3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
molecule keywords Green fluorescent protein
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
1ZAAC 4J88A 1C4FA 2OGRA 4HVFA 4JF9A 5LK4A 1X3CA 3LSAA 4DXMA 4W6GA 4U2VA 5AQBB 2LO3A 1HUYA 1A1KA 2G3DB 4KF5C 4EN1A 2VRDA 4R2EA 4XGYA 4IK5A 1LLMC 2EMZA 3GL4A 4Z4MA 1TN9A 1A1FA 1BBOA 5LTQA 1ZGPA 3M24A 5EXBA 5J2OA 3W1DA 2EOJA 3BXCA 4LJDC 4H48A 2EOZA 4ZF5A 4EULA 1ZU1A 2YTOA 3EVUA 2CTDA 3EKJA 4R2SA 2EN1A 1UISA 3MHSC 1YUJA 2MKDA 2DUIA 4R2RA 1CV7A 3CB9A 2EP3A 2EMNA 1GGXA 2YTJA 1MOUA 3NEDA 4P76A 1RMMA 3ST0A 3EK8A 3DPWA 4W76A 3M99B 2IB6A 4L12A 4UTSA 5HZUA 4W6RA 2QU1A 3LF4B 4Q7TA 5KTGA 4LJDA 3SVUA 2HCGA 1H4UA 3OGOA 1OXFA 4F2JC 2YU8A 2WBTA 4HE4A 2WCC3 5DPGA 2EN7A 3U0KA 2ELYA 2YTPA 1S6ZA 3SVEA 2G3OA 4EDSA 3PJ5A 2JPAA 4IK9A 4DXQA 2EMGA 2ENAA 3OSQA 2YTIA 5EB7A 2YU5A 2EPRA 1YJFA 3KCTA 2WHUA 4IK3A 3CFFA 2VAEA 3DQAA 2I13A 2AH8A 1YZWA 2DDCA 4IZNA 4Z4KA 1RMOA 1ZGQA 5LTPA 4ZB1A 2EPPA 3LVCA 2DUHA 3SSVA 2QLGA 4KGFA 5H88A 2FWQA 2EMBA 2EPAA 1RRXA 1TF3A 4P1QA 1EMKA 4LJCA 4J89A 5FHVA 2G6YA 3U0NA 2OTBA 3DQIA 3UG0A 3DQKA 1X5WA 2EOHA 3UK3C 3GJ2A 1KJKA 4XVPA 1Q73A 4HQ9A 2HJOA 2HGHA 3SG4A 2AHAA 1Z1QA 5KL3A 5DY6A 3IR8A 4ZBLA 2MDGA 2M9AA 1QY3A 2ENCA 1JK1A 2GW4B 3GB3A 4W6PA 5EHUA 2E72A 2EQ3A 1ZGOA 2QT2A 2EOSA 2EMCA 4OQWA 1G7KA 4W6JA 2EM4A 4W73A 1A1JA 4W6NA 3VICA 4OY4A 3SVNA 2EQ1A 2DGCA 5HZOA 4IK4A 4H47A 2HQKA 3SV5A 4W6OA 2A56B 4W6LA 2DMIA 3EVVA 2QLIA 2EPZA 2ZMUA 4I2YA 1MOVA 4W6KA 3CD1A 1QYQA 3EVRA 5DTLA 2J7JA 3DQ6A 2EN6A 3SG3A 2YE0A 1RMPA 2DD9A 4PFEA 4OHSA 3SG2A 2VZXA 4W6UA 2A50B 4W6HA 1AAYA 4LQTA 4W7CA 4JGEA 4KGEA 1YUIA 5KL5A 5HGEA 2GX2A 4W77A 1Q4CA 2YRKA 4W6MA 4XOVA 4PPKA 1RM9A 3NF0A 4OJ0A 4LW5A 3SSHA 1KP5A 4KW8A 4KA9A 4KW9A 2ZO6A 3U8PA 2OKYA 4ZIOA 2EPXA 3DQ3A 2BB8A 3ED8A 2AWKA 2P4MA 4IJDA 1EMEA 4W6IA 5DPHA 2A53B 4XOWA 2EL5A 2EMFA 5DTZA 2WBUA 2O2BA 3LVDA 4R2CA 2ZO7A 1ZR9A 4JEOA 4KF5A 2ELZA 1EMBA 1W7UA 5DPJA 1MEYC 5DRGA 4PPLA 2OKWA 2DUEA 3A8SA 1XSSA 4Q7RA 5KL4A 3K1KA 1B69A 3E5WA 1QYOA 5EBJA 4WSGA 1F2IG 2FL1A 3PIBA 2GX0A 2DLKA 4IK8A 4GZNC 2R1FA 3CFHA 3EK7A 1B9CA 2AWLA 3LA1A 5EXCI 4RYSA 4J8AA 5LTRA 2EJ4A 2EMAA 4LQUA 4W6DA 4N3DA 1OXDA 1QXTA 2RH7A 3DQ4A 2JADA 4W7EA 3W1CA 5BQLA 2EM2A 3SSYA 1ZUXA 4PPJA 3RWAA 2YRHA 2EM5A 4L1IA 3AI4A 3VHTB 2CSHA 3LVAA 3EPHA 1QYFA 3DQFA 2Q57A 4R2AA 1W7TA 2A54B 2H8QA 3BX9A 2Z6YA 1EMMA 4W6CA 2YE1A 5HZSA 2DUFA 3NEZA 4KF4A 4HQ8A 3EPJA 4W6TA 3G9AA 2LVHA 2G5ZB 2EMOA 1F09A 3AI5A 3SG6A 3SVDA 2G16B 4DXOA 2DLQA 4NWSA 3IP2A 4ZF4A 3DQDA 2RPCA 2QLHA 3EKHA 4W7AA 2O29A 4TZGA 2LV2A 4JFGA 2EOMA 2OTEA 3DQJA 3ST3A 4GOBA 4KW4A 2DRPA 1WJPA 2EM8A 3DQEA 1OXEA 2AWMA 3BXAA 2Y0GA 2V4EC 3ZUJA 4IS1C 1KYRA 4KEXA 3EPLA 2ARLA 4L13A 2YFPA 5BTTB 3DQLA 2EOYA 4M9VC 1JBYA 2EN4A 3SRYA 2ADRA 5H87A 1GL4A 4DXIA 2QRFA 1YHIA 2A46A 2Z6ZA 4ZINA 3ZULA 2EMWA 3NT9A 2QLGB 3PJBA 1A1LA 2EM7A 4OGSA 2G2SB 3U8CA 5FVFA 3SVBA 2YRMA 2JP9A 2HGDA 4F6NA 5KL7A 2WISA 3EK4A 2EOXA 2IOVA 3SG5A 4W75A 4Q9XA 4W6FA 3E5VA 3SSTA 4B30B 5EXUA 5BTTA 2BTJA 3WLDA 3SSLA 1X6HA 1JC1A 3TMRA 2EPUA 2EL4A 2DDDA 5F9GA 3E5TA 5KL2A 1EMAA 4DKMA 1XA9A 1XMZA 3SG7A 4H3NA 2LCEA 1Q4DA 2C9IA 3O78A 1H6RA 3SVCA 3WCKA 2EN8A 4AR7A 1DGCA 3P8UA 4ZF3A 2PRTA 2A25A 2WSNA 2Z6XA 4DXNA 4R2DA 3V3DA 2DD7A 4R2PA 2O24A 2QZ0A 3H1OA 3P28A 2A52B 2NABA 2B3PA 2GW3A 2MKNA 3DQHA 1BB8A 2EOOA 1MYWA 5DTXA 1YSAC 2EOFA 5DPIA 4FK5C 4Q9WA 3OSRA 1G2DC 3DQOA 4RTCA 4B5YA 2V4EB 2YTDA 1A1HA 4DKNA 5FVGA 3ST2A 1KYPA 5DU0A 3S05A 5HBDA 2Z1OA 3VHTA 2EMDA 2HQZA 4W6SA 4BDUA 2YTQA 2WSOA 3LS3A 2YTGA 2EM3A 3ST4A 1TF6A 1P47A 2H6VA 3SS0A 2VVIA 1X6FA 3CFAA 2OJKA 3ZUFA 2ICRA 2YTEA 2GHFA 2YTNA 4XL5A 3DQ7A 1YHGA 2EMLA 1XAEA 4EDOA 5HZTA 2FZUA 3U8AA 3SSPA 3DPZA 5KL6A 2GLIA 3CBEA 2EN3A 2YSOA 2B3QA 3DQ9A 5FVIA 2EE8A 3UFZA 2EMYA 2HPWA 2EPCA 3DQCA 1YJ2A 3NT3A 2EOQA 4JRBA 3RWTA 3SVSA 5EJUA 4H3MA 2A47A 1JC0A 2HRSA 2EM6A 3DQ8A 3ADFA 2YSPA 4TZAA 3DQNA 3CGLA 2EMHA 2ZMWA 4W7RA 4W69A 2CT1A 3TMTA 2VADA 3SSKA 4W6AA 3DQUA 4X9JA 1W7SA 2H5OA 3MGFA 5DQMA 2C9JA 3EPKA 3BXBA 1JBZA 2EM0A 2H5PA 3WLCA 4JC2A 3GEXA 2A48A 2ENHA 2H5RA 4RYWA 3I19A 2LT7A 1GFLA 4W74A 2EL6A 1EMLA 2IE2A 5DTYA 1Q4BA 1XQMA 4W6BA 4W7XA 4HQCA 2V4EA 2H5QA 5DRFA 1Q4EA 4W7DA 4KPIA 1NCSA 2PXWA 4H3LA 4B30A 1JK2A 2YDZA 2VVJA 4R6DA 4R2QA 2WHTA 1EMCA 4W7FA 4ANJA 4AS8A 3MHHC 2EOEA 2G6XA 2HFCA 2PXSA 4W72A 2WBSA 2Q6PA 3CD9A 4Q7UA 3DPXA 1RMDA 2EQ0A 4LJBA 1YFPA 2EORA 1F0BA 3O77A 4DXPA 3M22A 2VVHA 5H89A 1KYSA 1EMGA 3AKOA 2H9WA 2EMIA 3VK1A 3DQMA 1A1GA 1Z1BA 5HW9A 1UBDC 3ZTFA 4GESB 3SVOA 2EN2A 4KAGA 2G6EA 3U0LA 3SVRA 1YHHA 2EM9A 2RSIA 1X6EA 5DQBA 3GJ1A 1HCJA 3LF3A 1Z1PA 2HGYA 3U0MA 4R6BA 1Q4AA 5BT0A 4ZFSA 1UN6B 2EMKA 2D9HA 4GF6B 4IK1A 2QLEA 2EMXA 4EMQA 1BFPA 3EVPA 3PJ7A 2EOIA 2POXA 4ORNA 2DUGA 2WHSA 2YTFA 2WURA 1EMFA 3H1RA 2IB5A 3DQ1A 5EB6A 5T3IA 2WIQA 1A1IA 1G2FC 3KCSA 4F6MA 3DQ5A 2AWJA 3DQ2A
chains in the Genus database with same CATH superfamily
1ZAAC 4J88A 1C4FA 2OGRA 4HVFA 4JF9A 5LK4A 1X3CA 1HNZE 3LSAA 4DXMA 4W6GA 4U2VA 5AQBB 1WRJA 1HUYA 2H36X 2LO3A 4X64E 1A1KA 2G3DB 4KF5C 4JI0E 4EN1A 2VRDA 4R2EA 4X65E 4XGYA 4IK5A 1IBKE 1LLMC 2EMZA 1UILA 3DJWA 3GL4A 5IWAE 4Z4MA 1BBGA 1A1FA 1TN9A 5AE1A 4OX9E 1BBOA 5LTQA 1ZGPA 3M24A 5EXBA 5J2OA 3W1DA 2EOJA 2EPLX 3BXCA 1SFEA 4LJDC 3DF6A 5BR8E 4H48A 2EOZA 4ZF5A 4EULA 1ZU1A 2YTOA 3EVUA 4BBYA 2CTDA 3EKJA 4R2SA 2EN1A 1UISA 2EPOA 3MHSC 1YUJA 2MKDA 2DUIA 3IWBA 1T39A 2RSMA 4R2RA 1XNQE 1L4SA 1CV7A 3CB9A 3C4BA 4DV5E 3JAMC 2EP3A 4LF7E 2EMNA 1T4OA 1GGXA 2M1SA 2YTJA 1MOUA 3NEDA 4P76A 5A69A 3BF2A 1RMMA 3ST0A 3EK8A 3HPZA 3DPWA 4W76A 3M99B 4RHBB 3VK6A 2IB6A 4L12A 4UTSA 1IBME 5HZUA 4HEIA 4W6RA 4TUIA 2QU1A 2LE2A 4DV3E 3LF4B 4Q7TA 5KTGA 4LJDA 3SVUA 2HCGA 1H4UA 3OGOA 1J5EE 1OXFA 4DR2E 4F2JC 4DR5E 2YU8A 2WBTA 4F9AB 4HE4A 2WCC3 2UUBE 5DPGA 2EN7A 1FJGE 4K0KE 3U0KA 3KWRA 2ELYA 1WHQA 2YTPA 5IT9C 1S6ZA 3SVEA 2G3OA 4EDSA 3PJ5A 2JPAA 4IK9A 4DXQA 2EMGA 2ENAA 3OSQA 2DIXA 2YTIA 3VYYA 5EB7A 2EPNA 2YU5A 2EPRA 1YJFA 3KCTA 2WHUA 4P78A 2E5LE 4IK3A 3CFFA 2VAEA 4JI1E 3DQAA 2I13A 3OMLA 2VQFE 3BBGA 2AH8A 1YZWA 1DI2A 2DDCA 5A6JA 3T1YE 3F6HA 4IZNA 4DMIA 5AE3A 4Z4KA 1RMOA 1ZGQA 5LTPA 4ZB1A 4ZYEA 4DV7E 4LFBE 2EPPA 3LVCA 2DUHA 3SSVA 2QLGA 4KGFA 5H88A 2FWQA 2EMBA 2EPAA 1RRXA 5DNYA 4WX9A 2YZTA 2Q8UA 2NUFA 4YY3E 1TF3A 4P1QA 1AH5A 5AC4A 1EMKA 4LJCA 4J89A 1YYOA 2HC5A 5FHVA 2G6YA 3U0NA 4DV2E 2OTBA 1IQSA 2ZM6E 3DQIA 3UG0A 3DQKA 1X5WA 2B3TB 2EOHA 3GJ2A 3UK3C 4XVPA 5F3WA 1Q73A 4Q28A 1KJKA 4HQ9A 1X48A 1MGTA 3C6KA 2HJOA 4MLQA 2HGHA 1EH8A 5LLQA 4NXNE 3SG4A 2AHAA 1Z1QA 5KL3A 5DY6A 3P1XA 4N4RB 3IR8A 4DKKA 3HXLA 4ZBLA 2MDGA 2M9AA 1QY3A 2V85A 5IXMB 2ENCA 5IV8B 2JYAA 1JK1A 2N3HA 2GW4B 3GB3A 4W6PA 5EHUA 1IQOA 2E72A 4B3ME 2NUGA 2V88A 3C4TA 2EQ3A 1ZGOA 2QT2A 2EOSA 2EMCA 4OQWA 1G7KA 4W6JA 2EM4A 4W73A 2EWLA 4BHBA 4W6NA 3VICA 4OY4A 3SVNA 2EQ1A 1A1JA 2DGCA 2UUAE 5HZOA 4IK4A 1NEIA 2MDRA 5A2QC 4H47A 2HQKA 3SV5A 3KZZA 4W6OA 2A56B 4W6LA 2DMIA 4DV4E 3EVVA 2QLIA 2JOXA 2LTRA 2EPZA 2ZMUA 2GPIA 4I2YA 1MOVA 4B3TE 4W6KA 4JI4E 3CD1A 1QYQA 3LLHA 3EVRA 5DTLA 2J7JA 3BIDA 3DQ6A 2EN6A 1WXRA 3SG3A 2YE0A 1RMPA 2DD9A 4PFEA 4OHSA 3SG2A 2VZXA 4W6UA 2A50B 4W6HA 4RH8A 1AAYA 4LQTA 4W7CA 1YPNA 4JGEA 4KGEA 1YUIA 5KL5A 5HGEA 3ADLA 2GX2A 4W77A 1Q4CA 2YRKA 4W6MA 4XOVA 4PPKA 1RM9A 3NF0A 4OJ0A 4DV0E 4LW5A 3SSHA 1KP5A 4KW8A 4R03A 4KA9A 4KW9A 2M4IA 2ZO6A 3U8PA 2OKYA 3IWCA 4I8OA 4ZIOA 2YPNA 2EPXA 3DQ3A 2BB8A 3ED8A 2AWKA 4L5NC 1YZ9A 1FKAE 2P4MA 2ODRC 4IJDA 1EMEA 4W6IA 2FTXB 3BGHA 4O4KA 2NUEA 5DPHA 2A53B 4XOWA 2EL5A 2EMFA 5DTZA 4LU9A 5A6BA 2WBUA 2O2BA 3LVDA 1DQ3A 4R2CA 2ZO7A 3H09A 5LL6R 1ZR9A 3THOB 4JEOA 4KF5A 2ELZA 1EMBA 1W7UA 5DPJA 1MEYC 5DRGA 2RQLA 4PPLA 2JR1A 4M0VA 4WFTA 4ZYDA 1T38A 2OKWA 2DUEA 2K4VA 2V87A 3A8SA 4MLVA 1XSSA 4JI5E 3FIGA 4Q7RA 5KL4A 2HHHE 3K1KA 1B69A 3E5WA 1QYOA 5EBJA 4WSGA 1F2IG 2FL1A 3PIBA 2GX0A 2G7HA 2DLKA 4IK8A 4GZNC 2R1FA 3CFHA 1I94E 4B3RE 3EK7A 1B9CA 2AWLA 3LA1A 5EXCI 4RYSA 4J8AA 5LTRA 2EJ4A 2EMAA 4LQUA 4W6DA 2JY9A 4N3DA 2N3GA 1OXDA 1QXTA 2RH7A 3DQ4A 2JADA 4W7EA 3W1CA 2L33A 1J26A 5BQLA 2EM2A 4LFAE 3SSYA 1ZUXA 2L8TA 4PPJA 3RWAA 2LMZA 2YRHA 2EM5A 4L1IA 5CFFE 1XMQE 3AI4A 3VHTB 2CSHA 4KWYA 3LVAA 3EPHA 1QYFA 3DQFA 4BCAA 2Q57A 4R2AA 1GQEA 1IBLE 1W7TA 2A54B 3KZYA 2L2KB 2H8QA 3BX9A 2Z6YA 1EMMA 4W6CA 2YE1A 5HZSA 2DUFA 3NEZA 4KF4A 4BC7A 2L2MA 4HQ8A 3EPJA 4W6TA 3G9AA 2UUCE 2LVHA 3OTOE 1PDAA 2G5ZB 2EMOA 1F09A 3AI5A 3SG6A 4O5GA 3SVDA 2G16B 4DXOA 2DLQA 4NWSA 4BMJA 3IP2A 4ZF4A 3DQDA 2RPCA 2QLHA 3EKHA 4JI6E 5A6KA 4W7AA 2O29A 1ZBQA 4TZGA 2LV2A 1G2FC 2EPKX 4JFGA 2EOMA 2OTEA 3JTZA 4YHHE 4JYAE 3DQJA 3ST3A 4P7DA 4X66E 2FGGA 4GOBA 4KW4A 2V8QB 2DRPA 1WJPA 2EM8A 3DQEA 3HQ1A 1OXEA 2AWMA 3BXAA 2Y0GA 2V4EC 3ZUJA 2HJJA 4DV1E 4IS1C 1YFHA 4JV5E 4LF8E 4DR7E 2V86A 1KYRA 4KEXA 3EPLA 2ARLA 1YYKA 2LUPB 4L13A 2YFPA 5BTTB 3DQLA 2EOYA 4LTYA 4M9VC 1JBYA 2F4VE 2EN4A 3SRYA 4ZYHA 4F9CB 5LMNE 4WPYA 3F6GA 2ADRA 4DR4E 5H87A 4KHPE 1GL4A 4DXIA 2RS7A 2QRFA 1YHIA 2A46A 2Z6ZA 3THNA 4ZINA 3ZULA 2EMWA 3NT9A 2QLGB 3PJBA 2WZOA 1A1LA 2EM7A 4OGSA 2G2SB 3U8CA 4GKKE 5FVFA 3SVBA 2YRMA 2JP9A 2HGDA 2L2NA 4F6NA 5KL7A 1N3GA 4X8WA 4LF5E 2IHR1 4WXCA 2LTSA 2WISA 3EK4A 2LJUA 2EOXA 2IOVA 3SG5A 2I9IA 4WXDA 4W75A 4Q9XA 4W6FA 3E5VA 3SSTA 4B30B 3EQ1A 5EXUA 5BTTA 2YT4A 2BTJA 3WLDA 3SSLA 1X6HA 1JC1A 4OOGC 3TMRA 2EPUA 2EL4A 2DDDA 5F9GA 3E5TA 5KL2A 1EMAA 4DKMA 1XA9A 1XMZA 3SG7A 4BC9A 4H3NA 4DR3E 2KOUA 2LCEA 1RC7A 1Q4DA 2C9IA 3O78A 2LJHA 1H6RA 3SVCA 3WCKA 2EN8A 4AR7A 1STUA 4HTGA 1DGCA 3P8UA 2KONA 4ZF3A 2PRTA 1EKZA 3J7Yp 2A25A 4Q35B 3J81C 2EPMX 2WSNA 2Z6XA 4DXNA 1UHZA 3V3DA 4R2DA 5LMUE 2DD7A 4R2PA 3ADGA 2O24A 2QZ0A 5ADZA 1X49A 5A6AA 4LFCE 3H1OA 3P28A 3RMPA 2A52B 2DSYA 2NABA 4DV6E 2B3PA 2GW3A 2MKNA 1EH7A 3DQHA 1BB8A 2EOOA 1MYWA 5DTXA 1YSAC 2EOFA 4JI7E 2UXCE 5DPIA 4FK5C 4Q9WA 3OSRA 1XMOE 1G2DC 3J7AG 1HNWE 3DQOA 4RTCA 4B5YA 2V4EB 4LF9E 4DR6E 3AUZA 2YTDA 1A1HA 4DKNA 2YWQA 5FVGA 3ST2A 1KYPA 5DU0A 3S05A 3MSWA 5HBDA 2Z1OA 3VHTA 2EMDA 2HQZA 4W6SA 4BDUA 2YTQA 2WSOA 3LS3A 2YTGA 2LRSA 4WYQB 2EM3A 3ST4A 3JU0A 1TF6A 1P47A 2JVAA 3IWDA 1HNXE 4DUZE 2H6VA 3SS0A 2VVIA 1X6FA 2VQEE 2EZ6A 3CFAA 2OJKA 3ZUFA 2LUQA 2ICRA 3ADIA 2L3CA 2K7IA 2YTEA 2GHFA 2YTNA 4F54A 1KYQA 4B3SE 1N32E 4XL5A 4LF4E 3DQ7A 1YHGA 1SR9A 2EMLA 2RTXA 1T4NA 2M7QA 3VYXA 1XAEA 4EDOA 5HZTA 2FZUA 3U8AA 3SSPA 3DPZA 2CPNA 5KL6A 2B7VA 2GLIA 3CBEA 2EN3A 2YSOA 2B3QA 3DQ9A 5FVIA 2EE8A 3UFZA 4DR1E 4AQYE 2EMYA 2ODRD 2HPWA 2UXBE 2EPCA 2NA2A 1EH6A 3DQCA 1YJ2A 3NT3A 2EOQA 4JRBA 4JI2E 3RWTA 3SVSA 1PKPA 5EJUA 4H3MA 1HR0E 3QG5C 2A47A 1JC0A 4R8OA 2HRSA 2EM6A 3DQ8A 2E1MA 4GEQB 4JI3E 5A6BD 3ADFA 1GZ6A 2YSPA 4TZAA 2KHXA 3DQNA 2LBSB 3CGLA 2EMHA 1XNRE 2VF1A 4M30A 2ZMWA 4W7RA 4W69A 1PJTA 2CT1A 3TMTA 2VADA 3SSKA 1IMUA 4JI8E 2L6MA 4W6AA 2F8BA 3DQUA 4X9JA 1N36E 4M2ZA 1W7SA 4F9BB 2H5OA 3MGFA 5DQMA 2C9JA 2RS6A 3EPKA 3BXBA 1JBZA 2EM0A 4BHCA 2H5PA 2L92A 3WLCA 4JC2A 1RQ0A 3GEXA 2A48A 4X62E 4NHRA 4WSPA 2ENHA 2H5RA 4RYWA 3I19A 2LT7A 3ECRA 3HPSA 1GFLA 4DUYE 3ADJA 3T1HE 4W74A 2EL6A 1EMLA 5TSEA 2UU9E 2IE2A 5DTYA 1Q4BA 1XQMA 4W6BA 2UXDE 1QNTA 4W7XA 4HQCA 2V4EA 2H5QA 1O0WA 5DRFA 2R76A 1Q4EA 4W7DA 4KPIA 1NCSA 2V89A 4BS9A 2PXWA 1T4LB 4H3LA 1WHNA 2N8XA 4B30A 1JK2A 2YDZA 2JWOA 3TQMA 2VVJA 4R6DA 4R2QA 2WHTA 1X47A 1ZBTA 1EMCA 4W7FA 4ANJA 3ZOQB 4AS8A 3MHHC 2EOEA 2G6XA 2HFCA 2PXSA 4W72A 2WBSA 4ZYGA 2Q6PA 3CD9A 4Q7UA 3DPXA 1RMDA 2EQ0A 4LJBA 1YFPA 2EORA 1F0BA 3O77A 5AC5A 2DMYA 4TUGA 4DXPA 3M22A 2VVHA 5H89A 1KYSA 1EMGA 2V83A 3AKOA 2H9WA 2EMIA 3J80C 3VK1A 3AV0A 4LF6E 3DQMA 2JXPA 1A1GA 1Z1BA 5HW9A 1YYWA 1UBDC 3ZTFA 4GESB 3SVOA 2EN2A 1QU6A 3LMLA 2FV4B 4J8ZA 4KAGA 5AASA 2G6EA 3U0LA 4O43A 3SVRA 1YHHA 2EM9A 2RSIA 3L00A 1X6EA 1N34E 5DQBA 3GJ1A 4GKJE 3C6MA 1HCJA 5T6JA 3LF3A 1Z1PA 2JOBA 2HGYA 1PJSA 1N33E 4NXME 3U0MA 4KZSA 4R6BA 1GTKA 2MC5A 1Q4AA 5BT0A 2MC6A 5AE2A 2BBGA 4ZFSA 1PJQA 1UN6B 2EMKA 2D9HA 4L8NA 5FLXC 4GF6B 4IK1A 2QLEA 2EMXA 4EMQA 3K6QA 1BFPA 2L3JA 3HTXA 3EVPA 3PJ7A 2EOIA 2POXA 4ORNA 2DB2A 2VE7C 2DUGA 2WHSA 2YTFA 2WURA 1EMFA 3H1RA 4O24A 2IB5A 3DQ1A 5EB6A 5T3IA 2WIQA 2B9DA 1A1IA 3KCSA 2B7TA 4F6MA 3DQ5A 4NZVA 2AWJA 3DQ2A
chains in the Genus database with same CATH topology
1ZAAC 4J88A 1C4FA 2OGRA 4HVFA 4JF9A 5LK4A 1X3CA 3LSAA 4DXMA 4W6GA 4U2VA 5AQBB 2LO3A 1HUYA 1A1KA 2G3DB 4KF5C 4EN1A 2VRDA 4R2EA 4XGYA 4IK5A 1LLMC 2EMZA 3GL4A 4Z4MA 1TN9A 1A1FA 1BBOA 5LTQA 1ZGPA 3M24A 5EXBA 5J2OA 3W1DA 2EOJA 3BXCA 4LJDC 4H48A 2EOZA 4ZF5A 4EULA 1ZU1A 2YTOA 3EVUA 2CTDA 3EKJA 4R2SA 2EN1A 1UISA 3MHSC 1YUJA 2MKDA 2DUIA 4R2RA 1CV7A 3CB9A 2EP3A 2EMNA 1GGXA 2YTJA 1MOUA 3NEDA 4P76A 1RMMA 3ST0A 3EK8A 3DPWA 4W76A 3M99B 2IB6A 4L12A 4UTSA 5HZUA 4W6RA 2QU1A 3LF4B 4Q7TA 5KTGA 4LJDA 3SVUA 2HCGA 1H4UA 3OGOA 1OXFA 4F2JC 2YU8A 2WBTA 4HE4A 2WCC3 5DPGA 2EN7A 3U0KA 2ELYA 2YTPA 1S6ZA 3SVEA 2G3OA 4EDSA 3PJ5A 2JPAA 4IK9A 4DXQA 2EMGA 2ENAA 3OSQA 2YTIA 5EB7A 2YU5A 2EPRA 1YJFA 3KCTA 2WHUA 4IK3A 3CFFA 2VAEA 3DQAA 2I13A 2AH8A 1YZWA 2DDCA 4IZNA 4Z4KA 1RMOA 1ZGQA 5LTPA 4ZB1A 2EPPA 3LVCA 2DUHA 3SSVA 2QLGA 4KGFA 5H88A 2FWQA 2EMBA 2EPAA 1RRXA 1TF3A 4P1QA 1EMKA 4LJCA 4J89A 5FHVA 2G6YA 3U0NA 2OTBA 3DQIA 3UG0A 3DQKA 1X5WA 2EOHA 3UK3C 3GJ2A 1KJKA 4XVPA 1Q73A 4HQ9A 2HJOA 2HGHA 3SG4A 2AHAA 1Z1QA 5KL3A 5DY6A 3IR8A 4ZBLA 2MDGA 2M9AA 1QY3A 2ENCA 1JK1A 2GW4B 3GB3A 4W6PA 5EHUA 2E72A 2EQ3A 1ZGOA 2QT2A 2EOSA 2EMCA 4OQWA 1G7KA 4W6JA 2EM4A 4W73A 1A1JA 4W6NA 3VICA 4OY4A 3SVNA 2EQ1A 2DGCA 5HZOA 4IK4A 4H47A 2HQKA 3SV5A 4W6OA 2A56B 4W6LA 2DMIA 3EVVA 2QLIA 2EPZA 2ZMUA 4I2YA 1MOVA 4W6KA 3CD1A 1QYQA 3EVRA 5DTLA 2J7JA 3DQ6A 2EN6A 3SG3A 2YE0A 1RMPA 2DD9A 4PFEA 4OHSA 3SG2A 2VZXA 4W6UA 2A50B 4W6HA 1AAYA 4LQTA 4W7CA 4JGEA 4KGEA 1YUIA 5KL5A 5HGEA 2GX2A 4W77A 1Q4CA 2YRKA 4W6MA 4XOVA 4PPKA 1RM9A 3NF0A 4OJ0A 4LW5A 3SSHA 1KP5A 4KW8A 4KA9A 4KW9A 2ZO6A 3U8PA 2OKYA 4ZIOA 2EPXA 3DQ3A 2BB8A 3ED8A 2AWKA 2P4MA 4IJDA 1EMEA 4W6IA 5DPHA 2A53B 4XOWA 2EL5A 2EMFA 5DTZA 2WBUA 2O2BA 3LVDA 4R2CA 2ZO7A 1ZR9A 4JEOA 4KF5A 2ELZA 1EMBA 1W7UA 5DPJA 1MEYC 5DRGA 4PPLA 2OKWA 2DUEA 3A8SA 1XSSA 4Q7RA 5KL4A 3K1KA 1B69A 3E5WA 1QYOA 5EBJA 4WSGA 1F2IG 2FL1A 3PIBA 2GX0A 2DLKA 4IK8A 4GZNC 2R1FA 3CFHA 3EK7A 1B9CA 2AWLA 3LA1A 5EXCI 4RYSA 4J8AA 5LTRA 2EJ4A 2EMAA 4LQUA 4W6DA 4N3DA 1OXDA 1QXTA 2RH7A 3DQ4A 2JADA 4W7EA 3W1CA 5BQLA 2EM2A 3SSYA 1ZUXA 4PPJA 3RWAA 2YRHA 2EM5A 4L1IA 3AI4A 3VHTB 2CSHA 3LVAA 3EPHA 1QYFA 3DQFA 2Q57A 4R2AA 1W7TA 2A54B 2H8QA 3BX9A 2Z6YA 1EMMA 4W6CA 2YE1A 5HZSA 2DUFA 3NEZA 4KF4A 4HQ8A 3EPJA 4W6TA 3G9AA 2LVHA 2G5ZB 2EMOA 1F09A 3AI5A 3SG6A 3SVDA 2G16B 4DXOA 2DLQA 4NWSA 3IP2A 4ZF4A 3DQDA 2RPCA 2QLHA 3EKHA 4W7AA 2O29A 4TZGA 2LV2A 4JFGA 2EOMA 2OTEA 3DQJA 3ST3A 4GOBA 4KW4A 2DRPA 1WJPA 2EM8A 3DQEA 1OXEA 2AWMA 3BXAA 2Y0GA 2V4EC 3ZUJA 4IS1C 1KYRA 4KEXA 3EPLA 2ARLA 4L13A 2YFPA 5BTTB 3DQLA 2EOYA 4M9VC 1JBYA 2EN4A 3SRYA 2ADRA 5H87A 1GL4A 4DXIA 2QRFA 1YHIA 2A46A 2Z6ZA 4ZINA 3ZULA 2EMWA 3NT9A 2QLGB 3PJBA 1A1LA 2EM7A 4OGSA 2G2SB 3U8CA 5FVFA 3SVBA 2YRMA 2JP9A 2HGDA 4F6NA 5KL7A 2WISA 3EK4A 2EOXA 2IOVA 3SG5A 4W75A 4Q9XA 4W6FA 3E5VA 3SSTA 4B30B 5EXUA 5BTTA 2BTJA 3WLDA 3SSLA 1X6HA 1JC1A 3TMRA 2EPUA 2EL4A 2DDDA 5F9GA 3E5TA 5KL2A 1EMAA 4DKMA 1XA9A 1XMZA 3SG7A 4H3NA 2LCEA 1Q4DA 2C9IA 3O78A 1H6RA 3SVCA 3WCKA 2EN8A 4AR7A 1DGCA 3P8UA 4ZF3A 2PRTA 2A25A 2WSNA 2Z6XA 4DXNA 4R2DA 3V3DA 2DD7A 4R2PA 2O24A 2QZ0A 3H1OA 3P28A 2A52B 2NABA 2B3PA 2GW3A 2MKNA 3DQHA 1BB8A 2EOOA 1MYWA 5DTXA 1YSAC 2EOFA 5DPIA 4FK5C 4Q9WA 3OSRA 1G2DC 3DQOA 4RTCA 4B5YA 2V4EB 2YTDA 1A1HA 4DKNA 5FVGA 3ST2A 1KYPA 5DU0A 3S05A 5HBDA 2Z1OA 3VHTA 2EMDA 2HQZA 4W6SA 4BDUA 2YTQA 2WSOA 3LS3A 2YTGA 2EM3A 3ST4A 1TF6A 1P47A 2H6VA 3SS0A 2VVIA 1X6FA 3CFAA 2OJKA 3ZUFA 2ICRA 2YTEA 2GHFA 2YTNA 4XL5A 3DQ7A 1YHGA 2EMLA 1XAEA 4EDOA 5HZTA 2FZUA 3U8AA 3SSPA 3DPZA 5KL6A 2GLIA 3CBEA 2EN3A 2YSOA 2B3QA 3DQ9A 5FVIA 2EE8A 3UFZA 2EMYA 2HPWA 2EPCA 3DQCA 1YJ2A 3NT3A 2EOQA 4JRBA 3RWTA 3SVSA 5EJUA 4H3MA 2A47A 1JC0A 2HRSA 2EM6A 3DQ8A 3ADFA 2YSPA 4TZAA 3DQNA 3CGLA 2EMHA 2ZMWA 4W7RA 4W69A 2CT1A 3TMTA 2VADA 3SSKA 4W6AA 3DQUA 4X9JA 1W7SA 2H5OA 3MGFA 5DQMA 2C9JA 3EPKA 3BXBA 1JBZA 2EM0A 2H5PA 3WLCA 4JC2A 3GEXA 2A48A 2ENHA 2H5RA 4RYWA 3I19A 2LT7A 1GFLA 4W74A 2EL6A 1EMLA 2IE2A 5DTYA 1Q4BA 1XQMA 4W6BA 4W7XA 4HQCA 2V4EA 2H5QA 5DRFA 1Q4EA 4W7DA 4KPIA 1NCSA 2PXWA 4H3LA 4B30A 1JK2A 2YDZA 2VVJA 4R6DA 4R2QA 2WHTA 1EMCA 4W7FA 4ANJA 4AS8A 3MHHC 2EOEA 2G6XA 2HFCA 2PXSA 4W72A 2WBSA 2Q6PA 3CD9A 4Q7UA 3DPXA 1RMDA 2EQ0A 4LJBA 1YFPA 2EORA 1F0BA 3O77A 4DXPA 3M22A 2VVHA 5H89A 1KYSA 1EMGA 3AKOA 2H9WA 2EMIA 3VK1A 3DQMA 1A1GA 1Z1BA 5HW9A 1UBDC 3ZTFA 4GESB 3SVOA 2EN2A 4KAGA 2G6EA 3U0LA 3SVRA 1YHHA 2EM9A 2RSIA 1X6EA 5DQBA 3GJ1A 1HCJA 3LF3A 1Z1PA 2HGYA 3U0MA 4R6BA 1Q4AA 5BT0A 4ZFSA 1UN6B 2EMKA 2D9HA 4GF6B 4IK1A 2QLEA 2EMXA 4EMQA 1BFPA 3EVPA 3PJ7A 2EOIA 2POXA 4ORNA 2DUGA 2WHSA 2YTFA 2WURA 1EMFA 3H1RA 2IB5A 3DQ1A 5EB6A 5T3IA 2WIQA 1A1IA 1G2FC 3KCSA 4F6MA 3DQ5A 2AWJA 3DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAA C;  4J88 A;  1C4F A;  2OGR A;  4HVF A;  4JF9 A;  5LK4 A;  1X3C A;  3LSA A;  4DXM A;  4W6G A;  4U2V A;  5AQB B;  2LO3 A;  1HUY A;  1A1K A;  2G3D B;  4KF5 C;  4EN1 A;  2VRD A;  4R2E A;  4XGY A;  4IK5 A;  1LLM C;  2EMZ A;  3GL4 A;  4Z4M A;  1TN9 A;  1A1F A;  1BBO A;  5LTQ A;  1ZGP A;  3M24 A;  5EXB A;  5J2O A;  3W1D A;  2EOJ A;  3BXC A;  4LJD C;  4H48 A;  2EOZ A;  4ZF5 A;  4EUL A;  1ZU1 A;  2YTO A;  3EVU A;  2CTD A;  3EKJ A;  4R2S A;  2EN1 A;  1UIS A;  3MHS C;  1YUJ A;  2MKD A;  2DUI A;  4R2R A;  1CV7 A;  3CB9 A;  2EP3 A;  2EMN A;  1GGX A;  2YTJ A;  1MOU A;  3NED A;  4P76 A;  1RMM A;  3ST0 A;  3EK8 A;  3DPW A;  4W76 A;  3M99 B;  2IB6 A;  4L12 A;  4UTS A;  5HZU A;  4W6R A;  2QU1 A;  3LF4 B;  4Q7T A;  5KTG A;  4LJD A;  3SVU A;  2HCG A;  1H4U A;  3OGO A;  1OXF A;  4F2J C;  2YU8 A;  2WBT A;  4HE4 A;  2WCC 3;  5DPG A;  2EN7 A;  3U0K A;  2ELY A;  2YTP A;  1S6Z A;  3SVE A;  2G3O A;  4EDS A;  3PJ5 A;  2JPA A;  4IK9 A;  4DXQ A;  2EMG A;  2ENA A;  3OSQ A;  2YTI A;  5EB7 A;  2YU5 A;  2EPR A;  1YJF A;  3KCT A;  2WHU A;  4IK3 A;  3CFF A;  2VAE A;  3DQA A;  2I13 A;  2AH8 A;  1YZW A;  2DDC A;  4IZN A;  4Z4K A;  1RMO A;  1ZGQ A;  5LTP A;  4ZB1 A;  2EPP A;  3LVC A;  2DUH A;  3SSV A;  2QLG A;  4KGF A;  5H88 A;  2FWQ A;  2EMB A;  2EPA A;  1RRX A;  1TF3 A;  4P1Q A;  1EMK A;  4LJC A;  4J89 A;  5FHV A;  2G6Y A;  3U0N A;  2OTB A;  3DQI A;  3UG0 A;  3DQK A;  1X5W A;  2EOH A;  3UK3 C;  3GJ2 A;  1KJK A;  4XVP A;  1Q73 A;  4HQ9 A;  2HJO A;  2HGH A;  3SG4 A;  2AHA A;  1Z1Q A;  5KL3 A;  5DY6 A;  3IR8 A;  4ZBL A;  2MDG A;  2M9A A;  1QY3 A;  2ENC A;  1JK1 A;  2GW4 B;  3GB3 A;  4W6P A;  5EHU A;  2E72 A;  2EQ3 A;  1ZGO A;  2QT2 A;  2EOS A;  2EMC A;  4OQW A;  1G7K A;  4W6J A;  2EM4 A;  4W73 A;  1A1J A;  4W6N A;  3VIC A;  4OY4 A;  3SVN A;  2EQ1 A;  2DGC A;  5HZO A;  4IK4 A;  4H47 A;  2HQK A;  3SV5 A;  4W6O A;  2A56 B;  4W6L A;  2DMI A;  3EVV A;  2QLI A;  2EPZ A;  2ZMU A;  4I2Y A;  1MOV A;  4W6K A;  3CD1 A;  1QYQ A;  3EVR A;  5DTL A;  2J7J A;  3DQ6 A;  2EN6 A;  3SG3 A;  2YE0 A;  1RMP A;  2DD9 A;  4PFE A;  4OHS A;  3SG2 A;  2VZX A;  4W6U A;  2A50 B;  4W6H A;  1AAY A;  4LQT A;  4W7C A;  4JGE A;  4KGE A;  1YUI A;  5KL5 A;  5HGE A;  2GX2 A;  4W77 A;  1Q4C A;  2YRK A;  4W6M A;  4XOV A;  4PPK A;  1RM9 A;  3NF0 A;  4OJ0 A;  4LW5 A;  3SSH A;  1KP5 A;  4KW8 A;  4KA9 A;  4KW9 A;  2ZO6 A;  3U8P A;  2OKY A;  4ZIO A;  2EPX A;  3DQ3 A;  2BB8 A;  3ED8 A;  2AWK A;  2P4M A;  4IJD A;  1EME A;  4W6I A;  5DPH A;  2A53 B;  4XOW A;  2EL5 A;  2EMF A;  5DTZ A;  2WBU A;  2O2B A;  3LVD A;  4R2C A;  2ZO7 A;  1ZR9 A;  4JEO A;  4KF5 A;  2ELZ A;  1EMB A;  1W7U A;  5DPJ A;  1MEY C;  5DRG A;  4PPL A;  2OKW A;  2DUE A;  3A8S A;  1XSS A;  4Q7R A;  5KL4 A;  3K1K A;  1B69 A;  3E5W A;  1QYO A;  5EBJ A;  4WSG A;  1F2I G;  2FL1 A;  3PIB A;  2GX0 A;  2DLK A;  4IK8 A;  4GZN C;  2R1F A;  3CFH A;  3EK7 A;  1B9C A;  2AWL A;  3LA1 A;  5EXC I;  4RYS A;  4J8A A;  5LTR A;  2EJ4 A;  2EMA A;  4LQU A;  4W6D A;  4N3D A;  1OXD A;  1QXT A;  2RH7 A;  3DQ4 A;  2JAD A;  4W7E A;  3W1C A;  5BQL A;  2EM2 A;  3SSY A;  1ZUX A;  4PPJ A;  3RWA A;  2YRH A;  2EM5 A;  4L1I A;  3AI4 A;  3VHT B;  2CSH A;  3LVA A;  3EPH A;  1QYF A;  3DQF A;  2Q57 A;  4R2A A;  1W7T A;  2A54 B;  2H8Q A;  3BX9 A;  2Z6Y A;  1EMM A;  4W6C A;  2YE1 A;  5HZS A;  2DUF A;  3NEZ A;  4KF4 A;  4HQ8 A;  3EPJ A;  4W6T A;  3G9A A;  2LVH A;  2G5Z B;  2EMO A;  1F09 A;  3AI5 A;  3SG6 A;  3SVD A;  2G16 B;  4DXO A;  2DLQ A;  4NWS A;  3IP2 A;  4ZF4 A;  3DQD A;  2RPC A;  2QLH A;  3EKH A;  4W7A A;  2O29 A;  4TZG A;  2LV2 A;  4JFG A;  2EOM A;  2OTE A;  3DQJ A;  3ST3 A;  4GOB A;  4KW4 A;  2DRP A;  1WJP A;  2EM8 A;  3DQE A;  1OXE A;  2AWM A;  3BXA A;  2Y0G A;  2V4E C;  3ZUJ A;  4IS1 C;  1KYR A;  4KEX A;  3EPL A;  2ARL A;  4L13 A;  2YFP A;  5BTT B;  3DQL A;  2EOY A;  4M9V C;  1JBY A;  2EN4 A;  3SRY A;  2ADR A;  5H87 A;  1GL4 A;  4DXI A;  2QRF A;  1YHI A;  2A46 A;  2Z6Z A;  4ZIN A;  3ZUL A;  2EMW A;  3NT9 A;  2QLG B;  3PJB A;  1A1L A;  2EM7 A;  4OGS A;  2G2S B;  3U8C A;  5FVF A;  3SVB A;  2YRM A;  2JP9 A;  2HGD A;  4F6N A;  5KL7 A;  2WIS A;  3EK4 A;  2EOX A;  2IOV A;  3SG5 A;  4W75 A;  4Q9X A;  4W6F A;  3E5V A;  3SST A;  4B30 B;  5EXU A;  5BTT A;  2BTJ A;  3WLD A;  3SSL A;  1X6H A;  1JC1 A;  3TMR A;  2EPU A;  2EL4 A;  2DDD A;  5F9G A;  3E5T A;  5KL2 A;  1EMA A;  4DKM A;  1XA9 A;  1XMZ A;  3SG7 A;  4H3N A;  2LCE A;  1Q4D A;  2C9I A;  3O78 A;  1H6R A;  3SVC A;  3WCK A;  2EN8 A;  4AR7 A;  1DGC A;  3P8U A;  4ZF3 A;  2PRT A;  2A25 A;  2WSN A;  2Z6X A;  4DXN A;  4R2D A;  3V3D A;  2DD7 A;  4R2P A;  2O24 A;  2QZ0 A;  3H1O A;  3P28 A;  2A52 B;  2NAB A;  2B3P A;  2GW3 A;  2MKN A;  3DQH A;  1BB8 A;  2EOO A;  1MYW A;  5DTX A;  1YSA C;  2EOF A;  5DPI A;  4FK5 C;  4Q9W A;  3OSR A;  1G2D C;  3DQO A;  4RTC A;  4B5Y A;  2V4E B;  2YTD A;  1A1H A;  4DKN A;  5FVG A;  3ST2 A;  1KYP A;  5DU0 A;  3S05 A;  5HBD A;  2Z1O A;  3VHT A;  2EMD A;  2HQZ A;  4W6S A;  4BDU A;  2YTQ A;  2WSO A;  3LS3 A;  2YTG A;  2EM3 A;  3ST4 A;  1TF6 A;  1P47 A;  2H6V A;  3SS0 A;  2VVI A;  1X6F A;  3CFA A;  2OJK A;  3ZUF A;  2ICR A;  2YTE A;  2GHF A;  2YTN A;  4XL5 A;  3DQ7 A;  1YHG A;  2EML A;  1XAE A;  4EDO A;  5HZT A;  2FZU A;  3U8A A;  3SSP A;  3DPZ A;  5KL6 A;  2GLI A;  3CBE A;  2EN3 A;  2YSO A;  2B3Q A;  3DQ9 A;  5FVI A;  2EE8 A;  3UFZ A;  2EMY A;  2HPW A;  2EPC A;  3DQC A;  1YJ2 A;  3NT3 A;  2EOQ A;  4JRB A;  3RWT A;  3SVS A;  5EJU A;  4H3M A;  2A47 A;  1JC0 A;  2HRS A;  2EM6 A;  3DQ8 A;  3ADF A;  2YSP A;  4TZA A;  3DQN A;  3CGL A;  2EMH A;  2ZMW A;  4W7R A;  4W69 A;  2CT1 A;  3TMT A;  2VAD A;  3SSK A;  4W6A A;  3DQU A;  4X9J A;  1W7S A;  2H5O A;  3MGF A;  5DQM A;  2C9J A;  3EPK A;  3BXB A;  1JBZ A;  2EM0 A;  2H5P A;  3WLC A;  4JC2 A;  3GEX A;  2A48 A;  2ENH A;  2H5R A;  4RYW A;  3I19 A;  2LT7 A;  1GFL A;  4W74 A;  2EL6 A;  1EML A;  2IE2 A;  5DTY A;  1Q4B A;  1XQM A;  4W6B A;  4W7X A;  4HQC A;  2V4E A;  2H5Q A;  5DRF A;  1Q4E A;  4W7D A;  4KPI A;  1NCS A;  2PXW A;  4H3L A;  4B30 A;  1JK2 A;  2YDZ A;  2VVJ A;  4R6D A;  4R2Q A;  2WHT A;  1EMC A;  4W7F A;  4ANJ A;  4AS8 A;  3MHH C;  2EOE A;  2G6X A;  2HFC A;  2PXS A;  4W72 A;  2WBS A;  2Q6P A;  3CD9 A;  4Q7U A;  3DPX A;  1RMD A;  2EQ0 A;  4LJB A;  1YFP A;  2EOR A;  1F0B A;  3O77 A;  4DXP A;  3M22 A;  2VVH A;  5H89 A;  1KYS A;  1EMG A;  3AKO A;  2H9W A;  2EMI A;  3VK1 A;  3DQM A;  1A1G A;  1Z1B A;  5HW9 A;  1UBD C;  3ZTF A;  4GES B;  3SVO A;  2EN2 A;  4KAG A;  2G6E A;  3U0L A;  3SVR A;  1YHH A;  2EM9 A;  2RSI A;  1X6E A;  5DQB A;  3GJ1 A;  1HCJ A;  3LF3 A;  1Z1P A;  2HGY A;  3U0M A;  4R6B A;  1Q4A A;  5BT0 A;  4ZFS A;  1UN6 B;  2EMK A;  2D9H A;  4GF6 B;  4IK1 A;  2QLE A;  2EMX A;  4EMQ A;  1BFP A;  3EVP A;  3PJ7 A;  2EOI A;  2POX A;  4ORN A;  2DUG A;  2WHS A;  2YTF A;  2WUR A;  1EMF A;  3H1R A;  2IB5 A;  3DQ1 A;  5EB6 A;  5T3I A;  2WIQ A;  1A1I A;  1G2F C;  3KCS A;  4F6M A;  3DQ5 A;  2AWJ A;  3DQ2 A; 
#chains in the Genus database with same CATH topology
 1ZAA C;  4J88 A;  1C4F A;  2OGR A;  4HVF A;  4JF9 A;  5LK4 A;  1X3C A;  1HNZ E;  3LSA A;  4DXM A;  4W6G A;  4U2V A;  5AQB B;  1WRJ A;  1HUY A;  2H36 X;  2LO3 A;  4X64 E;  1A1K A;  2G3D B;  4KF5 C;  4JI0 E;  4EN1 A;  2VRD A;  4R2E A;  4X65 E;  4XGY A;  4IK5 A;  1IBK E;  1LLM C;  2EMZ A;  1UIL A;  3DJW A;  3GL4 A;  5IWA E;  4Z4M A;  1BBG A;  1A1F A;  1TN9 A;  5AE1 A;  4OX9 E;  1BBO A;  5LTQ A;  1ZGP A;  3M24 A;  5EXB A;  5J2O A;  3W1D A;  2EOJ A;  2EPL X;  3BXC A;  1SFE A;  4LJD C;  3DF6 A;  5BR8 E;  4H48 A;  2EOZ A;  4ZF5 A;  4EUL A;  1ZU1 A;  2YTO A;  3EVU A;  4BBY A;  2CTD A;  3EKJ A;  4R2S A;  2EN1 A;  1UIS A;  2EPO A;  3MHS C;  1YUJ A;  2MKD A;  2DUI A;  3IWB A;  1T39 A;  2RSM A;  4R2R A;  1XNQ E;  1L4S A;  1CV7 A;  3CB9 A;  3C4B A;  4DV5 E;  3JAM C;  2EP3 A;  4LF7 E;  2EMN A;  1T4O A;  1GGX A;  2M1S A;  2YTJ A;  1MOU A;  3NED A;  4P76 A;  5A69 A;  3BF2 A;  1RMM A;  3ST0 A;  3EK8 A;  3HPZ A;  3DPW A;  4W76 A;  3M99 B;  4RHB B;  3VK6 A;  2IB6 A;  4L12 A;  4UTS A;  1IBM E;  5HZU A;  4HEI A;  4W6R A;  4TUI A;  2QU1 A;  2LE2 A;  4DV3 E;  3LF4 B;  4Q7T A;  5KTG A;  4LJD A;  3SVU A;  2HCG A;  1H4U A;  3OGO A;  1J5E E;  1OXF A;  4DR2 E;  4F2J C;  4DR5 E;  2YU8 A;  2WBT A;  4F9A B;  4HE4 A;  2WCC 3;  2UUB E;  5DPG A;  2EN7 A;  1FJG E;  4K0K E;  3U0K A;  3KWR A;  2ELY A;  1WHQ A;  2YTP A;  5IT9 C;  1S6Z A;  3SVE A;  2G3O A;  4EDS A;  3PJ5 A;  2JPA A;  4IK9 A;  4DXQ A;  2EMG A;  2ENA A;  3OSQ A;  2DIX A;  2YTI A;  3VYY A;  5EB7 A;  2EPN A;  2YU5 A;  2EPR A;  1YJF A;  3KCT A;  2WHU A;  4P78 A;  2E5L E;  4IK3 A;  3CFF A;  2VAE A;  4JI1 E;  3DQA A;  2I13 A;  3OML A;  2VQF E;  3BBG A;  2AH8 A;  1YZW A;  1DI2 A;  2DDC A;  5A6J A;  3T1Y E;  3F6H A;  4IZN A;  4DMI A;  5AE3 A;  4Z4K A;  1RMO A;  1ZGQ A;  5LTP A;  4ZB1 A;  4ZYE A;  4DV7 E;  4LFB E;  2EPP A;  3LVC A;  2DUH A;  3SSV A;  2QLG A;  4KGF A;  5H88 A;  2FWQ A;  2EMB A;  2EPA A;  1RRX A;  5DNY A;  4WX9 A;  2YZT A;  2Q8U A;  2NUF A;  4YY3 E;  1TF3 A;  4P1Q A;  1AH5 A;  5AC4 A;  1EMK A;  4LJC A;  4J89 A;  1YYO A;  2HC5 A;  5FHV A;  2G6Y A;  3U0N A;  4DV2 E;  2OTB A;  1IQS A;  2ZM6 E;  3DQI A;  3UG0 A;  3DQK A;  1X5W A;  2B3T B;  2EOH A;  3GJ2 A;  3UK3 C;  4XVP A;  5F3W A;  1Q73 A;  4Q28 A;  1KJK A;  4HQ9 A;  1X48 A;  1MGT A;  3C6K A;  2HJO A;  4MLQ A;  2HGH A;  1EH8 A;  5LLQ A;  4NXN E;  3SG4 A;  2AHA A;  1Z1Q A;  5KL3 A;  5DY6 A;  3P1X A;  4N4R B;  3IR8 A;  4DKK A;  3HXL A;  4ZBL A;  2MDG A;  2M9A A;  1QY3 A;  2V85 A;  5IXM B;  2ENC A;  5IV8 B;  2JYA A;  1JK1 A;  2N3H A;  2GW4 B;  3GB3 A;  4W6P A;  5EHU A;  1IQO A;  2E72 A;  4B3M E;  2NUG A;  2V88 A;  3C4T A;  2EQ3 A;  1ZGO A;  2QT2 A;  2EOS A;  2EMC A;  4OQW A;  1G7K A;  4W6J A;  2EM4 A;  4W73 A;  2EWL A;  4BHB A;  4W6N A;  3VIC A;  4OY4 A;  3SVN A;  2EQ1 A;  1A1J A;  2DGC A;  2UUA E;  5HZO A;  4IK4 A;  1NEI A;  2MDR A;  5A2Q C;  4H47 A;  2HQK A;  3SV5 A;  3KZZ A;  4W6O A;  2A56 B;  4W6L A;  2DMI A;  4DV4 E;  3EVV A;  2QLI A;  2JOX A;  2LTR A;  2EPZ A;  2ZMU A;  2GPI A;  4I2Y A;  1MOV A;  4B3T E;  4W6K A;  4JI4 E;  3CD1 A;  1QYQ A;  3LLH A;  3EVR A;  5DTL A;  2J7J A;  3BID A;  3DQ6 A;  2EN6 A;  1WXR A;  3SG3 A;  2YE0 A;  1RMP A;  2DD9 A;  4PFE A;  4OHS A;  3SG2 A;  2VZX A;  4W6U A;  2A50 B;  4W6H A;  4RH8 A;  1AAY A;  4LQT A;  4W7C A;  1YPN A;  4JGE A;  4KGE A;  1YUI A;  5KL5 A;  5HGE A;  3ADL A;  2GX2 A;  4W77 A;  1Q4C A;  2YRK A;  4W6M A;  4XOV A;  4PPK A;  1RM9 A;  3NF0 A;  4OJ0 A;  4DV0 E;  4LW5 A;  3SSH A;  1KP5 A;  4KW8 A;  4R03 A;  4KA9 A;  4KW9 A;  2M4I A;  2ZO6 A;  3U8P A;  2OKY A;  3IWC A;  4I8O A;  4ZIO A;  2YPN A;  2EPX A;  3DQ3 A;  2BB8 A;  3ED8 A;  2AWK A;  4L5N C;  1YZ9 A;  1FKA E;  2P4M A;  2ODR C;  4IJD A;  1EME A;  4W6I A;  2FTX B;  3BGH A;  4O4K A;  2NUE A;  5DPH A;  2A53 B;  4XOW A;  2EL5 A;  2EMF A;  5DTZ A;  4LU9 A;  5A6B A;  2WBU A;  2O2B A;  3LVD A;  1DQ3 A;  4R2C A;  2ZO7 A;  3H09 A;  5LL6 R;  1ZR9 A;  3THO B;  4JEO A;  4KF5 A;  2ELZ A;  1EMB A;  1W7U A;  5DPJ A;  1MEY C;  5DRG A;  2RQL A;  4PPL A;  2JR1 A;  4M0V A;  4WFT A;  4ZYD A;  1T38 A;  2OKW A;  2DUE A;  2K4V A;  2V87 A;  3A8S A;  4MLV A;  1XSS A;  4JI5 E;  3FIG A;  4Q7R A;  5KL4 A;  2HHH E;  3K1K A;  1B69 A;  3E5W A;  1QYO A;  5EBJ A;  4WSG A;  1F2I G;  2FL1 A;  3PIB A;  2GX0 A;  2G7H A;  2DLK A;  4IK8 A;  4GZN C;  2R1F A;  3CFH A;  1I94 E;  4B3R E;  3EK7 A;  1B9C A;  2AWL A;  3LA1 A;  5EXC I;  4RYS A;  4J8A A;  5LTR A;  2EJ4 A;  2EMA A;  4LQU A;  4W6D A;  2JY9 A;  4N3D A;  2N3G A;  1OXD A;  1QXT A;  2RH7 A;  3DQ4 A;  2JAD A;  4W7E A;  3W1C A;  2L33 A;  1J26 A;  5BQL A;  2EM2 A;  4LFA E;  3SSY A;  1ZUX A;  2L8T A;  4PPJ A;  3RWA A;  2LMZ A;  2YRH A;  2EM5 A;  4L1I A;  5CFF E;  1XMQ E;  3AI4 A;  3VHT B;  2CSH A;  4KWY A;  3LVA A;  3EPH A;  1QYF A;  3DQF A;  4BCA A;  2Q57 A;  4R2A A;  1GQE A;  1IBL E;  1W7T A;  2A54 B;  3KZY A;  2L2K B;  2H8Q A;  3BX9 A;  2Z6Y A;  1EMM A;  4W6C A;  2YE1 A;  5HZS A;  2DUF A;  3NEZ A;  4KF4 A;  4BC7 A;  2L2M A;  4HQ8 A;  3EPJ A;  4W6T A;  3G9A A;  2UUC E;  2LVH A;  3OTO E;  1PDA A;  2G5Z B;  2EMO A;  1F09 A;  3AI5 A;  3SG6 A;  4O5G A;  3SVD A;  2G16 B;  4DXO A;  2DLQ A;  4NWS A;  4BMJ A;  3IP2 A;  4ZF4 A;  3DQD A;  2RPC A;  2QLH A;  3EKH A;  4JI6 E;  5A6K A;  4W7A A;  2O29 A;  1ZBQ A;  4TZG A;  2LV2 A;  1G2F C;  2EPK X;  4JFG A;  2EOM A;  2OTE A;  3JTZ A;  4YHH E;  4JYA E;  3DQJ A;  3ST3 A;  4P7D A;  4X66 E;  2FGG A;  4GOB A;  4KW4 A;  2V8Q B;  2DRP A;  1WJP A;  2EM8 A;  3DQE A;  3HQ1 A;  1OXE A;  2AWM A;  3BXA A;  2Y0G A;  2V4E C;  3ZUJ A;  2HJJ A;  4DV1 E;  4IS1 C;  1YFH A;  4JV5 E;  4LF8 E;  4DR7 E;  2V86 A;  1KYR A;  4KEX A;  3EPL A;  2ARL A;  1YYK A;  2LUP B;  4L13 A;  2YFP A;  5BTT B;  3DQL A;  2EOY A;  4LTY A;  4M9V C;  1JBY A;  2F4V E;  2EN4 A;  3SRY A;  4ZYH A;  4F9C B;  5LMN E;  4WPY A;  3F6G A;  2ADR A;  4DR4 E;  5H87 A;  4KHP E;  1GL4 A;  4DXI A;  2RS7 A;  2QRF A;  1YHI A;  2A46 A;  2Z6Z A;  3THN A;  4ZIN A;  3ZUL A;  2EMW A;  3NT9 A;  2QLG B;  3PJB A;  2WZO A;  1A1L A;  2EM7 A;  4OGS A;  2G2S B;  3U8C A;  4GKK E;  5FVF A;  3SVB A;  2YRM A;  2JP9 A;  2HGD A;  2L2N A;  4F6N A;  5KL7 A;  1N3G A;  4X8W A;  4LF5 E;  2IHR 1;  4WXC A;  2LTS A;  2WIS A;  3EK4 A;  2LJU A;  2EOX A;  2IOV A;  3SG5 A;  2I9I A;  4WXD A;  4W75 A;  4Q9X A;  4W6F A;  3E5V A;  3SST A;  4B30 B;  3EQ1 A;  5EXU A;  5BTT A;  2YT4 A;  2BTJ A;  3WLD A;  3SSL A;  1X6H A;  1JC1 A;  4OOG C;  3TMR A;  2EPU A;  2EL4 A;  2DDD A;  5F9G A;  3E5T A;  5KL2 A;  1EMA A;  4DKM A;  1XA9 A;  1XMZ A;  3SG7 A;  4BC9 A;  4H3N A;  4DR3 E;  2KOU A;  2LCE A;  1RC7 A;  1Q4D A;  2C9I A;  3O78 A;  2LJH A;  1H6R A;  3SVC A;  3WCK A;  2EN8 A;  4AR7 A;  1STU A;  4HTG A;  1DGC A;  3P8U A;  2KON A;  4ZF3 A;  2PRT A;  1EKZ A;  3J7Y p;  2A25 A;  4Q35 B;  3J81 C;  2EPM X;  2WSN A;  2Z6X A;  4DXN A;  1UHZ A;  3V3D A;  4R2D A;  5LMU E;  2DD7 A;  4R2P A;  3ADG A;  2O24 A;  2QZ0 A;  5ADZ A;  1X49 A;  5A6A A;  4LFC E;  3H1O A;  3P28 A;  3RMP A;  2A52 B;  2DSY A;  2NAB A;  4DV6 E;  2B3P A;  2GW3 A;  2MKN A;  1EH7 A;  3DQH A;  1BB8 A;  2EOO A;  1MYW A;  5DTX A;  1YSA C;  2EOF A;  4JI7 E;  2UXC E;  5DPI A;  4FK5 C;  4Q9W A;  3OSR A;  1XMO E;  1G2D C;  3J7A G;  1HNW E;  3DQO A;  4RTC A;  4B5Y A;  2V4E B;  4LF9 E;  4DR6 E;  3AUZ A;  2YTD A;  1A1H A;  4DKN A;  2YWQ A;  5FVG A;  3ST2 A;  1KYP A;  5DU0 A;  3S05 A;  3MSW A;  5HBD A;  2Z1O A;  3VHT A;  2EMD A;  2HQZ A;  4W6S A;  4BDU A;  2YTQ A;  2WSO A;  3LS3 A;  2YTG A;  2LRS A;  4WYQ B;  2EM3 A;  3ST4 A;  3JU0 A;  1TF6 A;  1P47 A;  2JVA A;  3IWD A;  1HNX E;  4DUZ E;  2H6V A;  3SS0 A;  2VVI A;  1X6F A;  2VQE E;  2EZ6 A;  3CFA A;  2OJK A;  3ZUF A;  2LUQ A;  2ICR A;  3ADI A;  2L3C A;  2K7I A;  2YTE A;  2GHF A;  2YTN A;  4F54 A;  1KYQ A;  4B3S E;  1N32 E;  4XL5 A;  4LF4 E;  3DQ7 A;  1YHG A;  1SR9 A;  2EML A;  2RTX A;  1T4N A;  2M7Q A;  3VYX A;  1XAE A;  4EDO A;  5HZT A;  2FZU A;  3U8A A;  3SSP A;  3DPZ A;  2CPN A;  5KL6 A;  2B7V A;  2GLI A;  3CBE A;  2EN3 A;  2YSO A;  2B3Q A;  3DQ9 A;  5FVI A;  2EE8 A;  3UFZ A;  4DR1 E;  4AQY E;  2EMY A;  2ODR D;  2HPW A;  2UXB E;  2EPC A;  2NA2 A;  1EH6 A;  3DQC A;  1YJ2 A;  3NT3 A;  2EOQ A;  4JRB A;  4JI2 E;  3RWT A;  3SVS A;  1PKP A;  5EJU A;  4H3M A;  1HR0 E;  3QG5 C;  2A47 A;  1JC0 A;  4R8O A;  2HRS A;  2EM6 A;  3DQ8 A;  2E1M A;  4GEQ B;  4JI3 E;  5A6B D;  3ADF A;  1GZ6 A;  2YSP A;  4TZA A;  2KHX A;  3DQN A;  2LBS B;  3CGL A;  2EMH A;  1XNR E;  2VF1 A;  4M30 A;  2ZMW A;  4W7R A;  4W69 A;  1PJT A;  2CT1 A;  3TMT A;  2VAD A;  3SSK A;  1IMU A;  4JI8 E;  2L6M A;  4W6A A;  2F8B A;  3DQU A;  4X9J A;  1N36 E;  4M2Z A;  1W7S A;  4F9B B;  2H5O A;  3MGF A;  5DQM A;  2C9J A;  2RS6 A;  3EPK A;  3BXB A;  1JBZ A;  2EM0 A;  4BHC A;  2H5P A;  2L92 A;  3WLC A;  4JC2 A;  1RQ0 A;  3GEX A;  2A48 A;  4X62 E;  4NHR A;  4WSP A;  2ENH A;  2H5R A;  4RYW A;  3I19 A;  2LT7 A;  3ECR A;  3HPS A;  1GFL A;  4DUY E;  3ADJ A;  3T1H E;  4W74 A;  2EL6 A;  1EML A;  5TSE A;  2UU9 E;  2IE2 A;  5DTY A;  1Q4B A;  1XQM A;  4W6B A;  2UXD E;  1QNT A;  4W7X A;  4HQC A;  2V4E A;  2H5Q A;  1O0W A;  5DRF A;  2R76 A;  1Q4E A;  4W7D A;  4KPI A;  1NCS A;  2V89 A;  4BS9 A;  2PXW A;  1T4L B;  4H3L A;  1WHN A;  2N8X A;  4B30 A;  1JK2 A;  2YDZ A;  2JWO A;  3TQM A;  2VVJ A;  4R6D A;  4R2Q A;  2WHT A;  1X47 A;  1ZBT A;  1EMC A;  4W7F A;  4ANJ A;  3ZOQ B;  4AS8 A;  3MHH C;  2EOE A;  2G6X A;  2HFC A;  2PXS A;  4W72 A;  2WBS A;  4ZYG A;  2Q6P A;  3CD9 A;  4Q7U A;  3DPX A;  1RMD A;  2EQ0 A;  4LJB A;  1YFP A;  2EOR A;  1F0B A;  3O77 A;  5AC5 A;  2DMY A;  4TUG A;  4DXP A;  3M22 A;  2VVH A;  5H89 A;  1KYS A;  1EMG A;  2V83 A;  3AKO A;  2H9W A;  2EMI A;  3J80 C;  3VK1 A;  3AV0 A;  4LF6 E;  3DQM A;  2JXP A;  1A1G A;  1Z1B A;  5HW9 A;  1YYW A;  1UBD C;  3ZTF A;  4GES B;  3SVO A;  2EN2 A;  1QU6 A;  3LML A;  2FV4 B;  4J8Z A;  4KAG A;  5AAS A;  2G6E A;  3U0L A;  4O43 A;  3SVR A;  1YHH A;  2EM9 A;  2RSI A;  3L00 A;  1X6E A;  1N34 E;  5DQB A;  3GJ1 A;  4GKJ E;  3C6M A;  1HCJ A;  5T6J A;  3LF3 A;  1Z1P A;  2JOB A;  2HGY A;  1PJS A;  1N33 E;  4NXM E;  3U0M A;  4KZS A;  4R6B A;  1GTK A;  2MC5 A;  1Q4A A;  5BT0 A;  2MC6 A;  5AE2 A;  2BBG A;  4ZFS A;  1PJQ A;  1UN6 B;  2EMK A;  2D9H A;  4L8N A;  5FLX C;  4GF6 B;  4IK1 A;  2QLE A;  2EMX A;  4EMQ A;  3K6Q A;  1BFP A;  2L3J A;  3HTX A;  3EVP A;  3PJ7 A;  2EOI A;  2POX A;  4ORN A;  2DB2 A;  2VE7 C;  2DUG A;  2WHS A;  2YTF A;  2WUR A;  1EMF A;  3H1R A;  4O24 A;  2IB5 A;  3DQ1 A;  5EB6 A;  5T3I A;  2WIQ A;  2B9D A;  1A1I A;  3KCS A;  2B7T A;  4F6M A;  3DQ5 A;  4NZV A;  2AWJ A;  3DQ2 A; 
#chains in the Genus database with same CATH homology
 1ZAA C;  4J88 A;  1C4F A;  2OGR A;  4HVF A;  4JF9 A;  5LK4 A;  1X3C A;  3LSA A;  4DXM A;  4W6G A;  4U2V A;  5AQB B;  2LO3 A;  1HUY A;  1A1K A;  2G3D B;  4KF5 C;  4EN1 A;  2VRD A;  4R2E A;  4XGY A;  4IK5 A;  1LLM C;  2EMZ A;  3GL4 A;  4Z4M A;  1TN9 A;  1A1F A;  1BBO A;  5LTQ A;  1ZGP A;  3M24 A;  5EXB A;  5J2O A;  3W1D A;  2EOJ A;  3BXC A;  4LJD C;  4H48 A;  2EOZ A;  4ZF5 A;  4EUL A;  1ZU1 A;  2YTO A;  3EVU A;  2CTD A;  3EKJ A;  4R2S A;  2EN1 A;  1UIS A;  3MHS C;  1YUJ A;  2MKD A;  2DUI A;  4R2R A;  1CV7 A;  3CB9 A;  2EP3 A;  2EMN A;  1GGX A;  2YTJ A;  1MOU A;  3NED A;  4P76 A;  1RMM A;  3ST0 A;  3EK8 A;  3DPW A;  4W76 A;  3M99 B;  2IB6 A;  4L12 A;  4UTS A;  5HZU A;  4W6R A;  2QU1 A;  3LF4 B;  4Q7T A;  5KTG A;  4LJD A;  3SVU A;  2HCG A;  1H4U A;  3OGO A;  1OXF A;  4F2J C;  2YU8 A;  2WBT A;  4HE4 A;  2WCC 3;  5DPG A;  2EN7 A;  3U0K A;  2ELY A;  2YTP A;  1S6Z A;  3SVE A;  2G3O A;  4EDS A;  3PJ5 A;  2JPA A;  4IK9 A;  4DXQ A;  2EMG A;  2ENA A;  3OSQ A;  2YTI A;  5EB7 A;  2YU5 A;  2EPR A;  1YJF A;  3KCT A;  2WHU A;  4IK3 A;  3CFF A;  2VAE A;  3DQA A;  2I13 A;  2AH8 A;  1YZW A;  2DDC A;  4IZN A;  4Z4K A;  1RMO A;  1ZGQ A;  5LTP A;  4ZB1 A;  2EPP A;  3LVC A;  2DUH A;  3SSV A;  2QLG A;  4KGF A;  5H88 A;  2FWQ A;  2EMB A;  2EPA A;  1RRX A;  1TF3 A;  4P1Q A;  1EMK A;  4LJC A;  4J89 A;  5FHV A;  2G6Y A;  3U0N A;  2OTB A;  3DQI A;  3UG0 A;  3DQK A;  1X5W A;  2EOH A;  3UK3 C;  3GJ2 A;  1KJK A;  4XVP A;  1Q73 A;  4HQ9 A;  2HJO A;  2HGH A;  3SG4 A;  2AHA A;  1Z1Q A;  5KL3 A;  5DY6 A;  3IR8 A;  4ZBL A;  2MDG A;  2M9A A;  1QY3 A;  2ENC A;  1JK1 A;  2GW4 B;  3GB3 A;  4W6P A;  5EHU A;  2E72 A;  2EQ3 A;  1ZGO A;  2QT2 A;  2EOS A;  2EMC A;  4OQW A;  1G7K A;  4W6J A;  2EM4 A;  4W73 A;  1A1J A;  4W6N A;  3VIC A;  4OY4 A;  3SVN A;  2EQ1 A;  2DGC A;  5HZO A;  4IK4 A;  4H47 A;  2HQK A;  3SV5 A;  4W6O A;  2A56 B;  4W6L A;  2DMI A;  3EVV A;  2QLI A;  2EPZ A;  2ZMU A;  4I2Y A;  1MOV A;  4W6K A;  3CD1 A;  1QYQ A;  3EVR A;  5DTL A;  2J7J A;  3DQ6 A;  2EN6 A;  3SG3 A;  2YE0 A;  1RMP A;  2DD9 A;  4PFE A;  4OHS A;  3SG2 A;  2VZX A;  4W6U A;  2A50 B;  4W6H A;  1AAY A;  4LQT A;  4W7C A;  4JGE A;  4KGE A;  1YUI A;  5KL5 A;  5HGE A;  2GX2 A;  4W77 A;  1Q4C A;  2YRK A;  4W6M A;  4XOV A;  4PPK A;  1RM9 A;  3NF0 A;  4OJ0 A;  4LW5 A;  3SSH A;  1KP5 A;  4KW8 A;  4KA9 A;  4KW9 A;  2ZO6 A;  3U8P A;  2OKY A;  4ZIO A;  2EPX A;  3DQ3 A;  2BB8 A;  3ED8 A;  2AWK A;  2P4M A;  4IJD A;  1EME A;  4W6I A;  5DPH A;  2A53 B;  4XOW A;  2EL5 A;  2EMF A;  5DTZ A;  2WBU A;  2O2B A;  3LVD A;  4R2C A;  2ZO7 A;  1ZR9 A;  4JEO A;  4KF5 A;  2ELZ A;  1EMB A;  1W7U A;  5DPJ A;  1MEY C;  5DRG A;  4PPL A;  2OKW A;  2DUE A;  3A8S A;  1XSS A;  4Q7R A;  5KL4 A;  3K1K A;  1B69 A;  3E5W A;  1QYO A;  5EBJ A;  4WSG A;  1F2I G;  2FL1 A;  3PIB A;  2GX0 A;  2DLK A;  4IK8 A;  4GZN C;  2R1F A;  3CFH A;  3EK7 A;  1B9C A;  2AWL A;  3LA1 A;  5EXC I;  4RYS A;  4J8A A;  5LTR A;  2EJ4 A;  2EMA A;  4LQU A;  4W6D A;  4N3D A;  1OXD A;  1QXT A;  2RH7 A;  3DQ4 A;  2JAD A;  4W7E A;  3W1C A;  5BQL A;  2EM2 A;  3SSY A;  1ZUX A;  4PPJ A;  3RWA A;  2YRH A;  2EM5 A;  4L1I A;  3AI4 A;  3VHT B;  2CSH A;  3LVA A;  3EPH A;  1QYF A;  3DQF A;  2Q57 A;  4R2A A;  1W7T A;  2A54 B;  2H8Q A;  3BX9 A;  2Z6Y A;  1EMM A;  4W6C A;  2YE1 A;  5HZS A;  2DUF A;  3NEZ A;  4KF4 A;  4HQ8 A;  3EPJ A;  4W6T A;  3G9A A;  2LVH A;  2G5Z B;  2EMO A;  1F09 A;  3AI5 A;  3SG6 A;  3SVD A;  2G16 B;  4DXO A;  2DLQ A;  4NWS A;  3IP2 A;  4ZF4 A;  3DQD A;  2RPC A;  2QLH A;  3EKH A;  4W7A A;  2O29 A;  4TZG A;  2LV2 A;  4JFG A;  2EOM A;  2OTE A;  3DQJ A;  3ST3 A;  4GOB A;  4KW4 A;  2DRP A;  1WJP A;  2EM8 A;  3DQE A;  1OXE A;  2AWM A;  3BXA A;  2Y0G A;  2V4E C;  3ZUJ A;  4IS1 C;  1KYR A;  4KEX A;  3EPL A;  2ARL A;  4L13 A;  2YFP A;  5BTT B;  3DQL A;  2EOY A;  4M9V C;  1JBY A;  2EN4 A;  3SRY A;  2ADR A;  5H87 A;  1GL4 A;  4DXI A;  2QRF A;  1YHI A;  2A46 A;  2Z6Z A;  4ZIN A;  3ZUL A;  2EMW A;  3NT9 A;  2QLG B;  3PJB A;  1A1L A;  2EM7 A;  4OGS A;  2G2S B;  3U8C A;  5FVF A;  3SVB A;  2YRM A;  2JP9 A;  2HGD A;  4F6N A;  5KL7 A;  2WIS A;  3EK4 A;  2EOX A;  2IOV A;  3SG5 A;  4W75 A;  4Q9X A;  4W6F A;  3E5V A;  3SST A;  4B30 B;  5EXU A;  5BTT A;  2BTJ A;  3WLD A;  3SSL A;  1X6H A;  1JC1 A;  3TMR A;  2EPU A;  2EL4 A;  2DDD A;  5F9G A;  3E5T A;  5KL2 A;  1EMA A;  4DKM A;  1XA9 A;  1XMZ A;  3SG7 A;  4H3N A;  2LCE A;  1Q4D A;  2C9I A;  3O78 A;  1H6R A;  3SVC A;  3WCK A;  2EN8 A;  4AR7 A;  1DGC A;  3P8U A;  4ZF3 A;  2PRT A;  2A25 A;  2WSN A;  2Z6X A;  4DXN A;  4R2D A;  3V3D A;  2DD7 A;  4R2P A;  2O24 A;  2QZ0 A;  3H1O A;  3P28 A;  2A52 B;  2NAB A;  2B3P A;  2GW3 A;  2MKN A;  3DQH A;  1BB8 A;  2EOO A;  1MYW A;  5DTX A;  1YSA C;  2EOF A;  5DPI A;  4FK5 C;  4Q9W A;  3OSR A;  1G2D C;  3DQO A;  4RTC A;  4B5Y A;  2V4E B;  2YTD A;  1A1H A;  4DKN A;  5FVG A;  3ST2 A;  1KYP A;  5DU0 A;  3S05 A;  5HBD A;  2Z1O A;  3VHT A;  2EMD A;  2HQZ A;  4W6S A;  4BDU A;  2YTQ A;  2WSO A;  3LS3 A;  2YTG A;  2EM3 A;  3ST4 A;  1TF6 A;  1P47 A;  2H6V A;  3SS0 A;  2VVI A;  1X6F A;  3CFA A;  2OJK A;  3ZUF A;  2ICR A;  2YTE A;  2GHF A;  2YTN A;  4XL5 A;  3DQ7 A;  1YHG A;  2EML A;  1XAE A;  4EDO A;  5HZT A;  2FZU A;  3U8A A;  3SSP A;  3DPZ A;  5KL6 A;  2GLI A;  3CBE A;  2EN3 A;  2YSO A;  2B3Q A;  3DQ9 A;  5FVI A;  2EE8 A;  3UFZ A;  2EMY A;  2HPW A;  2EPC A;  3DQC A;  1YJ2 A;  3NT3 A;  2EOQ A;  4JRB A;  3RWT A;  3SVS A;  5EJU A;  4H3M A;  2A47 A;  1JC0 A;  2HRS A;  2EM6 A;  3DQ8 A;  3ADF A;  2YSP A;  4TZA A;  3DQN A;  3CGL A;  2EMH A;  2ZMW A;  4W7R A;  4W69 A;  2CT1 A;  3TMT A;  2VAD A;  3SSK A;  4W6A A;  3DQU A;  4X9J A;  1W7S A;  2H5O A;  3MGF A;  5DQM A;  2C9J A;  3EPK A;  3BXB A;  1JBZ A;  2EM0 A;  2H5P A;  3WLC A;  4JC2 A;  3GEX A;  2A48 A;  2ENH A;  2H5R A;  4RYW A;  3I19 A;  2LT7 A;  1GFL A;  4W74 A;  2EL6 A;  1EML A;  2IE2 A;  5DTY A;  1Q4B A;  1XQM A;  4W6B A;  4W7X A;  4HQC A;  2V4E A;  2H5Q A;  5DRF A;  1Q4E A;  4W7D A;  4KPI A;  1NCS A;  2PXW A;  4H3L A;  4B30 A;  1JK2 A;  2YDZ A;  2VVJ A;  4R6D A;  4R2Q A;  2WHT A;  1EMC A;  4W7F A;  4ANJ A;  4AS8 A;  3MHH C;  2EOE A;  2G6X A;  2HFC A;  2PXS A;  4W72 A;  2WBS A;  2Q6P A;  3CD9 A;  4Q7U A;  3DPX A;  1RMD A;  2EQ0 A;  4LJB A;  1YFP A;  2EOR A;  1F0B A;  3O77 A;  4DXP A;  3M22 A;  2VVH A;  5H89 A;  1KYS A;  1EMG A;  3AKO A;  2H9W A;  2EMI A;  3VK1 A;  3DQM A;  1A1G A;  1Z1B A;  5HW9 A;  1UBD C;  3ZTF A;  4GES B;  3SVO A;  2EN2 A;  4KAG A;  2G6E A;  3U0L A;  3SVR A;  1YHH A;  2EM9 A;  2RSI A;  1X6E A;  5DQB A;  3GJ1 A;  1HCJ A;  3LF3 A;  1Z1P A;  2HGY A;  3U0M A;  4R6B A;  1Q4A A;  5BT0 A;  4ZFS A;  1UN6 B;  2EMK A;  2D9H A;  4GF6 B;  4IK1 A;  2QLE A;  2EMX A;  4EMQ A;  1BFP A;  3EVP A;  3PJ7 A;  2EOI A;  2POX A;  4ORN A;  2DUG A;  2WHS A;  2YTF A;  2WUR A;  1EMF A;  3H1R A;  2IB5 A;  3DQ1 A;  5EB6 A;  5T3I A;  2WIQ A;  1A1I A;  1G2F C;  3KCS A;  4F6M A;  3DQ5 A;  2AWJ A;  3DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...