HVFA 3SS0A 4FTGA 4W6PA 2O2BA 2P4MA 5EB6A 2NXQA 2YE1A 2GX2A 3BOWA 2JTZA 4DUQA 2H61C 4Q04A 1CKKA 1S6JA 3I5FB 1OZOA 1CV7A 5ER4X 1BG1A 5LTRA 4W7FA 2FZUA 4GNKB 1K9UA 2NCPA 1NUBA 5HZUA 4Q7TA 4DXIA 4KA9A 1A75B 4W6JA 1U5IB 3IR8A 1OSAA 4ZB1A 1PSRA 1QS7A 3ST0A 1RWYA 4LJCA 3DQAA 1XYDA 2GW3A 5H87A 4DCKA 3U0KA 1QV1A 1OMDA 2PSRA 3BOWB 1XFUO 1QVIZ 4ZFSA 2DD7A 2ZMUA 5LTQA 5HGEA 1LVCD 1Q4AA 3NXAA 4YGCB 4OCIA 4DKMA 1LINA 2G16B 5DTYA 4CFQA 4CPVA 1W7UA 4W6SA 4FQOA 3DVKA 1MOVA 2EHBA 2Z6ZA 3DQOA 3TDZA 2FWQA 3EVPA 5DKNA 5H89A 3DQCA 1V1FA 5DKRA 2LLTA 1SL7A 2JULA 2HPSA 2YE0A 1KFXL 1CLMA 1NX3A 3JVTC 2EMDA 3DQ3A 2PXWA 2L4HA 1KK7Y 4LQUA 1XVJA 4IL1A 4M2QA 5FYXA 3E5VA 2KAVA 1W7SA 4AQJA 5I2LA 1TNWA 2HQWA 5DRGA 1XMZA 2JTTA 4W6UA 3ST3A 1K8UA 1IJ6A 1YHGA 3DVMA 1FI5A 2F2OA 3JTDC 1RMPA 3SG5A 2BKHB 4UPGA 4WQ3A 3CLNA 2KFHA 1JUOA 4H3LA 2WCEA 3FWBA 2MBXA 4MBEA 3IP2A 1CDMA 2M49B 1CM4A 3SSPA 4P76A 1EMBA 4HRHA 1H6RA 4Q7RA 3I5FC 4KW9A 3SRYA 3BXKA 2A4JA 1EMEA 2FJUB 1CLBA 4Q9XA 3ST4A 4I2YA 4R1EA 1W7IB 3SVUA 5HW9A 1ZGPA 1J55A 2A52B 3PJBA 1YX8A 3VRNA 1B47A 5HLVA 2FCDA 3PALA 4PALA 1UHJA 2O24A 5I2OA 3LVAA 4HSZA 4YGEB 4HQCA 3BUNB 4RYWA 1TN4A 2Y1NA 4RYSA 2LMTA 1EMFA 1SCVA 1CTRA 5CSJA 1QYFA 3DQ6A 2BE4A 1IQ3A 1J7QA 1ZMZA 2LP3A 4TZAA 1NX2A 2M1KB 2PVBA 3GJ2A 4IK8A 4CLNA 4L13A 2OKWA 2LM5A 3EK4A 1H4UA 4KF5A 1FF1A 2G3OA 2O60A 4GUKA 4BDUA 2IB5A 2Z1OA 3CFAA 3DQEA 1PALA 3M0WA 4PPJA 4PFEA 3SSYA 2JT0A 2H9WA 2FCEA 2M8UA 1IGVA 2BCBA 4DXOA 1AUIB 4OHSA 1EMLA 4KPIA 4J8AA 2KGBC 5ER5A 4MSPA 3MSEB 3SVDA 2JXLA 2ZMWA 3TZ1A 2KBMA 4HQ9A 1K2HA 1JF0A 2R2IA 2KHNA 4NDBA 3TDIA 3U0LA 4C0KA 1DT7B 5DPJA 1MF8B 5PALA 1IWQA 2BKIB 2H2KA 2M29A 4N5XA 3PJ7A 1KK7Z 2KBIA 1K93D 4BY4A 4W74A 1N2DA 1XA9A 3D10A 1YZWA 5HZSA 4W6GA 2DUHA 2BBMA 2LE9B 2L98A 4PHMA 2QLGA 1A03A 1AP4A 1RRXA 3LL8B 1MXEA 1QLKA 4DXPA 4MLWA 2LAPA 4JQ0D 1JSAA 2OGRA 5HKWA 2SASA 1SL8A 2ZNEA 1UHHA 1XK4A 2CT9A 3CGAA 4F0ZB 2WCFA 3PFVA 5TNCA 5EB7A 1QVIY 1BJFA 1B7TY 1SW8A 5FHVA 2HGDA 1QLSA 1K9KA 2JU0A 4YRUA 5CPVA 2WNDA 2JT3A 1JWDA 4J88A 3SVCA 5DPGA 2ZO7A 1CMFA 3DQIA 5EHUA 2KQ6A 1BMOA 2AWKA 4JWQA 2LVIA 4DXNA 3GEXA 2A50B 1KWOB 4W6HA 2G6XA 5H88A 1XA5A 2LP2A 3KCSA 2I2RE 2FOTA 3DQ1A 2QLGB 3TS5C 1C7VA 1OXEA 1OQPA 4PE0A 1ZOTB 2GX0A 3NSIA 4TNCA 4W6KA 1QY3A 4QJ3B 3TMTA 3BXAA 2K8MB 1JC2A 2JT8A 2H5PA 2G2SB 1QX5B 2QZ0A 4YGAA 1F0BA 2G6EA 1A2XA 3LA1A 2AUCA 1BFPA 5I8NA 4A4BA 2K61A 3VROA 2DUFA 1JFJA 1SL9A 2IS9A 4AQIA 4ZIOA 3SVBA 2KI6C 2LHIA 2E6WA 5CSFA 1Q4CA 2A56B 3ADFA 1F4QA 2LUXA 1L7ZA 1UUSA 4EMQA 1DGVA 5DQBA 1TRFA 4N1GA 1F70A 2AWLA 2EMOA 2H8QA 4LW5A 3EKJA 3WCKA 3DQFA 1RK9A 2MRDA 1ZGQA 5IBWA 3KPXA 3CFHA 1TNQA 1C4FA 4ORAB 2ZO6A 4NQGA 2PMYA 3SSLA 1ALVA 4KF5C 3LSAA 2JRFA 4U2VA 3LCPC 5KSZA 1CDPA 1G33A 3DVEA 3BX9A 1UWOA 1CLLA 4ZINA 3GL4A 2QRFA 5DPHA 2GW4B 2F3ZA 4N1FA 1X02A 3H1RA 1NCXA 4NWSA 1S3PA 4W6BA 4MZJA 4GOBA 1YRUB 1M31A 1V1GA 4U8DA 4W6IA 2AMIA 4ANJA 1KYRA 1TCOB 2P6BB 2VADA 1A4PA 4EDOA 2PASA 1RFJA 4IK3A 3E5WA 1RROA 1YUUA 2KSPA 1BR4B 1JC1A 5KTGA 2AWMA 3AAJA 2OPOA 5HZTA 1KQMB 3SVRA 3PLFB 1VRKA 2WHSA 1BR1B 1DVIA 1EXRA 2H6VA 2Q6PA 4LJBA 4DIRA 1KWOC 3BXBA 4EN1A 4C0LA 3VICA 1J1EA 1SMGA 3NSLA 2WISA 2DDDA 3RM1A 1ZACA 2AH8A 2H5OA 3AI4A 4GGFC 1B7TZ 4BY5A 2IOVA 4OQWA 5HZOA 1RM9A 1F55A 2RH7A 5HLOA 3PATA 3U0NA 1XK4C 2BE6A 3SVOA 2LV7A 1UHNA 1GL4A 3A8SA 3BUWB 5DRFA 3SJSA 1B4CA 2LMVA 2WOSA 2LANA 4OV2A 2A54B 2LVKA 3SVNA 3H1OA 1IQ5A 1MHOA 4XJKA 1FPWA 2KNEA 1EMMA 2C9JA 3KEVA 1Y6WA 4Z4MA 2KQYA 4W76A 4OKHA 3O77A 3ZWHA 1PRWA 1GFLA 5HKYA 4XVPA 1S26D 3CD9A 2GV5A 2JZIA 2DOQA 1B8LA 1XO5A 2QLIA 5DPIA 5EXCI 5EJUA 4ZF5A 2Z6YA 4MRYA 3EVRA 1HUYA 1CM1A 3U8AA 3P8UA 3DQ7A 4R6BA 1NPQA 2KGRA 1LKJA 4YBHB 4HE4A 1AK8A 2OKYA 1QXTA 2KYFA 1YHIA 5DTXA 3OB2B 1KP5A 2GGZA 1DJXA 4H48A 3OHMB 2M7NA 1KFUL 4PHNA 4YI9A 1AHRA 3OGOA 2ZKMX 4XJKB 1RECA 1XFZO 3U8PA 4W6LA 1GGXA 3DVJA 2KYCA 4ICBA 2CBLA 3KF9A 3AI5A 3CD1A 2EGDA 2YDZA 2F3YA 4GBAA 1KQMC 5CSNA 2HETA 1K95A 3BUXB 2EMNA 3VRPA 1KQVA 3GK1A 1TOPA 2V53A 4IZNA 2K7BA 3ZULA 1BF5A 2JNFA 5AANA 3KCTA 4ZCUA 1K9PA 1DJZA 1NSHA 3BXCA 1WDCB 4W7EA 2WHUA 4E68A 3NF0A 4L12A 4DKNA 2VVHA 3DQKA 2ZRSA 3DQ4A 1K94A 1NCZA 3I5GB 1F09A 2MJWB 4UTSA 1Y1UA 3SG2A 2KDHA 3CR4X 1QJTA 4OVNF 1NWDA 2PRUA 1PVAA 3LF4B 4H47A 2VVJA 1Y1XA 3TS5B 1LA0A 4P5OE 1GGZA 4ETOA 1IH0A 4QJ5B 2BL0B 2K7DA 5J3XA 2KFFA 1HCJA 1K96A 1OXFA 3NSOA 1MR8A 2QACA 2CCMA 1SR6B 4MEWA 4PPLA 3QRXA 3WHUB 1QATA 3SG3A 4W6OA 2H5RA 5KU1A 4XL5A 2I7AA 4C0JA 3DQJA 1YJ2A 2G5ZB 3C1VA 2Q57A 2ISDA 1EG3A 5D7FA 4W7RA 1OMRA 4MVFA 1OMVA 4M2OA 3TUYB 2OTGB 3G9AA 2IB6A 4ORCB 3DQNA 1JFKA 4EULA 3U0MA 1FBVA 1QXPA 2KI6D 5AEQA 2KOTA 2G6YA 5HKZA 1Y1AA 1QX7A 1YHHA 3CR2A 1ZFSA 1LA3A 4AS8A 3DQDA 3BQ3A 3PJ5A 5DU0A 2QU1A 1CDLA 4ORBB 4OGSA 1F4OA 3I5HB 3F45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIA A;  3DQ8 A;  1SRA A;  2PAL A;  3CZT X;  1YX7 A;  3VRQ A;  2IE2 A;  4XGY A;  3I5I C;  2L51 A;  1H8B A;  3K1K A;  2LVV A;  1NX0 A;  3IF7 A;  1Q73 A;  1N65 A;  2WSO A;  5GQQ C;  2Y1M A;  4AR7 A;  1EH2 A;  1DJH A;  4W6T A;  3IQO A;  3SVS A;  1G8I A;  2ZFD A;  3LVC A;  2LUC A;  4I5K A;  3ZUF A;  5J2O A;  1H4B A;  4KGF A;  4ZF4 A;  1BT6 A;  3LK1 A;  4MZL A;  1EL4 A;  2M0R A;  1KFX S;  4YGD B;  1WLM A;  5BT0 A;  4CID A;  4NDD A;  1CB1 A;  2LVJ A;  1MYW A;  2QLE A;  2LHL A;  2L50 A;  2HF5 A;  2L5X B;  1WDC C;  3EKH A;  5BQL A;  3EK8 A;  1ODB A;  4HQ8 A;  4W69 A;  3OX5 A;  1OE9 B;  3DPZ A;  1M63 B;  1L2O B;  4EDS A;  3I5G C;  4HRG A;  2L2E A;  1SBJ A;  3FS7 A;  3M22 A;  2WOR A;  2POX A;  2K7O A;  4XOV A;  2GGM A;  5JJG A;  2PXS A;  2MHH A;  1RTP 1;  3U8C A;  1TNX A;  3DQ9 A;  1QTX A;  2BL0 C;  1B9A A;  1YJF A;  2B3P A;  2YFP A;  4RTC A;  4I5N B;  4H3N A;  1SR6 C;  4PCW A;  1RMO A;  1ZUZ A;  2Y5I A;  4ZBL A;  1F8H A;  2A48 A;  3DQH A;  1XFW O;  2HPW A;  1N0Y A;  4W6M A;  1YUS A;  2HRS A;  3WLD A;  2EC6 B;  4KGE A;  1OXD A;  3CR5 X;  1S5G Z;  4JEO A;  4AOM A;  2AAO A;  4GFT A;  1OZS A;  3TUY C;  2OTG C;  4KEX A;  3NED A;  1A29 A;  1XFX O;  1JF2 A;  1SKT A;  1YVH A;  3PM8 A;  4PHJ A;  1KYS A;  1MQ1 A;  4PDZ A;  1S6Z A;  3LF3 A;  3I5H C;  5HBD A;  2HFC A;  2G2B A;  2Q91 A;  1GJY A;  4GGN A;  2Z6X A;  1SK6 D;  1WLZ A;  2HJO A;  1NP8 A;  3KHE A;  4LJD A;  3GK2 A;  2K0J A;  2WC8 A;  1YFP A;  2F33 A;  2VRG A;  3M24 A;  1RJV A;  3SG4 A;  2LLU A;  1J7R A;  1J7P A;  1NYA A;  3OB1 B;  5AFP A;  1JBA A;  3DPW A;  1PK0 D;  3VGO A;  2M9G A;  2Y4Q A;  4QJ4 B;  4WQ2 A;  3ZTF A;  3FWC A;  3DQ2 A;  2CTN A;  3CB9 A;  3SSH A;  3LS3 A;  3HX4 A;  1PVB A;  1MOU A;  4L1I A;  1DMO A;  2JAD A;  3RWA A;  4M2P A;  1RMM A;  2HQZ A;  1L2O C;  2B3Q A;  2F2P A;  3MGF A;  2V4E A;  3GOF A;  2Q4U A;  2QT2 A;  2JWW A;  2JQ6 A;  4ZCV A;  1EG4 A;  1UIS A;  1D1O A;  3SSK A;  3SVE A;  2JPT A;  4B5Y A;  1DJG A;  4I5J A;  4PE7 A;  3GJ1 A;  3TMR A;  1XAE A;  4W73 A;  5DKQ A;  2BBN A;  5I2Q A;  1IKU A;  4N3D A;  2G3D B;  4JFG A;  4JC2 A;  3DQM A;  4MRX A;  2WHT A;  2HGY A;  5DTZ A;  2EC6 C;  2JC2 A;  5FVI A;  3BYA A;  2LC5 A;  1YR5 A;  1DJY A;  3RWT A;  3AKO A;  5FVF A;  2V4E B;  1TTX A;  4TZG A;  4YI8 A;  1OOJ A;  2QLH A;  2DD9 A;  2D8N A;  1B9C A;  2L4I A;  3BUO B;  3NSK A;  4LQT A;  4A4C A;  5T3I A;  4PHK A;  4W6R A;  3E3R A;  1E8A A;  2B1U A;  1YRT B;  1QYQ A;  5B8I B;  2ZRT A;  3DF0 A;  4XYN A;  1EMK A;  3SV5 A;  1QAS A;  2OJK A;  1R6P A;  4HRE E;  3UFZ A;  3AKA A;  1C07 A;  1IG5 A;  1SY9 A;  2OS8 C;  4W7D A;  2ARL A;  3CBE A;  5BTT A;  5F6T A;  2VVI A;  4GPL B;  1CFP A;  3DD4 A;  2QPT A;  1TNP A;  4D1E A;  1FI6 A;  3I5I B;  2M97 A;  5AER A;  3A8R A;  2NLN A;  1QYO A;  1R2U A;  1J1D A;  3DPX A;  4DS7 A;  3WHT B;  1FW4 A;  2JXC A;  2KI4 B;  2BEC A;  1BU3 A;  2SCP A;  4Q9W A;  3O6B A;  2I18 A;  3PN7 B;  2WSN A;  1CMG A;  2E30 A;  3WNX B;  1PSB A;  2BCX A;  2LNK A;  3DF0 B;  3HCM A;  2DUE A;  4OJ0 A;  3FIA A;  4R6D A;  2BTJ A;  1MWN A;  5DQM A;  3EK7 A;  1BOD A;  1M45 A;  1J7O A;  4W77 A;  1IRJ A;  1PUL A;  4LJD C;  1Q4B A;  1ZUX A;  3W1C A;  3CFF A;  1EMG A;  1Q80 A;  3O2P A;  3ED8 A;  4JF9 A;  3OX6 A;  5F9G A;  3PSR A;  5BTT B;  1Q4D A;  3I19 A;  1S1E A;  1DF0 A;  5EBJ A;  3OP0 A;  1G7K A;  3PIB A;  4JGE A;  2OTE A;  2H5Q A;  2CNP A;  4W7X A;  1ALW A;  1DTL A;  3CS1 A;  2C9I A;  1K90 D;  2ZN8 A;  3DQL A;  1BOC A;  1SYM A;  4PPK A;  1S5G Y;  4DXM A;  3EVV A;  4W7C A;  2KAX A;  4IK1 A;  4PE1 A;  2A53 B;  3O78 A;  3ZNI A;  5CSI A;  3NT3 A;  1XQM A;  4DRW A;  3ZUJ A;  2WIQ A;  1S6I A;  2LMU A;  3VK1 A;  1YTZ C;  2VZX A;  1WRZ A;  2V4E C;  3P28 A;  2NZ0 A;  4W75 A;  1NIW A;  2DUG A;  2VAE A;  4W72 A;  4OR9 B;  2M7L A;  4ORN A;  4JPZ B;  5EXB A;  2O5G A;  2H61 A;  2A47 A;  1DF0 B;  1HT9 A;  2K2A A;  1KK8 B;  1UP5 A;  2LLS A;  1KCY A;  3AAK A;  3LLE A;  1NCY A;  5G08 A;  4KAG A;  3SSV A;  1SCM B;  1JBY A;  1BLQ A;  3D0Y A;  5EXU A;  1QIV A;  5HYD A;  3UG0 A;  3WLC A;  4GES B;  3LK0 A;  2HQK A;  4OY4 A;  3S05 A;  2AWJ A;  1B8R A;  3LVD A;  2L0P A;  4I5L B;  3SG7 A;  3E5T A;  1F71 A;  2HQ8 A;  2LCP A;  2KI4 C;  2WUR A;  2MAZ A;  3EVU A;  1SNL A;  4J89 A;  3CTN A;  3IQQ A;  1S6C A;  3PN7 C;  1ZGO A;  4MN0 A;  3ST2 A;  2JNX A;  1WRL A;  3VHT A;  4ZF3 A;  1XFY O;  2JOJ A;  1C7W A;  3V3D A;  1Y0V H;  1G4Y R;  1MUX A;  4GGF A;  1M39 A;  2BCA A;  4WRI A;  2ICR A;  1TCF A;  3KO0 A;  3DQ5 A;  1KSO A;  1XSS A;  2K7C A;  1UHI A;  3NT9 A;  1AVS A;  1JC0 A;  1CFD A;  2I94 A;  1HQV A;  2K2F A;  1GGW A;  3D0Y B;  2CXJ A;  5FVG A;  5JOL A;  1GQM A;  1KSM A;  5AXI A;  2NCO A;  3AKB A;  4DXQ A;  1IJ5 A;  1WRK A;  1QIW A;  2AHA A;  1JBZ A;  1DGU A;  4L9M A;  4GF6 B;  3K21 A;  1LXF C;  2HCG A;  5LK4 A;  1TIZ A;  3W1D A;  5D69 A;  3ICB A;  2WCB A;  2DDC A;  1MXL C;  3VRR A;  4B30 A;  4NDC A;  2Y0G A;  1UUR A;  1XFV O;  4P1Q A;  3OSQ A;  3A4U B;  1KFU S;  3SIB A;  1YVL A;  4W7A A;  4YGB B;  1Z1P A;  2COL B;  4H3M A;  4W6A A;  1DJI A;  3VHT B;  3GK4 X;  1W7J B;  4IK5 A;  1WY9 A;  3CWG A;  2DUI A;  4KF4 A;  1CFF A;  4IK4 A;  1AJ5 A;  2FL1 A;  1SPY A;  2G9B A;  5K89 A;  3DQU A;  3RLZ A;  4W6C A;  1B8C A;  3WXA A;  5KTY A;  5DTL A;  1QV0 A;  1S36 A;  5AQB B;  1EJ3 A;  4W6N A;  5DY6 A;  3H4S E;  1B1G A;  4W6F A;  1YUT A;  1AJ4 A;  2F8P A;  4KW4 A;  2O29 A;  3SST A;  4W6D A;  1KK8 C;  4GAO A;  2MA2 A;  1EMC A;  4Z4K A;  1Q4E A;  2TN4 A;  3SG6 A;  2OTB A;  4KW8 A;  1SCM C;  1DJW A;  4CFR A;  4JRB A;  1CNP A;  2ZND A;  3JVT B;  1W7T A;  5BPJ A;  1UHK A;  4B30 B;  4P2Y B;  1CDN A;  1QX2 A;  3OSR A;  1Z1Q A;  5LTP A;  4USL A;  1EMA A;  3O4Y A;  3NEZ A;  1YUR A;  3CGL A;  2KFG A;  2M3W A;  2M1U A;  2KAY A;  4IK9 A;  1A75 A;  1U5I A;  4PE4 A;  2MLE C;  3GB3 A;  4XOW A;  2OS8 B;  1M46 A;  3BUM B;  1KYP A;  4Q7U A;  2A46 A;  3JTD B;  1F54 A;  2RGI A;  2MLF C;  3TDU A;  2ZN9 A;  1NX1 A;  4MZK A;  1CFC A;  4HVF A;  3SS0 A;  4FTG A;  4W6P A;  2O2B A;  2P4M A;  5EB6 A;  2NXQ A;  2YE1 A;  2GX2 A;  3BOW A;  2JTZ A;  4DUQ A;  2H61 C;  4Q04 A;  1CKK A;  1S6J A;  3I5F B;  1OZO A;  1CV7 A;  5ER4 X;  1BG1 A;  5LTR A;  4W7F A;  2FZU A;  4GNK B;  1K9U A;  2NCP A;  1NUB A;  5HZU A;  4Q7T A;  4DXI A;  4KA9 A;  1A75 B;  4W6J A;  1U5I B;  3IR8 A;  1OSA A;  4ZB1 A;  1PSR A;  1QS7 A;  3ST0 A;  1RWY A;  4LJC A;  3DQA A;  1XYD A;  2GW3 A;  5H87 A;  4DCK A;  3U0K A;  1QV1 A;  1OMD A;  2PSR A;  3BOW B;  1XFU O;  1QVI Z;  4ZFS A;  2DD7 A;  2ZMU A;  5LTQ A;  5HGE A;  1LVC D;  1Q4A A;  3NXA A;  4YGC B;  4OCI A;  4DKM A;  1LIN A;  2G16 B;  5DTY A;  4CFQ A;  4CPV A;  1W7U A;  4W6S A;  4FQO A;  3DVK A;  1MOV A;  2EHB A;  2Z6Z A;  3DQO A;  3TDZ A;  2FWQ A;  3EVP A;  5DKN A;  5H89 A;  3DQC A;  1V1F A;  5DKR A;  2LLT A;  1SL7 A;  2JUL A;  2HPS A;  2YE0 A;  1KFX L;  1CLM A;  1NX3 A;  3JVT C;  2EMD A;  3DQ3 A;  2PXW A;  2L4H A;  1KK7 Y;  4LQU A;  1XVJ A;  4IL1 A;  4M2Q A;  5FYX A;  3E5V A;  2KAV A;  1W7S A;  4AQJ A;  5I2L A;  1TNW A;  2HQW A;  5DRG A;  1XMZ A;  2JTT A;  4W6U A;  3ST3 A;  1K8U A;  1IJ6 A;  1YHG A;  3DVM A;  1FI5 A;  2F2O A;  3JTD C;  1RMP A;  3SG5 A;  2BKH B;  4UPG A;  4WQ3 A;  3CLN A;  2KFH A;  1JUO A;  4H3L A;  2WCE A;  3FWB A;  2MBX A;  4MBE A;  3IP2 A;  1CDM A;  2M49 B;  1CM4 A;  3SSP A;  4P76 A;  1EMB A;  4HRH A;  1H6R A;  4Q7R A;  3I5F C;  4KW9 A;  3SRY A;  3BXK A;  2A4J A;  1EME A;  2FJU B;  1CLB A;  4Q9X A;  3ST4 A;  4I2Y A;  4R1E A;  1W7I B;  3SVU A;  5HW9 A;  1ZGP A;  1J55 A;  2A52 B;  3PJB A;  1YX8 A;  3VRN A;  1B47 A;  5HLV A;  2FCD A;  3PAL A;  4PAL A;  1UHJ A;  2O24 A;  5I2O A;  3LVA A;  4HSZ A;  4YGE B;  4HQC A;  3BUN B;  4RYW A;  1TN4 A;  2Y1N A;  4RYS A;  2LMT A;  1EMF A;  1SCV A;  1CTR A;  5CSJ A;  1QYF A;  3DQ6 A;  2BE4 A;  1IQ3 A;  1J7Q A;  1ZMZ A;  2LP3 A;  4TZA A;  1NX2 A;  2M1K B;  2PVB A;  3GJ2 A;  4IK8 A;  4CLN A;  4L13 A;  2OKW A;  2LM5 A;  3EK4 A;  1H4U A;  4KF5 A;  1FF1 A;  2G3O A;  2O60 A;  4GUK A;  4BDU A;  2IB5 A;  2Z1O A;  3CFA A;  3DQE A;  1PAL A;  3M0W A;  4PPJ A;  4PFE A;  3SSY A;  2JT0 A;  2H9W A;  2FCE A;  2M8U A;  1IGV A;  2BCB A;  4DXO A;  1AUI B;  4OHS A;  1EML A;  4KPI A;  4J8A A;  2KGB C;  5ER5 A;  4MSP A;  3MSE B;  3SVD A;  2JXL A;  2ZMW A;  3TZ1 A;  2KBM A;  4HQ9 A;  1K2H A;  1JF0 A;  2R2I A;  2KHN A;  4NDB A;  3TDI A;  3U0L A;  4C0K A;  1DT7 B;  5DPJ A;  1MF8 B;  5PAL A;  1IWQ A;  2BKI B;  2H2K A;  2M29 A;  4N5X A;  3PJ7 A;  1KK7 Z;  2KBI A;  1K93 D;  4BY4 A;  4W74 A;  1N2D A;  1XA9 A;  3D10 A;  1YZW A;  5HZS A;  4W6G A;  2DUH A;  2BBM A;  2LE9 B;  2L98 A;  4PHM A;  2QLG A;  1A03 A;  1AP4 A;  1RRX A;  3LL8 B;  1MXE A;  1QLK A;  4DXP A;  4MLW A;  2LAP A;  4JQ0 D;  1JSA A;  2OGR A;  5HKW A;  2SAS A;  1SL8 A;  2ZNE A;  1UHH A;  1XK4 A;  2CT9 A;  3CGA A;  4F0Z B;  2WCF A;  3PFV A;  5TNC A;  5EB7 A;  1QVI Y;  1BJF A;  1B7T Y;  1SW8 A;  5FHV A;  2HGD A;  1QLS A;  1K9K A;  2JU0 A;  4YRU A;  5CPV A;  2WND A;  2JT3 A;  1JWD A;  4J88 A;  3SVC A;  5DPG A;  2ZO7 A;  1CMF A;  3DQI A;  5EHU A;  2KQ6 A;  1BMO A;  2AWK A;  4JWQ A;  2LVI A;  4DXN A;  3GEX A;  2A50 B;  1KWO B;  4W6H A;  2G6X A;  5H88 A;  1XA5 A;  2LP2 A;  3KCS A;  2I2R E;  2FOT A;  3DQ1 A;  2QLG B;  3TS5 C;  1C7V A;  1OXE A;  1OQP A;  4PE0 A;  1ZOT B;  2GX0 A;  3NSI A;  4TNC A;  4W6K A;  1QY3 A;  4QJ3 B;  3TMT A;  3BXA A;  2K8M B;  1JC2 A;  2JT8 A;  2H5P A;  2G2S B;  1QX5 B;  2QZ0 A;  4YGA A;  1F0B A;  2G6E A;  1A2X A;  3LA1 A;  2AUC A;  1BFP A;  5I8N A;  4A4B A;  2K61 A;  3VRO A;  2DUF A;  1JFJ A;  1SL9 A;  2IS9 A;  4AQI A;  4ZIO A;  3SVB A;  2KI6 C;  2LHI A;  2E6W A;  5CSF A;  1Q4C A;  2A56 B;  3ADF A;  1F4Q A;  2LUX A;  1L7Z A;  1UUS A;  4EMQ A;  1DGV A;  5DQB A;  1TRF A;  4N1G A;  1F70 A;  2AWL A;  2EMO A;  2H8Q A;  4LW5 A;  3EKJ A;  3WCK A;  3DQF A;  1RK9 A;  2MRD A;  1ZGQ A;  5IBW A;  3KPX A;  3CFH A;  1TNQ A;  1C4F A;  4ORA B;  2ZO6 A;  4NQG A;  2PMY A;  3SSL A;  1ALV A;  4KF5 C;  3LSA A;  2JRF A;  4U2V A;  3LCP C;  5KSZ A;  1CDP A;  1G33 A;  3DVE A;  3BX9 A;  1UWO A;  1CLL A;  4ZIN A;  3GL4 A;  2QRF A;  5DPH A;  2GW4 B;  2F3Z A;  4N1F A;  1X02 A;  3H1R A;  1NCX A;  4NWS A;  1S3P A;  4W6B A;  4MZJ A;  4GOB A;  1YRU B;  1M31 A;  1V1G A;  4U8D A;  4W6I A;  2AMI A;  4ANJ A;  1KYR A;  1TCO B;  2P6B B;  2VAD A;  1A4P A;  4EDO A;  2PAS A;  1RFJ A;  4IK3 A;  3E5W A;  1RRO A;  1YUU A;  2KSP A;  1BR4 B;  1JC1 A;  5KTG A;  2AWM A;  3AAJ A;  2OPO A;  5HZT A;  1KQM B;  3SVR A;  3PLF B;  1VRK A;  2WHS A;  1BR1 B;  1DVI A;  1EXR A;  2H6V A;  2Q6P A;  4LJB A;  4DIR A;  1KWO C;  3BXB A;  4EN1 A;  4C0L A;  3VIC A;  1J1E A;  1SMG A;  3NSL A;  2WIS A;  2DDD A;  3RM1 A;  1ZAC A;  2AH8 A;  2H5O A;  3AI4 A;  4GGF C;  1B7T Z;  4BY5 A;  2IOV A;  4OQW A;  5HZO A;  1RM9 A;  1F55 A;  2RH7 A;  5HLO A;  3PAT A;  3U0N A;  1XK4 C;  2BE6 A;  3SVO A;  2LV7 A;  1UHN A;  1GL4 A;  3A8S A;  3BUW B;  5DRF A;  3SJS A;  1B4C A;  2LMV A;  2WOS A;  2LAN A;  4OV2 A;  2A54 B;  2LVK A;  3SVN A;  3H1O A;  1IQ5 A;  1MHO A;  4XJK A;  1FPW A;  2KNE A;  1EMM A;  2C9J A;  3KEV A;  1Y6W A;  4Z4M A;  2KQY A;  4W76 A;  4OKH A;  3O77 A;  3ZWH A;  1PRW A;  1GFL A;  5HKY A;  4XVP A;  1S26 D;  3CD9 A;  2GV5 A;  2JZI A;  2DOQ A;  1B8L A;  1XO5 A;  2QLI A;  5DPI A;  5EXC I;  5EJU A;  4ZF5 A;  2Z6Y A;  4MRY A;  3EVR A;  1HUY A;  1CM1 A;  3U8A A;  3P8U A;  3DQ7 A;  4R6B A;  1NPQ A;  2KGR A;  1LKJ A;  4YBH B;  4HE4 A;  1AK8 A;  2OKY A;  1QXT A;  2KYF A;  1YHI A;  5DTX A;  3OB2 B;  1KP5 A;  2GGZ A;  1DJX A;  4H48 A;  3OHM B;  2M7N A;  1KFU L;  4PHN A;  4YI9 A;  1AHR A;  3OGO A;  2ZKM X;  4XJK B;  1REC A;  1XFZ O;  3U8P A;  4W6L A;  1GGX A;  3DVJ A;  2KYC A;  4ICB A;  2CBL A;  3KF9 A;  3AI5 A;  3CD1 A;  2EGD A;  2YDZ A;  2F3Y A;  4GBA A;  1KQM C;  5CSN A;  2HET A;  1K95 A;  3BUX B;  2EMN A;  3VRP A;  1KQV A;  3GK1 A;  1TOP A;  2V53 A;  4IZN A;  2K7B A;  3ZUL A;  1BF5 A;  2JNF A;  5AAN A;  3KCT A;  4ZCU A;  1K9P A;  1DJZ A;  1NSH A;  3BXC A;  1WDC B;  4W7E A;  2WHU A;  4E68 A;  3NF0 A;  4L12 A;  4DKN A;  2VVH A;  3DQK A;  2ZRS A;  3DQ4 A;  1K94 A;  1NCZ A;  3I5G B;  1F09 A;  2MJW B;  4UTS A;  1Y1U A;  3SG2 A;  2KDH A;  3CR4 X;  1QJT A;  4OVN F;  1NWD A;  2PRU A;  1PVA A;  3LF4 B;  4H47 A;  2VVJ A;  1Y1X A;  3TS5 B;  1LA0 A;  4P5O E;  1GGZ A;  4ETO A;  1IH0 A;  4QJ5 B;  2BL0 B;  2K7D A;  5J3X A;  2KFF A;  1HCJ A;  1K96 A;  1OXF A;  3NSO A;  1MR8 A;  2QAC A;  2CCM A;  1SR6 B;  4MEW A;  4PPL A;  3QRX A;  3WHU B;  1QAT A;  3SG3 A;  4W6O A;  2H5R A;  5KU1 A;  4XL5 A;  2I7A A;  4C0J A;  3DQJ A;  1YJ2 A;  2G5Z B;  3C1V A;  2Q57 A;  2ISD A;  1EG3 A;  5D7F A;  4W7R A;  1OMR A;  4MVF A;  1OMV A;  4M2O A;  3TUY B;  2OTG B;  3G9A A;  2IB6 A;  4ORC B;  3DQN A;  1JFK A;  4EUL A;  3U0M A;  1FBV A;  1QXP A;  2KI6 D;  5AEQ A;  2KOT A;  2G6Y A;  5HKZ A;  1Y1A A;  1QX7 A;  1YHH A;  3CR2 A;  1ZFS A;  1LA3 A;  4AS8 A;  3DQD A;  3BQ3 A;  3PJ5 A;  5DU0 A;  2QU1 A;  1CDL A;  4ORB B;  4OGS A;  1F4O A;  3I5H B;  3F45 A; 
#chains in the Genus database with same CATH topology
 3SIA A;  3DQ8 A;  1DEK A;  1SRA A;  2PAL A;  3CZT X;  1YX7 A;  3VRQ A;  2IE2 A;  1SSE B;  4XGY A;  3O4X A;  3I5I C;  2L51 A;  2QEV A;  1H8B A;  3K1K A;  2LVV A;  3NHI A;  1NX0 A;  3IF7 A;  1Q73 A;  1OOG A;  1N65 A;  2WSO A;  5GQQ C;  2Y1M A;  3Q8I A;  3SS3 A;  4AR7 A;  1EH2 A;  3B86 A;  1DJH A;  4W6T A;  3IQO A;  3SVS A;  1G8I A;  2ZFD A;  3LVC A;  2LUC A;  2GTE A;  4I5K A;  3ZUF A;  5J2O A;  1H4B A;  4KGF A;  4ZF4 A;  1BT6 A;  3LK1 A;  1C3Z A;  4MZL A;  1EL4 A;  2M0R A;  1KFX S;  4YGD B;  1WLM A;  5BT0 A;  4CID A;  4NDD A;  1CB1 A;  2LVJ A;  1MYW A;  2QLE A;  2LHL A;  2L50 A;  2HF5 A;  2L5X B;  1WDC C;  3EKH A;  5BQL A;  3EK8 A;  1ODB A;  4HQ8 A;  4W69 A;  3OX5 A;  1OE9 B;  3DPZ A;  1M63 B;  1L2O B;  4EDS A;  3I5G C;  4HRG A;  2L2E A;  1SBJ A;  3FS7 A;  2WCK A;  3M22 A;  2WOR A;  2POX A;  2K7O A;  2BNX A;  4XOV A;  2GGM A;  5JJG A;  2PXS A;  2MHH A;  1RTP 1;  3U8C A;  1TNX A;  3DQ9 A;  1QTX A;  2BL0 C;  1B9A A;  1YJF A;  2B3P A;  2YFP A;  4RTC A;  2QEO A;  4I5N B;  4H3N A;  1SR6 C;  4PCW A;  1RMO A;  1ZUZ A;  2Y5I A;  4ZBL A;  1F8H A;  2A48 A;  3R72 A;  3DQH A;  1XFW O;  2HPW A;  1N0Y A;  4W6M A;  3OBV A;  1YUS A;  2HRS A;  3WLD A;  2EC6 B;  4KGE A;  1OXD A;  3CR5 X;  1S5G Z;  4JEO A;  3CZ1 A;  4AOM A;  2AAO A;  3L47 A;  4GFT A;  1OZS A;  3S0E A;  2OTG C;  3TUY C;  4KEX A;  3NED A;  1A29 A;  1XFX O;  1JF2 A;  1SKT A;  1YVH A;  3PM8 A;  4PHJ A;  1KYS A;  1MQ1 A;  4PDZ A;  3PJI A;  1S6Z A;  3LF3 A;  3I5H C;  5HBD A;  2HFC A;  2G2B A;  2Q91 A;  1GJY A;  4GGN A;  2Z6X A;  1SK6 D;  3FE9 A;  1WLZ A;  2HJO A;  1NP8 A;  3KHE A;  4LJD A;  3CZ2 A;  3GK2 A;  2K0J A;  2WC8 A;  1YFP A;  2F33 A;  2VRG A;  3M24 A;  1OOI X;  1RJV A;  3SG4 A;  2LLU A;  1J7R A;  2WCM A;  1J7P A;  1NYA A;  3OB1 B;  5AFP A;  1JBA A;  3DPW A;  1PK0 D;  3VGO A;  2M9G A;  2Y4Q A;  4QJ4 B;  4WQ2 A;  3ZTF A;  2KPH A;  3FWC A;  3DQ2 A;  3D77 A;  2CTN A;  3CB9 A;  3SSH A;  3LS3 A;  3HX4 A;  1PVB A;  1MOU A;  4L1I A;  1DMO A;  2JAD A;  3RWA A;  4M2P A;  1RMM A;  2HQZ A;  1L2O C;  2B3Q A;  3S0A A;  2F2P A;  3MGF A;  2V4E A;  3GOF A;  2Q4U A;  2QT2 A;  2JWW A;  2JQ6 A;  4ZCV A;  3CDN A;  1EG4 A;  1UIS A;  1D1O A;  3SSK A;  3SVE A;  2JPT A;  4B5Y A;  1DJG A;  4I5J A;  4PE7 A;  3GJ1 A;  3TMR A;  1XAE A;  4W73 A;  5DKQ A;  2BBN A;  5I2Q A;  2L5Y A;  1IKU A;  4N3D A;  2G3D B;  4JFG A;  4JC2 A;  3DQM A;  1OOF A;  2WC6 A;  1TUZ A;  4MRX A;  2WHT A;  2HGY A;  5DTZ A;  2EC6 C;  2JC2 A;  3UO9 A;  5FVI A;  1QWV A;  3BYA A;  3DZT A;  3B6X A;  2LC5 A;  1YR5 A;  1DJY A;  1P28 A;  3RWT A;  3AKO A;  5FVF A;  4IJ7 A;  2V4E B;  1TTX A;  4TZG A;  4YI8 A;  1OOJ A;  2QLH A;  2DD9 A;  2D8N A;  1B9C A;  2L4I A;  3BUO B;  3NSK A;  4LQT A;  4A4C A;  5T3I A;  4PHK A;  4W6R A;  3E3R A;  1E8A A;  2B1U A;  1YRT B;  1QYQ A;  5B8I B;  2ZRT A;  3DF0 A;  4XYN A;  1EMK A;  3SV5 A;  2JPO A;  1QAS A;  2OJK A;  1R6P A;  4FQT A;  4HRE E;  3UFZ A;  3AKA A;  1C07 A;  1IG5 A;  1SY9 A;  2OS8 C;  2YGU A;  4W7D A;  2ARL A;  3CBE A;  5BTT A;  5F6T A;  2VVI A;  4GPL B;  1CFP A;  3DD4 A;  2QPT A;  1TNP A;  4D1E A;  1LS8 A;  1FI6 A;  3I5I B;  2M97 A;  5AER A;  3A8R A;  2NLN A;  1QYO A;  1R2U A;  1J1D A;  3DPX A;  4DS7 A;  3WHT B;  1FW4 A;  2JXC A;  2KI4 B;  2BEC A;  1BU3 A;  2SCP A;  4Q9W A;  3O6B A;  2I18 A;  3PN7 B;  2WSN A;  1CMG A;  2E30 A;  3WNX B;  1PSB A;  2BCX A;  2LNK A;  3DF0 B;  3HCM A;  2DUE A;  4OJ0 A;  3FIA A;  4R6D A;  2BTJ A;  1MWN A;  5DQM A;  3B7A A;  3EK7 A;  1BOD A;  1M45 A;  1J7O A;  4W77 A;  1IRJ A;  1PUL A;  4LJD C;  1Q4B A;  1ZUX A;  3W1C A;  3CFF A;  1EMG A;  3BFA A;  1Q80 A;  3O2P A;  3ED8 A;  4JF9 A;  3OX6 A;  5F9G A;  3PSR A;  5BTT B;  1Q4D A;  3I19 A;  1S1E A;  1DF0 A;  5EBJ A;  3OP0 A;  1G7K A;  3PIB A;  4JGE A;  2OTE A;  2H5Q A;  2CNP A;  4W7X A;  1ALW A;  1DTL A;  3CS1 A;  3VB1 A;  2C9I A;  1K90 D;  2ZN8 A;  3DQL A;  1BOC A;  1SYM A;  4PPK A;  1S5G Y;  4DXM A;  3EVV A;  4W7C A;  3S0B A;  2KAX A;  3OGN A;  4IK1 A;  4PE1 A;  2A53 B;  3O78 A;  3ZNI A;  5CSI A;  3NT3 A;  1XQM A;  4DRW A;  3ZUJ A;  2WIQ A;  3RZS A;  1S6I A;  2LMU A;  3VK1 A;  1YTZ C;  4PT1 A;  2VZX A;  1WRZ A;  2V4E C;  3P28 A;  2NZ0 A;  4W75 A;  1NIW A;  2DUG A;  2VAE A;  4W72 A;  4OR9 B;  2M7L A;  4ORN A;  4JPZ B;  5EXB A;  2O5G A;  2H61 A;  2A47 A;  1DF0 B;  1HT9 A;  2K2A A;  3D74 A;  1KK8 B;  1UP5 A;  2LLS A;  1KCY A;  3AAK A;  3LLE A;  1NCY A;  5G08 A;  4KAG A;  3SSV A;  1SCM B;  1JBY A;  2WCJ A;  1BLQ A;  3D0Y A;  5EXU A;  1QIV A;  3D75 A;  5HYD A;  3UG0 A;  3WLC A;  4INW A;  4GES B;  3LK0 A;  2HQK A;  4OY4 A;  5D3O A;  3S05 A;  2AWJ A;  1B8R A;  3LVD A;  2L0P A;  4I5L B;  3SG7 A;  3E5T A;  1F71 A;  2HQ8 A;  2LCP A;  2KI4 C;  2WUR A;  2MAZ A;  3EVU A;  1SNL A;  4J89 A;  3CTN A;  3IQQ A;  1S6C A;  3PN7 C;  1ZGO A;  4INX A;  4MN0 A;  3ST2 A;  2JNX A;  1WRL A;  3VHT A;  4ZF3 A;  1XFY O;  2JOJ A;  1C7W A;  3V3D A;  1Y0V H;  1G4Y R;  1MUX A;  4GGF A;  1M39 A;  2BCA A;  4WRI A;  2ICR A;  1TCF A;  3KO0 A;  3DQ5 A;  1KSO A;  1XSS A;  2K7C A;  1UHI A;  3NT9 A;  1AVS A;  1JC0 A;  1CFD A;  2I94 A;  1HQV A;  2K2F A;  1GGW A;  3D0Y B;  2CXJ A;  5FVG A;  5JOL A;  1GQM A;  1KSM A;  5AXI A;  2NCO A;  3AKB A;  4DXQ A;  1IJ5 A;  1WRK A;  1QIW A;  2AHA A;  1JBZ A;  1DGU A;  4L9M A;  5DIC A;  3K21 A;  4GF6 B;  1LXF C;  2HCG A;  5LK4 A;  1TIZ A;  3W1D A;  5D69 A;  3ICB A;  2WCB A;  2DDC A;  1MXL C;  3VRR A;  4B30 A;  4NDC A;  2Y0G A;  1UUR A;  1XFV O;  4P1Q A;  3OSQ A;  3A4U B;  1KFU S;  3SIB A;  1YVL A;  4W7A A;  4YGB B;  1Z1P A;  2COL B;  4H3M A;  4W6A A;  1DJI A;  3VHT B;  3GK4 X;  1W7J B;  4IK5 A;  1WY9 A;  3CWG A;  2DUI A;  4KF4 A;  1CFF A;  4IK4 A;  1AJ5 A;  2FL1 A;  1SPY A;  1Z4H A;  2G9B A;  5K89 A;  3DQU A;  3RLZ A;  4W6C A;  1B8C A;  3WXA A;  5KTY A;  5DTL A;  1QV0 A;  1S36 A;  5AQB B;  1EJ3 A;  4W6N A;  5DY6 A;  3DXL A;  3H4S E;  1B1G A;  4W6F A;  1YUT A;  1AJ4 A;  2F8P A;  4KW4 A;  2O29 A;  3SST A;  4W6D A;  1KK8 C;  4GAO A;  2MA2 A;  1EMC A;  4Z4K A;  1Q4E A;  2TN4 A;  3SG6 A;  2OTB A;  4KW8 A;  1SCM C;  1DJW A;  4CFR A;  4JRB A;  1CNP A;  2ZND A;  3JVT B;  1W7T A;  5BPJ A;  1UHK A;  3D73 A;  4B30 B;  4P2Y B;  1CDN A;  1QX2 A;  3OSR A;  1Z1Q A;  5LTP A;  4USL A;  1EMA A;  3O4Y A;  3NEZ A;  1YUR A;  3CGL A;  2KFG A;  5I94 A;  2M3W A;  2M1U A;  1OW4 A;  2KAY A;  1A75 A;  4IK9 A;  1U5I A;  4PE4 A;  3B88 A;  2MLE C;  3GB3 A;  4XOW A;  2OS8 B;  1M46 A;  3BUM B;  3NGV A;  1KYP A;  4Q7U A;  2WC5 A;  3JTD B;  1F54 A;  2A46 A;  2RGI A;  2BAP A;  2MLF C;  3TDU A;  2ZN9 A;  1NX1 A;  4MZK A;  1CFC A;  4HVF A;  3SS0 A;  4FTG A;  1DEL A;  2PYQ A;  4W6P A;  2O2B A;  2P4M A;  5EB6 A;  2NXQ A;  2YE1 A;  2GX2 A;  3BOW A;  2JTZ A;  4DUQ A;  2H61 C;  4Q04 A;  1CKK A;  1S6J A;  3I5F B;  1OZO A;  1CV7 A;  5ER4 X;  1BG1 A;  5LTR A;  4W7F A;  2FZU A;  4GNK B;  1K9U A;  2NCP A;  1NUB A;  5HZU A;  4Q7T A;  3D78 A;  3UNW A;  4KA9 A;  4DXI A;  1A75 B;  4W6J A;  1U5I B;  3IR8 A;  1OSA A;  4ZB1 A;  1PSR A;  1QS7 A;  3ST0 A;  1RWY A;  4LJC A;  3DQA A;  1XYD A;  2GW3 A;  5H87 A;  4DCK A;  3U0K A;  1QV1 A;  1OMD A;  2PSR A;  3BOW B;  1XFU O;  1QVI Z;  5FI6 A;  4ZFS A;  2DD7 A;  2ZMU A;  5LTQ A;  5HGE A;  1LVC D;  1Q4A A;  3NXA A;  4YGC B;  4OCI A;  4DKM A;  1LIN A;  2G16 B;  5DTY A;  4CFQ A;  4CPV A;  1W7U A;  4W6S A;  4FQO A;  3DVK A;  1MOV A;  2EHB A;  2Z6Z A;  3DQO A;  3TDZ A;  2FWQ A;  3EVP A;  5DKN A;  5H89 A;  3DQC A;  1V1F A;  5DKR A;  2LLT A;  1SL7 A;  3CZ0 A;  2JUL A;  2HPS A;  2YE0 A;  5FI2 A;  1KFX L;  1CLM A;  1NX3 A;  3JVT C;  2EMD A;  3DQ3 A;  2PXW A;  2L4H A;  1KK7 Y;  4LQU A;  1XVJ A;  1DQE A;  4IL1 A;  4M2Q A;  5FYX A;  3E5V A;  2KAV A;  5EL2 A;  1W7S A;  4AQJ A;  5I2L A;  1TNW A;  2HQW A;  5DRG A;  1XMZ A;  2JTT A;  4W6U A;  3ST3 A;  1K8U A;  1IJ6 A;  1YHG A;  3DVM A;  1FI5 A;  2K60 A;  2F2O A;  3JTD C;  3PM2 A;  1RMP A;  3SG5 A;  2BKH B;  4UPG A;  1TWO A;  4WQ3 A;  3CLN A;  2KFH A;  1JUO A;  4H3L A;  3SS4 A;  2WCE A;  3FWB A;  2MBX A;  4MBE A;  3IP2 A;  1CDM A;  2M49 B;  1CM4 A;  1ORG A;  3SSP A;  4P76 A;  1XFR A;  1EMB A;  4HRH A;  2P71 A;  1H6R A;  4Q7R A;  3I5F C;  4KW9 A;  3SRY A;  3BXK A;  2A4J A;  2QEH A;  1EME A;  2FJU B;  1CLB A;  4Q9X A;  3ST4 A;  4I2Y A;  4R1E A;  1W7I B;  3SVU A;  5HW9 A;  1ZGP A;  1J55 A;  2A52 B;  3PJB A;  1YX8 A;  3VRN A;  1B47 A;  5HLV A;  2FCD A;  3PAL A;  4PAL A;  5HL1 A;  1UHJ A;  2O24 A;  5I2O A;  3LVA A;  4HSZ A;  4YGE B;  4HQC A;  5FI7 A;  3BUN B;  4RYW A;  1TN4 A;  4KYN A;  2Y1N A;  4RYS A;  2LMT A;  1EMF A;  1SCV A;  1CTR A;  1TUJ A;  3QME A;  5CSJ A;  1QYF A;  3DQ6 A;  2BE4 A;  1IQ3 A;  4JKT A;  1J7Q A;  1ZMZ A;  2LP3 A;  4TZA A;  1NX2 A;  2M1K B;  2PVB A;  3GJ2 A;  4IK8 A;  4CLN A;  4L13 A;  2OKW A;  2LM5 A;  3EK4 A;  1H4U A;  4KF5 A;  1FF1 A;  2G3O A;  2O60 A;  4GUK A;  4BDU A;  2IB5 A;  2Z1O A;  3CFA A;  3DQE A;  1PAL A;  3M0W A;  4PPJ A;  4PFE A;  3SSY A;  2JT0 A;  3DYE A;  3R1V A;  2H9W A;  2FCE A;  2M8U A;  1IGV A;  2BCB A;  4DXO A;  1AUI B;  4OHS A;  1EML A;  1IIO A;  4KPI A;  4J8A A;  2KGB C;  5ER5 A;  4MSP A;  3MSE B;  3SVD A;  2JXL A;  2ZMW A;  3TZ1 A;  2KBM A;  4HQ9 A;  1K2H A;  1JF0 A;  2KLD A;  2R2I A;  2KHN A;  4NDB A;  3TDI A;  3U0L A;  4C0K A;  1DT7 B;  5DPJ A;  1MF8 B;  5PAL A;  1IWQ A;  2BKI B;  2H2K A;  2M29 A;  4N5X A;  3PJ7 A;  1KK7 Z;  2KBI A;  1K93 D;  4BY4 A;  4W74 A;  1N2D A;  1XA9 A;  3D10 A;  1YZW A;  5HZS A;  4W6G A;  2QDI A;  2DUH A;  2BBM A;  2LE9 B;  2L98 A;  4PHM A;  2QLG A;  1A03 A;  1AP4 A;  1RRX A;  3LL8 B;  1MXE A;  1QLK A;  4DXP A;  4MLW A;  2LAP A;  4JQ0 D;  1JSA A;  2OGR A;  4F7F A;  5HKW A;  2SAS A;  1SL8 A;  2ZNE A;  1UHH A;  1XK4 A;  3DY9 A;  2CT9 A;  3CGA A;  4F0Z B;  1DC1 A;  2WCF A;  3PFV A;  5TNC A;  5EB7 A;  1QVI Y;  1BJF A;  3R1O A;  1B7T Y;  2QEB A;  1SW8 A;  5FHV A;  1GM0 A;  2HGD A;  1QLS A;  1K9K A;  2JU0 A;  4YRU A;  5CPV A;  2WND A;  2JT3 A;  1JWD A;  4J88 A;  3SVC A;  5DPG A;  2ZO7 A;  1CMF A;  3DQI A;  5EHU A;  2KQ6 A;  1BMO A;  2AWK A;  4JWQ A;  2LVI A;  4DXN A;  3GEX A;  2A50 B;  1KWO B;  4W6H A;  2G6X A;  5H88 A;  1XA5 A;  3BFH A;  2LP2 A;  3KCS A;  2I2R E;  2FOT A;  3DQ1 A;  2QLG B;  3S0D A;  3TS5 C;  1C7V A;  1OXE A;  1OQP A;  4PE0 A;  1ZOT B;  2GX0 A;  3NSI A;  4TNC A;  4W6K A;  1QY3 A;  4QJ3 B;  3TMT A;  3IVT A;  3BXA A;  2K8M B;  1JC2 A;  2JT8 A;  2H5P A;  2G2S B;  1QX5 B;  2QZ0 A;  4YGA A;  1F0B A;  2G6E A;  1A2X A;  3LA1 A;  2AUC A;  3FE8 A;  1BFP A;  5I8N A;  4A4B A;  2K61 A;  3VRO A;  2DUF A;  1JFJ A;  1SL9 A;  2IS9 A;  4AQI A;  4ZIO A;  3S0F A;  3SVB A;  2KI6 C;  2LHI A;  1C3Y A;  2E6W A;  5CSF A;  1Q4C A;  2A56 B;  3S0G A;  3ADF A;  3BFB A;  1F4Q A;  2LUX A;  1L7Z A;  1UUS A;  4EMQ A;  1DGV A;  5DQB A;  1TRF A;  4N1G A;  1F70 A;  2AWL A;  2EMO A;  2H8Q A;  4LW5 A;  3EKJ A;  3WCK A;  3DQF A;  1RK9 A;  2MRD A;  1ZGQ A;  5IBW A;  3KPX A;  3CFH A;  1TNQ A;  1C4F A;  4ORA B;  2ZO6 A;  4NQG A;  2PMY A;  3SSL A;  2ERB A;  2WCH A;  1ALV A;  1OOH A;  4KF5 C;  3LSA A;  2JRF A;  2P70 A;  4U2V A;  3LCP C;  5KSZ A;  1CDP A;  1G33 A;  3DVE A;  3BX9 A;  1UWO A;  1CLL A;  4ZIN A;  3GL4 A;  2KLE A;  2QRF A;  5DPH A;  2GW4 B;  2F3Z A;  4N1F A;  1X02 A;  3H1R A;  1NCX A;  4NWS A;  1S3P A;  1W9Z A;  4W6B A;  4MZJ A;  4GOB A;  1YRU B;  1M31 A;  1V1G A;  2H8V A;  4U8D A;  4W6I A;  2AMI A;  4ANJ A;  1KYR A;  1TCO B;  2P6B B;  2VAD A;  1A4P A;  4EDO A;  2PAS A;  1RFJ A;  4IK3 A;  3E5W A;  1RRO A;  1YUU A;  2KSP A;  1BR4 B;  1JC1 A;  5KTG A;  2AWM A;  3AAJ A;  2OPO A;  5HZT A;  1KQM B;  3SVR A;  2PQL A;  2FJY A;  3PLF B;  3NHT A;  1VRK A;  2WHS A;  1BR1 B;  1DVI A;  1EXR A;  2H6V A;  2Q6P A;  4LJB A;  4DIR A;  1KWO C;  3BXB A;  4EN1 A;  4C0L A;  3VIC A;  3BJH A;  1J1E A;  1SMG A;  3K1E A;  3NSL A;  2WIS A;  2L2C A;  2DDD A;  3RM1 A;  1ZAC A;  2AH8 A;  2H5O A;  3AI4 A;  4GGF C;  1B7T Z;  4BY5 A;  3V2L A;  2IOV A;  4OQW A;  5HZO A;  1RM9 A;  1F55 A;  2RH7 A;  5HLO A;  3PAT A;  3U0N A;  1XK4 C;  2BE6 A;  3SVO A;  3SS5 A;  2LV7 A;  1UHN A;  1GL4 A;  3A8S A;  3BUW B;  5DRF A;  3SJS A;  1B4C A;  2LMV A;  2WOS A;  2LAN A;  4OV2 A;  2A54 B;  2LVK A;  3FE6 A;  3SVN A;  3H1O A;  1IQ5 A;  1MHO A;  4XJK A;  1FPW A;  2KNE A;  1EMM A;  2C9J A;  3KEV A;  1Y6W A;  4Z4M A;  2KQY A;  4W76 A;  4OKH A;  3O77 A;  3ZWH A;  1PRW A;  1GFL A;  5HKY A;  4XVP A;  1S26 D;  3CD9 A;  4OZD A;  2GV5 A;  2JZI A;  2WCL A;  1T14 A;  2DOQ A;  1B8L A;  1XO5 A;  2QLI A;  3CYZ A;  5DPI A;  5EXC I;  5EJU A;  4ZF5 A;  2Z6Y A;  4MRY A;  3EVR A;  1HUY A;  1CM1 A;  3U8A A;  3P8U A;  3DQ7 A;  1NPQ A;  2KGR A;  4YBH B;  1LKJ A;  4HE4 A;  4R6B A;  1AK8 A;  2OKY A;  3N7H A;  3L4A A;  1QXT A;  2KYF A;  1YHI A;  5DTX A;  4JD9 A;  3OB2 B;  1KP5 A;  2GGZ A;  1DJX A;  4H48 A;  3OHM B;  2M7N A;  1KFU L;  4PHN A;  4YI9 A;  1AHR A;  3OGO A;  2ZKM X;  4XJK B;  3R1P A;  1REC A;  1XFZ O;  3U8P A;  4W6L A;  1Z2C B;  1GGX A;  3DVJ A;  2KYC A;  4ICB A;  2CBL A;  3KF9 A;  3AI5 A;  3D76 A;  3CD1 A;  2EGD A;  2YDZ A;  2F3Y A;  4GBA A;  1KQM C;  5CSN A;  2HET A;  1K95 A;  3BUX B;  2EMN A;  3VRP A;  1KQV A;  3GK1 A;  1TOP A;  2V53 A;  4IZN A;  2K7B A;  3ZUL A;  1BF5 A;  2JNF A;  5AAN A;  3KCT A;  4ZCU A;  1K9P A;  1DJZ A;  1NSH A;  3BXC A;  1WDC B;  4W7E A;  2WHU A;  4E68 A;  3NF0 A;  4L12 A;  4DKN A;  2VVH A;  3DQK A;  2ZRS A;  3DQ4 A;  1K94 A;  1NCZ A;  3I5G B;  1F09 A;  2MJW B;  4UTS A;  1Y1U A;  3SG2 A;  2KDH A;  3B87 A;  3CR4 X;  1QJT A;  4OVN F;  1NWD A;  2PRU A;  1PVA A;  3LF4 B;  4H47 A;  2VVJ A;  1Y1X A;  3TS5 B;  1LA0 A;  4P5O E;  3L4L A;  1GGZ A;  4ETO A;  1IH0 A;  4QJ5 B;  2BL0 B;  2K7D A;  5J3X A;  2KFF A;  3CAB A;  1HCJ A;  1K96 A;  1OXF A;  3NSO A;  1MR8 A;  2QAC A;  2CCM A;  1SR6 B;  4MEW A;  4PPL A;  3QRX A;  3WHU B;  1QAT A;  3SG3 A;  4W6O A;  2H5R A;  5KU1 A;  4XL5 A;  2I7A A;  4C0J A;  3DQJ A;  1YJ2 A;  2G5Z B;  3C1V A;  2Q57 A;  2ISD A;  1EG3 A;  5D7F A;  4W7R A;  1OMR A;  4MVF A;  1OMV A;  4M2O A;  3TUY B;  2OTG B;  3G9A A;  2IB6 A;  4ORC B;  3DQN A;  1JFK A;  4EUL A;  3U0M A;  1FBV A;  1QXP A;  2KI6 D;  5AEQ A;  2KOT A;  2G6Y A;  3EG5 B;  5HKZ A;  1Y1A A;  1QX7 A;  1YHH A;  3CR2 A;  1ZFS A;  1LA3 A;  4AS8 A;  3DQD A;  3BQ3 A;  3PJ5 A;  5DU0 A;  2QU1 A;  1CDL A;  4ORB B;  4OGS A;  1F4O A;  3I5H B;  3F45 A; 
#chains in the Genus database with same CATH homology
 3SIA A;  3DQ8 A;  1SRA A;  2PAL A;  3CZT X;  1YX7 A;  3VRQ A;  2IE2 A;  4XGY A;  3I5I C;  2L51 A;  1H8B A;  3K1K A;  2LVV A;  1NX0 A;  3IF7 A;  1Q73 A;  1N65 A;  2WSO A;  5GQQ C;  2Y1M A;  4AR7 A;  1EH2 A;  1DJH A;  4W6T A;  3IQO A;  3SVS A;  1G8I A;  2ZFD A;  3LVC A;  2LUC A;  4I5K A;  3ZUF A;  5J2O A;  1H4B A;  4KGF A;  4ZF4 A;  1BT6 A;  3LK1 A;  4MZL A;  1EL4 A;  2M0R A;  1KFX S;  4YGD B;  1WLM A;  5BT0 A;  4CID A;  4NDD A;  1CB1 A;  2LVJ A;  1MYW A;  2QLE A;  2LHL A;  2L50 A;  2HF5 A;  2L5X B;  1WDC C;  3EKH A;  5BQL A;  3EK8 A;  1ODB A;  4HQ8 A;  4W69 A;  3OX5 A;  1OE9 B;  3DPZ A;  1M63 B;  1L2O B;  4EDS A;  3I5G C;  4HRG A;  2L2E A;  1SBJ A;  3FS7 A;  3M22 A;  2WOR A;  2POX A;  2K7O A;  4XOV A;  2GGM A;  5JJG A;  2PXS A;  2MHH A;  1RTP 1;  3U8C A;  1TNX A;  3DQ9 A;  1QTX A;  2BL0 C;  1B9A A;  1YJF A;  2B3P A;  2YFP A;  4RTC A;  4I5N B;  4H3N A;  1SR6 C;  4PCW A;  1RMO A;  1ZUZ A;  2Y5I A;  4ZBL A;  1F8H A;  2A48 A;  3DQH A;  1XFW O;  2HPW A;  1N0Y A;  4W6M A;  1YUS A;  2HRS A;  3WLD A;  2EC6 B;  4KGE A;  1OXD A;  3CR5 X;  1S5G Z;  4JEO A;  4AOM A;  2AAO A;  4GFT A;  1OZS A;  3TUY C;  2OTG C;  4KEX A;  3NED A;  1A29 A;  1XFX O;  1JF2 A;  1SKT A;  1YVH A;  3PM8 A;  4PHJ A;  1KYS A;  1MQ1 A;  4PDZ A;  1S6Z A;  3LF3 A;  3I5H C;  5HBD A;  2HFC A;  2G2B A;  2Q91 A;  1GJY A;  4GGN A;  2Z6X A;  1SK6 D;  1WLZ A;  2HJO A;  1NP8 A;  3KHE A;  4LJD A;  3GK2 A;  2K0J A;  2WC8 A;  1YFP A;  2F33 A;  2VRG A;  3M24 A;  1RJV A;  3SG4 A;  2LLU A;  1J7R A;  1J7P A;  1NYA A;  3OB1 B;  5AFP A;  1JBA A;  3DPW A;  1PK0 D;  3VGO A;  2M9G A;  2Y4Q A;  4QJ4 B;  4WQ2 A;  3ZTF A;  3FWC A;  3DQ2 A;  2CTN A;  3CB9 A;  3SSH A;  3LS3 A;  3HX4 A;  1PVB A;  1MOU A;  4L1I A;  1DMO A;  2JAD A;  3RWA A;  4M2P A;  1RMM A;  2HQZ A;  1L2O C;  2B3Q A;  2F2P A;  3MGF A;  2V4E A;  3GOF A;  2Q4U A;  2QT2 A;  2JWW A;  2JQ6 A;  4ZCV A;  1EG4 A;  1UIS A;  1D1O A;  3SSK A;  3SVE A;  2JPT A;  4B5Y A;  1DJG A;  4I5J A;  4PE7 A;  3GJ1 A;  3TMR A;  1XAE A;  4W73 A;  5DKQ A;  2BBN A;  5I2Q A;  1IKU A;  4N3D A;  2G3D B;  4JFG A;  4JC2 A;  3DQM A;  4MRX A;  2WHT A;  2HGY A;  5DTZ A;  2EC6 C;  2JC2 A;  5FVI A;  3BYA A;  2LC5 A;  1YR5 A;  1DJY A;  3RWT A;  3AKO A;  5FVF A;  2V4E B;  1TTX A;  4TZG A;  4YI8 A;  1OOJ A;  2QLH A;  2DD9 A;  2D8N A;  1B9C A;  2L4I A;  3BUO B;  3NSK A;  4LQT A;  4A4C A;  5T3I A;  4PHK A;  4W6R A;  3E3R A;  1E8A A;  2B1U A;  1YRT B;  1QYQ A;  5B8I B;  2ZRT A;  3DF0 A;  4XYN A;  1EMK A;  3SV5 A;  1QAS A;  2OJK A;  1R6P A;  4HRE E;  3UFZ A;  3AKA A;  1C07 A;  1IG5 A;  1SY9 A;  2OS8 C;  4W7D A;  2ARL A;  3CBE A;  5BTT A;  5F6T A;  2VVI A;  4GPL B;  1CFP A;  3DD4 A;  2QPT A;  1TNP A;  4D1E A;  1FI6 A;  3I5I B;  2M97 A;  5AER A;  3A8R A;  2NLN A;  1QYO A;  1R2U A;  1J1D A;  3DPX A;  4DS7 A;  3WHT B;  1FW4 A;  2JXC A;  2KI4 B;  2BEC A;  1BU3 A;  2SCP A;  4Q9W A;  3O6B A;  2I18 A;  3PN7 B;  2WSN A;  1CMG A;  2E30 A;  3WNX B;  1PSB A;  2BCX A;  2LNK A;  3DF0 B;  3HCM A;  2DUE A;  4OJ0 A;  3FIA A;  4R6D A;  2BTJ A;  1MWN A;  5DQM A;  3EK7 A;  1BOD A;  1M45 A;  1J7O A;  4W77 A;  1IRJ A;  1PUL A;  4LJD C;  1Q4B A;  1ZUX A;  3W1C A;  3CFF A;  1EMG A;  1Q80 A;  3O2P A;  3ED8 A;  4JF9 A;  3OX6 A;  5F9G A;  3PSR A;  5BTT B;  1Q4D A;  3I19 A;  1S1E A;  1DF0 A;  5EBJ A;  3OP0 A;  1G7K A;  3PIB A;  4JGE A;  2OTE A;  2H5Q A;  2CNP A;  4W7X A;  1ALW A;  1DTL A;  3CS1 A;  2C9I A;  1K90 D;  2ZN8 A;  3DQL A;  1BOC A;  1SYM A;  4PPK A;  1S5G Y;  4DXM A;  3EVV A;  4W7C A;  2KAX A;  4IK1 A;  4PE1 A;  2A53 B;  3O78 A;  3ZNI A;  5CSI A;  3NT3 A;  1XQM A;  4DRW A;  3ZUJ A;  2WIQ A;  1S6I A;  2LMU A;  3VK1 A;  1YTZ C;  2VZX A;  1WRZ A;  2V4E C;  3P28 A;  2NZ0 A;  4W75 A;  1NIW A;  2DUG A;  2VAE A;  4W72 A;  4OR9 B;  2M7L A;  4ORN A;  4JPZ B;  5EXB A;  2O5G A;  2H61 A;  2A47 A;  1DF0 B;  1HT9 A;  2K2A A;  1KK8 B;  1UP5 A;  2LLS A;  1KCY A;  3AAK A;  3LLE A;  1NCY A;  5G08 A;  4KAG A;  3SSV A;  1SCM B;  1JBY A;  1BLQ A;  3D0Y A;  5EXU A;  1QIV A;  5HYD A;  3UG0 A;  3WLC A;  4GES B;  3LK0 A;  2HQK A;  4OY4 A;  3S05 A;  2AWJ A;  1B8R A;  3LVD A;  2L0P A;  4I5L B;  3SG7 A;  3E5T A;  1F71 A;  2HQ8 A;  2LCP A;  2KI4 C;  2WUR A;  2MAZ A;  3EVU A;  1SNL A;  4J89 A;  3CTN A;  3IQQ A;  1S6C A;  3PN7 C;  1ZGO A;  4MN0 A;  3ST2 A;  2JNX A;  1WRL A;  3VHT A;  4ZF3 A;  1XFY O;  2JOJ A;  1C7W A;  3V3D A;  1Y0V H;  1G4Y R;  1MUX A;  4GGF A;  1M39 A;  2BCA A;  4WRI A;  2ICR A;  1TCF A;  3KO0 A;  3DQ5 A;  1KSO A;  1XSS A;  2K7C A;  1UHI A;  3NT9 A;  1AVS A;  1JC0 A;  1CFD A;  2I94 A;  1HQV A;  2K2F A;  1GGW A;  3D0Y B;  2CXJ A;  5FVG A;  5JOL A;  1GQM A;  1KSM A;  5AXI A;  2NCO A;  3AKB A;  4DXQ A;  1IJ5 A;  1WRK A;  1QIW A;  2AHA A;  1JBZ A;  1DGU A;  4L9M A;  4GF6 B;  3K21 A;  1LXF C;  2HCG A;  5LK4 A;  1TIZ A;  3W1D A;  5D69 A;  3ICB A;  2WCB A;  2DDC A;  1MXL C;  3VRR A;  4B30 A;  4NDC A;  2Y0G A;  1UUR A;  1XFV O;  4P1Q A;  3OSQ A;  3A4U B;  1KFU S;  3SIB A;  1YVL A;  4W7A A;  4YGB B;  1Z1P A;  2COL B;  4H3M A;  4W6A A;  1DJI A;  3VHT B;  3GK4 X;  1W7J B;  4IK5 A;  1WY9 A;  3CWG A;  2DUI A;  4KF4 A;  1CFF A;  4IK4 A;  1AJ5 A;  2FL1 A;  1SPY A;  2G9B A;  5K89 A;  3DQU A;  3RLZ A;  4W6C A;  1B8C A;  3WXA A;  5KTY A;  5DTL A;  1QV0 A;  1S36 A;  5AQB B;  1EJ3 A;  4W6N A;  5DY6 A;  3H4S E;  1B1G A;  4W6F A;  1YUT A;  1AJ4 A;  2F8P A;  4KW4 A;  2O29 A;  3SST A;  4W6D A;  1KK8 C;  4GAO A;  2MA2 A;  1EMC A;  4Z4K A;  1Q4E A;  2TN4 A;  3SG6 A;  2OTB A;  4KW8 A;  1SCM C;  1DJW A;  4CFR A;  4JRB A;  1CNP A;  2ZND A;  3JVT B;  1W7T A;  5BPJ A;  1UHK A;  4B30 B;  4P2Y B;  1CDN A;  1QX2 A;  3OSR A;  1Z1Q A;  5LTP A;  4USL A;  1EMA A;  3O4Y A;  3NEZ A;  1YUR A;  3CGL A;  2KFG A;  2M3W A;  2M1U A;  2KAY A;  4IK9 A;  1A75 A;  1U5I A;  4PE4 A;  2MLE C;  3GB3 A;  4XOW A;  2OS8 B;  1M46 A;  3BUM B;  1KYP A;  4Q7U A;  2A46 A;  3JTD B;  1F54 A;  2RGI A;  2MLF C;  3TDU A;  2ZN9 A;  1NX1 A;  4MZK A;  1CFC A;  4HVF A;  3SS0 A;  4FTG A;  4W6P A;  2O2B A;  2P4M A;  5EB6 A;  2NXQ A;  2YE1 A;  2GX2 A;  3BOW A;  2JTZ A;  4DUQ A;  2H61 C;  4Q04 A;  1CKK A;  1S6J A;  3I5F B;  1OZO A;  1CV7 A;  5ER4 X;  1BG1 A;  5LTR A;  4W7F A;  2FZU A;  4GNK B;  1K9U A;  2NCP A;  1NUB A;  5HZU A;  4Q7T A;  4DXI A;  4KA9 A;  1A75 B;  4W6J A;  1U5I B;  3IR8 A;  1OSA A;  4ZB1 A;  1PSR A;  1QS7 A;  3ST0 A;  1RWY A;  4LJC A;  3DQA A;  1XYD A;  2GW3 A;  5H87 A;  4DCK A;  3U0K A;  1QV1 A;  1OMD A;  2PSR A;  3BOW B;  1XFU O;  1QVI Z;  4ZFS A;  2DD7 A;  2ZMU A;  5LTQ A;  5HGE A;  1LVC D;  1Q4A A;  3NXA A;  4YGC B;  4OCI A;  4DKM A;  1LIN A;  2G16 B;  5DTY A;  4CFQ A;  4CPV A;  1W7U A;  4W6S A;  4FQO A;  3DVK A;  1MOV A;  2EHB A;  2Z6Z A;  3DQO A;  3TDZ A;  2FWQ A;  3EVP A;  5DKN A;  5H89 A;  3DQC A;  1V1F A;  5DKR A;  2LLT A;  1SL7 A;  2JUL A;  2HPS A;  2YE0 A;  1KFX L;  1CLM A;  1NX3 A;  3JVT C;  2EMD A;  3DQ3 A;  2PXW A;  2L4H A;  1KK7 Y;  4LQU A;  1XVJ A;  4IL1 A;  4M2Q A;  5FYX A;  3E5V A;  2KAV A;  1W7S A;  4AQJ A;  5I2L A;  1TNW A;  2HQW A;  5DRG A;  1XMZ A;  2JTT A;  4W6U A;  3ST3 A;  1K8U A;  1IJ6 A;  1YHG A;  3DVM A;  1FI5 A;  2F2O A;  3JTD C;  1RMP A;  3SG5 A;  2BKH B;  4UPG A;  4WQ3 A;  3CLN A;  2KFH A;  1JUO A;  4H3L A;  2WCE A;  3FWB A;  2MBX A;  4MBE A;  3IP2 A;  1CDM A;  2M49 B;  1CM4 A;  3SSP A;  4P76 A;  1EMB A;  4HRH A;  1H6R A;  4Q7R A;  3I5F C;  4KW9 A;  3SRY A;  3BXK A;  2A4J A;  1EME A;  2FJU B;  1CLB A;  4Q9X A;  3ST4 A;  4I2Y A;  4R1E A;  1W7I B;  3SVU A;  5HW9 A;  1ZGP A;  1J55 A;  2A52 B;  3PJB A;  1YX8 A;  3VRN A;  1B47 A;  5HLV A;  2FCD A;  3PAL A;  4PAL A;  1UHJ A;  2O24 A;  5I2O A;  3LVA A;  4HSZ A;  4YGE B;  4HQC A;  3BUN B;  4RYW A;  1TN4 A;  2Y1N A;  4RYS A;  2LMT A;  1EMF A;  1SCV A;  1CTR A;  5CSJ A;  1QYF A;  3DQ6 A;  2BE4 A;  1IQ3 A;  1J7Q A;  1ZMZ A;  2LP3 A;  4TZA A;  1NX2 A;  2M1K B;  2PVB A;  3GJ2 A;  4IK8 A;  4CLN A;  4L13 A;  2OKW A;  2LM5 A;  3EK4 A;  1H4U A;  4KF5 A;  1FF1 A;  2G3O A;  2O60 A;  4GUK A;  4BDU A;  2IB5 A;  2Z1O A;  3CFA A;  3DQE A;  1PAL A;  3M0W A;  4PPJ A;  4PFE A;  3SSY A;  2JT0 A;  2H9W A;  2FCE A;  2M8U A;  1IGV A;  2BCB A;  4DXO A;  1AUI B;  4OHS A;  1EML A;  4KPI A;  4J8A A;  2KGB C;  5ER5 A;  4MSP A;  3MSE B;  3SVD A;  2JXL A;  2ZMW A;  3TZ1 A;  2KBM A;  4HQ9 A;  1K2H A;  1JF0 A;  2R2I A;  2KHN A;  4NDB A;  3TDI A;  3U0L A;  4C0K A;  1DT7 B;  5DPJ A;  1MF8 B;  5PAL A;  1IWQ A;  2BKI B;  2H2K A;  2M29 A;  4N5X A;  3PJ7 A;  1KK7 Z;  2KBI A;  1K93 D;  4BY4 A;  4W74 A;  1N2D A;  1XA9 A;  3D10 A;  1YZW A;  5HZS A;  4W6G A;  2DUH A;  2BBM A;  2LE9 B;  2L98 A;  4PHM A;  2QLG A;  1A03 A;  1AP4 A;  1RRX A;  3LL8 B;  1MXE A;  1QLK A;  4DXP A;  4MLW A;  2LAP A;  4JQ0 D;  1JSA A;  2OGR A;  5HKW A;  2SAS A;  1SL8 A;  2ZNE A;  1UHH A;  1XK4 A;  2CT9 A;  3CGA A;  4F0Z B;  2WCF A;  3PFV A;  5TNC A;  5EB7 A;  1QVI Y;  1BJF A;  1B7T Y;  1SW8 A;  5FHV A;  2HGD A;  1QLS A;  1K9K A;  2JU0 A;  4YRU A;  5CPV A;  2WND A;  2JT3 A;  1JWD A;  4J88 A;  3SVC A;  5DPG A;  2ZO7 A;  1CMF A;  3DQI A;  5EHU A;  2KQ6 A;  1BMO A;  2AWK A;  4JWQ A;  2LVI A;  4DXN A;  3GEX A;  2A50 B;  1KWO B;  4W6H A;  2G6X A;  5H88 A;  1XA5 A;  2LP2 A;  3KCS A;  2I2R E;  2FOT A;  3DQ1 A;  2QLG B;  3TS5 C;  1C7V A;  1OXE A;  1OQP A;  4PE0 A;  1ZOT B;  2GX0 A;  3NSI A;  4TNC A;  4W6K A;  1QY3 A;  4QJ3 B;  3TMT A;  3BXA A;  2K8M B;  1JC2 A;  2JT8 A;  2H5P A;  2G2S B;  1QX5 B;  2QZ0 A;  4YGA A;  1F0B A;  2G6E A;  1A2X A;  3LA1 A;  2AUC A;  1BFP A;  5I8N A;  4A4B A;  2K61 A;  3VRO A;  2DUF A;  1JFJ A;  1SL9 A;  2IS9 A;  4AQI A;  4ZIO A;  3SVB A;  2KI6 C;  2LHI A;  2E6W A;  5CSF A;  1Q4C A;  2A56 B;  3ADF A;  1F4Q A;  2LUX A;  1L7Z A;  1UUS A;  4EMQ A;  1DGV A;  5DQB A;  1TRF A;  4N1G A;  1F70 A;  2AWL A;  2EMO A;  2H8Q A;  4LW5 A;  3EKJ A;  3WCK A;  3DQF A;  1RK9 A;  2MRD A;  1ZGQ A;  5IBW A;  3KPX A;  3CFH A;  1TNQ A;  1C4F A;  4ORA B;  2ZO6 A;  4NQG A;  2PMY A;  3SSL A;  1ALV A;  4KF5 C;  3LSA A;  2JRF A;  4U2V A;  3LCP C;  5KSZ A;  1CDP A;  1G33 A;  3DVE A;  3BX9 A;  1UWO A;  1CLL A;  4ZIN A;  3GL4 A;  2QRF A;  5DPH A;  2GW4 B;  2F3Z A;  4N1F A;  1X02 A;  3H1R A;  1NCX A;  4NWS A;  1S3P A;  4W6B A;  4MZJ A;  4GOB A;  1YRU B;  1M31 A;  1V1G A;  4U8D A;  4W6I A;  2AMI A;  4ANJ A;  1KYR A;  1TCO B;  2P6B B;  2VAD A;  1A4P A;  4EDO A;  2PAS A;  1RFJ A;  4IK3 A;  3E5W A;  1RRO A;  1YUU A;  2KSP A;  1BR4 B;  1JC1 A;  5KTG A;  2AWM A;  3AAJ A;  2OPO A;  5HZT A;  1KQM B;  3SVR A;  3PLF B;  1VRK A;  2WHS A;  1BR1 B;  1DVI A;  1EXR A;  2H6V A;  2Q6P A;  4LJB A;  4DIR A;  1KWO C;  3BXB A;  4EN1 A;  4C0L A;  3VIC A;  1J1E A;  1SMG A;  3NSL A;  2WIS A;  2DDD A;  3RM1 A;  1ZAC A;  2AH8 A;  2H5O A;  3AI4 A;  4GGF C;  1B7T Z;  4BY5 A;  2IOV A;  4OQW A;  5HZO A;  1RM9 A;  1F55 A;  2RH7 A;  5HLO A;  3PAT A;  3U0N A;  1XK4 C;  2BE6 A;  3SVO A;  2LV7 A;  1UHN A;  1GL4 A;  3A8S A;  3BUW B;  5DRF A;  3SJS A;  1B4C A;  2LMV A;  2WOS A;  2LAN A;  4OV2 A;  2A54 B;  2LVK A;  3SVN A;  3H1O A;  1IQ5 A;  1MHO A;  4XJK A;  1FPW A;  2KNE A;  1EMM A;  2C9J A;  3KEV A;  1Y6W A;  4Z4M A;  2KQY A;  4W76 A;  4OKH A;  3O77 A;  3ZWH A;  1PRW A;  1GFL A;  5HKY A;  4XVP A;  1S26 D;  3CD9 A;  2GV5 A;  2JZI A;  2DOQ A;  1B8L A;  1XO5 A;  2QLI A;  5DPI A;  5EXC I;  5EJU A;  4ZF5 A;  2Z6Y A;  4MRY A;  3EVR A;  1HUY A;  1CM1 A;  3U8A A;  3P8U A;  3DQ7 A;  4R6B A;  1NPQ A;  2KGR A;  1LKJ A;  4YBH B;  4HE4 A;  1AK8 A;  2OKY A;  1QXT A;  2KYF A;  1YHI A;  5DTX A;  3OB2 B;  1KP5 A;  2GGZ A;  1DJX A;  4H48 A;  3OHM B;  2M7N A;  1KFU L;  4PHN A;  4YI9 A;  1AHR A;  3OGO A;  2ZKM X;  4XJK B;  1REC A;  1XFZ O;  3U8P A;  4W6L A;  1GGX A;  3DVJ A;  2KYC A;  4ICB A;  2CBL A;  3KF9 A;  3AI5 A;  3CD1 A;  2EGD A;  2YDZ A;  2F3Y A;  4GBA A;  1KQM C;  5CSN A;  2HET A;  1K95 A;  3BUX B;  2EMN A;  3VRP A;  1KQV A;  3GK1 A;  1TOP A;  2V53 A;  4IZN A;  2K7B A;  3ZUL A;  1BF5 A;  2JNF A;  5AAN A;  3KCT A;  4ZCU A;  1K9P A;  1DJZ A;  1NSH A;  3BXC A;  1WDC B;  4W7E A;  2WHU A;  4E68 A;  3NF0 A;  4L12 A;  4DKN A;  2VVH A;  3DQK A;  2ZRS A;  3DQ4 A;  1K94 A;  1NCZ A;  3I5G B;  1F09 A;  2MJW B;  4UTS A;  1Y1U A;  3SG2 A;  2KDH A;  3CR4 X;  1QJT A;  4OVN F;  1NWD A;  2PRU A;  1PVA A;  3LF4 B;  4H47 A;  2VVJ A;  1Y1X A;  3TS5 B;  1LA0 A;  4P5O E;  1GGZ A;  4ETO A;  1IH0 A;  4QJ5 B;  2BL0 B;  2K7D A;  5J3X A;  2KFF A;  1HCJ A;  1K96 A;  1OXF A;  3NSO A;  1MR8 A;  2QAC A;  2CCM A;  1SR6 B;  4MEW A;  4PPL A;  3QRX A;  3WHU B;  1QAT A;  3SG3 A;  4W6O A;  2H5R A;  5KU1 A;  4XL5 A;  2I7A A;  4C0J A;  3DQJ A;  1YJ2 A;  2G5Z B;  3C1V A;  2Q57 A;  2ISD A;  1EG3 A;  5D7F A;  4W7R A;  1OMR A;  4MVF A;  1OMV A;  4M2O A;  3TUY B;  2OTG B;  3G9A A;  2IB6 A;  4ORC B;  3DQN A;  1JFK A;  4EUL A;  3U0M A;  1FBV A;  1QXP A;  2KI6 D;  5AEQ A;  2KOT A;  2G6Y A;  5HKZ A;  1Y1A A;  1QX7 A;  1YHH A;  3CR2 A;  1ZFS A;  1LA3 A;  4AS8 A;  3DQD A;  3BQ3 A;  3PJ5 A;  5DU0 A;  2QU1 A;  1CDL A;  4ORB B;  4OGS A;  1F4O A;  3I5H B;  3F45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...