3BXCA

Monomeric far-red fluorescent protein mkate crystallized at ph 9.0
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
218
Chain Sequence
ITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far-red fluorescent protein mKate
publication title A Crystallographic Study of Bright Far-Red Fluorescent Protein mKate Reveals pH-induced cis-trans Isomerization of the Chromophore.
pubmed doi rcsb
source organism Entacmaea quadricolor
molecule tags Fluorescent protein
total genus 62
structure length 218
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3bxcA00
1EMBA 3DQIA 3H1RA 3LVDA 4J88A 4H47A 3LF3A 2A54B 4OY4A 4W74A 1S6ZA 4R6BA 4W72A 5DPIA 4JGEA 4ZB1A 5LK4A 4JFGA 3EK7A 1XA9A 1XSSA 3DQDA 2ICRA 3UFZA 1Q4BA 4J89A 2YFPA 3DQFA 4W7RA 4GESB 4ZF5A 3BX9A 4IK4A 3RWAA 3V3DA 3DPZA 5EB6A 2A46A 1Q4AA 2PXWA 2A53B 3M24A 1KYPA 3ST4A 5HZTA 4W6CA 1QYQA 4EN1A 2C9JA 4W7EA 1EMMA 1ZGPA 4RYWA 1ZGQA 2H6VA 1JBZA 4KA9A 1QYOA 2DUEA 3GJ2A 5EHUA 3SVUA 5EXUA 4GOBA 1H6RA 1EMGA 2EMOA 4W6MA 1RMOA 5HGEA 2VZXA 1XQMA 2B3PA 4ANJA 3ZUFA 3SSLA 2HPWA 3SVBA 2HQZA 1KP5A 3NT9A 4OQWA 3DQ2A 3DQ1A 3P28A 3H1OA 2DD9A 2QZ0A 4W6NA 3S05A 4ORNA 2O29A 3CBEA 3CFHA 1YJ2A 2QU1A 1F0BA 2O2BA 3SVCA 5FVIA 5H89A 1EMAA 3DQJA 4L1IA 4R6DA 5DPHA 3CD1A 4DXNA 2BTJA 3EVVA 4B5YA 3CD9A 5HW9A 1UISA 4W6TA 2HCGA 3VHTA 2C9IA 2JADA 4W6FA 3BXCA 1ZGOA 3BXAA 5BTTA 1Q4CA 3EKJA 2OKWA 3SG6A 2PXSA 4KW9A 2Z6ZA 4EULA 2G2SB 4RTCA 4DXPA 2ARLA 3P8UA 3SV5A 4JF9A 1EMCA 3SG2A 3VHTB 4UTSA 3E5TA 5BTTB 3G9AA 4XL5A 3SSVA 2FWQA 5DU0A 2EMDA 4DXQA 2GX0A 3DQLA 4JEOA 4W6HA 1OXEA 5EB7A 2DD7A 2Q6PA 2OKYA 2WIQA 4XVPA 4W77A 1GFLA 1Q4DA 4H3LA 5DTLA 1Q73A 2YE0A 2Z1OA 3GEXA 4LJDC 5DRGA 3EK4A 3WLDA 2WISA 4IK1A 3OSQA 4H3NA 4HQ8A 2HGYA 2QLGA 4H3MA 3EVPA 4KGEA 4DKMA 3DQ4A 4BDUA 3DQAA 2GW3A 4KW8A 4W7FA 4Z4KA 3U8AA 2A56B 3ZUJA 5DPGA 2AHAA 4P76A 4IK5A 5DTXA 3SVRA 1RRXA 1CV7A 3LA1A 2FZUA 2GW4B 2G3DB 3ZULA 3LSAA 4DKNA 5F9GA 4W6GA 3GL4A 2WHSA 1GGXA 4LJCA 4HE4A 2H5QA 1XAEA 2QLGB 1ZUXA 3PJBA 1Z1PA 3U0KA 3SG4A 4HVFA 3AI4A 4KEXA 2G6YA 4RYSA 2HQKA 5H88A 1QY3A 4W76A 4HQCA 4W73A 3DQ7A 4KPIA 4LJDA 1MOVA 1JBYA 4GF6B 3KCSA 2B3QA 1YZWA 3SG7A 1GL4A 2OTEA 4XOVA 4ZF3A 1JC0A 2ZO7A 3EVRA 1Q4EA 4DXIA 4J8AA 1KYSA 1EMKA 3O77A 1C4FA 2QLEA 2G6EA 3CGLA 4ZIOA 4B30A 2A48A 4L12A 2GX2A 1W7TA 3DQEA 4AS8A 3DQ6A 1YHIA 4EDSA 4W6RA 4KF4A 3ST2A 3SS0A 3SG3A 2H5PA 2OTBA 3PIBA 3EVUA 1B9CA 4W75A 3UG0A 2IE2A 3AI5A 4B30B 1W7SA 3EK8A 3WLCA 4H48A 2ZMWA 2A52B 1MYWA 5EXCI 4W7XA 3BXBA 2DUFA 3NEZA 5HZSA 3M22A 3RWTA 3CB9A 2HGDA 2QLHA 3ST3A 5AQBB 5KTGA 3A8SA 5DPJA 5T3IA 3TMTA 1XMZA 2Q57A 3DQMA 3ZTFA 3LS3A 3SVDA 4L13A 2QT2A 4DXMA 4ZF4A 4NWSA 3MGFA 2HJOA 4DXOA 2VAEA 4AR7A 1QXTA 3DQCA 2Z6XA 1RMMA 4LJBA 4W6KA 3U0LA 5LTQA 4HQ9A 4P1QA 5FVGA 2AWMA 4PFEA 3NF0A 4EMQA 3GB3A 4IK9A 3VK1A 3LVCA 3I19A 2DUGA 4IZNA 2QLIA 3DPXA 3ADFA 2WSOA 5HZOA 2H5OA 4W6PA 2Z6YA 3WCKA 2OJKA 5EXBA 3TMRA 3E5VA 1BFPA 3PJ7A 4W7DA 5BT0A 3E5WA 2WURA 4W6OA 2AWLA 3EKHA 4Q7UA 3DQ3A 5EJUA 3W1DA 4IK8A 4JC2A 3U8PA 4I2YA 1MOUA 4Q9WA 1F09A 2H5RA 2DUIA 4XOWA 1H4UA 2ZO6A 2AH8A 2H8QA 2V4EC 3U0MA 5DTZA 4W6BA 5H87A 5LTRA 4W7AA 5HZUA 1Z1QA 4TZGA 3OSRA 2IOVA 1EMLA 3PJ5A 1G7KA 1W7UA 3SVNA 3K1KA 3DQHA 5EBJA 2O24A 3AKOA 3KCTA 2P4MA 4W6IA 4Q7RA 4W6UA 4OHSA 2VVIA 1KYRA 2HRSA 4LQUA 3SG5A 2YE1A 1HCJA 1YHGA 4OJ0A 4W7CA 2WSNA 3OGOA 3LF4B 3DQUA 3DQ8A 3SRYA 2DDDA 4KF5C 4Q9XA 5FVFA 2DDCA 3IR8A 3SSHA 2Y0GA 2RH7A 4W69A 2YDZA 2EMNA 2WHTA 2A47A 3DQOA 3LVAA 2HFCA 3SVSA 5J2OA 3SSKA 2IB5A 2IB6A 2V4EA 3DQ5A 3SVEA 3SSYA 3O78A 3SVOA 4PPLA 4OGSA 3SSPA 4XGYA 4Z4MA 4W6JA 2AWKA 4U2VA 2FL1A 5DRFA 4IK3A 3DQ9A 2G6XA 5DTYA 1OXFA 1EMFA 3DQKA 4KAGA 3DQNA 3CFAA 2POXA 2G5ZB 2V4EB 3NEDA 4W6SA 4N3DA 2OGRA 3DPWA 3IP2A 3GJ1A 5LTPA 1JC1A 4ZINA 4Q7TA 1YHHA 4TZAA 4PPKA 4KW4A 4LQTA 5HBDA 4KF5A 3CFFA 4W6AA 2VVHA 5BQLA 5DY6A 2G16B 3SSTA 3ED8A 3NT3A 1HUYA 5FHVA 1YJFA 2VADA 2DUHA 1QYFA 3U8CA 5DQMA 4EDOA 2AWJA 4ZBLA 3W1CA 2A50B 3VICA 2WHUA 3ST0A 1RM9A 2H9WA 4W6DA 5DQBA 4LW5A 2G3OA 1OXDA 2QRFA 4KGFA 1YFPA 4W6LA 1RMPA 4JRBA 2ZMUA 1EMEA 4ZFSA 4PPJA 3U0NA 2VVJA
chains in the Genus database with same CATH superfamily
1EMBA 3DQIA 3H1RA 3LVDA 4J88A 4H47A 3LF3A 2A54B 4OY4A 4W74A 1S6ZA 4R6BA 4W72A 5DPIA 4JGEA 4ZB1A 5LK4A 4JFGA 3EK7A 1XA9A 1XSSA 3DQDA 2ICRA 3UFZA 1Q4BA 4J89A 2YFPA 3DQFA 4W7RA 4GESB 4ZF5A 3BX9A 4IK4A 3RWAA 3V3DA 3DPZA 5EB6A 2A46A 1Q4AA 2PXWA 2A53B 3M24A 1KYPA 3ST4A 5HZTA 4W6CA 1QYQA 4EN1A 2C9JA 4W7EA 1EMMA 1ZGPA 4RYWA 1ZGQA 2H6VA 1JBZA 4KA9A 1QYOA 2DUEA 3GJ2A 5EHUA 3SVUA 5EXUA 4GOBA 1H6RA 1EMGA 2EMOA 4W6MA 1RMOA 5HGEA 2VZXA 1XQMA 2B3PA 4ANJA 3ZUFA 3SSLA 2HPWA 3SVBA 2HQZA 1KP5A 3NT9A 4OQWA 3DQ2A 3DQ1A 3P28A 3H1OA 2DD9A 2QZ0A 4W6NA 3S05A 4ORNA 2O29A 3CBEA 3CFHA 1YJ2A 2QU1A 1F0BA 2O2BA 3SVCA 5FVIA 5H89A 1EMAA 3DQJA 4L1IA 4R6DA 5DPHA 3CD1A 4DXNA 2BTJA 3EVVA 4B5YA 3CD9A 5HW9A 1UISA 4W6TA 2HCGA 3VHTA 2C9IA 2JADA 4W6FA 3BXCA 1ZGOA 3BXAA 5BTTA 1Q4CA 3EKJA 2OKWA 3SG6A 2PXSA 4KW9A 2Z6ZA 4EULA 2G2SB 4RTCA 4DXPA 2ARLA 3P8UA 3SV5A 4JF9A 1EMCA 3SG2A 3VHTB 4UTSA 3E5TA 5BTTB 3G9AA 4XL5A 3SSVA 2FWQA 5DU0A 2EMDA 4DXQA 2GX0A 3DQLA 4JEOA 4W6HA 1OXEA 5EB7A 2DD7A 2Q6PA 2OKYA 2WIQA 4XVPA 4W77A 1GFLA 1Q4DA 4H3LA 5DTLA 1Q73A 2YE0A 2Z1OA 3GEXA 4LJDC 5DRGA 3EK4A 3WLDA 2WISA 4IK1A 3OSQA 4H3NA 4HQ8A 2HGYA 2QLGA 4H3MA 3EVPA 4KGEA 4DKMA 3DQ4A 4BDUA 3DQAA 2GW3A 4KW8A 4W7FA 4Z4KA 3U8AA 2A56B 3ZUJA 5DPGA 2AHAA 4P76A 4IK5A 5DTXA 3SVRA 1RRXA 1CV7A 3LA1A 2FZUA 2GW4B 2G3DB 3ZULA 3LSAA 4DKNA 5F9GA 4W6GA 3GL4A 2WHSA 1GGXA 4LJCA 4HE4A 2H5QA 1XAEA 2QLGB 1ZUXA 3PJBA 1Z1PA 3U0KA 3SG4A 4HVFA 3AI4A 4KEXA 2G6YA 4RYSA 2HQKA 5H88A 1QY3A 4W76A 4HQCA 4W73A 3DQ7A 4KPIA 4LJDA 1MOVA 1JBYA 4GF6B 3KCSA 2B3QA 1YZWA 3SG7A 1GL4A 2OTEA 4XOVA 4ZF3A 1JC0A 2ZO7A 3EVRA 1Q4EA 4DXIA 4J8AA 1KYSA 1EMKA 3O77A 1C4FA 2QLEA 2G6EA 3CGLA 4ZIOA 4B30A 2A48A 4L12A 2GX2A 1W7TA 3DQEA 4AS8A 3DQ6A 1YHIA 4EDSA 4W6RA 4KF4A 3ST2A 3SS0A 3SG3A 2H5PA 2OTBA 3PIBA 3EVUA 1B9CA 4W75A 3UG0A 2IE2A 3AI5A 4B30B 1W7SA 3EK8A 3WLCA 4H48A 2ZMWA 2A52B 1MYWA 5EXCI 4W7XA 3BXBA 2DUFA 3NEZA 5HZSA 3M22A 3RWTA 3CB9A 2HGDA 2QLHA 3ST3A 5AQBB 5KTGA 3A8SA 5DPJA 5T3IA 3TMTA 1XMZA 2Q57A 3DQMA 3ZTFA 3LS3A 3SVDA 4L13A 2QT2A 4DXMA 4ZF4A 4NWSA 3MGFA 2HJOA 4DXOA 2VAEA 4AR7A 1QXTA 3DQCA 2Z6XA 1RMMA 4LJBA 4W6KA 3U0LA 5LTQA 4HQ9A 4P1QA 5FVGA 2AWMA 4PFEA 3NF0A 4EMQA 3GB3A 4IK9A 3VK1A 3LVCA 3I19A 2DUGA 4IZNA 2QLIA 3DPXA 3ADFA 2WSOA 5HZOA 2H5OA 4W6PA 2Z6YA 3WCKA 2OJKA 5EXBA 3TMRA 3E5VA 1BFPA 3PJ7A 4W7DA 5BT0A 3E5WA 2WURA 4W6OA 2AWLA 3EKHA 4Q7UA 3DQ3A 5EJUA 3W1DA 4IK8A 4JC2A 3U8PA 4I2YA 1MOUA 4Q9WA 1F09A 2H5RA 2DUIA 4XOWA 1H4UA 2ZO6A 2AH8A 2H8QA 2V4EC 3U0MA 5DTZA 4W6BA 5H87A 5LTRA 4W7AA 5HZUA 1Z1QA 4TZGA 3OSRA 2IOVA 1EMLA 3PJ5A 1G7KA 1W7UA 3SVNA 3K1KA 3DQHA 5EBJA 2O24A 3AKOA 3KCTA 2P4MA 4W6IA 4Q7RA 4W6UA 4OHSA 2VVIA 1KYRA 2HRSA 4LQUA 3SG5A 2YE1A 1HCJA 1YHGA 4OJ0A 4W7CA 2WSNA 3OGOA 3LF4B 3DQUA 3DQ8A 3SRYA 2DDDA 4KF5C 4Q9XA 5FVFA 2DDCA 3IR8A 3SSHA 2Y0GA 2RH7A 4W69A 2YDZA 2EMNA 2WHTA 2A47A 3DQOA 3LVAA 2HFCA 3SVSA 5J2OA 3SSKA 2IB5A 2IB6A 2V4EA 3DQ5A 3SVEA 3SSYA 3O78A 3SVOA 4PPLA 4OGSA 3SSPA 4XGYA 4Z4MA 4W6JA 2AWKA 4U2VA 2FL1A 5DRFA 4IK3A 3DQ9A 2G6XA 5DTYA 1OXFA 1EMFA 3DQKA 4KAGA 3DQNA 3CFAA 2POXA 2G5ZB 2V4EB 3NEDA 4W6SA 4N3DA 2OGRA 3DPWA 3IP2A 3GJ1A 5LTPA 1JC1A 4ZINA 4Q7TA 1YHHA 4TZAA 4PPKA 4KW4A 4LQTA 5HBDA 4KF5A 3CFFA 4W6AA 2VVHA 5BQLA 5DY6A 2G16B 3SSTA 3ED8A 3NT3A 1HUYA 5FHVA 1YJFA 2VADA 2DUHA 1QYFA 3U8CA 5DQMA 4EDOA 2AWJA 4ZBLA 3W1CA 2A50B 3VICA 2WHUA 3ST0A 1RM9A 2H9WA 4W6DA 5DQBA 4LW5A 2G3OA 1OXDA 2QRFA 4KGFA 1YFPA 4W6LA 1RMPA 4JRBA 2ZMUA 1EMEA 4ZFSA 4PPJA 3U0NA 2VVJA
chains in the Genus database with same CATH topology
1EMBA 3DQIA 3H1RA 3LVDA 4J88A 4H47A 3LF3A 2A54B 4OY4A 4W74A 1S6ZA 4R6BA 4W72A 5DPIA 4JGEA 4ZB1A 5LK4A 4JFGA 3EK7A 1XA9A 1XSSA 3DQDA 2ICRA 3UFZA 1Q4BA 4J89A 2YFPA 3DQFA 4W7RA 4GESB 4ZF5A 3BX9A 4IK4A 3RWAA 3V3DA 3DPZA 5EB6A 2A46A 1Q4AA 2PXWA 2A53B 3M24A 1KYPA 3ST4A 5HZTA 4W6CA 1QYQA 4EN1A 2C9JA 4W7EA 1EMMA 1ZGPA 4RYWA 1ZGQA 2H6VA 1JBZA 4KA9A 1QYOA 2DUEA 3GJ2A 5EHUA 3SVUA 5EXUA 4GOBA 1H6RA 1EMGA 2EMOA 4W6MA 1RMOA 5HGEA 2VZXA 1XQMA 2B3PA 4ANJA 3ZUFA 3SSLA 2HPWA 3SVBA 2HQZA 1KP5A 3NT9A 4OQWA 3DQ2A 3DQ1A 3P28A 3H1OA 2DD9A 2QZ0A 4W6NA 3S05A 4ORNA 2O29A 3CBEA 3CFHA 1YJ2A 2QU1A 1F0BA 2O2BA 3SVCA 5FVIA 5H89A 1EMAA 3DQJA 4L1IA 4R6DA 5DPHA 3CD1A 4DXNA 2BTJA 3EVVA 4B5YA 3CD9A 5HW9A 1UISA 4W6TA 2HCGA 3VHTA 2C9IA 2JADA 4W6FA 3BXCA 1ZGOA 3BXAA 5BTTA 1Q4CA 3EKJA 2OKWA 3SG6A 2PXSA 4KW9A 2Z6ZA 4EULA 2G2SB 4RTCA 4DXPA 2ARLA 3P8UA 3SV5A 4JF9A 1EMCA 3SG2A 3VHTB 4UTSA 3E5TA 5BTTB 3G9AA 4XL5A 3SSVA 2FWQA 5DU0A 2EMDA 4DXQA 2GX0A 3DQLA 4JEOA 4W6HA 1OXEA 5EB7A 2DD7A 2Q6PA 2OKYA 2WIQA 4XVPA 4W77A 1GFLA 1Q4DA 4H3LA 5DTLA 1Q73A 2YE0A 2Z1OA 3GEXA 4LJDC 5DRGA 3EK4A 3WLDA 2WISA 4IK1A 3OSQA 4H3NA 4HQ8A 2HGYA 2QLGA 4H3MA 3EVPA 4KGEA 4DKMA 3DQ4A 4BDUA 3DQAA 2GW3A 4KW8A 4W7FA 4Z4KA 3U8AA 2A56B 3ZUJA 5DPGA 2AHAA 4P76A 4IK5A 5DTXA 3SVRA 1RRXA 1CV7A 3LA1A 2FZUA 2GW4B 2G3DB 3ZULA 3LSAA 4DKNA 5F9GA 4W6GA 3GL4A 2WHSA 1GGXA 4LJCA 4HE4A 2H5QA 1XAEA 2QLGB 1ZUXA 3PJBA 1Z1PA 3U0KA 3SG4A 4HVFA 3AI4A 4KEXA 2G6YA 4RYSA 2HQKA 5H88A 1QY3A 4W76A 4HQCA 4W73A 3DQ7A 4KPIA 4LJDA 1MOVA 1JBYA 4GF6B 3KCSA 2B3QA 1YZWA 3SG7A 1GL4A 2OTEA 4XOVA 4ZF3A 1JC0A 2ZO7A 3EVRA 1Q4EA 4DXIA 4J8AA 1KYSA 1EMKA 3O77A 1C4FA 2QLEA 2G6EA 3CGLA 4ZIOA 4B30A 2A48A 4L12A 2GX2A 1W7TA 3DQEA 4AS8A 3DQ6A 1YHIA 4EDSA 4W6RA 4KF4A 3ST2A 3SS0A 3SG3A 2H5PA 2OTBA 3PIBA 3EVUA 1B9CA 4W75A 3UG0A 2IE2A 3AI5A 4B30B 1W7SA 3EK8A 3WLCA 4H48A 2ZMWA 2A52B 1MYWA 5EXCI 4W7XA 3BXBA 2DUFA 3NEZA 5HZSA 3M22A 3RWTA 3CB9A 2HGDA 2QLHA 3ST3A 5AQBB 5KTGA 3A8SA 5DPJA 5T3IA 3TMTA 1XMZA 2Q57A 3DQMA 3ZTFA 3LS3A 3SVDA 4L13A 2QT2A 4DXMA 4ZF4A 4NWSA 3MGFA 2HJOA 4DXOA 2VAEA 4AR7A 1QXTA 3DQCA 2Z6XA 1RMMA 4LJBA 4W6KA 3U0LA 5LTQA 4HQ9A 4P1QA 5FVGA 2AWMA 4PFEA 3NF0A 4EMQA 3GB3A 4IK9A 3VK1A 3LVCA 3I19A 2DUGA 4IZNA 2QLIA 3DPXA 3ADFA 2WSOA 5HZOA 2H5OA 4W6PA 2Z6YA 3WCKA 2OJKA 5EXBA 3TMRA 3E5VA 1BFPA 3PJ7A 4W7DA 5BT0A 3E5WA 2WURA 4W6OA 2AWLA 3EKHA 4Q7UA 3DQ3A 5EJUA 3W1DA 4IK8A 4JC2A 3U8PA 4I2YA 1MOUA 4Q9WA 1F09A 2H5RA 2DUIA 4XOWA 1H4UA 2ZO6A 2AH8A 2H8QA 2V4EC 3U0MA 5DTZA 4W6BA 5H87A 5LTRA 4W7AA 5HZUA 1Z1QA 4TZGA 3OSRA 2IOVA 1EMLA 3PJ5A 1G7KA 1W7UA 3SVNA 3K1KA 3DQHA 5EBJA 2O24A 3AKOA 3KCTA 2P4MA 4W6IA 4Q7RA 4W6UA 4OHSA 2VVIA 1KYRA 2HRSA 4LQUA 3SG5A 2YE1A 1HCJA 1YHGA 4OJ0A 4W7CA 2WSNA 3OGOA 3LF4B 3DQUA 3DQ8A 3SRYA 2DDDA 4KF5C 4Q9XA 5FVFA 2DDCA 3IR8A 3SSHA 2Y0GA 2RH7A 4W69A 2YDZA 2EMNA 2WHTA 2A47A 3DQOA 3LVAA 2HFCA 3SVSA 5J2OA 3SSKA 2IB5A 2IB6A 2V4EA 3DQ5A 3SVEA 3SSYA 3O78A 3SVOA 4PPLA 4OGSA 3SSPA 4XGYA 4Z4MA 4W6JA 2AWKA 4U2VA 2FL1A 5DRFA 4IK3A 3DQ9A 2G6XA 5DTYA 1OXFA 1EMFA 3DQKA 4KAGA 3DQNA 3CFAA 2POXA 2G5ZB 2V4EB 3NEDA 4W6SA 4N3DA 2OGRA 3DPWA 3IP2A 3GJ1A 5LTPA 1JC1A 4ZINA 4Q7TA 1YHHA 4TZAA 4PPKA 4KW4A 4LQTA 5HBDA 4KF5A 3CFFA 4W6AA 2VVHA 5BQLA 5DY6A 2G16B 3SSTA 3ED8A 3NT3A 1HUYA 5FHVA 1YJFA 2VADA 2DUHA 1QYFA 3U8CA 5DQMA 4EDOA 2AWJA 4ZBLA 3W1CA 2A50B 3VICA 2WHUA 3ST0A 1RM9A 2H9WA 4W6DA 5DQBA 4LW5A 2G3OA 1OXDA 2QRFA 4KGFA 1YFPA 4W6LA 1RMPA 4JRBA 2ZMUA 1EMEA 4ZFSA 4PPJA 3U0NA 2VVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EMB A;  3DQI A;  3H1R A;  3LVD A;  4J88 A;  4H47 A;  3LF3 A;  2A54 B;  4OY4 A;  4W74 A;  1S6Z A;  4R6B A;  4W72 A;  5DPI A;  4JGE A;  4ZB1 A;  5LK4 A;  4JFG A;  3EK7 A;  1XA9 A;  1XSS A;  3DQD A;  2ICR A;  3UFZ A;  1Q4B A;  4J89 A;  2YFP A;  3DQF A;  4W7R A;  4GES B;  4ZF5 A;  3BX9 A;  4IK4 A;  3RWA A;  3V3D A;  3DPZ A;  5EB6 A;  2A46 A;  1Q4A A;  2PXW A;  2A53 B;  3M24 A;  1KYP A;  3ST4 A;  5HZT A;  4W6C A;  1QYQ A;  4EN1 A;  2C9J A;  4W7E A;  1EMM A;  1ZGP A;  4RYW A;  1ZGQ A;  2H6V A;  1JBZ A;  4KA9 A;  1QYO A;  2DUE A;  3GJ2 A;  5EHU A;  3SVU A;  5EXU A;  4GOB A;  1H6R A;  1EMG A;  2EMO A;  4W6M A;  1RMO A;  5HGE A;  2VZX A;  1XQM A;  2B3P A;  4ANJ A;  3ZUF A;  3SSL A;  2HPW A;  3SVB A;  2HQZ A;  1KP5 A;  3NT9 A;  4OQW A;  3DQ2 A;  3DQ1 A;  3P28 A;  3H1O A;  2DD9 A;  2QZ0 A;  4W6N A;  3S05 A;  4ORN A;  2O29 A;  3CBE A;  3CFH A;  1YJ2 A;  2QU1 A;  1F0B A;  2O2B A;  3SVC A;  5FVI A;  5H89 A;  1EMA A;  3DQJ A;  4L1I A;  4R6D A;  5DPH A;  3CD1 A;  4DXN A;  2BTJ A;  3EVV A;  4B5Y A;  3CD9 A;  5HW9 A;  1UIS A;  4W6T A;  2HCG A;  3VHT A;  2C9I A;  2JAD A;  4W6F A;  3BXC A;  1ZGO A;  3BXA A;  5BTT A;  1Q4C A;  3EKJ A;  2OKW A;  3SG6 A;  2PXS A;  4KW9 A;  2Z6Z A;  4EUL A;  2G2S B;  4RTC A;  4DXP A;  2ARL A;  3P8U A;  3SV5 A;  4JF9 A;  1EMC A;  3SG2 A;  3VHT B;  4UTS A;  3E5T A;  5BTT B;  3G9A A;  4XL5 A;  3SSV A;  2FWQ A;  5DU0 A;  2EMD A;  4DXQ A;  2GX0 A;  3DQL A;  4JEO A;  4W6H A;  1OXE A;  5EB7 A;  2DD7 A;  2Q6P A;  2OKY A;  2WIQ A;  4XVP A;  4W77 A;  1GFL A;  1Q4D A;  4H3L A;  5DTL A;  1Q73 A;  2YE0 A;  2Z1O A;  3GEX A;  4LJD C;  5DRG A;  3EK4 A;  3WLD A;  2WIS A;  4IK1 A;  3OSQ A;  4H3N A;  4HQ8 A;  2HGY A;  2QLG A;  4H3M A;  3EVP A;  4KGE A;  4DKM A;  3DQ4 A;  4BDU A;  3DQA A;  2GW3 A;  4KW8 A;  4W7F A;  4Z4K A;  3U8A A;  2A56 B;  3ZUJ A;  5DPG A;  2AHA A;  4P76 A;  4IK5 A;  5DTX A;  3SVR A;  1RRX A;  1CV7 A;  3LA1 A;  2FZU A;  2GW4 B;  2G3D B;  3ZUL A;  3LSA A;  4DKN A;  5F9G A;  4W6G A;  3GL4 A;  2WHS A;  1GGX A;  4LJC A;  4HE4 A;  2H5Q A;  1XAE A;  2QLG B;  1ZUX A;  3PJB A;  1Z1P A;  3U0K A;  3SG4 A;  4HVF A;  3AI4 A;  4KEX A;  2G6Y A;  4RYS A;  2HQK A;  5H88 A;  1QY3 A;  4W76 A;  4HQC A;  4W73 A;  3DQ7 A;  4KPI A;  4LJD A;  1MOV A;  1JBY A;  4GF6 B;  3KCS A;  2B3Q A;  1YZW A;  3SG7 A;  1GL4 A;  2OTE A;  4XOV A;  4ZF3 A;  1JC0 A;  2ZO7 A;  3EVR A;  1Q4E A;  4DXI A;  4J8A A;  1KYS A;  1EMK A;  3O77 A;  1C4F A;  2QLE A;  2G6E A;  3CGL A;  4ZIO A;  4B30 A;  2A48 A;  4L12 A;  2GX2 A;  1W7T A;  3DQE A;  4AS8 A;  3DQ6 A;  1YHI A;  4EDS A;  4W6R A;  4KF4 A;  3ST2 A;  3SS0 A;  3SG3 A;  2H5P A;  2OTB A;  3PIB A;  3EVU A;  1B9C A;  4W75 A;  3UG0 A;  2IE2 A;  3AI5 A;  4B30 B;  1W7S A;  3EK8 A;  3WLC A;  4H48 A;  2ZMW A;  2A52 B;  1MYW A;  5EXC I;  4W7X A;  3BXB A;  2DUF A;  3NEZ A;  5HZS A;  3M22 A;  3RWT A;  3CB9 A;  2HGD A;  2QLH A;  3ST3 A;  5AQB B;  5KTG A;  3A8S A;  5DPJ A;  5T3I A;  3TMT A;  1XMZ A;  2Q57 A;  3DQM A;  3ZTF A;  3LS3 A;  3SVD A;  4L13 A;  2QT2 A;  4DXM A;  4ZF4 A;  4NWS A;  3MGF A;  2HJO A;  4DXO A;  2VAE A;  4AR7 A;  1QXT A;  3DQC A;  2Z6X A;  1RMM A;  4LJB A;  4W6K A;  3U0L A;  5LTQ A;  4HQ9 A;  4P1Q A;  5FVG A;  2AWM A;  4PFE A;  3NF0 A;  4EMQ A;  3GB3 A;  4IK9 A;  3VK1 A;  3LVC A;  3I19 A;  2DUG A;  4IZN A;  2QLI A;  3DPX A;  3ADF A;  2WSO A;  5HZO A;  2H5O A;  4W6P A;  2Z6Y A;  3WCK A;  2OJK A;  5EXB A;  3TMR A;  3E5V A;  1BFP A;  3PJ7 A;  4W7D A;  5BT0 A;  3E5W A;  2WUR A;  4W6O A;  2AWL A;  3EKH A;  4Q7U A;  3DQ3 A;  5EJU A;  3W1D A;  4IK8 A;  4JC2 A;  3U8P A;  4I2Y A;  1MOU A;  4Q9W A;  1F09 A;  2H5R A;  2DUI A;  4XOW A;  1H4U A;  2ZO6 A;  2AH8 A;  2H8Q A;  2V4E C;  3U0M A;  5DTZ A;  4W6B A;  5H87 A;  5LTR A;  4W7A A;  5HZU A;  1Z1Q A;  4TZG A;  3OSR A;  2IOV A;  1EML A;  3PJ5 A;  1G7K A;  1W7U A;  3SVN A;  3K1K A;  3DQH A;  5EBJ A;  2O24 A;  3AKO A;  3KCT A;  2P4M A;  4W6I A;  4Q7R A;  4W6U A;  4OHS A;  2VVI A;  1KYR A;  2HRS A;  4LQU A;  3SG5 A;  2YE1 A;  1HCJ A;  1YHG A;  4OJ0 A;  4W7C A;  2WSN A;  3OGO A;  3LF4 B;  3DQU A;  3DQ8 A;  3SRY A;  2DDD A;  4KF5 C;  4Q9X A;  5FVF A;  2DDC A;  3IR8 A;  3SSH A;  2Y0G A;  2RH7 A;  4W69 A;  2YDZ A;  2EMN A;  2WHT A;  2A47 A;  3DQO A;  3LVA A;  2HFC A;  3SVS A;  5J2O A;  3SSK A;  2IB5 A;  2IB6 A;  2V4E A;  3DQ5 A;  3SVE A;  3SSY A;  3O78 A;  3SVO A;  4PPL A;  4OGS A;  3SSP A;  4XGY A;  4Z4M A;  4W6J A;  2AWK A;  4U2V A;  2FL1 A;  5DRF A;  4IK3 A;  3DQ9 A;  2G6X A;  5DTY A;  1OXF A;  1EMF A;  3DQK A;  4KAG A;  3DQN A;  3CFA A;  2POX A;  2G5Z B;  2V4E B;  3NED A;  4W6S A;  4N3D A;  2OGR A;  3DPW A;  3IP2 A;  3GJ1 A;  5LTP A;  1JC1 A;  4ZIN A;  4Q7T A;  1YHH A;  4TZA A;  4PPK A;  4KW4 A;  4LQT A;  5HBD A;  4KF5 A;  3CFF A;  4W6A A;  2VVH A;  5BQL A;  5DY6 A;  2G16 B;  3SST A;  3ED8 A;  3NT3 A;  1HUY A;  5FHV A;  1YJF A;  2VAD A;  2DUH A;  1QYF A;  3U8C A;  5DQM A;  4EDO A;  2AWJ A;  4ZBL A;  3W1C A;  2A50 B;  3VIC A;  2WHU A;  3ST0 A;  1RM9 A;  2H9W A;  4W6D A;  5DQB A;  4LW5 A;  2G3O A;  1OXD A;  2QRF A;  4KGF A;  1YFP A;  4W6L A;  1RMP A;  4JRB A;  2ZMU A;  1EME A;  4ZFS A;  4PPJ A;  3U0N A;  2VVJ A; 
#chains in the Genus database with same CATH topology
 1EMB A;  3DQI A;  3H1R A;  3LVD A;  4J88 A;  4H47 A;  3LF3 A;  2A54 B;  4OY4 A;  4W74 A;  1S6Z A;  4R6B A;  4W72 A;  5DPI A;  4JGE A;  4ZB1 A;  5LK4 A;  4JFG A;  3EK7 A;  1XA9 A;  1XSS A;  3DQD A;  2ICR A;  3UFZ A;  1Q4B A;  4J89 A;  2YFP A;  3DQF A;  4W7R A;  4GES B;  4ZF5 A;  3BX9 A;  4IK4 A;  3RWA A;  3V3D A;  3DPZ A;  5EB6 A;  2A46 A;  1Q4A A;  2PXW A;  2A53 B;  3M24 A;  1KYP A;  3ST4 A;  5HZT A;  4W6C A;  1QYQ A;  4EN1 A;  2C9J A;  4W7E A;  1EMM A;  1ZGP A;  4RYW A;  1ZGQ A;  2H6V A;  1JBZ A;  4KA9 A;  1QYO A;  2DUE A;  3GJ2 A;  5EHU A;  3SVU A;  5EXU A;  4GOB A;  1H6R A;  1EMG A;  2EMO A;  4W6M A;  1RMO A;  5HGE A;  2VZX A;  1XQM A;  2B3P A;  4ANJ A;  3ZUF A;  3SSL A;  2HPW A;  3SVB A;  2HQZ A;  1KP5 A;  3NT9 A;  4OQW A;  3DQ2 A;  3DQ1 A;  3P28 A;  3H1O A;  2DD9 A;  2QZ0 A;  4W6N A;  3S05 A;  4ORN A;  2O29 A;  3CBE A;  3CFH A;  1YJ2 A;  2QU1 A;  1F0B A;  2O2B A;  3SVC A;  5FVI A;  5H89 A;  1EMA A;  3DQJ A;  4L1I A;  4R6D A;  5DPH A;  3CD1 A;  4DXN A;  2BTJ A;  3EVV A;  4B5Y A;  3CD9 A;  5HW9 A;  1UIS A;  4W6T A;  2HCG A;  3VHT A;  2C9I A;  2JAD A;  4W6F A;  3BXC A;  1ZGO A;  3BXA A;  5BTT A;  1Q4C A;  3EKJ A;  2OKW A;  3SG6 A;  2PXS A;  4KW9 A;  2Z6Z A;  4EUL A;  2G2S B;  4RTC A;  4DXP A;  2ARL A;  3P8U A;  3SV5 A;  4JF9 A;  1EMC A;  3SG2 A;  3VHT B;  4UTS A;  3E5T A;  5BTT B;  3G9A A;  4XL5 A;  3SSV A;  2FWQ A;  5DU0 A;  2EMD A;  4DXQ A;  2GX0 A;  3DQL A;  4JEO A;  4W6H A;  1OXE A;  5EB7 A;  2DD7 A;  2Q6P A;  2OKY A;  2WIQ A;  4XVP A;  4W77 A;  1GFL A;  1Q4D A;  4H3L A;  5DTL A;  1Q73 A;  2YE0 A;  2Z1O A;  3GEX A;  4LJD C;  5DRG A;  3EK4 A;  3WLD A;  2WIS A;  4IK1 A;  3OSQ A;  4H3N A;  4HQ8 A;  2HGY A;  2QLG A;  4H3M A;  3EVP A;  4KGE A;  4DKM A;  3DQ4 A;  4BDU A;  3DQA A;  2GW3 A;  4KW8 A;  4W7F A;  4Z4K A;  3U8A A;  2A56 B;  3ZUJ A;  5DPG A;  2AHA A;  4P76 A;  4IK5 A;  5DTX A;  3SVR A;  1RRX A;  1CV7 A;  3LA1 A;  2FZU A;  2GW4 B;  2G3D B;  3ZUL A;  3LSA A;  4DKN A;  5F9G A;  4W6G A;  3GL4 A;  2WHS A;  1GGX A;  4LJC A;  4HE4 A;  2H5Q A;  1XAE A;  2QLG B;  1ZUX A;  3PJB A;  1Z1P A;  3U0K A;  3SG4 A;  4HVF A;  3AI4 A;  4KEX A;  2G6Y A;  4RYS A;  2HQK A;  5H88 A;  1QY3 A;  4W76 A;  4HQC A;  4W73 A;  3DQ7 A;  4KPI A;  4LJD A;  1MOV A;  1JBY A;  4GF6 B;  3KCS A;  2B3Q A;  1YZW A;  3SG7 A;  1GL4 A;  2OTE A;  4XOV A;  4ZF3 A;  1JC0 A;  2ZO7 A;  3EVR A;  1Q4E A;  4DXI A;  4J8A A;  1KYS A;  1EMK A;  3O77 A;  1C4F A;  2QLE A;  2G6E A;  3CGL A;  4ZIO A;  4B30 A;  2A48 A;  4L12 A;  2GX2 A;  1W7T A;  3DQE A;  4AS8 A;  3DQ6 A;  1YHI A;  4EDS A;  4W6R A;  4KF4 A;  3ST2 A;  3SS0 A;  3SG3 A;  2H5P A;  2OTB A;  3PIB A;  3EVU A;  1B9C A;  4W75 A;  3UG0 A;  2IE2 A;  3AI5 A;  4B30 B;  1W7S A;  3EK8 A;  3WLC A;  4H48 A;  2ZMW A;  2A52 B;  1MYW A;  5EXC I;  4W7X A;  3BXB A;  2DUF A;  3NEZ A;  5HZS A;  3M22 A;  3RWT A;  3CB9 A;  2HGD A;  2QLH A;  3ST3 A;  5AQB B;  5KTG A;  3A8S A;  5DPJ A;  5T3I A;  3TMT A;  1XMZ A;  2Q57 A;  3DQM A;  3ZTF A;  3LS3 A;  3SVD A;  4L13 A;  2QT2 A;  4DXM A;  4ZF4 A;  4NWS A;  3MGF A;  2HJO A;  4DXO A;  2VAE A;  4AR7 A;  1QXT A;  3DQC A;  2Z6X A;  1RMM A;  4LJB A;  4W6K A;  3U0L A;  5LTQ A;  4HQ9 A;  4P1Q A;  5FVG A;  2AWM A;  4PFE A;  3NF0 A;  4EMQ A;  3GB3 A;  4IK9 A;  3VK1 A;  3LVC A;  3I19 A;  2DUG A;  4IZN A;  2QLI A;  3DPX A;  3ADF A;  2WSO A;  5HZO A;  2H5O A;  4W6P A;  2Z6Y A;  3WCK A;  2OJK A;  5EXB A;  3TMR A;  3E5V A;  1BFP A;  3PJ7 A;  4W7D A;  5BT0 A;  3E5W A;  2WUR A;  4W6O A;  2AWL A;  3EKH A;  4Q7U A;  3DQ3 A;  5EJU A;  3W1D A;  4IK8 A;  4JC2 A;  3U8P A;  4I2Y A;  1MOU A;  4Q9W A;  1F09 A;  2H5R A;  2DUI A;  4XOW A;  1H4U A;  2ZO6 A;  2AH8 A;  2H8Q A;  2V4E C;  3U0M A;  5DTZ A;  4W6B A;  5H87 A;  5LTR A;  4W7A A;  5HZU A;  1Z1Q A;  4TZG A;  3OSR A;  2IOV A;  1EML A;  3PJ5 A;  1G7K A;  1W7U A;  3SVN A;  3K1K A;  3DQH A;  5EBJ A;  2O24 A;  3AKO A;  3KCT A;  2P4M A;  4W6I A;  4Q7R A;  4W6U A;  4OHS A;  2VVI A;  1KYR A;  2HRS A;  4LQU A;  3SG5 A;  2YE1 A;  1HCJ A;  1YHG A;  4OJ0 A;  4W7C A;  2WSN A;  3OGO A;  3LF4 B;  3DQU A;  3DQ8 A;  3SRY A;  2DDD A;  4KF5 C;  4Q9X A;  5FVF A;  2DDC A;  3IR8 A;  3SSH A;  2Y0G A;  2RH7 A;  4W69 A;  2YDZ A;  2EMN A;  2WHT A;  2A47 A;  3DQO A;  3LVA A;  2HFC A;  3SVS A;  5J2O A;  3SSK A;  2IB5 A;  2IB6 A;  2V4E A;  3DQ5 A;  3SVE A;  3SSY A;  3O78 A;  3SVO A;  4PPL A;  4OGS A;  3SSP A;  4XGY A;  4Z4M A;  4W6J A;  2AWK A;  4U2V A;  2FL1 A;  5DRF A;  4IK3 A;  3DQ9 A;  2G6X A;  5DTY A;  1OXF A;  1EMF A;  3DQK A;  4KAG A;  3DQN A;  3CFA A;  2POX A;  2G5Z B;  2V4E B;  3NED A;  4W6S A;  4N3D A;  2OGR A;  3DPW A;  3IP2 A;  3GJ1 A;  5LTP A;  1JC1 A;  4ZIN A;  4Q7T A;  1YHH A;  4TZA A;  4PPK A;  4KW4 A;  4LQT A;  5HBD A;  4KF5 A;  3CFF A;  4W6A A;  2VVH A;  5BQL A;  5DY6 A;  2G16 B;  3SST A;  3ED8 A;  3NT3 A;  1HUY A;  5FHV A;  1YJF A;  2VAD A;  2DUH A;  1QYF A;  3U8C A;  5DQM A;  4EDO A;  2AWJ A;  4ZBL A;  3W1C A;  2A50 B;  3VIC A;  2WHU A;  3ST0 A;  1RM9 A;  2H9W A;  4W6D A;  5DQB A;  4LW5 A;  2G3O A;  1OXD A;  2QRF A;  4KGF A;  1YFP A;  4W6L A;  1RMP A;  4JRB A;  2ZMU A;  1EME A;  4ZFS A;  4PPJ A;  3U0N A;  2VVJ A; 
#chains in the Genus database with same CATH homology
 1EMB A;  3DQI A;  3H1R A;  3LVD A;  4J88 A;  4H47 A;  3LF3 A;  2A54 B;  4OY4 A;  4W74 A;  1S6Z A;  4R6B A;  4W72 A;  5DPI A;  4JGE A;  4ZB1 A;  5LK4 A;  4JFG A;  3EK7 A;  1XA9 A;  1XSS A;  3DQD A;  2ICR A;  3UFZ A;  1Q4B A;  4J89 A;  2YFP A;  3DQF A;  4W7R A;  4GES B;  4ZF5 A;  3BX9 A;  4IK4 A;  3RWA A;  3V3D A;  3DPZ A;  5EB6 A;  2A46 A;  1Q4A A;  2PXW A;  2A53 B;  3M24 A;  1KYP A;  3ST4 A;  5HZT A;  4W6C A;  1QYQ A;  4EN1 A;  2C9J A;  4W7E A;  1EMM A;  1ZGP A;  4RYW A;  1ZGQ A;  2H6V A;  1JBZ A;  4KA9 A;  1QYO A;  2DUE A;  3GJ2 A;  5EHU A;  3SVU A;  5EXU A;  4GOB A;  1H6R A;  1EMG A;  2EMO A;  4W6M A;  1RMO A;  5HGE A;  2VZX A;  1XQM A;  2B3P A;  4ANJ A;  3ZUF A;  3SSL A;  2HPW A;  3SVB A;  2HQZ A;  1KP5 A;  3NT9 A;  4OQW A;  3DQ2 A;  3DQ1 A;  3P28 A;  3H1O A;  2DD9 A;  2QZ0 A;  4W6N A;  3S05 A;  4ORN A;  2O29 A;  3CBE A;  3CFH A;  1YJ2 A;  2QU1 A;  1F0B A;  2O2B A;  3SVC A;  5FVI A;  5H89 A;  1EMA A;  3DQJ A;  4L1I A;  4R6D A;  5DPH A;  3CD1 A;  4DXN A;  2BTJ A;  3EVV A;  4B5Y A;  3CD9 A;  5HW9 A;  1UIS A;  4W6T A;  2HCG A;  3VHT A;  2C9I A;  2JAD A;  4W6F A;  3BXC A;  1ZGO A;  3BXA A;  5BTT A;  1Q4C A;  3EKJ A;  2OKW A;  3SG6 A;  2PXS A;  4KW9 A;  2Z6Z A;  4EUL A;  2G2S B;  4RTC A;  4DXP A;  2ARL A;  3P8U A;  3SV5 A;  4JF9 A;  1EMC A;  3SG2 A;  3VHT B;  4UTS A;  3E5T A;  5BTT B;  3G9A A;  4XL5 A;  3SSV A;  2FWQ A;  5DU0 A;  2EMD A;  4DXQ A;  2GX0 A;  3DQL A;  4JEO A;  4W6H A;  1OXE A;  5EB7 A;  2DD7 A;  2Q6P A;  2OKY A;  2WIQ A;  4XVP A;  4W77 A;  1GFL A;  1Q4D A;  4H3L A;  5DTL A;  1Q73 A;  2YE0 A;  2Z1O A;  3GEX A;  4LJD C;  5DRG A;  3EK4 A;  3WLD A;  2WIS A;  4IK1 A;  3OSQ A;  4H3N A;  4HQ8 A;  2HGY A;  2QLG A;  4H3M A;  3EVP A;  4KGE A;  4DKM A;  3DQ4 A;  4BDU A;  3DQA A;  2GW3 A;  4KW8 A;  4W7F A;  4Z4K A;  3U8A A;  2A56 B;  3ZUJ A;  5DPG A;  2AHA A;  4P76 A;  4IK5 A;  5DTX A;  3SVR A;  1RRX A;  1CV7 A;  3LA1 A;  2FZU A;  2GW4 B;  2G3D B;  3ZUL A;  3LSA A;  4DKN A;  5F9G A;  4W6G A;  3GL4 A;  2WHS A;  1GGX A;  4LJC A;  4HE4 A;  2H5Q A;  1XAE A;  2QLG B;  1ZUX A;  3PJB A;  1Z1P A;  3U0K A;  3SG4 A;  4HVF A;  3AI4 A;  4KEX A;  2G6Y A;  4RYS A;  2HQK A;  5H88 A;  1QY3 A;  4W76 A;  4HQC A;  4W73 A;  3DQ7 A;  4KPI A;  4LJD A;  1MOV A;  1JBY A;  4GF6 B;  3KCS A;  2B3Q A;  1YZW A;  3SG7 A;  1GL4 A;  2OTE A;  4XOV A;  4ZF3 A;  1JC0 A;  2ZO7 A;  3EVR A;  1Q4E A;  4DXI A;  4J8A A;  1KYS A;  1EMK A;  3O77 A;  1C4F A;  2QLE A;  2G6E A;  3CGL A;  4ZIO A;  4B30 A;  2A48 A;  4L12 A;  2GX2 A;  1W7T A;  3DQE A;  4AS8 A;  3DQ6 A;  1YHI A;  4EDS A;  4W6R A;  4KF4 A;  3ST2 A;  3SS0 A;  3SG3 A;  2H5P A;  2OTB A;  3PIB A;  3EVU A;  1B9C A;  4W75 A;  3UG0 A;  2IE2 A;  3AI5 A;  4B30 B;  1W7S A;  3EK8 A;  3WLC A;  4H48 A;  2ZMW A;  2A52 B;  1MYW A;  5EXC I;  4W7X A;  3BXB A;  2DUF A;  3NEZ A;  5HZS A;  3M22 A;  3RWT A;  3CB9 A;  2HGD A;  2QLH A;  3ST3 A;  5AQB B;  5KTG A;  3A8S A;  5DPJ A;  5T3I A;  3TMT A;  1XMZ A;  2Q57 A;  3DQM A;  3ZTF A;  3LS3 A;  3SVD A;  4L13 A;  2QT2 A;  4DXM A;  4ZF4 A;  4NWS A;  3MGF A;  2HJO A;  4DXO A;  2VAE A;  4AR7 A;  1QXT A;  3DQC A;  2Z6X A;  1RMM A;  4LJB A;  4W6K A;  3U0L A;  5LTQ A;  4HQ9 A;  4P1Q A;  5FVG A;  2AWM A;  4PFE A;  3NF0 A;  4EMQ A;  3GB3 A;  4IK9 A;  3VK1 A;  3LVC A;  3I19 A;  2DUG A;  4IZN A;  2QLI A;  3DPX A;  3ADF A;  2WSO A;  5HZO A;  2H5O A;  4W6P A;  2Z6Y A;  3WCK A;  2OJK A;  5EXB A;  3TMR A;  3E5V A;  1BFP A;  3PJ7 A;  4W7D A;  5BT0 A;  3E5W A;  2WUR A;  4W6O A;  2AWL A;  3EKH A;  4Q7U A;  3DQ3 A;  5EJU A;  3W1D A;  4IK8 A;  4JC2 A;  3U8P A;  4I2Y A;  1MOU A;  4Q9W A;  1F09 A;  2H5R A;  2DUI A;  4XOW A;  1H4U A;  2ZO6 A;  2AH8 A;  2H8Q A;  2V4E C;  3U0M A;  5DTZ A;  4W6B A;  5H87 A;  5LTR A;  4W7A A;  5HZU A;  1Z1Q A;  4TZG A;  3OSR A;  2IOV A;  1EML A;  3PJ5 A;  1G7K A;  1W7U A;  3SVN A;  3K1K A;  3DQH A;  5EBJ A;  2O24 A;  3AKO A;  3KCT A;  2P4M A;  4W6I A;  4Q7R A;  4W6U A;  4OHS A;  2VVI A;  1KYR A;  2HRS A;  4LQU A;  3SG5 A;  2YE1 A;  1HCJ A;  1YHG A;  4OJ0 A;  4W7C A;  2WSN A;  3OGO A;  3LF4 B;  3DQU A;  3DQ8 A;  3SRY A;  2DDD A;  4KF5 C;  4Q9X A;  5FVF A;  2DDC A;  3IR8 A;  3SSH A;  2Y0G A;  2RH7 A;  4W69 A;  2YDZ A;  2EMN A;  2WHT A;  2A47 A;  3DQO A;  3LVA A;  2HFC A;  3SVS A;  5J2O A;  3SSK A;  2IB5 A;  2IB6 A;  2V4E A;  3DQ5 A;  3SVE A;  3SSY A;  3O78 A;  3SVO A;  4PPL A;  4OGS A;  3SSP A;  4XGY A;  4Z4M A;  4W6J A;  2AWK A;  4U2V A;  2FL1 A;  5DRF A;  4IK3 A;  3DQ9 A;  2G6X A;  5DTY A;  1OXF A;  1EMF A;  3DQK A;  4KAG A;  3DQN A;  3CFA A;  2POX A;  2G5Z B;  2V4E B;  3NED A;  4W6S A;  4N3D A;  2OGR A;  3DPW A;  3IP2 A;  3GJ1 A;  5LTP A;  1JC1 A;  4ZIN A;  4Q7T A;  1YHH A;  4TZA A;  4PPK A;  4KW4 A;  4LQT A;  5HBD A;  4KF5 A;  3CFF A;  4W6A A;  2VVH A;  5BQL A;  5DY6 A;  2G16 B;  3SST A;  3ED8 A;  3NT3 A;  1HUY A;  5FHV A;  1YJF A;  2VAD A;  2DUH A;  1QYF A;  3U8C A;  5DQM A;  4EDO A;  2AWJ A;  4ZBL A;  3W1C A;  2A50 B;  3VIC A;  2WHU A;  3ST0 A;  1RM9 A;  2H9W A;  4W6D A;  5DQB A;  4LW5 A;  2G3O A;  1OXD A;  2QRF A;  4KGF A;  1YFP A;  4W6L A;  1RMP A;  4JRB A;  2ZMU A;  1EME A;  4ZFS A;  4PPJ A;  3U0N A;  2VVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...