3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
b'SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
5DU0A 2EQ0A 4R6BA 3EKJA 2H5OA 3NEZA 3MHSC 2ENCA 4KGEA 2DD9A 2DLQA 4W6KA 2QLEA 2IOVA 1JK1A 3A8SA 5DPIA 5EB6A 3LSAA 3DQ8A 4Q7TA 2EOMA 1EMLA 1TN9A 3CD1A 4IK4A 1MYWA 2QLHA 2EQ3A 2M9AA 2IB6A 2EPCA 1BBOA 1BB8A 1YHHA 1RMDA 3W1DA 2ADRA 3UFZA 1XMZA 2EM5A 4W6OA 2WSOA 2Z6ZA 4W6MA 3SG7A 2EMDA 2O29A 4J88A 2DUFA 2HGDA 4LJBA 4W6HA 2EQ1A 2ZMUA 3DQHA 2YE1A 3TMRA 2EPUA 4HQ8A 2EN1A 2B3QA 2EMZA 2GHFA 2G5ZB 3CD9A 4DXQA 3EVPA 4LJDC 2YTQA 4IS1C 2DRPA 4J8AA 3VICA 3DQ1A 3DQ6A 1KYRA 2VZXA 2Q57A 3CFFA 5DQMA 2YSPA 2Z6YA 2EM3A 2EMAA 4P1QA 2VVIA 1UISA 1YFPA 2G3OA 2V4EC 2EM6A 4F2JC 1YUIA 3IR8A 2EL5A 4ZF3A 4W6CA 3DQOA 4GESB 5T3IA 1H4UA 3AI4A 5EJUA 2YTFA 1YSAC 5H88A 4W6NA 5BT0A 1KYSA 3LS3A 3SG4A 4KGFA 2AWLA 1YJ2A 1HUYA 2YU5A 4JC2A 2HQKA 2EP3A 3EVUA 4N3DA 4DXOA 4EDSA 5LTQA 2C9JA 1JBZA 4B30A 2VADA 4W6SA 2A47A 1X6HA 3MHHC 4W6AA 3ST3A 1DGCA 2QLGB 4L12A 3LF4B 2BB8A 2JPAA 2LCEA 2EPPA 3CB9A 2EMOA 1UBDC 2ENHA 3CFHA 4HQ9A 4GZNC 5AQBB 3W1CA 3ED8A 2DDDA 3H1OA 4ZF4A 1A1GA 4H47A 4W73A 1YHGA 2QZ0A 3P8UA 3DQKA 5DTLA 2EOJA 3WCKA 2YRHA 3ST2A 4R2EA 4R2QA 3ZULA 1G7KA 2RSIA 2A54B 3GL4A 1GFLA 2EN6A 1EMKA 2IE2A 3DQNA 3GJ2A 1JC1A 1ZGOA 2EMXA 3K1KA 1EMBA 2G6XA 4BDUA 4JFGA 1A1KA 2EOEA 3GEXA 4LJCA 1Q4EA 4DXIA 1X3CA 2POXA 4L13A 2EJ4A 2CT1A 5DRGA 4OGSA 3EKHA 1G2FC 2EOXA 2A53B 2OJKA 1UN6B 4HQCA 4W6GA 1S6ZA 2A25A 5EXUA 2WCC3 2YDZA 2CSHA 3NT3A 4L1IA 2FZUA 2EMLA 4LQUA 2EM9A 3DQUA 3VHTA 2CTDA 5DPHA 2R1FA 2YRKA 2EM8A 3SG3A 5LK4A 2EORA 3PJ5A 2EMNA 3EPHA 4HE4A 5FVFA 3PIBA 2PXWA 4KF5A 2EOSA 3GJ1A 1GGXA 3VK1A 3LVCA 3SSVA 2EOYA 3DQ4A 4OQWA 3O78A 2ELZA 2EM0A 1MOVA 3NT9A 3NF0A 4NWSA 4AS8A 1JBYA 3SVSA 3DQ3A 2EOHA 3G9AA 2EOIA 3E5WA 1F09A 3LA1A 1W7TA 4W6UA 2YFPA 2LT7A 4U2VA 4IK3A 4AR7A 2HGHA 5BQLA 4JF9A 3RWAA 2A46A 1QYFA 2AWKA 5KL3A 4EULA 2QRFA 3SRYA 3U0MA 4W6IA 2EM4A 5DTZA 2WURA 2DMIA 3DPZA 3SG5A 3OSRA 1P47A 1A1JA 2G6EA 3SVBA 2ELYA 4W7RA 3E5VA 5KL5A 4R2RA 1EMAA 1OXFA 2DDCA 2GW4B 1RRXA 1B69A 1YJFA 2D9HA 2ICRA 3OGOA 2O2BA 2HCGA 5EB7A 4DKMA 4IJDA 1RMPA 5H87A 2ENAA 2H9WA 2Y0GA 2EOZA 4WSGA 4OY4A 4XVPA 4KAGA 4RYSA 3SVEA 5KL2A 4PPKA 1X6FA 2EMHA 3CBEA 2YTEA 3U8AA 4KPIA 3DPWA 1C4FA 1NCSA 4W74A 2VVJA 2O24A 2A48A 4XL5A 1Q4AA 4GOBA 4Q9WA 4LQTA 4TZGA 2HPWA 5LTPA 4PFEA 2EMGA 2BTJA 4R2AA 2QT2A 2G2SB 4R2CA 4HVFA 1X6EA 2YTOA 1A1FA 1JC0A 2AHAA 1KP5A 2ZMWA 4W7CA 2HFCA 2ARLA 1A1LA 2Q6PA 3DQLA 5DPGA 3ST4A 4B30B 2AWJA 2EM2A 4W6PA 5LTRA 3M22A 2HGYA 1Q4BA 3EK8A 3SSLA 2RPCA 3MGFA 3SV5A 3U0KA 1G2DC 2OKWA 2YTNA 3DQ7A 3EVRA 3V3DA 2EL4A 1YHIA 2DD7A 3LF3A 1X5WA 3GB3A 2HJOA 3P28A 3WLCA 1OXEA 1OXDA 3DQIA 1A1HA 3SVRA 4H3MA 2YU8A 1H6RA 1TF3A 4LJDA 4TZAA 3U0LA 2G6YA 5KTGA 4UTSA 4EDOA 2IB5A 4ZINA 5EHUA 4X9JA 3DQJA 2VAEA 2Z6XA 2V4EA 4W6JA 2WBTA 1Z1PA 2A50B 3SSKA 5BTTA 1ZR9A 2OGRA 2AH8A 5FVGA 3EK4A 3AKOA 1XAEA 1W7UA 3BXBA 1KJKA 2EMBA 3LVAA 2GX0A 5EBJA 4ZFSA 2EL6A 3DQ2A 1XSSA 4DKNA 3EK7A 3U8PA 3VHTB 3DQCA 3DQ5A 3O77A 3EPJA 1LLMC 3NEDA 5KL4A 4B5YA 5HZTA 4J89A 2EOQA 1B9CA 2ZO7A 5HW9A 2LVHA 3EPKA 2DGCA 5EXCI 4Q7RA 3SVUA 1QYQA 3M24A 2GW3A 1TF6A 2JP9A 1QY3A 5DTYA 2EOOA 4R2SA 3DQAA 3SSYA 3DQDA 5DQBA 2EPZA 3U0NA 1Q4CA 2A52B 3DPXA 4I2YA 4KEXA 2QU1A 4W7EA 4XOVA 2EN7A 5KL7A 2HQZA 2EPRA 5KL6A 3AI5A 4W7AA 4EN1A 4R2DA 5J2OA 3OSQA 4XGYA 3ZTFA 4W6FA 2YTIA 3LVDA 4GF6B 1XQMA 4KW9A 3SG6A 5EXBA 1EMEA 3SVOA 3BXAA 2YSOA 2E72A 2H5QA 3DQMA 5HZSA 1A1IA 2YTDA 4OJ0A 4W72A 4W6RA 1RMMA 4XOWA 1MOUA 5HGEA 2GLIA 1EMMA 1AAYA 3DQEA 3SS0A 3UG0A 2MKNA 1Q4DA 4KW8A 2OTEA 2EM7A 2EOFA 1HCJA 2WHTA 1EMFA 4DXPA 2EPAA 2EN4A 2MDGA 3M99B 4H3LA 2FWQA 3EVVA 2DUIA 3KCSA 4Q9XA 1QYOA 2H6VA 2C9IA 1ZU1A 2YTJA 4Z4MA 1CV7A 5F9GA 4FK5C 4M9VC 3S05A 2DUGA 1EMGA 2EN3A 2A56B 3DQ9A 4RYWA 1ZGPA 4W6TA 4JRBA 2I13A 5FHVA 4DXMA 1F0BA 4EMQA 2NABA 1EMCA 1BFPA 2EN8A 1Z1BA 2EMKA 1W7SA 4JEOA 2WHSA 2EMYA 2PRTA 2WBUA 4ZB1A 3ZUFA 3PJ7A 3DQFA 2QLGA 2EMWA 1MEYC 1JK2A 3CGLA 3KCTA 2H5PA 3RWTA 3SVNA 2DLKA 4KF5C 1ZAAC 3BXCA 4ZBLA 2ZO6A 2Z1OA 1RMOA 3BX9A 4KF4A 4LW5A 4W7DA 5DTXA 3CFAA 3SSPA 2WIQA 5HZOA 3H1RA 2YTGA 3UK3C 4W77A 3SG2A 2EMFA 4IZNA 3SSHA 4KA9A 3WLDA 2YRMA 4PPJA 3TMTA 2WHUA 5DPJA 3IP2A 4R2PA 2EMCA 2WBSA 1F2IG 2PXSA 4ORNA 4W69A 2DUEA 3EPLA 2LV2A 4P76A 1QXTA 2AWMA 2JADA 5FVIA 1KYPA 2QLIA 2LO3A 4IK9A 4JGEA 3SSTA 2WISA 4R6DA 4W7FA 4IK5A 2J7JA 5H89A 5DRFA 2YTPA 4W6DA 4Q7UA 4W7XA 3PJBA 4Z4KA 5DY6A 4OHSA 1YZWA 4H48A 4KW4A 3SVCA 3ST0A 2H8QA 5HZUA 1Z1QA 4IK1A 3I19A 2EMIA 2MKDA 4F6NA 5HBDA 3ZUJA 2EE8A 2VVHA 2VRDA 1YUJA 4IK8A 4PPLA 4W75A 2RH7A 2EN2A 2P4MA 2V4EB 1WJPA 3ADFA 2OTBA 5BTTB 4ZF5A 4W76A 2EPXA 1XA9A 1RM9A 1ZUXA 2OKYA 1Q73A 2B3PA 4W6BA 1ZGQA 2H5RA 2YE0A 2FL1A 2HRSA 4DXNA 4RTCA 1GL4A 3SVDA 2WSNA 4W6LA 4F6MA 2G16B 4H3NA 2G3DB 4ZIOA 2GX2A 2DUHA 3U8CA 3E5TA 4ANJA
chains in the Genus database with same CATH superfamily
4KWYA 5BR8E 5DU0A 2EZ6A 1PJSA 2EQ0A 2V89A 4R6BA 3C4BA 3EKJA 2H5OA 3NEZA 3DF6A 1GQEA 4N4RB 3DJWA 3MHSC 2ENCA 4KGEA 2DD9A 2DLQA 4W6KA 2QLEA 2IOVA 2RSMA 3A8SA 5DPIA 5EB6A 1JK1A 3LSAA 3DQ8A 4Q7TA 2EOMA 3L00A 1HNZE 4DR3E 1EMLA 2K7IA 1TN9A 4JI3E 4NZVA 3CD1A 4IK4A 1MYWA 2QLHA 2EQ3A 2G7HA 2M9AA 2IB6A 2EPCA 4DR5E 5F3WA 4JI4E 3J80C 1BB8A 1BBOA 1YHHA 3VK6A 2VQFE 1RMDA 2LUQA 3W1DA 2ADRA 2JR1A 3UFZA 1XMZA 5AE2A 2EM5A 4W6OA 2WSOA 2Z6ZA 4W6MA 3SG7A 4DUYE 2EMDA 4F54A 2NUGA 2O29A 4J88A 2DUFA 2HGDA 4LJBA 4W6HA 2EQ1A 2ZMUA 3DQHA 2YE1A 3TMRA 1N3GA 2EPUA 4HQ8A 4KHPE 2EN1A 2KONA 3T1HE 2B3QA 2EMZA 1UILA 2GHFA 5A69A 2G5ZB 3CD9A 1N32E 4DXQA 3EVPA 4LJDC 2YTQA 3C6KA 4IS1C 2LJHA 3RMPA 2DRPA 4J8AA 1IBME 3VICA 5IV8B 2KHXA 3DQ1A 1DQ3A 4LFBE 3DQ6A 3LLHA 1T4OA 1KYRA 2VZXA 2DGCA 2Q57A 3CFFA 5DQMA 2YSPA 2Z6YA 2EM3A 2EMAA 4P1QA 2YWQA 1J5EE 2VVIA 1UISA 1YFPA 2G3OA 2V4EC 1RQ0A 2EM6A 2JOBA 2JOXA 1IBLE 4F2JC 1YUIA 3IR8A 1DI2A 2EL5A 2LJUA 4ZF3A 4W6CA 3HQ1A 3DQOA 4GESB 5T3IA 1H4UA 3AI4A 2NUFA 4X8WA 5EJUA 2YTFA 2NA2A 1YSAC 4WXDA 4DV2E 5H88A 4W6NA 4DV6E 2K4VA 1RC7A 5BT0A 1KYSA 3LS3A 3SG4A 4KGFA 2AWLA 1YJ2A 1HUYA 2V8QB 2YU5A 4AQYE 4JC2A 1T39A 2HQKA 2EP3A 3EVUA 4N3DA 4DXOA 4EDSA 3J7Yp 5LTQA 2C9JA 1JBZA 4B30A 2VADA 4X62E 4DV1E 4DV7E 4W6SA 1FJGE 2A47A 1X6HA 3MHHC 4W6AA 3ST3A 1DGCA 1L4SA 2QLGB 2VQEE 2JVAA 4L12A 2EPMX 3LF4B 2BB8A 2JPAA 4BHCA 2LCEA 2EPPA 1XMQE 3CB9A 1PDAA 2EMOA 1UBDC 3F6GA 1XNRE 1YYKA 2ENHA 3CFHA 4HQ9A 4M2ZA 4GZNC 5AQBB 3W1CA 3ED8A 2DDDA 3H1OA 4ZF4A 1EH8A 4H47A 4W73A 2FGGA 2V86A 1YHGA 2QZ0A 3P8UA 3DQKA 5DTLA 3AUZA 4ZYEA 2EOJA 4O43A 3WCKA 3IWBA 2YRHA 3ST2A 4R2EA 4R2QA 3ZULA 1G7KA 1O0WA 2RSIA 2A54B 3GL4A 1GFLA 2EN6A 1EMKA 2IE2A 3DQNA 3GJ2A 2L33A 1JC1A 1ZGOA 4F9AB 2EMXA 4DR6E 3TQMA 1QU6A 3K1KA 2L8TA 1EMBA 2G6XA 2KOUA 4BDUA 4GEQB 4JFGA 1A1KA 2WZOA 2EOEA 1X47A 3GEXA 4LJCA 2V83A 1Q4EA 2DB2A 4DXIA 1X3CA 2POXA 4L13A 2EJ4A 2CT1A 5DRGA 4OGSA 3EKHA 1KYQA 1G2FC 2EOXA 2A53B 2OJKA 1UN6B 4HQCA 4W6GA 1S6ZA 2FV4B 3BF2A 1XNQE 2A25A 5EXUA 2WCC3 2YDZA 2CSHA 3KWRA 3NT3A 5TSEA 4L1IA 4LU9A 3ZOQB 1YYWA 2FZUA 2EMLA 4LQUA 2EM9A 2ODRC 3IWCA 4JI6E 2UUBE 3DQUA 3VHTA 2CTDA 5DPHA 2R1FA 2YRKA 2L2KB 2EM8A 3SG3A 5LK4A 2L3JA 4LF8E 2EORA 3PJ5A 2N8XA 2EMNA 2DMYA 3HPZA 2UXBE 3EPHA 4HE4A 4BC7A 2L6MA 5FVFA 3PIBA 2CPNA 4HTGA 2PXWA 4KF5A 2EOSA 3GJ1A 1GGXA 3VK1A 3LVCA 3SSVA 2EOYA 3DQ4A 4OQWA 3O78A 2ELZA 2EM0A 1MOVA 3NT9A 3QG5C 3NF0A 4NWSA 4AS8A 1JBYA 3SVSA 3DQ3A 2EOHA 3G9AA 2EOIA 3E5WA 1F09A 3LA1A 1W7TA 4W6UA 2RS6A 4WSPA 2YFPA 2LT7A 4U2VA 4IK3A 4AR7A 2HGHA 5BQLA 4JF9A 3RWAA 3VYXA 2A46A 1QYFA 2AWKA 1EH6A 4EULA 4BMJA 5KL3A 4LF5E 2QRFA 3SRYA 3U0MA 1QNTA 4W6IA 2JY9A 2EM4A 2VF1A 5DTZA 2WURA 2DMIA 4MLVA 3DPZA 4BHBA 3SG5A 3OSRA 2HHHE 1P47A 5A6BD 2G6EA 1A1JA 3SVBA 3THNA 2ELYA 3FIGA 3AV0A 4W7RA 3ADJA 3E5VA 4Q35B 5KL5A 4R2RA 4NXME 3BIDA 1EMAA 4F9CB 3IWDA 5LMNE 1OXFA 2DDCA 2HC5A 1SFEA 2GW4B 1RRXA 4B3RE 2EPOA 1B69A 1YJFA 2D9HA 5AASA 2ICRA 3OGOA 2O2BA 2HCGA 5EB7A 4DKMA 4NHRA 4IJDA 4BBYA 5T6JA 1RMPA 5H87A 2ENAA 1AH5A 2H9WA 4R03A 1BBGA 2Y0GA 3KZYA 2EOZA 2B7VA 4WSGA 4OY4A 4XVPA 4KAGA 4RYSA 3SVEA 4O24A 4PPKA 5KL2A 3C4TA 4TUGA 4X64E 3LMLA 5IT9C 1EH7A 1X6FA 4B3SE 2EMHA 3CBEA 2YTEA 2V88A 2M4IA 3U8AA 4L8NA 4KPIA 2B7TA 3DPWA 1C4FA 1NCSA 4R8OA 4W74A 3JU0A 2VVJA 1SR9A 2O24A 2A48A 4XL5A 1Q4AA 2RTXA 4GOBA 4WYQB 1YZ9A 4Q9WA 3P1XA 4LQTA 4TZGA 2HPWA 5LTPA 4PFEA 1ZBQA 2BTJA 2EMGA 4WXCA 2QT2A 4R2AA 4LF6E 2G2SB 4RHBB 4R2CA 4HVFA 2DSYA 1X6EA 2YTOA 5A2QC 2LRSA 1A1FA 1JC0A 2LE2A 2AHAA 2HJJA 5CFFE 1KP5A 1T4LB 2ZMWA 4W7CA 2HFCA 2ARLA 1A1LA 2Q6PA 3DQLA 5DPGA 3ST4A 4B30B 2BBGA 2AWJA 2EM2A 1IMUA 4W6PA 5LTRA 3M22A 2HGYA 1Q4BA 3EK8A 3HPSA 3SSLA 2RPCA 2UU9E 4WPYA 4JYAE 3ADGA 5A6AA 4JI1E 3C6MA 3MGFA 3SV5A 3U0KA 1ZBTA 4JI8E 1G2DC 2FTXB 4JI0E 2OKWA 2YTNA 3DQ7A 3EVRA 3V3DA 2EL4A 1YHIA 4M0VA 2DD7A 3LF3A 1X5WA 3GB3A 3OMLA 2HJOA 3P28A 2RS7A 1T38A 3WLCA 1X49A 2M1SA 1OXEA 1OXDA 2V85A 3DQIA 1A1HA 4WX9A 3SVRA 4H3MA 4YY3E 2YU8A 1H6RA 1TF3A 4LJDA 4TZAA 3U0LA 2JWOA 4B3TE 2G6YA 5KTGA 4J8ZA 2F4VE 5ADZA 4K0KE 4UTSA 4EDOA 1N36E 2IB5A 1FKAE 5A6JA 4LF9E 4ZINA 4DR7E 5EHUA 1GZ6A 2I9IA 2MC5A 4X9JA 1IQOA 2M7QA 3DQJA 2VAEA 2Z6XA 2V4EA 4W6JA 4P7DA 2WBTA 1Z1PA 3EQ1A 2A50B 3SSKA 5BTTA 1ZR9A 2DIXA 2OGRA 4L5NC 2AH8A 5FVGA 1YPNA 3EK4A 3AKOA 1XAEA 1PJQA 1W7UA 3BXBA 1KJKA 2EMBA 3LVAA 4X66E 2GX0A 5EBJA 3ADIA 3KZZA 2NUEA 4ZFSA 2EL6A 3DQ2A 1XSSA 4O5GA 4BCAA 4DKNA 4BS9A 3EK7A 4LTYA 3U8PA 3VHTB 3DQCA 3DQ5A 3O77A 4ZYGA 3EPJA 3NEDA 5KL4A 1LLMC 4RH8A 4B5YA 2E1MA 1T4NA 5HZTA 4J89A 2EOQA 3BGHA 1B9CA 2ZO7A 5HW9A 2LVHA 3EPKA 4OOGC 2LBSB 5EXCI 1WHNA 1X48A 2EWLA 4Q7RA 3JAMC 3SVUA 1QYQA 2B3TB 1WXRA 4DV5E 3M24A 2GW3A 4BC9A 1TF6A 1QY3A 5DTYA 2EOOA 2JP9A 4R2SA 3DQAA 4TUIA 3SSYA 3DQDA 1PJTA 5DQBA 1EKZA 2EPZA 3F6HA 2LTSA 4NXNE 3U0NA 1Q4CA 2A52B 3DPXA 4I2YA 4KEXA 2QU1A 4W7EA 4XOVA 2EN7A 3JTZA 2HQZA 2EPRA 4WFTA 3THOB 5KL6A 5KL7A 3AI5A 4W7AA 2F8BA 4EN1A 2VE7C 4R2DA 5J2OA 2L3CA 3HTXA 2LUPB 3OSQA 4XGYA 3ZTFA 4YHHE 4OX9E 4JI2E 4W6FA 2LMZA 3LVDA 2YTIA 3HXLA 4GF6B 5IXMB 3J81C 1XQMA 4KW9A 3SG6A 2UUCE 5EXBA 1EMEA 2ODRD 3SVOA 3BXAA 2YSOA 2E72A 4KZSA 2H5QA 3DQMA 3BBGA 4DR4E 4JV5E 5HZSA 4LFAE 1A1IA 2YTDA 4MLQA 4OJ0A 4W72A 4W6RA 1RMMA 5LLQA 4XOWA 1MOUA 5HGEA 2GLIA 1EMMA 1AAYA 3DQEA 3SS0A 3UG0A 2MKNA 1Q4DA 4DUZE 4KW8A 1HNXE 2OTEA 2EM7A 1N33E 2EOFA 1HCJA 1NEIA 2WHTA 1EMFA 4DXPA 2B9DA 2EPAA 2MC6A 2EN4A 2MDGA 5IWAE 3K6QA 3M99B 5A6BA 4H3LA 2FWQA 2L2NA 3EVVA 2DUIA 3KCSA 4Q9XA 1GTKA 1UHZA 1QYOA 2EPKX 4O4KA 1YYOA 2H6VA 2N3HA 1HNWE 4B3ME 2C9IA 2UXCE 1ZU1A 2YTJA 4Z4MA 4Q28A 4DV3E 1CV7A 5F9GA 4FK5C 4ZYDA 4M9VC 3S05A 2DUGA 1EMGA 4P78A 5A6KA 2EN3A 2A56B 4F9BB 3DQ9A 4RYWA 2L92A 4ZYHA 4DR1E 1ZGPA 4W6TA 2UXDE 4JRBA 1PKPA 5FHVA 4DXMA 2I13A 1F0BA 4EMQA 2EPNA 2NABA 4X65E 1EMCA 2L2MA 1BFPA 5AE3A 2EN8A 5FLXC 1Z1BA 2EMKA 1IQSA 1W7SA 4JEOA 2WHSA 2EMYA 2PRTA 2WBUA 4ZB1A 3ZUFA 3J7AG 2YPNA 4GKJE 4DV4E 5AC4A 3PJ7A 3DQFA 2E5LE 4DR2E 4LF4E 2QLGA 2EMWA 4LF7E 1MEYC 1JK2A 2MDRA 3CGLA 3KCTA 2H5PA 3RWTA 3SVNA 2DLKA 4GKKE 4KF5C 3T1YE 3MSWA 1ZAAC 3BXCA 4ZBLA 2ZO6A 2Z1OA 1RMOA 3BX9A 4KF4A 4LW5A 4W7DA 5DTXA 1WHQA 3CFAA 3SSPA 2WIQA 1WRJA 1XMOE 5HZOA 3H1RA 2YTGA 3UK3C 4W77A 3SG2A 2EMFA 2YT4A 4IZNA 3SSHA 2GPIA 1IBKE 4KA9A 3WLDA 2YRMA 4PPJA 2YZTA 3TMTA 3ECRA 5AC5A 2WHUA 5DPJA 3IP2A 4R2PA 2EMCA 2WBSA 1F2IG 2PXSA 4ORNA 2R76A 4W69A 2ZM6E 4HEIA 2DUEA 2LTRA 3EPLA 2LV2A 4P76A 1QXTA 2AWMA 2JADA 5FVIA 1KYPA 2QLIA 4JI5E 2LO3A 4IK9A 2V87A 4JGEA 3SSTA 2WISA 4I8OA 4R6DA 2H36X 4W7FA 4IK5A 2J7JA 5H89A 5DRFA 2YTPA 4W6DA 4Q7UA 4W7XA 3PJBA 4Z4KA 2N3GA 1A1GA 5DY6A 4OHSA 5LL6R 4M30A 1YZWA 4H48A 4KW4A 3SVCA 4LFCE 3ST0A 2H8QA 5HZUA 1Z1QA 4IK1A 3I19A 2EMIA 2MKDA 3VYYA 4F6NA 1I94E 3ADLA 2JYAA 5HBDA 3ZUJA 2EE8A 2VVHA 2VRDA 4DKKA 1YUJA 4IK8A 4PPLA 3OTOE 4DV0E 4W75A 2RH7A 2EN2A 2P4MA 2V4EB 1WJPA 3ADFA 2OTBA 5BTTB 4ZF5A 4W76A 2EPXA 1XA9A 2IHR1 1RM9A 1MGTA 1ZUXA 4JI7E 2OKYA 2Q8UA 2JXPA 1Q73A 2B3PA 4W6BA 1ZGQA 2H5RA 2YE0A 1HR0E 1J26A 2FL1A 5LMUE 2HRSA 4DXNA 1YFHA 5DNYA 4RTCA 1GL4A 3SVDA 2RQLA 1N34E 2WSNA 4W6LA 4F6MA 2G16B 4H3NA 2EPLX 5AE1A 2G3DB 1STUA 4ZIOA 2GX2A 4DMIA 2DUHA 3U8CA 3E5TA 4ANJA 3H09A 2UUAE
chains in the Genus database with same CATH topology
5DU0A 2EQ0A 4R6BA 3EKJA 2H5OA 3NEZA 3MHSC 2ENCA 4KGEA 2DD9A 2DLQA 4W6KA 2QLEA 2IOVA 1JK1A 3A8SA 5DPIA 5EB6A 3LSAA 3DQ8A 4Q7TA 2EOMA 1EMLA 1TN9A 3CD1A 4IK4A 1MYWA 2QLHA 2EQ3A 2M9AA 2IB6A 2EPCA 1BBOA 1BB8A 1YHHA 1RMDA 3W1DA 2ADRA 3UFZA 1XMZA 2EM5A 4W6OA 2WSOA 2Z6ZA 4W6MA 3SG7A 2EMDA 2O29A 4J88A 2DUFA 2HGDA 4LJBA 4W6HA 2EQ1A 2ZMUA 3DQHA 2YE1A 3TMRA 2EPUA 4HQ8A 2EN1A 2B3QA 2EMZA 2GHFA 2G5ZB 3CD9A 4DXQA 3EVPA 4LJDC 2YTQA 4IS1C 2DRPA 4J8AA 3VICA 3DQ1A 3DQ6A 1KYRA 2VZXA 2Q57A 3CFFA 5DQMA 2YSPA 2Z6YA 2EM3A 2EMAA 4P1QA 2VVIA 1UISA 1YFPA 2G3OA 2V4EC 2EM6A 4F2JC 1YUIA 3IR8A 2EL5A 4ZF3A 4W6CA 3DQOA 4GESB 5T3IA 1H4UA 3AI4A 5EJUA 2YTFA 1YSAC 5H88A 4W6NA 5BT0A 1KYSA 3LS3A 3SG4A 4KGFA 2AWLA 1YJ2A 1HUYA 2YU5A 4JC2A 2HQKA 2EP3A 3EVUA 4N3DA 4DXOA 4EDSA 5LTQA 2C9JA 1JBZA 4B30A 2VADA 4W6SA 2A47A 1X6HA 3MHHC 4W6AA 3ST3A 1DGCA 2QLGB 4L12A 3LF4B 2BB8A 2JPAA 2LCEA 2EPPA 3CB9A 2EMOA 1UBDC 2ENHA 3CFHA 4HQ9A 4GZNC 5AQBB 3W1CA 3ED8A 2DDDA 3H1OA 4ZF4A 1A1GA 4H47A 4W73A 1YHGA 2QZ0A 3P8UA 3DQKA 5DTLA 2EOJA 3WCKA 2YRHA 3ST2A 4R2EA 4R2QA 3ZULA 1G7KA 2RSIA 2A54B 3GL4A 1GFLA 2EN6A 1EMKA 2IE2A 3DQNA 3GJ2A 1JC1A 1ZGOA 2EMXA 3K1KA 1EMBA 2G6XA 4BDUA 4JFGA 1A1KA 2EOEA 3GEXA 4LJCA 1Q4EA 4DXIA 1X3CA 2POXA 4L13A 2EJ4A 2CT1A 5DRGA 4OGSA 3EKHA 1G2FC 2EOXA 2A53B 2OJKA 1UN6B 4HQCA 4W6GA 1S6ZA 2A25A 5EXUA 2WCC3 2YDZA 2CSHA 3NT3A 4L1IA 2FZUA 2EMLA 4LQUA 2EM9A 3DQUA 3VHTA 2CTDA 5DPHA 2R1FA 2YRKA 2EM8A 3SG3A 5LK4A 2EORA 3PJ5A 2EMNA 3EPHA 4HE4A 5FVFA 3PIBA 2PXWA 4KF5A 2EOSA 3GJ1A 1GGXA 3VK1A 3LVCA 3SSVA 2EOYA 3DQ4A 4OQWA 3O78A 2ELZA 2EM0A 1MOVA 3NT9A 3NF0A 4NWSA 4AS8A 1JBYA 3SVSA 3DQ3A 2EOHA 3G9AA 2EOIA 3E5WA 1F09A 3LA1A 1W7TA 4W6UA 2YFPA 2LT7A 4U2VA 4IK3A 4AR7A 2HGHA 5BQLA 4JF9A 3RWAA 2A46A 1QYFA 2AWKA 5KL3A 4EULA 2QRFA 3SRYA 3U0MA 4W6IA 2EM4A 5DTZA 2WURA 2DMIA 3DPZA 3SG5A 3OSRA 1P47A 1A1JA 2G6EA 3SVBA 2ELYA 4W7RA 3E5VA 5KL5A 4R2RA 1EMAA 1OXFA 2DDCA 2GW4B 1RRXA 1B69A 1YJFA 2D9HA 2ICRA 3OGOA 2O2BA 2HCGA 5EB7A 4DKMA 4IJDA 1RMPA 5H87A 2ENAA 2H9WA 2Y0GA 2EOZA 4WSGA 4OY4A 4XVPA 4KAGA 4RYSA 3SVEA 5KL2A 4PPKA 1X6FA 2EMHA 3CBEA 2YTEA 3U8AA 4KPIA 3DPWA 1C4FA 1NCSA 4W74A 2VVJA 2O24A 2A48A 4XL5A 1Q4AA 4GOBA 4Q9WA 4LQTA 4TZGA 2HPWA 5LTPA 4PFEA 2EMGA 2BTJA 4R2AA 2QT2A 2G2SB 4R2CA 4HVFA 1X6EA 2YTOA 1A1FA 1JC0A 2AHAA 1KP5A 2ZMWA 4W7CA 2HFCA 2ARLA 1A1LA 2Q6PA 3DQLA 5DPGA 3ST4A 4B30B 2AWJA 2EM2A 4W6PA 5LTRA 3M22A 2HGYA 1Q4BA 3EK8A 3SSLA 2RPCA 3MGFA 3SV5A 3U0KA 1G2DC 2OKWA 2YTNA 3DQ7A 3EVRA 3V3DA 2EL4A 1YHIA 2DD7A 3LF3A 1X5WA 3GB3A 2HJOA 3P28A 3WLCA 1OXEA 1OXDA 3DQIA 1A1HA 3SVRA 4H3MA 2YU8A 1H6RA 1TF3A 4LJDA 4TZAA 3U0LA 2G6YA 5KTGA 4UTSA 4EDOA 2IB5A 4ZINA 5EHUA 4X9JA 3DQJA 2VAEA 2Z6XA 2V4EA 4W6JA 2WBTA 1Z1PA 2A50B 3SSKA 5BTTA 1ZR9A 2OGRA 2AH8A 5FVGA 3EK4A 3AKOA 1XAEA 1W7UA 3BXBA 1KJKA 2EMBA 3LVAA 2GX0A 5EBJA 4ZFSA 2EL6A 3DQ2A 1XSSA 4DKNA 3EK7A 3U8PA 3VHTB 3DQCA 3DQ5A 3O77A 3EPJA 1LLMC 3NEDA 5KL4A 4B5YA 5HZTA 4J89A 2EOQA 1B9CA 2ZO7A 5HW9A 2LVHA 3EPKA 2DGCA 5EXCI 4Q7RA 3SVUA 1QYQA 3M24A 2GW3A 1TF6A 2JP9A 1QY3A 5DTYA 2EOOA 4R2SA 3DQAA 3SSYA 3DQDA 5DQBA 2EPZA 3U0NA 1Q4CA 2A52B 3DPXA 4I2YA 4KEXA 2QU1A 4W7EA 4XOVA 2EN7A 5KL7A 2HQZA 2EPRA 5KL6A 3AI5A 4W7AA 4EN1A 4R2DA 5J2OA 3OSQA 4XGYA 3ZTFA 4W6FA 2YTIA 3LVDA 4GF6B 1XQMA 4KW9A 3SG6A 5EXBA 1EMEA 3SVOA 3BXAA 2YSOA 2E72A 2H5QA 3DQMA 5HZSA 1A1IA 2YTDA 4OJ0A 4W72A 4W6RA 1RMMA 4XOWA 1MOUA 5HGEA 2GLIA 1EMMA 1AAYA 3DQEA 3SS0A 3UG0A 2MKNA 1Q4DA 4KW8A 2OTEA 2EM7A 2EOFA 1HCJA 2WHTA 1EMFA 4DXPA 2EPAA 2EN4A 2MDGA 3M99B 4H3LA 2FWQA 3EVVA 2DUIA 3KCSA 4Q9XA 1QYOA 2H6VA 2C9IA 1ZU1A 2YTJA 4Z4MA 1CV7A 5F9GA 4FK5C 4M9VC 3S05A 2DUGA 1EMGA 2EN3A 2A56B 3DQ9A 4RYWA 1ZGPA 4W6TA 4JRBA 2I13A 5FHVA 4DXMA 1F0BA 4EMQA 2NABA 1EMCA 1BFPA 2EN8A 1Z1BA 2EMKA 1W7SA 4JEOA 2WHSA 2EMYA 2PRTA 2WBUA 4ZB1A 3ZUFA 3PJ7A 3DQFA 2QLGA 2EMWA 1MEYC 1JK2A 3CGLA 3KCTA 2H5PA 3RWTA 3SVNA 2DLKA 4KF5C 1ZAAC 3BXCA 4ZBLA 2ZO6A 2Z1OA 1RMOA 3BX9A 4KF4A 4LW5A 4W7DA 5DTXA 3CFAA 3SSPA 2WIQA 5HZOA 3H1RA 2YTGA 3UK3C 4W77A 3SG2A 2EMFA 4IZNA 3SSHA 4KA9A 3WLDA 2YRMA 4PPJA 3TMTA 2WHUA 5DPJA 3IP2A 4R2PA 2EMCA 2WBSA 1F2IG 2PXSA 4ORNA 4W69A 2DUEA 3EPLA 2LV2A 4P76A 1QXTA 2AWMA 2JADA 5FVIA 1KYPA 2QLIA 2LO3A 4IK9A 4JGEA 3SSTA 2WISA 4R6DA 4W7FA 4IK5A 2J7JA 5H89A 5DRFA 2YTPA 4W6DA 4Q7UA 4W7XA 3PJBA 4Z4KA 5DY6A 4OHSA 1YZWA 4H48A 4KW4A 3SVCA 3ST0A 2H8QA 5HZUA 1Z1QA 4IK1A 3I19A 2EMIA 2MKDA 4F6NA 5HBDA 3ZUJA 2EE8A 2VVHA 2VRDA 1YUJA 4IK8A 4PPLA 4W75A 2RH7A 2EN2A 2P4MA 2V4EB 1WJPA 3ADFA 2OTBA 5BTTB 4ZF5A 4W76A 2EPXA 1XA9A 1RM9A 1ZUXA 2OKYA 1Q73A 2B3PA 4W6BA 1ZGQA 2H5RA 2YE0A 2FL1A 2HRSA 4DXNA 4RTCA 1GL4A 3SVDA 2WSNA 4W6LA 4F6MA 2G16B 4H3NA 2G3DB 4ZIOA 2GX2A 2DUHA 3U8CA 3E5TA 4ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DU0 A;  2EQ0 A;  4R6B A;  3EKJ A;  2H5O A;  3NEZ A;  3MHS C;  2ENC A;  4KGE A;  2DD9 A;  2DLQ A;  4W6K A;  2QLE A;  2IOV A;  1JK1 A;  3A8S A;  5DPI A;  5EB6 A;  3LSA A;  3DQ8 A;  4Q7T A;  2EOM A;  1EML A;  1TN9 A;  3CD1 A;  4IK4 A;  1MYW A;  2QLH A;  2EQ3 A;  2M9A A;  2IB6 A;  2EPC A;  1BBO A;  1BB8 A;  1YHH A;  1RMD A;  3W1D A;  2ADR A;  3UFZ A;  1XMZ A;  2EM5 A;  4W6O A;  2WSO A;  2Z6Z A;  4W6M A;  3SG7 A;  2EMD A;  2O29 A;  4J88 A;  2DUF A;  2HGD A;  4LJB A;  4W6H A;  2EQ1 A;  2ZMU A;  3DQH A;  2YE1 A;  3TMR A;  2EPU A;  4HQ8 A;  2EN1 A;  2B3Q A;  2EMZ A;  2GHF A;  2G5Z B;  3CD9 A;  4DXQ A;  3EVP A;  4LJD C;  2YTQ A;  4IS1 C;  2DRP A;  4J8A A;  3VIC A;  3DQ1 A;  3DQ6 A;  1KYR A;  2VZX A;  2Q57 A;  3CFF A;  5DQM A;  2YSP A;  2Z6Y A;  2EM3 A;  2EMA A;  4P1Q A;  2VVI A;  1UIS A;  1YFP A;  2G3O A;  2V4E C;  2EM6 A;  4F2J C;  1YUI A;  3IR8 A;  2EL5 A;  4ZF3 A;  4W6C A;  3DQO A;  4GES B;  5T3I A;  1H4U A;  3AI4 A;  5EJU A;  2YTF A;  1YSA C;  5H88 A;  4W6N A;  5BT0 A;  1KYS A;  3LS3 A;  3SG4 A;  4KGF A;  2AWL A;  1YJ2 A;  1HUY A;  2YU5 A;  4JC2 A;  2HQK A;  2EP3 A;  3EVU A;  4N3D A;  4DXO A;  4EDS A;  5LTQ A;  2C9J A;  1JBZ A;  4B30 A;  2VAD A;  4W6S A;  2A47 A;  1X6H A;  3MHH C;  4W6A A;  3ST3 A;  1DGC A;  2QLG B;  4L12 A;  3LF4 B;  2BB8 A;  2JPA A;  2LCE A;  2EPP A;  3CB9 A;  2EMO A;  1UBD C;  2ENH A;  3CFH A;  4HQ9 A;  4GZN C;  5AQB B;  3W1C A;  3ED8 A;  2DDD A;  3H1O A;  4ZF4 A;  1A1G A;  4H47 A;  4W73 A;  1YHG A;  2QZ0 A;  3P8U A;  3DQK A;  5DTL A;  2EOJ A;  3WCK A;  2YRH A;  3ST2 A;  4R2E A;  4R2Q A;  3ZUL A;  1G7K A;  2RSI A;  2A54 B;  3GL4 A;  1GFL A;  2EN6 A;  1EMK A;  2IE2 A;  3DQN A;  3GJ2 A;  1JC1 A;  1ZGO A;  2EMX A;  3K1K A;  1EMB A;  2G6X A;  4BDU A;  4JFG A;  1A1K A;  2EOE A;  3GEX A;  4LJC A;  1Q4E A;  4DXI A;  1X3C A;  2POX A;  4L13 A;  2EJ4 A;  2CT1 A;  5DRG A;  4OGS A;  3EKH A;  1G2F C;  2EOX A;  2A53 B;  2OJK A;  1UN6 B;  4HQC A;  4W6G A;  1S6Z A;  2A25 A;  5EXU A;  2WCC 3;  2YDZ A;  2CSH A;  3NT3 A;  4L1I A;  2FZU A;  2EML A;  4LQU A;  2EM9 A;  3DQU A;  3VHT A;  2CTD A;  5DPH A;  2R1F A;  2YRK A;  2EM8 A;  3SG3 A;  5LK4 A;  2EOR A;  3PJ5 A;  2EMN A;  3EPH A;  4HE4 A;  5FVF A;  3PIB A;  2PXW A;  4KF5 A;  2EOS A;  3GJ1 A;  1GGX A;  3VK1 A;  3LVC A;  3SSV A;  2EOY A;  3DQ4 A;  4OQW A;  3O78 A;  2ELZ A;  2EM0 A;  1MOV A;  3NT9 A;  3NF0 A;  4NWS A;  4AS8 A;  1JBY A;  3SVS A;  3DQ3 A;  2EOH A;  3G9A A;  2EOI A;  3E5W A;  1F09 A;  3LA1 A;  1W7T A;  4W6U A;  2YFP A;  2LT7 A;  4U2V A;  4IK3 A;  4AR7 A;  2HGH A;  5BQL A;  4JF9 A;  3RWA A;  2A46 A;  1QYF A;  2AWK A;  5KL3 A;  4EUL A;  2QRF A;  3SRY A;  3U0M A;  4W6I A;  2EM4 A;  5DTZ A;  2WUR A;  2DMI A;  3DPZ A;  3SG5 A;  3OSR A;  1P47 A;  1A1J A;  2G6E A;  3SVB A;  2ELY A;  4W7R A;  3E5V A;  5KL5 A;  4R2R A;  1EMA A;  1OXF A;  2DDC A;  2GW4 B;  1RRX A;  1B69 A;  1YJF A;  2D9H A;  2ICR A;  3OGO A;  2O2B A;  2HCG A;  5EB7 A;  4DKM A;  4IJD A;  1RMP A;  5H87 A;  2ENA A;  2H9W A;  2Y0G A;  2EOZ A;  4WSG A;  4OY4 A;  4XVP A;  4KAG A;  4RYS A;  3SVE A;  5KL2 A;  4PPK A;  1X6F A;  2EMH A;  3CBE A;  2YTE A;  3U8A A;  4KPI A;  3DPW A;  1C4F A;  1NCS A;  4W74 A;  2VVJ A;  2O24 A;  2A48 A;  4XL5 A;  1Q4A A;  4GOB A;  4Q9W A;  4LQT A;  4TZG A;  2HPW A;  5LTP A;  4PFE A;  2EMG A;  2BTJ A;  4R2A A;  2QT2 A;  2G2S B;  4R2C A;  4HVF A;  1X6E A;  2YTO A;  1A1F A;  1JC0 A;  2AHA A;  1KP5 A;  2ZMW A;  4W7C A;  2HFC A;  2ARL A;  1A1L A;  2Q6P A;  3DQL A;  5DPG A;  3ST4 A;  4B30 B;  2AWJ A;  2EM2 A;  4W6P A;  5LTR A;  3M22 A;  2HGY A;  1Q4B A;  3EK8 A;  3SSL A;  2RPC A;  3MGF A;  3SV5 A;  3U0K A;  1G2D C;  2OKW A;  2YTN A;  3DQ7 A;  3EVR A;  3V3D A;  2EL4 A;  1YHI A;  2DD7 A;  3LF3 A;  1X5W A;  3GB3 A;  2HJO A;  3P28 A;  3WLC A;  1OXE A;  1OXD A;  3DQI A;  1A1H A;  3SVR A;  4H3M A;  2YU8 A;  1H6R A;  1TF3 A;  4LJD A;  4TZA A;  3U0L A;  2G6Y A;  5KTG A;  4UTS A;  4EDO A;  2IB5 A;  4ZIN A;  5EHU A;  4X9J A;  3DQJ A;  2VAE A;  2Z6X A;  2V4E A;  4W6J A;  2WBT A;  1Z1P A;  2A50 B;  3SSK A;  5BTT A;  1ZR9 A;  2OGR A;  2AH8 A;  5FVG A;  3EK4 A;  3AKO A;  1XAE A;  1W7U A;  3BXB A;  1KJK A;  2EMB A;  3LVA A;  2GX0 A;  5EBJ A;  4ZFS A;  2EL6 A;  3DQ2 A;  1XSS A;  4DKN A;  3EK7 A;  3U8P A;  3VHT B;  3DQC A;  3DQ5 A;  3O77 A;  3EPJ A;  1LLM C;  3NED A;  5KL4 A;  4B5Y A;  5HZT A;  4J89 A;  2EOQ A;  1B9C A;  2ZO7 A;  5HW9 A;  2LVH A;  3EPK A;  2DGC A;  5EXC I;  4Q7R A;  3SVU A;  1QYQ A;  3M24 A;  2GW3 A;  1TF6 A;  2JP9 A;  1QY3 A;  5DTY A;  2EOO A;  4R2S A;  3DQA A;  3SSY A;  3DQD A;  5DQB A;  2EPZ A;  3U0N A;  1Q4C A;  2A52 B;  3DPX A;  4I2Y A;  4KEX A;  2QU1 A;  4W7E A;  4XOV A;  2EN7 A;  5KL7 A;  2HQZ A;  2EPR A;  5KL6 A;  3AI5 A;  4W7A A;  4EN1 A;  4R2D A;  5J2O A;  3OSQ A;  4XGY A;  3ZTF A;  4W6F A;  2YTI A;  3LVD A;  4GF6 B;  1XQM A;  4KW9 A;  3SG6 A;  5EXB A;  1EME A;  3SVO A;  3BXA A;  2YSO A;  2E72 A;  2H5Q A;  3DQM A;  5HZS A;  1A1I A;  2YTD A;  4OJ0 A;  4W72 A;  4W6R A;  1RMM A;  4XOW A;  1MOU A;  5HGE A;  2GLI A;  1EMM A;  1AAY A;  3DQE A;  3SS0 A;  3UG0 A;  2MKN A;  1Q4D A;  4KW8 A;  2OTE A;  2EM7 A;  2EOF A;  1HCJ A;  2WHT A;  1EMF A;  4DXP A;  2EPA A;  2EN4 A;  2MDG A;  3M99 B;  4H3L A;  2FWQ A;  3EVV A;  2DUI A;  3KCS A;  4Q9X A;  1QYO A;  2H6V A;  2C9I A;  1ZU1 A;  2YTJ A;  4Z4M A;  1CV7 A;  5F9G A;  4FK5 C;  4M9V C;  3S05 A;  2DUG A;  1EMG A;  2EN3 A;  2A56 B;  3DQ9 A;  4RYW A;  1ZGP A;  4W6T A;  4JRB A;  2I13 A;  5FHV A;  4DXM A;  1F0B A;  4EMQ A;  2NAB A;  1EMC A;  1BFP A;  2EN8 A;  1Z1B A;  2EMK A;  1W7S A;  4JEO A;  2WHS A;  2EMY A;  2PRT A;  2WBU A;  4ZB1 A;  3ZUF A;  3PJ7 A;  3DQF A;  2QLG A;  2EMW A;  1MEY C;  1JK2 A;  3CGL A;  3KCT A;  2H5P A;  3RWT A;  3SVN A;  2DLK A;  4KF5 C;  1ZAA C;  3BXC A;  4ZBL A;  2ZO6 A;  2Z1O A;  1RMO A;  3BX9 A;  4KF4 A;  4LW5 A;  4W7D A;  5DTX A;  3CFA A;  3SSP A;  2WIQ A;  5HZO A;  3H1R A;  2YTG A;  3UK3 C;  4W77 A;  3SG2 A;  2EMF A;  4IZN A;  3SSH A;  4KA9 A;  3WLD A;  2YRM A;  4PPJ A;  3TMT A;  2WHU A;  5DPJ A;  3IP2 A;  4R2P A;  2EMC A;  2WBS A;  1F2I G;  2PXS A;  4ORN A;  4W69 A;  2DUE A;  3EPL A;  2LV2 A;  4P76 A;  1QXT A;  2AWM A;  2JAD A;  5FVI A;  1KYP A;  2QLI A;  2LO3 A;  4IK9 A;  4JGE A;  3SST A;  2WIS A;  4R6D A;  4W7F A;  4IK5 A;  2J7J A;  5H89 A;  5DRF A;  2YTP A;  4W6D A;  4Q7U A;  4W7X A;  3PJB A;  4Z4K A;  5DY6 A;  4OHS A;  1YZW A;  4H48 A;  4KW4 A;  3SVC A;  3ST0 A;  2H8Q A;  5HZU A;  1Z1Q A;  4IK1 A;  3I19 A;  2EMI A;  2MKD A;  4F6N A;  5HBD A;  3ZUJ A;  2EE8 A;  2VVH A;  2VRD A;  1YUJ A;  4IK8 A;  4PPL A;  4W75 A;  2RH7 A;  2EN2 A;  2P4M A;  2V4E B;  1WJP A;  3ADF A;  2OTB A;  5BTT B;  4ZF5 A;  4W76 A;  2EPX A;  1XA9 A;  1RM9 A;  1ZUX A;  2OKY A;  1Q73 A;  2B3P A;  4W6B A;  1ZGQ A;  2H5R A;  2YE0 A;  2FL1 A;  2HRS A;  4DXN A;  4RTC A;  1GL4 A;  3SVD A;  2WSN A;  4W6L A;  4F6M A;  2G16 B;  4H3N A;  2G3D B;  4ZIO A;  2GX2 A;  2DUH A;  3U8C A;  3E5T A;  4ANJ A; 
#chains in the Genus database with same CATH topology
 4KWY A;  5BR8 E;  5DU0 A;  2EZ6 A;  1PJS A;  2EQ0 A;  2V89 A;  4R6B A;  3C4B A;  3EKJ A;  2H5O A;  3NEZ A;  3DF6 A;  1GQE A;  4N4R B;  3DJW A;  3MHS C;  2ENC A;  4KGE A;  2DD9 A;  2DLQ A;  4W6K A;  2QLE A;  2IOV A;  2RSM A;  3A8S A;  5DPI A;  5EB6 A;  1JK1 A;  3LSA A;  3DQ8 A;  4Q7T A;  2EOM A;  3L00 A;  1HNZ E;  4DR3 E;  1EML A;  2K7I A;  1TN9 A;  4JI3 E;  4NZV A;  3CD1 A;  4IK4 A;  1MYW A;  2QLH A;  2EQ3 A;  2G7H A;  2M9A A;  2IB6 A;  2EPC A;  4DR5 E;  5F3W A;  4JI4 E;  3J80 C;  1BB8 A;  1BBO A;  1YHH A;  3VK6 A;  2VQF E;  1RMD A;  2LUQ A;  3W1D A;  2ADR A;  2JR1 A;  3UFZ A;  1XMZ A;  5AE2 A;  2EM5 A;  4W6O A;  2WSO A;  2Z6Z A;  4W6M A;  3SG7 A;  4DUY E;  2EMD A;  4F54 A;  2NUG A;  2O29 A;  4J88 A;  2DUF A;  2HGD A;  4LJB A;  4W6H A;  2EQ1 A;  2ZMU A;  3DQH A;  2YE1 A;  3TMR A;  1N3G A;  2EPU A;  4HQ8 A;  4KHP E;  2EN1 A;  2KON A;  3T1H E;  2B3Q A;  2EMZ A;  1UIL A;  2GHF A;  5A69 A;  2G5Z B;  3CD9 A;  1N32 E;  4DXQ A;  3EVP A;  4LJD C;  2YTQ A;  3C6K A;  4IS1 C;  2LJH A;  3RMP A;  2DRP A;  4J8A A;  1IBM E;  3VIC A;  5IV8 B;  2KHX A;  3DQ1 A;  1DQ3 A;  4LFB E;  3DQ6 A;  3LLH A;  1T4O A;  1KYR A;  2VZX A;  2DGC A;  2Q57 A;  3CFF A;  5DQM A;  2YSP A;  2Z6Y A;  2EM3 A;  2EMA A;  4P1Q A;  2YWQ A;  1J5E E;  2VVI A;  1UIS A;  1YFP A;  2G3O A;  2V4E C;  1RQ0 A;  2EM6 A;  2JOB A;  2JOX A;  1IBL E;  4F2J C;  1YUI A;  3IR8 A;  1DI2 A;  2EL5 A;  2LJU A;  4ZF3 A;  4W6C A;  3HQ1 A;  3DQO A;  4GES B;  5T3I A;  1H4U A;  3AI4 A;  2NUF A;  4X8W A;  5EJU A;  2YTF A;  2NA2 A;  1YSA C;  4WXD A;  4DV2 E;  5H88 A;  4W6N A;  4DV6 E;  2K4V A;  1RC7 A;  5BT0 A;  1KYS A;  3LS3 A;  3SG4 A;  4KGF A;  2AWL A;  1YJ2 A;  1HUY A;  2V8Q B;  2YU5 A;  4AQY E;  4JC2 A;  1T39 A;  2HQK A;  2EP3 A;  3EVU A;  4N3D A;  4DXO A;  4EDS A;  3J7Y p;  5LTQ A;  2C9J A;  1JBZ A;  4B30 A;  2VAD A;  4X62 E;  4DV1 E;  4DV7 E;  4W6S A;  1FJG E;  2A47 A;  1X6H A;  3MHH C;  4W6A A;  3ST3 A;  1DGC A;  1L4S A;  2QLG B;  2VQE E;  2JVA A;  4L12 A;  2EPM X;  3LF4 B;  2BB8 A;  2JPA A;  4BHC A;  2LCE A;  2EPP A;  1XMQ E;  3CB9 A;  1PDA A;  2EMO A;  1UBD C;  3F6G A;  1XNR E;  1YYK A;  2ENH A;  3CFH A;  4HQ9 A;  4M2Z A;  4GZN C;  5AQB B;  3W1C A;  3ED8 A;  2DDD A;  3H1O A;  4ZF4 A;  1EH8 A;  4H47 A;  4W73 A;  2FGG A;  2V86 A;  1YHG A;  2QZ0 A;  3P8U A;  3DQK A;  5DTL A;  3AUZ A;  4ZYE A;  2EOJ A;  4O43 A;  3WCK A;  3IWB A;  2YRH A;  3ST2 A;  4R2E A;  4R2Q A;  3ZUL A;  1G7K A;  1O0W A;  2RSI A;  2A54 B;  3GL4 A;  1GFL A;  2EN6 A;  1EMK A;  2IE2 A;  3DQN A;  3GJ2 A;  2L33 A;  1JC1 A;  1ZGO A;  4F9A B;  2EMX A;  4DR6 E;  3TQM A;  1QU6 A;  3K1K A;  2L8T A;  1EMB A;  2G6X A;  2KOU A;  4BDU A;  4GEQ B;  4JFG A;  1A1K A;  2WZO A;  2EOE A;  1X47 A;  3GEX A;  4LJC A;  2V83 A;  1Q4E A;  2DB2 A;  4DXI A;  1X3C A;  2POX A;  4L13 A;  2EJ4 A;  2CT1 A;  5DRG A;  4OGS A;  3EKH A;  1KYQ A;  1G2F C;  2EOX A;  2A53 B;  2OJK A;  1UN6 B;  4HQC A;  4W6G A;  1S6Z A;  2FV4 B;  3BF2 A;  1XNQ E;  2A25 A;  5EXU A;  2WCC 3;  2YDZ A;  2CSH A;  3KWR A;  3NT3 A;  5TSE A;  4L1I A;  4LU9 A;  3ZOQ B;  1YYW A;  2FZU A;  2EML A;  4LQU A;  2EM9 A;  2ODR C;  3IWC A;  4JI6 E;  2UUB E;  3DQU A;  3VHT A;  2CTD A;  5DPH A;  2R1F A;  2YRK A;  2L2K B;  2EM8 A;  3SG3 A;  5LK4 A;  2L3J A;  4LF8 E;  2EOR A;  3PJ5 A;  2N8X A;  2EMN A;  2DMY A;  3HPZ A;  2UXB E;  3EPH A;  4HE4 A;  4BC7 A;  2L6M A;  5FVF A;  3PIB A;  2CPN A;  4HTG A;  2PXW A;  4KF5 A;  2EOS A;  3GJ1 A;  1GGX A;  3VK1 A;  3LVC A;  3SSV A;  2EOY A;  3DQ4 A;  4OQW A;  3O78 A;  2ELZ A;  2EM0 A;  1MOV A;  3NT9 A;  3QG5 C;  3NF0 A;  4NWS A;  4AS8 A;  1JBY A;  3SVS A;  3DQ3 A;  2EOH A;  3G9A A;  2EOI A;  3E5W A;  1F09 A;  3LA1 A;  1W7T A;  4W6U A;  2RS6 A;  4WSP A;  2YFP A;  2LT7 A;  4U2V A;  4IK3 A;  4AR7 A;  2HGH A;  5BQL A;  4JF9 A;  3RWA A;  3VYX A;  2A46 A;  1QYF A;  2AWK A;  1EH6 A;  4EUL A;  4BMJ A;  5KL3 A;  4LF5 E;  2QRF A;  3SRY A;  3U0M A;  1QNT A;  4W6I A;  2JY9 A;  2EM4 A;  2VF1 A;  5DTZ A;  2WUR A;  2DMI A;  4MLV A;  3DPZ A;  4BHB A;  3SG5 A;  3OSR A;  2HHH E;  1P47 A;  5A6B D;  2G6E A;  1A1J A;  3SVB A;  3THN A;  2ELY A;  3FIG A;  3AV0 A;  4W7R A;  3ADJ A;  3E5V A;  4Q35 B;  5KL5 A;  4R2R A;  4NXM E;  3BID A;  1EMA A;  4F9C B;  3IWD A;  5LMN E;  1OXF A;  2DDC A;  2HC5 A;  1SFE A;  2GW4 B;  1RRX A;  4B3R E;  2EPO A;  1B69 A;  1YJF A;  2D9H A;  5AAS A;  2ICR A;  3OGO A;  2O2B A;  2HCG A;  5EB7 A;  4DKM A;  4NHR A;  4IJD A;  4BBY A;  5T6J A;  1RMP A;  5H87 A;  2ENA A;  1AH5 A;  2H9W A;  4R03 A;  1BBG A;  2Y0G A;  3KZY A;  2EOZ A;  2B7V A;  4WSG A;  4OY4 A;  4XVP A;  4KAG A;  4RYS A;  3SVE A;  4O24 A;  4PPK A;  5KL2 A;  3C4T A;  4TUG A;  4X64 E;  3LML A;  5IT9 C;  1EH7 A;  1X6F A;  4B3S E;  2EMH A;  3CBE A;  2YTE A;  2V88 A;  2M4I A;  3U8A A;  4L8N A;  4KPI A;  2B7T A;  3DPW A;  1C4F A;  1NCS A;  4R8O A;  4W74 A;  3JU0 A;  2VVJ A;  1SR9 A;  2O24 A;  2A48 A;  4XL5 A;  1Q4A A;  2RTX A;  4GOB A;  4WYQ B;  1YZ9 A;  4Q9W A;  3P1X A;  4LQT A;  4TZG A;  2HPW A;  5LTP A;  4PFE A;  1ZBQ A;  2BTJ A;  2EMG A;  4WXC A;  2QT2 A;  4R2A A;  4LF6 E;  2G2S B;  4RHB B;  4R2C A;  4HVF A;  2DSY A;  1X6E A;  2YTO A;  5A2Q C;  2LRS A;  1A1F A;  1JC0 A;  2LE2 A;  2AHA A;  2HJJ A;  5CFF E;  1KP5 A;  1T4L B;  2ZMW A;  4W7C A;  2HFC A;  2ARL A;  1A1L A;  2Q6P A;  3DQL A;  5DPG A;  3ST4 A;  4B30 B;  2BBG A;  2AWJ A;  2EM2 A;  1IMU A;  4W6P A;  5LTR A;  3M22 A;  2HGY A;  1Q4B A;  3EK8 A;  3HPS A;  3SSL A;  2RPC A;  2UU9 E;  4WPY A;  4JYA E;  3ADG A;  5A6A A;  4JI1 E;  3C6M A;  3MGF A;  3SV5 A;  3U0K A;  1ZBT A;  4JI8 E;  1G2D C;  2FTX B;  4JI0 E;  2OKW A;  2YTN A;  3DQ7 A;  3EVR A;  3V3D A;  2EL4 A;  1YHI A;  4M0V A;  2DD7 A;  3LF3 A;  1X5W A;  3GB3 A;  3OML A;  2HJO A;  3P28 A;  2RS7 A;  1T38 A;  3WLC A;  1X49 A;  2M1S A;  1OXE A;  1OXD A;  2V85 A;  3DQI A;  1A1H A;  4WX9 A;  3SVR A;  4H3M A;  4YY3 E;  2YU8 A;  1H6R A;  1TF3 A;  4LJD A;  4TZA A;  3U0L A;  2JWO A;  4B3T E;  2G6Y A;  5KTG A;  4J8Z A;  2F4V E;  5ADZ A;  4K0K E;  4UTS A;  4EDO A;  1N36 E;  2IB5 A;  1FKA E;  5A6J A;  4LF9 E;  4ZIN A;  4DR7 E;  5EHU A;  1GZ6 A;  2I9I A;  2MC5 A;  4X9J A;  1IQO A;  2M7Q A;  3DQJ A;  2VAE A;  2Z6X A;  2V4E A;  4W6J A;  4P7D A;  2WBT A;  1Z1P A;  3EQ1 A;  2A50 B;  3SSK A;  5BTT A;  1ZR9 A;  2DIX A;  2OGR A;  4L5N C;  2AH8 A;  5FVG A;  1YPN A;  3EK4 A;  3AKO A;  1XAE A;  1PJQ A;  1W7U A;  3BXB A;  1KJK A;  2EMB A;  3LVA A;  4X66 E;  2GX0 A;  5EBJ A;  3ADI A;  3KZZ A;  2NUE A;  4ZFS A;  2EL6 A;  3DQ2 A;  1XSS A;  4O5G A;  4BCA A;  4DKN A;  4BS9 A;  3EK7 A;  4LTY A;  3U8P A;  3VHT B;  3DQC A;  3DQ5 A;  3O77 A;  4ZYG A;  3EPJ A;  3NED A;  5KL4 A;  1LLM C;  4RH8 A;  4B5Y A;  2E1M A;  1T4N A;  5HZT A;  4J89 A;  2EOQ A;  3BGH A;  1B9C A;  2ZO7 A;  5HW9 A;  2LVH A;  3EPK A;  4OOG C;  2LBS B;  5EXC I;  1WHN A;  1X48 A;  2EWL A;  4Q7R A;  3JAM C;  3SVU A;  1QYQ A;  2B3T B;  1WXR A;  4DV5 E;  3M24 A;  2GW3 A;  4BC9 A;  1TF6 A;  1QY3 A;  5DTY A;  2EOO A;  2JP9 A;  4R2S A;  3DQA A;  4TUI A;  3SSY A;  3DQD A;  1PJT A;  5DQB A;  1EKZ A;  2EPZ A;  3F6H A;  2LTS A;  4NXN E;  3U0N A;  1Q4C A;  2A52 B;  3DPX A;  4I2Y A;  4KEX A;  2QU1 A;  4W7E A;  4XOV A;  2EN7 A;  3JTZ A;  2HQZ A;  2EPR A;  4WFT A;  3THO B;  5KL6 A;  5KL7 A;  3AI5 A;  4W7A A;  2F8B A;  4EN1 A;  2VE7 C;  4R2D A;  5J2O A;  2L3C A;  3HTX A;  2LUP B;  3OSQ A;  4XGY A;  3ZTF A;  4YHH E;  4OX9 E;  4JI2 E;  4W6F A;  2LMZ A;  3LVD A;  2YTI A;  3HXL A;  4GF6 B;  5IXM B;  3J81 C;  1XQM A;  4KW9 A;  3SG6 A;  2UUC E;  5EXB A;  1EME A;  2ODR D;  3SVO A;  3BXA A;  2YSO A;  2E72 A;  4KZS A;  2H5Q A;  3DQM A;  3BBG A;  4DR4 E;  4JV5 E;  5HZS A;  4LFA E;  1A1I A;  2YTD A;  4MLQ A;  4OJ0 A;  4W72 A;  4W6R A;  1RMM A;  5LLQ A;  4XOW A;  1MOU A;  5HGE A;  2GLI A;  1EMM A;  1AAY A;  3DQE A;  3SS0 A;  3UG0 A;  2MKN A;  1Q4D A;  4DUZ E;  4KW8 A;  1HNX E;  2OTE A;  2EM7 A;  1N33 E;  2EOF A;  1HCJ A;  1NEI A;  2WHT A;  1EMF A;  4DXP A;  2B9D A;  2EPA A;  2MC6 A;  2EN4 A;  2MDG A;  5IWA E;  3K6Q A;  3M99 B;  5A6B A;  4H3L A;  2FWQ A;  2L2N A;  3EVV A;  2DUI A;  3KCS A;  4Q9X A;  1GTK A;  1UHZ A;  1QYO A;  2EPK X;  4O4K A;  1YYO A;  2H6V A;  2N3H A;  1HNW E;  4B3M E;  2C9I A;  2UXC E;  1ZU1 A;  2YTJ A;  4Z4M A;  4Q28 A;  4DV3 E;  1CV7 A;  5F9G A;  4FK5 C;  4ZYD A;  4M9V C;  3S05 A;  2DUG A;  1EMG A;  4P78 A;  5A6K A;  2EN3 A;  2A56 B;  4F9B B;  3DQ9 A;  4RYW A;  2L92 A;  4ZYH A;  4DR1 E;  1ZGP A;  4W6T A;  2UXD E;  4JRB A;  1PKP A;  5FHV A;  4DXM A;  2I13 A;  1F0B A;  4EMQ A;  2EPN A;  2NAB A;  4X65 E;  1EMC A;  2L2M A;  1BFP A;  5AE3 A;  2EN8 A;  5FLX C;  1Z1B A;  2EMK A;  1IQS A;  1W7S A;  4JEO A;  2WHS A;  2EMY A;  2PRT A;  2WBU A;  4ZB1 A;  3ZUF A;  3J7A G;  2YPN A;  4GKJ E;  4DV4 E;  5AC4 A;  3PJ7 A;  3DQF A;  2E5L E;  4DR2 E;  4LF4 E;  2QLG A;  2EMW A;  4LF7 E;  1MEY C;  1JK2 A;  2MDR A;  3CGL A;  3KCT A;  2H5P A;  3RWT A;  3SVN A;  2DLK A;  4GKK E;  4KF5 C;  3T1Y E;  3MSW A;  1ZAA C;  3BXC A;  4ZBL A;  2ZO6 A;  2Z1O A;  1RMO A;  3BX9 A;  4KF4 A;  4LW5 A;  4W7D A;  5DTX A;  1WHQ A;  3CFA A;  3SSP A;  2WIQ A;  1WRJ A;  1XMO E;  5HZO A;  3H1R A;  2YTG A;  3UK3 C;  4W77 A;  3SG2 A;  2EMF A;  2YT4 A;  4IZN A;  3SSH A;  2GPI A;  1IBK E;  4KA9 A;  3WLD A;  2YRM A;  4PPJ A;  2YZT A;  3TMT A;  3ECR A;  5AC5 A;  2WHU A;  5DPJ A;  3IP2 A;  4R2P A;  2EMC A;  2WBS A;  1F2I G;  2PXS A;  4ORN A;  2R76 A;  4W69 A;  2ZM6 E;  4HEI A;  2DUE A;  2LTR A;  3EPL A;  2LV2 A;  4P76 A;  1QXT A;  2AWM A;  2JAD A;  5FVI A;  1KYP A;  2QLI A;  4JI5 E;  2LO3 A;  4IK9 A;  2V87 A;  4JGE A;  3SST A;  2WIS A;  4I8O A;  4R6D A;  2H36 X;  4W7F A;  4IK5 A;  2J7J A;  5H89 A;  5DRF A;  2YTP A;  4W6D A;  4Q7U A;  4W7X A;  3PJB A;  4Z4K A;  2N3G A;  1A1G A;  5DY6 A;  4OHS A;  5LL6 R;  4M30 A;  1YZW A;  4H48 A;  4KW4 A;  3SVC A;  4LFC E;  3ST0 A;  2H8Q A;  5HZU A;  1Z1Q A;  4IK1 A;  3I19 A;  2EMI A;  2MKD A;  3VYY A;  4F6N A;  1I94 E;  3ADL A;  2JYA A;  5HBD A;  3ZUJ A;  2EE8 A;  2VVH A;  2VRD A;  4DKK A;  1YUJ A;  4IK8 A;  4PPL A;  3OTO E;  4DV0 E;  4W75 A;  2RH7 A;  2EN2 A;  2P4M A;  2V4E B;  1WJP A;  3ADF A;  2OTB A;  5BTT B;  4ZF5 A;  4W76 A;  2EPX A;  1XA9 A;  2IHR 1;  1RM9 A;  1MGT A;  1ZUX A;  4JI7 E;  2OKY A;  2Q8U A;  2JXP A;  1Q73 A;  2B3P A;  4W6B A;  1ZGQ A;  2H5R A;  2YE0 A;  1HR0 E;  1J26 A;  2FL1 A;  5LMU E;  2HRS A;  4DXN A;  1YFH A;  5DNY A;  4RTC A;  1GL4 A;  3SVD A;  2RQL A;  1N34 E;  2WSN A;  4W6L A;  4F6M A;  2G16 B;  4H3N A;  2EPL X;  5AE1 A;  2G3D B;  1STU A;  4ZIO A;  2GX2 A;  4DMI A;  2DUH A;  3U8C A;  3E5T A;  4ANJ A;  3H09 A;  2UUA E; 
#chains in the Genus database with same CATH homology
 5DU0 A;  2EQ0 A;  4R6B A;  3EKJ A;  2H5O A;  3NEZ A;  3MHS C;  2ENC A;  4KGE A;  2DD9 A;  2DLQ A;  4W6K A;  2QLE A;  2IOV A;  1JK1 A;  3A8S A;  5DPI A;  5EB6 A;  3LSA A;  3DQ8 A;  4Q7T A;  2EOM A;  1EML A;  1TN9 A;  3CD1 A;  4IK4 A;  1MYW A;  2QLH A;  2EQ3 A;  2M9A A;  2IB6 A;  2EPC A;  1BBO A;  1BB8 A;  1YHH A;  1RMD A;  3W1D A;  2ADR A;  3UFZ A;  1XMZ A;  2EM5 A;  4W6O A;  2WSO A;  2Z6Z A;  4W6M A;  3SG7 A;  2EMD A;  2O29 A;  4J88 A;  2DUF A;  2HGD A;  4LJB A;  4W6H A;  2EQ1 A;  2ZMU A;  3DQH A;  2YE1 A;  3TMR A;  2EPU A;  4HQ8 A;  2EN1 A;  2B3Q A;  2EMZ A;  2GHF A;  2G5Z B;  3CD9 A;  4DXQ A;  3EVP A;  4LJD C;  2YTQ A;  4IS1 C;  2DRP A;  4J8A A;  3VIC A;  3DQ1 A;  3DQ6 A;  1KYR A;  2VZX A;  2Q57 A;  3CFF A;  5DQM A;  2YSP A;  2Z6Y A;  2EM3 A;  2EMA A;  4P1Q A;  2VVI A;  1UIS A;  1YFP A;  2G3O A;  2V4E C;  2EM6 A;  4F2J C;  1YUI A;  3IR8 A;  2EL5 A;  4ZF3 A;  4W6C A;  3DQO A;  4GES B;  5T3I A;  1H4U A;  3AI4 A;  5EJU A;  2YTF A;  1YSA C;  5H88 A;  4W6N A;  5BT0 A;  1KYS A;  3LS3 A;  3SG4 A;  4KGF A;  2AWL A;  1YJ2 A;  1HUY A;  2YU5 A;  4JC2 A;  2HQK A;  2EP3 A;  3EVU A;  4N3D A;  4DXO A;  4EDS A;  5LTQ A;  2C9J A;  1JBZ A;  4B30 A;  2VAD A;  4W6S A;  2A47 A;  1X6H A;  3MHH C;  4W6A A;  3ST3 A;  1DGC A;  2QLG B;  4L12 A;  3LF4 B;  2BB8 A;  2JPA A;  2LCE A;  2EPP A;  3CB9 A;  2EMO A;  1UBD C;  2ENH A;  3CFH A;  4HQ9 A;  4GZN C;  5AQB B;  3W1C A;  3ED8 A;  2DDD A;  3H1O A;  4ZF4 A;  1A1G A;  4H47 A;  4W73 A;  1YHG A;  2QZ0 A;  3P8U A;  3DQK A;  5DTL A;  2EOJ A;  3WCK A;  2YRH A;  3ST2 A;  4R2E A;  4R2Q A;  3ZUL A;  1G7K A;  2RSI A;  2A54 B;  3GL4 A;  1GFL A;  2EN6 A;  1EMK A;  2IE2 A;  3DQN A;  3GJ2 A;  1JC1 A;  1ZGO A;  2EMX A;  3K1K A;  1EMB A;  2G6X A;  4BDU A;  4JFG A;  1A1K A;  2EOE A;  3GEX A;  4LJC A;  1Q4E A;  4DXI A;  1X3C A;  2POX A;  4L13 A;  2EJ4 A;  2CT1 A;  5DRG A;  4OGS A;  3EKH A;  1G2F C;  2EOX A;  2A53 B;  2OJK A;  1UN6 B;  4HQC A;  4W6G A;  1S6Z A;  2A25 A;  5EXU A;  2WCC 3;  2YDZ A;  2CSH A;  3NT3 A;  4L1I A;  2FZU A;  2EML A;  4LQU A;  2EM9 A;  3DQU A;  3VHT A;  2CTD A;  5DPH A;  2R1F A;  2YRK A;  2EM8 A;  3SG3 A;  5LK4 A;  2EOR A;  3PJ5 A;  2EMN A;  3EPH A;  4HE4 A;  5FVF A;  3PIB A;  2PXW A;  4KF5 A;  2EOS A;  3GJ1 A;  1GGX A;  3VK1 A;  3LVC A;  3SSV A;  2EOY A;  3DQ4 A;  4OQW A;  3O78 A;  2ELZ A;  2EM0 A;  1MOV A;  3NT9 A;  3NF0 A;  4NWS A;  4AS8 A;  1JBY A;  3SVS A;  3DQ3 A;  2EOH A;  3G9A A;  2EOI A;  3E5W A;  1F09 A;  3LA1 A;  1W7T A;  4W6U A;  2YFP A;  2LT7 A;  4U2V A;  4IK3 A;  4AR7 A;  2HGH A;  5BQL A;  4JF9 A;  3RWA A;  2A46 A;  1QYF A;  2AWK A;  5KL3 A;  4EUL A;  2QRF A;  3SRY A;  3U0M A;  4W6I A;  2EM4 A;  5DTZ A;  2WUR A;  2DMI A;  3DPZ A;  3SG5 A;  3OSR A;  1P47 A;  1A1J A;  2G6E A;  3SVB A;  2ELY A;  4W7R A;  3E5V A;  5KL5 A;  4R2R A;  1EMA A;  1OXF A;  2DDC A;  2GW4 B;  1RRX A;  1B69 A;  1YJF A;  2D9H A;  2ICR A;  3OGO A;  2O2B A;  2HCG A;  5EB7 A;  4DKM A;  4IJD A;  1RMP A;  5H87 A;  2ENA A;  2H9W A;  2Y0G A;  2EOZ A;  4WSG A;  4OY4 A;  4XVP A;  4KAG A;  4RYS A;  3SVE A;  5KL2 A;  4PPK A;  1X6F A;  2EMH A;  3CBE A;  2YTE A;  3U8A A;  4KPI A;  3DPW A;  1C4F A;  1NCS A;  4W74 A;  2VVJ A;  2O24 A;  2A48 A;  4XL5 A;  1Q4A A;  4GOB A;  4Q9W A;  4LQT A;  4TZG A;  2HPW A;  5LTP A;  4PFE A;  2EMG A;  2BTJ A;  4R2A A;  2QT2 A;  2G2S B;  4R2C A;  4HVF A;  1X6E A;  2YTO A;  1A1F A;  1JC0 A;  2AHA A;  1KP5 A;  2ZMW A;  4W7C A;  2HFC A;  2ARL A;  1A1L A;  2Q6P A;  3DQL A;  5DPG A;  3ST4 A;  4B30 B;  2AWJ A;  2EM2 A;  4W6P A;  5LTR A;  3M22 A;  2HGY A;  1Q4B A;  3EK8 A;  3SSL A;  2RPC A;  3MGF A;  3SV5 A;  3U0K A;  1G2D C;  2OKW A;  2YTN A;  3DQ7 A;  3EVR A;  3V3D A;  2EL4 A;  1YHI A;  2DD7 A;  3LF3 A;  1X5W A;  3GB3 A;  2HJO A;  3P28 A;  3WLC A;  1OXE A;  1OXD A;  3DQI A;  1A1H A;  3SVR A;  4H3M A;  2YU8 A;  1H6R A;  1TF3 A;  4LJD A;  4TZA A;  3U0L A;  2G6Y A;  5KTG A;  4UTS A;  4EDO A;  2IB5 A;  4ZIN A;  5EHU A;  4X9J A;  3DQJ A;  2VAE A;  2Z6X A;  2V4E A;  4W6J A;  2WBT A;  1Z1P A;  2A50 B;  3SSK A;  5BTT A;  1ZR9 A;  2OGR A;  2AH8 A;  5FVG A;  3EK4 A;  3AKO A;  1XAE A;  1W7U A;  3BXB A;  1KJK A;  2EMB A;  3LVA A;  2GX0 A;  5EBJ A;  4ZFS A;  2EL6 A;  3DQ2 A;  1XSS A;  4DKN A;  3EK7 A;  3U8P A;  3VHT B;  3DQC A;  3DQ5 A;  3O77 A;  3EPJ A;  1LLM C;  3NED A;  5KL4 A;  4B5Y A;  5HZT A;  4J89 A;  2EOQ A;  1B9C A;  2ZO7 A;  5HW9 A;  2LVH A;  3EPK A;  2DGC A;  5EXC I;  4Q7R A;  3SVU A;  1QYQ A;  3M24 A;  2GW3 A;  1TF6 A;  2JP9 A;  1QY3 A;  5DTY A;  2EOO A;  4R2S A;  3DQA A;  3SSY A;  3DQD A;  5DQB A;  2EPZ A;  3U0N A;  1Q4C A;  2A52 B;  3DPX A;  4I2Y A;  4KEX A;  2QU1 A;  4W7E A;  4XOV A;  2EN7 A;  5KL7 A;  2HQZ A;  2EPR A;  5KL6 A;  3AI5 A;  4W7A A;  4EN1 A;  4R2D A;  5J2O A;  3OSQ A;  4XGY A;  3ZTF A;  4W6F A;  2YTI A;  3LVD A;  4GF6 B;  1XQM A;  4KW9 A;  3SG6 A;  5EXB A;  1EME A;  3SVO A;  3BXA A;  2YSO A;  2E72 A;  2H5Q A;  3DQM A;  5HZS A;  1A1I A;  2YTD A;  4OJ0 A;  4W72 A;  4W6R A;  1RMM A;  4XOW A;  1MOU A;  5HGE A;  2GLI A;  1EMM A;  1AAY A;  3DQE A;  3SS0 A;  3UG0 A;  2MKN A;  1Q4D A;  4KW8 A;  2OTE A;  2EM7 A;  2EOF A;  1HCJ A;  2WHT A;  1EMF A;  4DXP A;  2EPA A;  2EN4 A;  2MDG A;  3M99 B;  4H3L A;  2FWQ A;  3EVV A;  2DUI A;  3KCS A;  4Q9X A;  1QYO A;  2H6V A;  2C9I A;  1ZU1 A;  2YTJ A;  4Z4M A;  1CV7 A;  5F9G A;  4FK5 C;  4M9V C;  3S05 A;  2DUG A;  1EMG A;  2EN3 A;  2A56 B;  3DQ9 A;  4RYW A;  1ZGP A;  4W6T A;  4JRB A;  2I13 A;  5FHV A;  4DXM A;  1F0B A;  4EMQ A;  2NAB A;  1EMC A;  1BFP A;  2EN8 A;  1Z1B A;  2EMK A;  1W7S A;  4JEO A;  2WHS A;  2EMY A;  2PRT A;  2WBU A;  4ZB1 A;  3ZUF A;  3PJ7 A;  3DQF A;  2QLG A;  2EMW A;  1MEY C;  1JK2 A;  3CGL A;  3KCT A;  2H5P A;  3RWT A;  3SVN A;  2DLK A;  4KF5 C;  1ZAA C;  3BXC A;  4ZBL A;  2ZO6 A;  2Z1O A;  1RMO A;  3BX9 A;  4KF4 A;  4LW5 A;  4W7D A;  5DTX A;  3CFA A;  3SSP A;  2WIQ A;  5HZO A;  3H1R A;  2YTG A;  3UK3 C;  4W77 A;  3SG2 A;  2EMF A;  4IZN A;  3SSH A;  4KA9 A;  3WLD A;  2YRM A;  4PPJ A;  3TMT A;  2WHU A;  5DPJ A;  3IP2 A;  4R2P A;  2EMC A;  2WBS A;  1F2I G;  2PXS A;  4ORN A;  4W69 A;  2DUE A;  3EPL A;  2LV2 A;  4P76 A;  1QXT A;  2AWM A;  2JAD A;  5FVI A;  1KYP A;  2QLI A;  2LO3 A;  4IK9 A;  4JGE A;  3SST A;  2WIS A;  4R6D A;  4W7F A;  4IK5 A;  2J7J A;  5H89 A;  5DRF A;  2YTP A;  4W6D A;  4Q7U A;  4W7X A;  3PJB A;  4Z4K A;  5DY6 A;  4OHS A;  1YZW A;  4H48 A;  4KW4 A;  3SVC A;  3ST0 A;  2H8Q A;  5HZU A;  1Z1Q A;  4IK1 A;  3I19 A;  2EMI A;  2MKD A;  4F6N A;  5HBD A;  3ZUJ A;  2EE8 A;  2VVH A;  2VRD A;  1YUJ A;  4IK8 A;  4PPL A;  4W75 A;  2RH7 A;  2EN2 A;  2P4M A;  2V4E B;  1WJP A;  3ADF A;  2OTB A;  5BTT B;  4ZF5 A;  4W76 A;  2EPX A;  1XA9 A;  1RM9 A;  1ZUX A;  2OKY A;  1Q73 A;  2B3P A;  4W6B A;  1ZGQ A;  2H5R A;  2YE0 A;  2FL1 A;  2HRS A;  4DXN A;  4RTC A;  1GL4 A;  3SVD A;  2WSN A;  4W6L A;  4F6M A;  2G16 B;  4H3N A;  2G3D B;  4ZIO A;  2GX2 A;  2DUH A;  3U8C A;  3E5T A;  4ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...