3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein/protein binding
molecule keywords Green fluorescent protein
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
2QLIA 4JRBA 3W1DA 4GESB 2ARLA 4ZBLA 3WCKA 2EQ0A 3RWTA 4W6JA 3I19A 3DQOA 4W6TA 2MDGA 4OGSA 1Q4DA 1ZUXA 3SG7A 1GFLA 2RH7A 4ZIOA 5DTXA 2CTDA 3CFFA 2EMBA 4W6MA 3EVPA 4JF9A 5DU0A 4DXPA 2OTBA 1X3CA 1MOVA 2OJKA 2CSHA 1EMGA 3EVUA 1X6EA 2B3QA 4R2QA 5EXCI 3GB3A 2EQ1A 2I13A 3DQ4A 2EMKA 3M24A 4ZB1A 2IB6A 2R1FA 3ED8A 2GLIA 2YTGA 2A56B 2EMAA 3SVDA 3SSHA 3SSYA 5HZTA 2QT2A 3PIBA 1B9CA 4PFEA 1Q73A 1QYQA 3SSVA 2WSOA 1EMFA 5BT0A 1Q4AA 3DQ8A 2AWMA 2A25A 5J2OA 5LK4A 1YFPA 4OY4A 5BQLA 4H3LA 2EMHA 3LVDA 1YHGA 1F2IG 4KPIA 1EMKA 2DDCA 4Z4MA 5HZOA 2G6XA 3DQKA 5DQBA 2WIQA 4W6SA 1EMAA 2ZMWA 3LF4B 4KW8A 3ST0A 3H1OA 2YTFA 3V3DA 2ENHA 4KGFA 2QLGB 5EBJA 2G2SB 1F0BA 3CD9A 5HBDA 2EOFA 5AQBB 4R2CA 2QLHA 2LO3A 1B69A 2G5ZB 5KL6A 1UN6B 2HGDA 2V4EA 2EPUA 3EK8A 4H48A 3LSAA 3AI4A 1RRXA 3DQFA 2YU8A 2OKYA 2EMYA 4B30A 4GOBA 3EVVA 1MOUA 4XL5A 2VRDA 5BTTB 4L13A 4DXNA 3DQ7A 2HQZA 5DRFA 2WBUA 4N3DA 5DTYA 2EMOA 1Z1BA 2EM5A 3DQDA 4OQWA 2EM6A 2YTDA 1GGXA 2FWQA 3EVRA 2HPWA 4W75A 1QY3A 4EULA 3EKJA 4ZINA 2DLKA 1ZGOA 1YUJA 1ZU1A 2DUEA 3VHTB 1NCSA 2H5RA 2HGYA 3DQCA 3E5TA 1X5WA 4ZF3A 3SG6A 1HUYA 2EMIA 5EXBA 1QYOA 3SVOA 2HFCA 4HVFA 3SVRA 5KL4A 2EPRA 2VVHA 5DPGA 2WBSA 3O77A 4W6IA 5KTGA 2YTQA 2A50B 4H47A 3GJ1A 2EOXA 2LVHA 4LJBA 1XQMA 1Z1PA 2JPAA 4W7CA 4DXMA 3GJ2A 2EM7A 2A52B 3MGFA 2V4EC 2YDZA 3CB9A 4W7RA 4P1QA 1Q4CA 5DPHA 1W7UA 5T3IA 2ICRA 2YE0A 3M22A 2YRKA 3EK7A 2OTEA 4I2YA 4R2EA 1F09A 2QU1A 2Q6PA 3IR8A 4W6AA 3BX9A 3PJBA 4PPLA 3WLCA 4L12A 2EORA 1ZGPA 2Y0GA 3U8PA 4W6HA 3SSLA 2IB5A 4HQ9A 2YE1A 2GW4B 3SSPA 2MKNA 4IK3A 1XSSA 4TZAA 3PJ5A 2DD7A 2EMWA 2EM3A 4R2SA 3NT3A 3BXBA 2HJOA 4OJ0A 1YUIA 2DLQA 2EN4A 1OXFA 2PXSA 4ANJA 2Z6XA 5LTQA 3ST3A 3AKOA 2VVJA 3SVBA 1KYRA 4HE4A 5HZUA 4GF6B 2NABA 2YTIA 5FVIA 5HGEA 1KYSA 4DKMA 3MHSC 4LJDA 4KA9A 3AI5A 2G3OA 3DQNA 3RWAA 4W69A 2YRHA 3UG0A 1RMPA 1ZAAC 4JC2A 2IOVA 3SG5A 4WSGA 3DQLA 2ZO7A 4ZFSA 3SSKA 4W6GA 5DQMA 1C4FA 3NEDA 2MKDA 2QZ0A 2ELYA 2A48A 3H1RA 4KF5A 3ZUFA 3ZULA 3WLDA 2YSPA 3DQHA 1A1GA 4P76A 2WHTA 4W74A 4Q7UA 2EL5A 2EPAA 2A47A 5DPJA 4U2VA 1CV7A 3DQIA 2HQKA 3G9AA 4W6CA 5FVFA 1GL4A 4JGEA 2V4EB 1Q4EA 3A8SA 1RMOA 2OKWA 4RYWA 3M99B 2EPZA 3UFZA 1JK2A 1A1KA 4JEOA 5EXUA 2EOYA 3DQ1A 1JC1A 3SS0A 4W6OA 4B30B 2JADA 3DQAA 2E72A 1HCJA 1YZWA 4EDOA 2EOJA 2BB8A 1YJFA 4HQCA 2YTOA 2EE8A 1OXEA 3DQ5A 2C9IA 2EQ3A 1W7TA 2EPXA 4W76A 3NEZA 2EPPA 2A53B 4PPKA 2O2BA 2ADRA 3EPLA 2LT7A 4XOVA 3SRYA 2EMLA 1MYWA 5DRGA 5H87A 4GZNC 2JP9A 2HGHA 3DQMA 4ZF5A 4LJDC 4R2AA 1EMLA 2GX0A 4IK4A 2EOIA 3DQ3A 2Q57A 3U0LA 2EMGA 2VADA 4W7FA 3LS3A 1MEYC 2DDDA 5DY6A 1KJKA 5HW9A 4IS1C 3EPHA 2EM4A 4EN1A 2WSNA 4H3MA 1A1FA 4IK5A 1EMMA 4Q9WA 1RMDA 4XGYA 3DQJA 4KF5C 2ENAA 4LW5A 4DXQA 2HRSA 3ADFA 3LVCA 1KYPA 2H6VA 4F6NA 2H5QA 3DPXA 2EMXA 3EPJA 3EPKA 2EMFA 3MHHC 2LV2A 4KF4A 2J7JA 2O29A 2G6YA 3KCSA 2EL6A 1YJ2A 3DQ2A 2DD9A 3SVEA 5LTPA 4BDUA 4F6MA 1KP5A 5F9GA 1X6HA 4NWSA 2C9JA 3GL4A 2EMNA 4W6KA 4W6NA 2GX2A 3IP2A 3ZUJA 4KGEA 2Z1OA 1G7KA 4AS8A 1RMMA 1BBOA 2YTPA 2EM2A 1Q4BA 4W6UA 3DQUA 4KW4A 2EN2A 1G2FC 1TN9A 2EOEA 1JBYA 2G6EA 2AWKA 1A1LA 1A1JA 2O24A 5H89A 4TZGA 4L1IA 3K1KA 2GW3A 1TF3A 2ZMUA 3SG3A 4Q7TA 2OGRA 3E5VA 3VICA 1XMZA 5EB6A 2YFPA 2P4MA 2DUGA 2YTNA 2B3PA 2H8QA 1RM9A 4W6RA 4DKNA 3BXCA 5HZSA 4J8AA 3ST2A 1G2DC 2EOOA 3P28A 2AWJA 1QYFA 2G16B 5DPIA 2ENCA 3DPWA 4RTCA 2A46A 4W6PA 4Q9XA 4W7DA 4X9JA 2EMCA 1BFPA 2WISA 2QLEA 2YTJA 2G3DB 3LA1A 2EPCA 3U8AA 3ZTFA 4R2PA 4LJCA 1Z1QA 4B5YA 3TMRA 1S6ZA 3CGLA 2VVIA 4M9VC 2A54B 4ZF4A 2EN1A 4IK1A 2ELZA 4EMQA 2ZO6A 3NT9A 3CD1A 2EM8A 4F2JC 3NF0A 1H6RA 4W6DA 5EJUA 1X6FA 2EP3A 3LVAA 1UISA 3S05A 4UTSA 2YRMA 2YSOA 4W6LA 1JK1A 3PJ7A 2EL4A 4W77A 2H5OA 4Q7RA 3DPZA 5FHVA 4XOWA 5KL3A 2DGCA 3OSQA 2AHAA 3U0KA 1DGCA 2DUHA 4LQUA 4R6DA 1JBZA 1EMCA 1YSAC 3U8CA 2FL1A 4DXIA 2LCEA 1XAEA 3SVNA 3SG4A 3TMTA 2EN8A 5KL7A 2Z6ZA 1A1HA 5H88A 2DUFA 3DQ6A 3EK4A 4R2RA 1BB8A 5DTZA 2WCC3 2DUIA 4XVPA 2EJ4A 2BTJA 3LF3A 4W6BA 1YHIA 4IZNA 4KAGA 2EN6A 2EN3A 4ORNA 4PPJA 2WURA 3DQEA 4W73A 4HQ8A 2YU5A 3CFHA 2WHSA 3EKHA 3DQ9A 2WHUA 2EOSA 1LLMC 4W6FA 1YHHA 2EM9A 2EOQA 4IJDA 2VZXA 3CBEA 2RSIA 5EB7A 4J89A 2IE2A 1ZGQA 2CT1A 1W7SA 1XA9A 2QLGA 3BXAA 2FZUA 3OGOA 2H5PA 3CFAA 5FVGA 3GEXA 4RYSA 5KL2A 2Z6YA 4KEXA 3OSRA 4W7AA 3SG2A 1ZR9A 3W1CA 4R6BA 3KCTA 1OXDA 2GHFA 4LQTA 4R2DA 3SSTA 1TF6A 4Z4KA 2QRFA 2AWLA 3SVCA 2VAEA 2YTEA 2POXA 2HCGA 3SVUA 4W7XA 2EM0A 1EMEA 1QXTA 1H4UA 1WJPA 5BTTA 2WBTA 2EMZA 2M9AA 3ST4A 4EDSA 1AAYA 2EN7A 4W7EA 4AR7A 2RPCA 2EOMA 3UK3C 4IK8A 4IK9A 3U0MA 1P47A 3SV5A 1EMBA 2D9HA 5EHUA 3U0NA 1UBDC 2AH8A 4OHSA 4FK5C 5DTLA 3VHTA 5KL5A 3SVSA 4W72A 4J88A 3O78A 2DRPA 2EMDA 1JC0A 4DXOA 5LTRA 2EOZA 2H9WA 3P8UA 4KW9A 3E5WA 2PRTA 1A1IA 3VK1A 4H3NA 4JFGA 2PXWA 2EOHA 2DMIA
chains in the Genus database with same CATH superfamily
2QLIA 4HEIA 4WSPA 4JRBA 3W1DA 2EPNA 4GESB 3BF2A 5AASA 2ARLA 2JVAA 4ZBLA 4DUZE 3WCKA 2EQ0A 3RWTA 3HXLA 4W6JA 1IQSA 3OMLA 2ODRD 3I19A 3DQOA 4W6TA 2MDGA 4WX9A 4OGSA 4NXNE 4DR1E 1Q4DA 1ZUXA 1QNTA 2RQLA 2JY9A 3SG7A 1GFLA 2RH7A 4ZIOA 1YFHA 5DTXA 2CTDA 2JOBA 3CFFA 2EMBA 4DV6E 4W6MA 2I9IA 3EVPA 4JF9A 2M1SA 5DU0A 4DXPA 2OTBA 4BCAA 4DV2E 1X3CA 1MOVA 2OJKA 3KZZA 2CSHA 4JI0E 2JWOA 1EMGA 2EPMX 3EVUA 1X6EA 2B3QA 4R2QA 5EXCI 3GB3A 3THNA 2EQ1A 2I13A 3DQ4A 1T4OA 4GKKE 2EMKA 3M24A 2EPOA 2V89A 3VK6A 4ZB1A 1IMUA 2IB6A 1X47A 2R1FA 3BGHA 3ED8A 2GLIA 2YTGA 2A56B 1UHZA 2EMAA 3SVDA 3SSHA 3SSYA 4LTYA 5HZTA 2QT2A 3PIBA 1B9CA 4PFEA 3DF6A 1IBKE 2FGGA 5CFFE 1Q73A 1QYQA 3K6QA 3SSVA 2WSOA 1EMFA 5BT0A 1T4LB 4O5GA 1Q4AA 3DQ8A 2AWMA 4O4KA 5A69A 2A25A 5J2OA 2JXPA 5LK4A 4WPYA 1YFPA 4F9BB 4OY4A 2V87A 5BQLA 2VQFE 4LU9A 4H3LA 2EMHA 2IHR1 3LVDA 1YHGA 3ZOQB 1F2IG 4KPIA 2KOUA 1EMKA 2DDCA 4Z4MA 3F6HA 2LBSB 5HZOA 2G6XA 1DQ3A 3DQKA 4B3ME 5DQBA 2WIQA 4W6SA 1EMAA 2ZMWA 3LF4B 1PJTA 4R03A 5IXMB 4KW8A 4B3RE 3ST0A 3H1OA 4O24A 2N8XA 2YTFA 3V3DA 1ZBTA 2ENHA 2FV4B 4KGFA 2YPNA 2QLGB 1WXRA 5EBJA 1PJSA 2G2SB 1F0BA 3CD9A 5HBDA 2RS7A 2EOFA 2V83A 5AQBB 4R2CA 2QLHA 2LO3A 1B69A 2G5ZB 5KL6A 1UN6B 2HGDA 2V4EA 1N3GA 2EPUA 2EWLA 5A6KA 3EK8A 4H48A 3LSAA 3AI4A 4JV5E 1RRXA 3DQFA 2YU8A 5IV8B 2OKYA 1RQ0A 2EMYA 4B30A 4R8OA 4GOBA 3HQ1A 3EVVA 1XMQE 1MOUA 4XL5A 2DSYA 2VRDA 5BTTB 4L13A 4DV3E 4DXNA 1WRJA 4M2ZA 1EH6A 3DQ7A 1PKPA 2HQZA 5DRFA 2WBUA 1GTKA 3IWBA 1YYWA 4N3DA 4BS9A 5DTYA 2EMOA 1IQOA 1Z1BA 4JI4E 2EM5A 3DQDA 4N4RB 2UUCE 4OQWA 2EM6A 2YTDA 2KONA 1GGXA 2FWQA 3EVRA 2HPWA 4W75A 1QY3A 4EULA 3EKJA 4ZINA 1UILA 1X49A 2DLKA 4F9AB 1ZGOA 1YUJA 3H09A 4P7DA 1ZU1A 4ZYEA 2DUEA 3ADJA 3VHTB 1NCSA 2FTXB 2LUPB 4M30A 2H5RA 2HGYA 3DQCA 3E5TA 1X5WA 4ZF3A 3SG6A 1HUYA 1XNRE 2EMIA 5EXBA 3EQ1A 4NZVA 1QYOA 3SVOA 2HFCA 4HVFA 3SVRA 5KL4A 2EPRA 2VVHA 5DPGA 1MGTA 2WBSA 3O77A 4W6IA 5KTGA 5TSEA 2YTQA 2A50B 5A6BD 4H47A 3GJ1A 4WXDA 2EOXA 2LVHA 4LJBA 3VYYA 4LF7E 1XQMA 1Z1PA 2JPAA 4W7CA 4DXMA 4WYQB 3GJ2A 2EM7A 2A52B 3MGFA 4DR4E 2V4EC 2YDZA 3CB9A 4W7RA 2L2NA 4P1QA 1O0WA 1Q4CA 5DPHA 2CPNA 1W7UA 2LUQA 5T3IA 4KZSA 2ICRA 2YE0A 3M22A 2YRKA 3EK7A 2OTEA 4I2YA 4R2EA 1F09A 2QU1A 2Q6PA 3IWDA 1KYQA 3IR8A 4W6AA 2VE7C 3BX9A 3PJBA 4PPLA 3WLCA 4HTGA 4NHRA 4L12A 2EORA 1ZGPA 2Y0GA 4JI7E 3JAMC 2H36X 3U8PA 1N34E 4W6HA 3SSLA 2IB5A 3J80C 4HQ9A 2LJHA 2YE1A 2UUAE 5AE2A 2GW4B 3SSPA 2MKNA 4IK3A 1XSSA 4TZAA 3MSWA 3PJ5A 2DD7A 1YPNA 2EMWA 2EM3A 4R2SA 3NT3A 3BXBA 2HJOA 4OJ0A 4YY3E 1YUIA 2DLQA 3IWCA 2EN4A 1T38A 1OXFA 2PXSA 4ANJA 2Z6XA 5LTQA 3ST3A 3AKOA 2VVJA 4TUGA 4BHCA 1RC7A 4LF8E 3SVBA 1KYRA 4HE4A 2L33A 5HZUA 4GF6B 2NABA 2YTIA 3F6GA 5A6JA 5FVIA 5HGEA 2B7VA 5IWAE 4DV0E 1KYSA 4DKMA 3MHSC 4LJDA 4KA9A 3AI5A 2G3OA 3DQNA 3RWAA 1I94E 4W69A 2YRHA 2KHXA 3UG0A 1RMPA 1ZAAC 4JC2A 2IOVA 4DR2E 3SG5A 3HPZA 4WSGA 3DQLA 4F9CB 2ZO7A 4ZFSA 3SSKA 4W6GA 5DQMA 1C4FA 3NEDA 2MKDA 3C4BA 2QZ0A 2ELYA 2EZ6A 3JU0A 3T1YE 2A48A 3H1RA 4KF5A 3ZUFA 3ZULA 2GPIA 3WLDA 2ODRC 4P78A 3ADIA 3J7AG 2YSPA 4BC7A 3DQHA 1A1GA 4P76A 2WHTA 4W74A 4Q7UA 1SR9A 2EL5A 2EPAA 2V85A 2A47A 5DPJA 4K0KE 4LFCE 4U2VA 4RH8A 3J7Yp 1CV7A 2UXBE 2HHHE 3DQIA 2DIXA 2HQKA 3G9AA 4W6CA 5FVFA 1GL4A 4LF5E 4JGEA 2V4EB 1Q4EA 3A8SA 2HC5A 1RMOA 2OKWA 4RYWA 3M99B 2EPZA 4L5NC 2M7QA 3UFZA 1JK2A 1A1KA 2L92A 4JEOA 5EXUA 2EOYA 3DQ1A 1JC1A 3SS0A 4W6OA 4B30B 2YT4A 4F54A 4X62E 2JADA 3DQAA 2NA2A 2E72A 1J26A 1HCJA 1YZWA 4EDOA 2EOJA 2BB8A 1FKAE 1YJFA 4HQCA 2YTOA 2UXDE 2EE8A 5AC5A 1OXEA 3AUZA 3DQ5A 2C9IA 2EQ3A 1W7TA 2EPXA 1YYOA 4W76A 3NEZA 2EPPA 2A53B 3C4TA 4PPKA 2O2BA 2ADRA 2VF1A 5AE3A 4LF9E 2HJJA 3EPLA 2LT7A 4XOVA 3SRYA 2L8TA 2NUGA 2EMLA 4DR6E 2DMYA 1MYWA 5DRGA 5H87A 4GZNC 1PJQA 4X64E 2JP9A 2HGHA 3DQMA 4ZF5A 4LJDC 4R2AA 1EMLA 2GX0A 4IK4A 2EOIA 2RS6A 3DQ3A 2Q57A 3U0LA 2EMGA 2VADA 2LJUA 4W7FA 3LS3A 2MDRA 2DDDA 5DY6A 3AV0A 1MEYC 1KJKA 4O43A 5HW9A 4IS1C 2MC5A 4MLQA 3EPHA 2EM4A 2JOXA 4EN1A 4DV1E 1HNWE 2WSNA 4H3MA 1A1FA 4IK5A 1EMMA 4Q9WA 5IT9C 3ADLA 3KWRA 1RMDA 4XGYA 3DQJA 4KF5C 2ENAA 4LW5A 4DXQA 2HRSA 4LFBE 5A6BA 4LF6E 3ADFA 3LVCA 4OOGC 1KYPA 2H6VA 4F6NA 1AH5A 2H5QA 3DPXA 1ZBQA 2EMXA 2EPLX 2EMFA 2V8QB 3EPJA 3EPKA 3HTXA 1L4SA 3MHHC 2LV2A 2WZOA 4KF4A 2J7JA 2L3CA 2O29A 1T39A 2NUFA 2JR1A 2G6YA 3KCSA 2EL6A 1YJ2A 3DQ2A 4BBYA 4AQYE 4JI3E 4NXME 2DD9A 3SVEA 5LTPA 1HNXE 4Q28A 4DR7E 4BDUA 4F6MA 2LE2A 1KP5A 3DJWA 5F9GA 1X6HA 3BBGA 2L3JA 4NWSA 4DKKA 2C9JA 2VQEE 3GL4A 2EMNA 2N3GA 4W6KA 4W6NA 2GX2A 1GZ6A 3JTZA 4JI1E 3IP2A 3ZUJA 4KGEA 2Z1OA 2LTRA 2UUBE 1G7KA 1QU6A 3C6MA 4I8OA 4AS8A 1RMMA 1BBOA 3KZYA 5AC4A 2YTPA 2EM2A 1Q4BA 3LLHA 4W6UA 4TUIA 3DQUA 4KW4A 2EN2A 1G2FC 1TN9A 1PDAA 2EOEA 1N32E 1JBYA 3FIGA 2G6EA 2JYAA 2AWKA 2YZTA 1A1LA 4X66E 2O24A 5H89A 1A1JA 2N3HA 4TZGA 4L1IA 3K1KA 2GW3A 2B9DA 2V88A 1TF3A 4JI2E 4KHPE 2ZMUA 3SG3A 4BHBA 4Q7TA 2OGRA 3E5VA 3VICA 1XMZA 5EB6A 5BR8E 2YFPA 2P4MA 2DUGA 2YTNA 4MLVA 1IBLE 2B3PA 2H8QA 1RM9A 5DNYA 4W6RA 4DKNA 3BXCA 5AE1A 5HZSA 4J8AA 1HR0E 3ST2A 1G2DC 2EOOA 3P28A 2AWJA 2V86A 1QYFA 1EKZA 2RSMA 2G16B 2L2KB 5DPIA 2ENCA 3DPWA 4RTCA 2A46A 4W6PA 1FJGE 4Q9XA 4W7DA 4X9JA 2EMCA 1BFPA 2WISA 2QLEA 3L00A 2YTJA 2G3DB 2EPKX 3LA1A 2EPCA 1WHQA 1XMOE 3U8AA 3ZTFA 4R2PA 4LJCA 1Z1QA 4B5YA 2L6MA 3TMRA 4B3TE 1S6ZA 3CGLA 2VVIA 2MC6A 3RMPA 2LTSA 4DV4E 4JI5E 1EH8A 2A54B 4ZF4A 2EN1A 4IK1A 5T6JA 2ELZA 4M9VC 4EMQA 2ZO6A 3NT9A 1HNZE 3CD1A 4LFAE 2EM8A 4F2JC 4OX9E 3NF0A 2K7IA 1H6RA 4W6DA 5EJUA 1X6FA 2EP3A 2Q8UA 4DUYE 3LVAA 1UISA 1N36E 3S05A 4UTSA 2E5LE 2YRMA 1YZ9A 2YSOA 4W6LA 3T1HE 3PJ7A 2EL4A 1JK1A 4B3SE 4W77A 3VYXA 2H5OA 4Q7RA 2RTXA 3DPZA 5FHVA 2B3TB 4XOWA 5KL3A 4BMJA 1WHNA 2DGCA 3OSQA 2AHAA 2UXCE 5LMUE 3LMLA 3U0KA 4GEQB 1DGCA 2DUHA 4WFTA 4LQUA 4R6DA 1JBZA 1EMCA 1GQEA 2DB2A 1YSAC 3U8CA 2F8BA 2LRSA 2FL1A 4DXIA 4JYAE 2LCEA 2ZM6E 1XAEA 3SVNA 3SG4A 3TMTA 3J81C 2EN8A 5KL7A 2Z6ZA 1A1HA 5H88A 2DUFA 4J8ZA 1YYKA 3DQ6A 3EK4A 4R2RA 4DR5E 1BB8A 5DTZA 2WCC3 2DUIA 4XVPA 1X48A 3THOB 5LMNE 5FLXC 2EJ4A 2BTJA 4DR3E 3LF3A 4W6BA 1YHIA 4IZNA 4KAGA 1STUA 2EN6A 2UU9E 2EN3A 4ORNA 4PPJA 2WURA 3DQEA 4W73A 4HQ8A 2YU5A 3OTOE 4LF4E 3CFHA 4GKJE 1NEIA 2WHSA 3ADGA 1EH7A 3EKHA 3C6KA 3DQ9A 2WHUA 2EOSA 1LLMC 1IBME 4W6FA 1YHHA 2B7TA 2EM9A 4L8NA 2EOQA 4IJDA 2VZXA 4BC9A 4JI8E 1SFEA 3QG5C 2LMZA 3CBEA 2RSIA 5EB7A 4J89A 3ECRA 5LL6R 2IE2A 4KWYA 1ZGQA 2CT1A 5ADZA 1W7SA 1XA9A 2QLGA 3BXAA 2FZUA 2L2MA 5A6AA 3OGOA 4RHBB 2NUEA 2H5PA 3CFAA 4JI6E 5FVGA 3GEXA 4RYSA 5KL2A 2Z6YA 4KEXA 3OSRA 4W7AA 3SG2A 1ZR9A 3P1XA 2F4VE 1BBGA 3W1CA 2K4VA 4R6BA 3KCTA 1OXDA 2GHFA 4LQTA 4R2DA 1XNQE 3SSTA 4WXCA 1TF6A 1T4NA 4Z4KA 2QRFA 2AWLA 3SVCA 2VAEA 2YTEA 2POXA 2HCGA 3SVUA 4W7XA 2EM0A 1EMEA 1QXTA 1H4UA 1WJPA 5BTTA 2WBTA 2EMZA 2M9AA 2G7HA 3ST4A 4EDSA 1DI2A 4DV7E 1AAYA 4ZYDA 2EN7A 4Q35B 2E1MA 4W7EA 4AR7A 2RPCA 2EOMA 3UK3C 5LLQA 4IK8A 4IK9A 3U0MA 2M4IA 1J5EE 4M0VA 1P47A 3SV5A 1EMBA 2D9HA 5EHUA 3U0NA 1UBDC 1N33E 4DMIA 2AH8A 4X65E 4OHSA 4FK5C 5DTLA 3VHTA 5KL5A 2YWQA 3SVSA 3BIDA 4X8WA 5A2QC 4W72A 4YHHE 4DV5E 4J88A 3O78A 2DRPA 2EMDA 1JC0A 4DXOA 5LTRA 2EOZA 2R76A 2H9WA 4ZYGA 3P8UA 5F3WA 4KW9A 3E5WA 2BBGA 3HPSA 4ZYHA 3TQMA 2PRTA 1A1IA 3VK1A 4H3NA 4JFGA 2PXWA 2EOHA 2DMIA
chains in the Genus database with same CATH topology
2QLIA 4JRBA 3W1DA 4GESB 2ARLA 4ZBLA 3WCKA 2EQ0A 3RWTA 4W6JA 3I19A 3DQOA 4W6TA 2MDGA 4OGSA 1Q4DA 1ZUXA 3SG7A 1GFLA 2RH7A 4ZIOA 5DTXA 2CTDA 3CFFA 2EMBA 4W6MA 3EVPA 4JF9A 5DU0A 4DXPA 2OTBA 1X3CA 1MOVA 2OJKA 2CSHA 1EMGA 3EVUA 1X6EA 2B3QA 4R2QA 5EXCI 3GB3A 2EQ1A 2I13A 3DQ4A 2EMKA 3M24A 4ZB1A 2IB6A 2R1FA 3ED8A 2GLIA 2YTGA 2A56B 2EMAA 3SVDA 3SSHA 3SSYA 5HZTA 2QT2A 3PIBA 1B9CA 4PFEA 1Q73A 1QYQA 3SSVA 2WSOA 1EMFA 5BT0A 1Q4AA 3DQ8A 2AWMA 2A25A 5J2OA 5LK4A 1YFPA 4OY4A 5BQLA 4H3LA 2EMHA 3LVDA 1YHGA 1F2IG 4KPIA 1EMKA 2DDCA 4Z4MA 5HZOA 2G6XA 3DQKA 5DQBA 2WIQA 4W6SA 1EMAA 2ZMWA 3LF4B 4KW8A 3ST0A 3H1OA 2YTFA 3V3DA 2ENHA 4KGFA 2QLGB 5EBJA 2G2SB 1F0BA 3CD9A 5HBDA 2EOFA 5AQBB 4R2CA 2QLHA 2LO3A 1B69A 2G5ZB 5KL6A 1UN6B 2HGDA 2V4EA 2EPUA 3EK8A 4H48A 3LSAA 3AI4A 1RRXA 3DQFA 2YU8A 2OKYA 2EMYA 4B30A 4GOBA 3EVVA 1MOUA 4XL5A 2VRDA 5BTTB 4L13A 4DXNA 3DQ7A 2HQZA 5DRFA 2WBUA 4N3DA 5DTYA 2EMOA 1Z1BA 2EM5A 3DQDA 4OQWA 2EM6A 2YTDA 1GGXA 2FWQA 3EVRA 2HPWA 4W75A 1QY3A 4EULA 3EKJA 4ZINA 2DLKA 1ZGOA 1YUJA 1ZU1A 2DUEA 3VHTB 1NCSA 2H5RA 2HGYA 3DQCA 3E5TA 1X5WA 4ZF3A 3SG6A 1HUYA 2EMIA 5EXBA 1QYOA 3SVOA 2HFCA 4HVFA 3SVRA 5KL4A 2EPRA 2VVHA 5DPGA 2WBSA 3O77A 4W6IA 5KTGA 2YTQA 2A50B 4H47A 3GJ1A 2EOXA 2LVHA 4LJBA 1XQMA 1Z1PA 2JPAA 4W7CA 4DXMA 3GJ2A 2EM7A 2A52B 3MGFA 2V4EC 2YDZA 3CB9A 4W7RA 4P1QA 1Q4CA 5DPHA 1W7UA 5T3IA 2ICRA 2YE0A 3M22A 2YRKA 3EK7A 2OTEA 4I2YA 4R2EA 1F09A 2QU1A 2Q6PA 3IR8A 4W6AA 3BX9A 3PJBA 4PPLA 3WLCA 4L12A 2EORA 1ZGPA 2Y0GA 3U8PA 4W6HA 3SSLA 2IB5A 4HQ9A 2YE1A 2GW4B 3SSPA 2MKNA 4IK3A 1XSSA 4TZAA 3PJ5A 2DD7A 2EMWA 2EM3A 4R2SA 3NT3A 3BXBA 2HJOA 4OJ0A 1YUIA 2DLQA 2EN4A 1OXFA 2PXSA 4ANJA 2Z6XA 5LTQA 3ST3A 3AKOA 2VVJA 3SVBA 1KYRA 4HE4A 5HZUA 4GF6B 2NABA 2YTIA 5FVIA 5HGEA 1KYSA 4DKMA 3MHSC 4LJDA 4KA9A 3AI5A 2G3OA 3DQNA 3RWAA 4W69A 2YRHA 3UG0A 1RMPA 1ZAAC 4JC2A 2IOVA 3SG5A 4WSGA 3DQLA 2ZO7A 4ZFSA 3SSKA 4W6GA 5DQMA 1C4FA 3NEDA 2MKDA 2QZ0A 2ELYA 2A48A 3H1RA 4KF5A 3ZUFA 3ZULA 3WLDA 2YSPA 3DQHA 1A1GA 4P76A 2WHTA 4W74A 4Q7UA 2EL5A 2EPAA 2A47A 5DPJA 4U2VA 1CV7A 3DQIA 2HQKA 3G9AA 4W6CA 5FVFA 1GL4A 4JGEA 2V4EB 1Q4EA 3A8SA 1RMOA 2OKWA 4RYWA 3M99B 2EPZA 3UFZA 1JK2A 1A1KA 4JEOA 5EXUA 2EOYA 3DQ1A 1JC1A 3SS0A 4W6OA 4B30B 2JADA 3DQAA 2E72A 1HCJA 1YZWA 4EDOA 2EOJA 2BB8A 1YJFA 4HQCA 2YTOA 2EE8A 1OXEA 3DQ5A 2C9IA 2EQ3A 1W7TA 2EPXA 4W76A 3NEZA 2EPPA 2A53B 4PPKA 2O2BA 2ADRA 3EPLA 2LT7A 4XOVA 3SRYA 2EMLA 1MYWA 5DRGA 5H87A 4GZNC 2JP9A 2HGHA 3DQMA 4ZF5A 4LJDC 4R2AA 1EMLA 2GX0A 4IK4A 2EOIA 3DQ3A 2Q57A 3U0LA 2EMGA 2VADA 4W7FA 3LS3A 1MEYC 2DDDA 5DY6A 1KJKA 5HW9A 4IS1C 3EPHA 2EM4A 4EN1A 2WSNA 4H3MA 1A1FA 4IK5A 1EMMA 4Q9WA 1RMDA 4XGYA 3DQJA 4KF5C 2ENAA 4LW5A 4DXQA 2HRSA 3ADFA 3LVCA 1KYPA 2H6VA 4F6NA 2H5QA 3DPXA 2EMXA 3EPJA 3EPKA 2EMFA 3MHHC 2LV2A 4KF4A 2J7JA 2O29A 2G6YA 3KCSA 2EL6A 1YJ2A 3DQ2A 2DD9A 3SVEA 5LTPA 4BDUA 4F6MA 1KP5A 5F9GA 1X6HA 4NWSA 2C9JA 3GL4A 2EMNA 4W6KA 4W6NA 2GX2A 3IP2A 3ZUJA 4KGEA 2Z1OA 1G7KA 4AS8A 1RMMA 1BBOA 2YTPA 2EM2A 1Q4BA 4W6UA 3DQUA 4KW4A 2EN2A 1G2FC 1TN9A 2EOEA 1JBYA 2G6EA 2AWKA 1A1LA 1A1JA 2O24A 5H89A 4TZGA 4L1IA 3K1KA 2GW3A 1TF3A 2ZMUA 3SG3A 4Q7TA 2OGRA 3E5VA 3VICA 1XMZA 5EB6A 2YFPA 2P4MA 2DUGA 2YTNA 2B3PA 2H8QA 1RM9A 4W6RA 4DKNA 3BXCA 5HZSA 4J8AA 3ST2A 1G2DC 2EOOA 3P28A 2AWJA 1QYFA 2G16B 5DPIA 2ENCA 3DPWA 4RTCA 2A46A 4W6PA 4Q9XA 4W7DA 4X9JA 2EMCA 1BFPA 2WISA 2QLEA 2YTJA 2G3DB 3LA1A 2EPCA 3U8AA 3ZTFA 4R2PA 4LJCA 1Z1QA 4B5YA 3TMRA 1S6ZA 3CGLA 2VVIA 4M9VC 2A54B 4ZF4A 2EN1A 4IK1A 2ELZA 4EMQA 2ZO6A 3NT9A 3CD1A 2EM8A 4F2JC 3NF0A 1H6RA 4W6DA 5EJUA 1X6FA 2EP3A 3LVAA 1UISA 3S05A 4UTSA 2YRMA 2YSOA 4W6LA 1JK1A 3PJ7A 2EL4A 4W77A 2H5OA 4Q7RA 3DPZA 5FHVA 4XOWA 5KL3A 2DGCA 3OSQA 2AHAA 3U0KA 1DGCA 2DUHA 4LQUA 4R6DA 1JBZA 1EMCA 1YSAC 3U8CA 2FL1A 4DXIA 2LCEA 1XAEA 3SVNA 3SG4A 3TMTA 2EN8A 5KL7A 2Z6ZA 1A1HA 5H88A 2DUFA 3DQ6A 3EK4A 4R2RA 1BB8A 5DTZA 2WCC3 2DUIA 4XVPA 2EJ4A 2BTJA 3LF3A 4W6BA 1YHIA 4IZNA 4KAGA 2EN6A 2EN3A 4ORNA 4PPJA 2WURA 3DQEA 4W73A 4HQ8A 2YU5A 3CFHA 2WHSA 3EKHA 3DQ9A 2WHUA 2EOSA 1LLMC 4W6FA 1YHHA 2EM9A 2EOQA 4IJDA 2VZXA 3CBEA 2RSIA 5EB7A 4J89A 2IE2A 1ZGQA 2CT1A 1W7SA 1XA9A 2QLGA 3BXAA 2FZUA 3OGOA 2H5PA 3CFAA 5FVGA 3GEXA 4RYSA 5KL2A 2Z6YA 4KEXA 3OSRA 4W7AA 3SG2A 1ZR9A 3W1CA 4R6BA 3KCTA 1OXDA 2GHFA 4LQTA 4R2DA 3SSTA 1TF6A 4Z4KA 2QRFA 2AWLA 3SVCA 2VAEA 2YTEA 2POXA 2HCGA 3SVUA 4W7XA 2EM0A 1EMEA 1QXTA 1H4UA 1WJPA 5BTTA 2WBTA 2EMZA 2M9AA 3ST4A 4EDSA 1AAYA 2EN7A 4W7EA 4AR7A 2RPCA 2EOMA 3UK3C 4IK8A 4IK9A 3U0MA 1P47A 3SV5A 1EMBA 2D9HA 5EHUA 3U0NA 1UBDC 2AH8A 4OHSA 4FK5C 5DTLA 3VHTA 5KL5A 3SVSA 4W72A 4J88A 3O78A 2DRPA 2EMDA 1JC0A 4DXOA 5LTRA 2EOZA 2H9WA 3P8UA 4KW9A 3E5WA 2PRTA 1A1IA 3VK1A 4H3NA 4JFGA 2PXWA 2EOHA 2DMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLI A;  4JRB A;  3W1D A;  4GES B;  2ARL A;  4ZBL A;  3WCK A;  2EQ0 A;  3RWT A;  4W6J A;  3I19 A;  3DQO A;  4W6T A;  2MDG A;  4OGS A;  1Q4D A;  1ZUX A;  3SG7 A;  1GFL A;  2RH7 A;  4ZIO A;  5DTX A;  2CTD A;  3CFF A;  2EMB A;  4W6M A;  3EVP A;  4JF9 A;  5DU0 A;  4DXP A;  2OTB A;  1X3C A;  1MOV A;  2OJK A;  2CSH A;  1EMG A;  3EVU A;  1X6E A;  2B3Q A;  4R2Q A;  5EXC I;  3GB3 A;  2EQ1 A;  2I13 A;  3DQ4 A;  2EMK A;  3M24 A;  4ZB1 A;  2IB6 A;  2R1F A;  3ED8 A;  2GLI A;  2YTG A;  2A56 B;  2EMA A;  3SVD A;  3SSH A;  3SSY A;  5HZT A;  2QT2 A;  3PIB A;  1B9C A;  4PFE A;  1Q73 A;  1QYQ A;  3SSV A;  2WSO A;  1EMF A;  5BT0 A;  1Q4A A;  3DQ8 A;  2AWM A;  2A25 A;  5J2O A;  5LK4 A;  1YFP A;  4OY4 A;  5BQL A;  4H3L A;  2EMH A;  3LVD A;  1YHG A;  1F2I G;  4KPI A;  1EMK A;  2DDC A;  4Z4M A;  5HZO A;  2G6X A;  3DQK A;  5DQB A;  2WIQ A;  4W6S A;  1EMA A;  2ZMW A;  3LF4 B;  4KW8 A;  3ST0 A;  3H1O A;  2YTF A;  3V3D A;  2ENH A;  4KGF A;  2QLG B;  5EBJ A;  2G2S B;  1F0B A;  3CD9 A;  5HBD A;  2EOF A;  5AQB B;  4R2C A;  2QLH A;  2LO3 A;  1B69 A;  2G5Z B;  5KL6 A;  1UN6 B;  2HGD A;  2V4E A;  2EPU A;  3EK8 A;  4H48 A;  3LSA A;  3AI4 A;  1RRX A;  3DQF A;  2YU8 A;  2OKY A;  2EMY A;  4B30 A;  4GOB A;  3EVV A;  1MOU A;  4XL5 A;  2VRD A;  5BTT B;  4L13 A;  4DXN A;  3DQ7 A;  2HQZ A;  5DRF A;  2WBU A;  4N3D A;  5DTY A;  2EMO A;  1Z1B A;  2EM5 A;  3DQD A;  4OQW A;  2EM6 A;  2YTD A;  1GGX A;  2FWQ A;  3EVR A;  2HPW A;  4W75 A;  1QY3 A;  4EUL A;  3EKJ A;  4ZIN A;  2DLK A;  1ZGO A;  1YUJ A;  1ZU1 A;  2DUE A;  3VHT B;  1NCS A;  2H5R A;  2HGY A;  3DQC A;  3E5T A;  1X5W A;  4ZF3 A;  3SG6 A;  1HUY A;  2EMI A;  5EXB A;  1QYO A;  3SVO A;  2HFC A;  4HVF A;  3SVR A;  5KL4 A;  2EPR A;  2VVH A;  5DPG A;  2WBS A;  3O77 A;  4W6I A;  5KTG A;  2YTQ A;  2A50 B;  4H47 A;  3GJ1 A;  2EOX A;  2LVH A;  4LJB A;  1XQM A;  1Z1P A;  2JPA A;  4W7C A;  4DXM A;  3GJ2 A;  2EM7 A;  2A52 B;  3MGF A;  2V4E C;  2YDZ A;  3CB9 A;  4W7R A;  4P1Q A;  1Q4C A;  5DPH A;  1W7U A;  5T3I A;  2ICR A;  2YE0 A;  3M22 A;  2YRK A;  3EK7 A;  2OTE A;  4I2Y A;  4R2E A;  1F09 A;  2QU1 A;  2Q6P A;  3IR8 A;  4W6A A;  3BX9 A;  3PJB A;  4PPL A;  3WLC A;  4L12 A;  2EOR A;  1ZGP A;  2Y0G A;  3U8P A;  4W6H A;  3SSL A;  2IB5 A;  4HQ9 A;  2YE1 A;  2GW4 B;  3SSP A;  2MKN A;  4IK3 A;  1XSS A;  4TZA A;  3PJ5 A;  2DD7 A;  2EMW A;  2EM3 A;  4R2S A;  3NT3 A;  3BXB A;  2HJO A;  4OJ0 A;  1YUI A;  2DLQ A;  2EN4 A;  1OXF A;  2PXS A;  4ANJ A;  2Z6X A;  5LTQ A;  3ST3 A;  3AKO A;  2VVJ A;  3SVB A;  1KYR A;  4HE4 A;  5HZU A;  4GF6 B;  2NAB A;  2YTI A;  5FVI A;  5HGE A;  1KYS A;  4DKM A;  3MHS C;  4LJD A;  4KA9 A;  3AI5 A;  2G3O A;  3DQN A;  3RWA A;  4W69 A;  2YRH A;  3UG0 A;  1RMP A;  1ZAA C;  4JC2 A;  2IOV A;  3SG5 A;  4WSG A;  3DQL A;  2ZO7 A;  4ZFS A;  3SSK A;  4W6G A;  5DQM A;  1C4F A;  3NED A;  2MKD A;  2QZ0 A;  2ELY A;  2A48 A;  3H1R A;  4KF5 A;  3ZUF A;  3ZUL A;  3WLD A;  2YSP A;  3DQH A;  1A1G A;  4P76 A;  2WHT A;  4W74 A;  4Q7U A;  2EL5 A;  2EPA A;  2A47 A;  5DPJ A;  4U2V A;  1CV7 A;  3DQI A;  2HQK A;  3G9A A;  4W6C A;  5FVF A;  1GL4 A;  4JGE A;  2V4E B;  1Q4E A;  3A8S A;  1RMO A;  2OKW A;  4RYW A;  3M99 B;  2EPZ A;  3UFZ A;  1JK2 A;  1A1K A;  4JEO A;  5EXU A;  2EOY A;  3DQ1 A;  1JC1 A;  3SS0 A;  4W6O A;  4B30 B;  2JAD A;  3DQA A;  2E72 A;  1HCJ A;  1YZW A;  4EDO A;  2EOJ A;  2BB8 A;  1YJF A;  4HQC A;  2YTO A;  2EE8 A;  1OXE A;  3DQ5 A;  2C9I A;  2EQ3 A;  1W7T A;  2EPX A;  4W76 A;  3NEZ A;  2EPP A;  2A53 B;  4PPK A;  2O2B A;  2ADR A;  3EPL A;  2LT7 A;  4XOV A;  3SRY A;  2EML A;  1MYW A;  5DRG A;  5H87 A;  4GZN C;  2JP9 A;  2HGH A;  3DQM A;  4ZF5 A;  4LJD C;  4R2A A;  1EML A;  2GX0 A;  4IK4 A;  2EOI A;  3DQ3 A;  2Q57 A;  3U0L A;  2EMG A;  2VAD A;  4W7F A;  3LS3 A;  1MEY C;  2DDD A;  5DY6 A;  1KJK A;  5HW9 A;  4IS1 C;  3EPH A;  2EM4 A;  4EN1 A;  2WSN A;  4H3M A;  1A1F A;  4IK5 A;  1EMM A;  4Q9W A;  1RMD A;  4XGY A;  3DQJ A;  4KF5 C;  2ENA A;  4LW5 A;  4DXQ A;  2HRS A;  3ADF A;  3LVC A;  1KYP A;  2H6V A;  4F6N A;  2H5Q A;  3DPX A;  2EMX A;  3EPJ A;  3EPK A;  2EMF A;  3MHH C;  2LV2 A;  4KF4 A;  2J7J A;  2O29 A;  2G6Y A;  3KCS A;  2EL6 A;  1YJ2 A;  3DQ2 A;  2DD9 A;  3SVE A;  5LTP A;  4BDU A;  4F6M A;  1KP5 A;  5F9G A;  1X6H A;  4NWS A;  2C9J A;  3GL4 A;  2EMN A;  4W6K A;  4W6N A;  2GX2 A;  3IP2 A;  3ZUJ A;  4KGE A;  2Z1O A;  1G7K A;  4AS8 A;  1RMM A;  1BBO A;  2YTP A;  2EM2 A;  1Q4B A;  4W6U A;  3DQU A;  4KW4 A;  2EN2 A;  1G2F C;  1TN9 A;  2EOE A;  1JBY A;  2G6E A;  2AWK A;  1A1L A;  1A1J A;  2O24 A;  5H89 A;  4TZG A;  4L1I A;  3K1K A;  2GW3 A;  1TF3 A;  2ZMU A;  3SG3 A;  4Q7T A;  2OGR A;  3E5V A;  3VIC A;  1XMZ A;  5EB6 A;  2YFP A;  2P4M A;  2DUG A;  2YTN A;  2B3P A;  2H8Q A;  1RM9 A;  4W6R A;  4DKN A;  3BXC A;  5HZS A;  4J8A A;  3ST2 A;  1G2D C;  2EOO A;  3P28 A;  2AWJ A;  1QYF A;  2G16 B;  5DPI A;  2ENC A;  3DPW A;  4RTC A;  2A46 A;  4W6P A;  4Q9X A;  4W7D A;  4X9J A;  2EMC A;  1BFP A;  2WIS A;  2QLE A;  2YTJ A;  2G3D B;  3LA1 A;  2EPC A;  3U8A A;  3ZTF A;  4R2P A;  4LJC A;  1Z1Q A;  4B5Y A;  3TMR A;  1S6Z A;  3CGL A;  2VVI A;  4M9V C;  2A54 B;  4ZF4 A;  2EN1 A;  4IK1 A;  2ELZ A;  4EMQ A;  2ZO6 A;  3NT9 A;  3CD1 A;  2EM8 A;  4F2J C;  3NF0 A;  1H6R A;  4W6D A;  5EJU A;  1X6F A;  2EP3 A;  3LVA A;  1UIS A;  3S05 A;  4UTS A;  2YRM A;  2YSO A;  4W6L A;  1JK1 A;  3PJ7 A;  2EL4 A;  4W77 A;  2H5O A;  4Q7R A;  3DPZ A;  5FHV A;  4XOW A;  5KL3 A;  2DGC A;  3OSQ A;  2AHA A;  3U0K A;  1DGC A;  2DUH A;  4LQU A;  4R6D A;  1JBZ A;  1EMC A;  1YSA C;  3U8C A;  2FL1 A;  4DXI A;  2LCE A;  1XAE A;  3SVN A;  3SG4 A;  3TMT A;  2EN8 A;  5KL7 A;  2Z6Z A;  1A1H A;  5H88 A;  2DUF A;  3DQ6 A;  3EK4 A;  4R2R A;  1BB8 A;  5DTZ A;  2WCC 3;  2DUI A;  4XVP A;  2EJ4 A;  2BTJ A;  3LF3 A;  4W6B A;  1YHI A;  4IZN A;  4KAG A;  2EN6 A;  2EN3 A;  4ORN A;  4PPJ A;  2WUR A;  3DQE A;  4W73 A;  4HQ8 A;  2YU5 A;  3CFH A;  2WHS A;  3EKH A;  3DQ9 A;  2WHU A;  2EOS A;  1LLM C;  4W6F A;  1YHH A;  2EM9 A;  2EOQ A;  4IJD A;  2VZX A;  3CBE A;  2RSI A;  5EB7 A;  4J89 A;  2IE2 A;  1ZGQ A;  2CT1 A;  1W7S A;  1XA9 A;  2QLG A;  3BXA A;  2FZU A;  3OGO A;  2H5P A;  3CFA A;  5FVG A;  3GEX A;  4RYS A;  5KL2 A;  2Z6Y A;  4KEX A;  3OSR A;  4W7A A;  3SG2 A;  1ZR9 A;  3W1C A;  4R6B A;  3KCT A;  1OXD A;  2GHF A;  4LQT A;  4R2D A;  3SST A;  1TF6 A;  4Z4K A;  2QRF A;  2AWL A;  3SVC A;  2VAE A;  2YTE A;  2POX A;  2HCG A;  3SVU A;  4W7X A;  2EM0 A;  1EME A;  1QXT A;  1H4U A;  1WJP A;  5BTT A;  2WBT A;  2EMZ A;  2M9A A;  3ST4 A;  4EDS A;  1AAY A;  2EN7 A;  4W7E A;  4AR7 A;  2RPC A;  2EOM A;  3UK3 C;  4IK8 A;  4IK9 A;  3U0M A;  1P47 A;  3SV5 A;  1EMB A;  2D9H A;  5EHU A;  3U0N A;  1UBD C;  2AH8 A;  4OHS A;  4FK5 C;  5DTL A;  3VHT A;  5KL5 A;  3SVS A;  4W72 A;  4J88 A;  3O78 A;  2DRP A;  2EMD A;  1JC0 A;  4DXO A;  5LTR A;  2EOZ A;  2H9W A;  3P8U A;  4KW9 A;  3E5W A;  2PRT A;  1A1I A;  3VK1 A;  4H3N A;  4JFG A;  2PXW A;  2EOH A;  2DMI A; 
#chains in the Genus database with same CATH topology
 2QLI A;  4HEI A;  4WSP A;  4JRB A;  3W1D A;  2EPN A;  4GES B;  3BF2 A;  5AAS A;  2ARL A;  2JVA A;  4ZBL A;  4DUZ E;  3WCK A;  2EQ0 A;  3RWT A;  3HXL A;  4W6J A;  1IQS A;  3OML A;  2ODR D;  3I19 A;  3DQO A;  4W6T A;  2MDG A;  4WX9 A;  4OGS A;  4NXN E;  4DR1 E;  1Q4D A;  1ZUX A;  1QNT A;  2RQL A;  2JY9 A;  3SG7 A;  1GFL A;  2RH7 A;  4ZIO A;  1YFH A;  5DTX A;  2CTD A;  2JOB A;  3CFF A;  2EMB A;  4DV6 E;  4W6M A;  2I9I A;  3EVP A;  4JF9 A;  2M1S A;  5DU0 A;  4DXP A;  2OTB A;  4BCA A;  4DV2 E;  1X3C A;  1MOV A;  2OJK A;  3KZZ A;  2CSH A;  4JI0 E;  2JWO A;  1EMG A;  2EPM X;  3EVU A;  1X6E A;  2B3Q A;  4R2Q A;  5EXC I;  3GB3 A;  3THN A;  2EQ1 A;  2I13 A;  3DQ4 A;  1T4O A;  4GKK E;  2EMK A;  3M24 A;  2EPO A;  2V89 A;  3VK6 A;  4ZB1 A;  1IMU A;  2IB6 A;  1X47 A;  2R1F A;  3BGH A;  3ED8 A;  2GLI A;  2YTG A;  2A56 B;  1UHZ A;  2EMA A;  3SVD A;  3SSH A;  3SSY A;  4LTY A;  5HZT A;  2QT2 A;  3PIB A;  1B9C A;  4PFE A;  3DF6 A;  1IBK E;  2FGG A;  5CFF E;  1Q73 A;  1QYQ A;  3K6Q A;  3SSV A;  2WSO A;  1EMF A;  5BT0 A;  1T4L B;  4O5G A;  1Q4A A;  3DQ8 A;  2AWM A;  4O4K A;  5A69 A;  2A25 A;  5J2O A;  2JXP A;  5LK4 A;  4WPY A;  1YFP A;  4F9B B;  4OY4 A;  2V87 A;  5BQL A;  2VQF E;  4LU9 A;  4H3L A;  2EMH A;  2IHR 1;  3LVD A;  1YHG A;  3ZOQ B;  1F2I G;  4KPI A;  2KOU A;  1EMK A;  2DDC A;  4Z4M A;  3F6H A;  2LBS B;  5HZO A;  2G6X A;  1DQ3 A;  3DQK A;  4B3M E;  5DQB A;  2WIQ A;  4W6S A;  1EMA A;  2ZMW A;  3LF4 B;  1PJT A;  4R03 A;  5IXM B;  4KW8 A;  4B3R E;  3ST0 A;  3H1O A;  4O24 A;  2N8X A;  2YTF A;  3V3D A;  1ZBT A;  2ENH A;  2FV4 B;  4KGF A;  2YPN A;  2QLG B;  1WXR A;  5EBJ A;  1PJS A;  2G2S B;  1F0B A;  3CD9 A;  5HBD A;  2RS7 A;  2EOF A;  2V83 A;  5AQB B;  4R2C A;  2QLH A;  2LO3 A;  1B69 A;  2G5Z B;  5KL6 A;  1UN6 B;  2HGD A;  2V4E A;  1N3G A;  2EPU A;  2EWL A;  5A6K A;  3EK8 A;  4H48 A;  3LSA A;  3AI4 A;  4JV5 E;  1RRX A;  3DQF A;  2YU8 A;  5IV8 B;  2OKY A;  1RQ0 A;  2EMY A;  4B30 A;  4R8O A;  4GOB A;  3HQ1 A;  3EVV A;  1XMQ E;  1MOU A;  4XL5 A;  2DSY A;  2VRD A;  5BTT B;  4L13 A;  4DV3 E;  4DXN A;  1WRJ A;  4M2Z A;  1EH6 A;  3DQ7 A;  1PKP A;  2HQZ A;  5DRF A;  2WBU A;  1GTK A;  3IWB A;  1YYW A;  4N3D A;  4BS9 A;  5DTY A;  2EMO A;  1IQO A;  1Z1B A;  4JI4 E;  2EM5 A;  3DQD A;  4N4R B;  2UUC E;  4OQW A;  2EM6 A;  2YTD A;  2KON A;  1GGX A;  2FWQ A;  3EVR A;  2HPW A;  4W75 A;  1QY3 A;  4EUL A;  3EKJ A;  4ZIN A;  1UIL A;  1X49 A;  2DLK A;  4F9A B;  1ZGO A;  1YUJ A;  3H09 A;  4P7D A;  1ZU1 A;  4ZYE A;  2DUE A;  3ADJ A;  3VHT B;  1NCS A;  2FTX B;  2LUP B;  4M30 A;  2H5R A;  2HGY A;  3DQC A;  3E5T A;  1X5W A;  4ZF3 A;  3SG6 A;  1HUY A;  1XNR E;  2EMI A;  5EXB A;  3EQ1 A;  4NZV A;  1QYO A;  3SVO A;  2HFC A;  4HVF A;  3SVR A;  5KL4 A;  2EPR A;  2VVH A;  5DPG A;  1MGT A;  2WBS A;  3O77 A;  4W6I A;  5KTG A;  5TSE A;  2YTQ A;  2A50 B;  5A6B D;  4H47 A;  3GJ1 A;  4WXD A;  2EOX A;  2LVH A;  4LJB A;  3VYY A;  4LF7 E;  1XQM A;  1Z1P A;  2JPA A;  4W7C A;  4DXM A;  4WYQ B;  3GJ2 A;  2EM7 A;  2A52 B;  3MGF A;  4DR4 E;  2V4E C;  2YDZ A;  3CB9 A;  4W7R A;  2L2N A;  4P1Q A;  1O0W A;  1Q4C A;  5DPH A;  2CPN A;  1W7U A;  2LUQ A;  5T3I A;  4KZS A;  2ICR A;  2YE0 A;  3M22 A;  2YRK A;  3EK7 A;  2OTE A;  4I2Y A;  4R2E A;  1F09 A;  2QU1 A;  2Q6P A;  3IWD A;  1KYQ A;  3IR8 A;  4W6A A;  2VE7 C;  3BX9 A;  3PJB A;  4PPL A;  3WLC A;  4HTG A;  4NHR A;  4L12 A;  2EOR A;  1ZGP A;  2Y0G A;  4JI7 E;  3JAM C;  2H36 X;  3U8P A;  1N34 E;  4W6H A;  3SSL A;  2IB5 A;  3J80 C;  4HQ9 A;  2LJH A;  2YE1 A;  2UUA E;  5AE2 A;  2GW4 B;  3SSP A;  2MKN A;  4IK3 A;  1XSS A;  4TZA A;  3MSW A;  3PJ5 A;  2DD7 A;  1YPN A;  2EMW A;  2EM3 A;  4R2S A;  3NT3 A;  3BXB A;  2HJO A;  4OJ0 A;  4YY3 E;  1YUI A;  2DLQ A;  3IWC A;  2EN4 A;  1T38 A;  1OXF A;  2PXS A;  4ANJ A;  2Z6X A;  5LTQ A;  3ST3 A;  3AKO A;  2VVJ A;  4TUG A;  4BHC A;  1RC7 A;  4LF8 E;  3SVB A;  1KYR A;  4HE4 A;  2L33 A;  5HZU A;  4GF6 B;  2NAB A;  2YTI A;  3F6G A;  5A6J A;  5FVI A;  5HGE A;  2B7V A;  5IWA E;  4DV0 E;  1KYS A;  4DKM A;  3MHS C;  4LJD A;  4KA9 A;  3AI5 A;  2G3O A;  3DQN A;  3RWA A;  1I94 E;  4W69 A;  2YRH A;  2KHX A;  3UG0 A;  1RMP A;  1ZAA C;  4JC2 A;  2IOV A;  4DR2 E;  3SG5 A;  3HPZ A;  4WSG A;  3DQL A;  4F9C B;  2ZO7 A;  4ZFS A;  3SSK A;  4W6G A;  5DQM A;  1C4F A;  3NED A;  2MKD A;  3C4B A;  2QZ0 A;  2ELY A;  2EZ6 A;  3JU0 A;  3T1Y E;  2A48 A;  3H1R A;  4KF5 A;  3ZUF A;  3ZUL A;  2GPI A;  3WLD A;  2ODR C;  4P78 A;  3ADI A;  3J7A G;  2YSP A;  4BC7 A;  3DQH A;  1A1G A;  4P76 A;  2WHT A;  4W74 A;  4Q7U A;  1SR9 A;  2EL5 A;  2EPA A;  2V85 A;  2A47 A;  5DPJ A;  4K0K E;  4LFC E;  4U2V A;  4RH8 A;  3J7Y p;  1CV7 A;  2UXB E;  2HHH E;  3DQI A;  2DIX A;  2HQK A;  3G9A A;  4W6C A;  5FVF A;  1GL4 A;  4LF5 E;  4JGE A;  2V4E B;  1Q4E A;  3A8S A;  2HC5 A;  1RMO A;  2OKW A;  4RYW A;  3M99 B;  2EPZ A;  4L5N C;  2M7Q A;  3UFZ A;  1JK2 A;  1A1K A;  2L92 A;  4JEO A;  5EXU A;  2EOY A;  3DQ1 A;  1JC1 A;  3SS0 A;  4W6O A;  4B30 B;  2YT4 A;  4F54 A;  4X62 E;  2JAD A;  3DQA A;  2NA2 A;  2E72 A;  1J26 A;  1HCJ A;  1YZW A;  4EDO A;  2EOJ A;  2BB8 A;  1FKA E;  1YJF A;  4HQC A;  2YTO A;  2UXD E;  2EE8 A;  5AC5 A;  1OXE A;  3AUZ A;  3DQ5 A;  2C9I A;  2EQ3 A;  1W7T A;  2EPX A;  1YYO A;  4W76 A;  3NEZ A;  2EPP A;  2A53 B;  3C4T A;  4PPK A;  2O2B A;  2ADR A;  2VF1 A;  5AE3 A;  4LF9 E;  2HJJ A;  3EPL A;  2LT7 A;  4XOV A;  3SRY A;  2L8T A;  2NUG A;  2EML A;  4DR6 E;  2DMY A;  1MYW A;  5DRG A;  5H87 A;  4GZN C;  1PJQ A;  4X64 E;  2JP9 A;  2HGH A;  3DQM A;  4ZF5 A;  4LJD C;  4R2A A;  1EML A;  2GX0 A;  4IK4 A;  2EOI A;  2RS6 A;  3DQ3 A;  2Q57 A;  3U0L A;  2EMG A;  2VAD A;  2LJU A;  4W7F A;  3LS3 A;  2MDR A;  2DDD A;  5DY6 A;  3AV0 A;  1MEY C;  1KJK A;  4O43 A;  5HW9 A;  4IS1 C;  2MC5 A;  4MLQ A;  3EPH A;  2EM4 A;  2JOX A;  4EN1 A;  4DV1 E;  1HNW E;  2WSN A;  4H3M A;  1A1F A;  4IK5 A;  1EMM A;  4Q9W A;  5IT9 C;  3ADL A;  3KWR A;  1RMD A;  4XGY A;  3DQJ A;  4KF5 C;  2ENA A;  4LW5 A;  4DXQ A;  2HRS A;  4LFB E;  5A6B A;  4LF6 E;  3ADF A;  3LVC A;  4OOG C;  1KYP A;  2H6V A;  4F6N A;  1AH5 A;  2H5Q A;  3DPX A;  1ZBQ A;  2EMX A;  2EPL X;  2EMF A;  2V8Q B;  3EPJ A;  3EPK A;  3HTX A;  1L4S A;  3MHH C;  2LV2 A;  2WZO A;  4KF4 A;  2J7J A;  2L3C A;  2O29 A;  1T39 A;  2NUF A;  2JR1 A;  2G6Y A;  3KCS A;  2EL6 A;  1YJ2 A;  3DQ2 A;  4BBY A;  4AQY E;  4JI3 E;  4NXM E;  2DD9 A;  3SVE A;  5LTP A;  1HNX E;  4Q28 A;  4DR7 E;  4BDU A;  4F6M A;  2LE2 A;  1KP5 A;  3DJW A;  5F9G A;  1X6H A;  3BBG A;  2L3J A;  4NWS A;  4DKK A;  2C9J A;  2VQE E;  3GL4 A;  2EMN A;  2N3G A;  4W6K A;  4W6N A;  2GX2 A;  1GZ6 A;  3JTZ A;  4JI1 E;  3IP2 A;  3ZUJ A;  4KGE A;  2Z1O A;  2LTR A;  2UUB E;  1G7K A;  1QU6 A;  3C6M A;  4I8O A;  4AS8 A;  1RMM A;  1BBO A;  3KZY A;  5AC4 A;  2YTP A;  2EM2 A;  1Q4B A;  3LLH A;  4W6U A;  4TUI A;  3DQU A;  4KW4 A;  2EN2 A;  1G2F C;  1TN9 A;  1PDA A;  2EOE A;  1N32 E;  1JBY A;  3FIG A;  2G6E A;  2JYA A;  2AWK A;  2YZT A;  1A1L A;  4X66 E;  2O24 A;  5H89 A;  1A1J A;  2N3H A;  4TZG A;  4L1I A;  3K1K A;  2GW3 A;  2B9D A;  2V88 A;  1TF3 A;  4JI2 E;  4KHP E;  2ZMU A;  3SG3 A;  4BHB A;  4Q7T A;  2OGR A;  3E5V A;  3VIC A;  1XMZ A;  5EB6 A;  5BR8 E;  2YFP A;  2P4M A;  2DUG A;  2YTN A;  4MLV A;  1IBL E;  2B3P A;  2H8Q A;  1RM9 A;  5DNY A;  4W6R A;  4DKN A;  3BXC A;  5AE1 A;  5HZS A;  4J8A A;  1HR0 E;  3ST2 A;  1G2D C;  2EOO A;  3P28 A;  2AWJ A;  2V86 A;  1QYF A;  1EKZ A;  2RSM A;  2G16 B;  2L2K B;  5DPI A;  2ENC A;  3DPW A;  4RTC A;  2A46 A;  4W6P A;  1FJG E;  4Q9X A;  4W7D A;  4X9J A;  2EMC A;  1BFP A;  2WIS A;  2QLE A;  3L00 A;  2YTJ A;  2G3D B;  2EPK X;  3LA1 A;  2EPC A;  1WHQ A;  1XMO E;  3U8A A;  3ZTF A;  4R2P A;  4LJC A;  1Z1Q A;  4B5Y A;  2L6M A;  3TMR A;  4B3T E;  1S6Z A;  3CGL A;  2VVI A;  2MC6 A;  3RMP A;  2LTS A;  4DV4 E;  4JI5 E;  1EH8 A;  2A54 B;  4ZF4 A;  2EN1 A;  4IK1 A;  5T6J A;  2ELZ A;  4M9V C;  4EMQ A;  2ZO6 A;  3NT9 A;  1HNZ E;  3CD1 A;  4LFA E;  2EM8 A;  4F2J C;  4OX9 E;  3NF0 A;  2K7I A;  1H6R A;  4W6D A;  5EJU A;  1X6F A;  2EP3 A;  2Q8U A;  4DUY E;  3LVA A;  1UIS A;  1N36 E;  3S05 A;  4UTS A;  2E5L E;  2YRM A;  1YZ9 A;  2YSO A;  4W6L A;  3T1H E;  3PJ7 A;  2EL4 A;  1JK1 A;  4B3S E;  4W77 A;  3VYX A;  2H5O A;  4Q7R A;  2RTX A;  3DPZ A;  5FHV A;  2B3T B;  4XOW A;  5KL3 A;  4BMJ A;  1WHN A;  2DGC A;  3OSQ A;  2AHA A;  2UXC E;  5LMU E;  3LML A;  3U0K A;  4GEQ B;  1DGC A;  2DUH A;  4WFT A;  4LQU A;  4R6D A;  1JBZ A;  1EMC A;  1GQE A;  2DB2 A;  1YSA C;  3U8C A;  2F8B A;  2LRS A;  2FL1 A;  4DXI A;  4JYA E;  2LCE A;  2ZM6 E;  1XAE A;  3SVN A;  3SG4 A;  3TMT A;  3J81 C;  2EN8 A;  5KL7 A;  2Z6Z A;  1A1H A;  5H88 A;  2DUF A;  4J8Z A;  1YYK A;  3DQ6 A;  3EK4 A;  4R2R A;  4DR5 E;  1BB8 A;  5DTZ A;  2WCC 3;  2DUI A;  4XVP A;  1X48 A;  3THO B;  5LMN E;  5FLX C;  2EJ4 A;  2BTJ A;  4DR3 E;  3LF3 A;  4W6B A;  1YHI A;  4IZN A;  4KAG A;  1STU A;  2EN6 A;  2UU9 E;  2EN3 A;  4ORN A;  4PPJ A;  2WUR A;  3DQE A;  4W73 A;  4HQ8 A;  2YU5 A;  3OTO E;  4LF4 E;  3CFH A;  4GKJ E;  1NEI A;  2WHS A;  3ADG A;  1EH7 A;  3EKH A;  3C6K A;  3DQ9 A;  2WHU A;  2EOS A;  1LLM C;  1IBM E;  4W6F A;  1YHH A;  2B7T A;  2EM9 A;  4L8N A;  2EOQ A;  4IJD A;  2VZX A;  4BC9 A;  4JI8 E;  1SFE A;  3QG5 C;  2LMZ A;  3CBE A;  2RSI A;  5EB7 A;  4J89 A;  3ECR A;  5LL6 R;  2IE2 A;  4KWY A;  1ZGQ A;  2CT1 A;  5ADZ A;  1W7S A;  1XA9 A;  2QLG A;  3BXA A;  2FZU A;  2L2M A;  5A6A A;  3OGO A;  4RHB B;  2NUE A;  2H5P A;  3CFA A;  4JI6 E;  5FVG A;  3GEX A;  4RYS A;  5KL2 A;  2Z6Y A;  4KEX A;  3OSR A;  4W7A A;  3SG2 A;  1ZR9 A;  3P1X A;  2F4V E;  1BBG A;  3W1C A;  2K4V A;  4R6B A;  3KCT A;  1OXD A;  2GHF A;  4LQT A;  4R2D A;  1XNQ E;  3SST A;  4WXC A;  1TF6 A;  1T4N A;  4Z4K A;  2QRF A;  2AWL A;  3SVC A;  2VAE A;  2YTE A;  2POX A;  2HCG A;  3SVU A;  4W7X A;  2EM0 A;  1EME A;  1QXT A;  1H4U A;  1WJP A;  5BTT A;  2WBT A;  2EMZ A;  2M9A A;  2G7H A;  3ST4 A;  4EDS A;  1DI2 A;  4DV7 E;  1AAY A;  4ZYD A;  2EN7 A;  4Q35 B;  2E1M A;  4W7E A;  4AR7 A;  2RPC A;  2EOM A;  3UK3 C;  5LLQ A;  4IK8 A;  4IK9 A;  3U0M A;  2M4I A;  1J5E E;  4M0V A;  1P47 A;  3SV5 A;  1EMB A;  2D9H A;  5EHU A;  3U0N A;  1UBD C;  1N33 E;  4DMI A;  2AH8 A;  4X65 E;  4OHS A;  4FK5 C;  5DTL A;  3VHT A;  5KL5 A;  2YWQ A;  3SVS A;  3BID A;  4X8W A;  5A2Q C;  4W72 A;  4YHH E;  4DV5 E;  4J88 A;  3O78 A;  2DRP A;  2EMD A;  1JC0 A;  4DXO A;  5LTR A;  2EOZ A;  2R76 A;  2H9W A;  4ZYG A;  3P8U A;  5F3W A;  4KW9 A;  3E5W A;  2BBG A;  3HPS A;  4ZYH A;  3TQM A;  2PRT A;  1A1I A;  3VK1 A;  4H3N A;  4JFG A;  2PXW A;  2EOH A;  2DMI A; 
#chains in the Genus database with same CATH homology
 2QLI A;  4JRB A;  3W1D A;  4GES B;  2ARL A;  4ZBL A;  3WCK A;  2EQ0 A;  3RWT A;  4W6J A;  3I19 A;  3DQO A;  4W6T A;  2MDG A;  4OGS A;  1Q4D A;  1ZUX A;  3SG7 A;  1GFL A;  2RH7 A;  4ZIO A;  5DTX A;  2CTD A;  3CFF A;  2EMB A;  4W6M A;  3EVP A;  4JF9 A;  5DU0 A;  4DXP A;  2OTB A;  1X3C A;  1MOV A;  2OJK A;  2CSH A;  1EMG A;  3EVU A;  1X6E A;  2B3Q A;  4R2Q A;  5EXC I;  3GB3 A;  2EQ1 A;  2I13 A;  3DQ4 A;  2EMK A;  3M24 A;  4ZB1 A;  2IB6 A;  2R1F A;  3ED8 A;  2GLI A;  2YTG A;  2A56 B;  2EMA A;  3SVD A;  3SSH A;  3SSY A;  5HZT A;  2QT2 A;  3PIB A;  1B9C A;  4PFE A;  1Q73 A;  1QYQ A;  3SSV A;  2WSO A;  1EMF A;  5BT0 A;  1Q4A A;  3DQ8 A;  2AWM A;  2A25 A;  5J2O A;  5LK4 A;  1YFP A;  4OY4 A;  5BQL A;  4H3L A;  2EMH A;  3LVD A;  1YHG A;  1F2I G;  4KPI A;  1EMK A;  2DDC A;  4Z4M A;  5HZO A;  2G6X A;  3DQK A;  5DQB A;  2WIQ A;  4W6S A;  1EMA A;  2ZMW A;  3LF4 B;  4KW8 A;  3ST0 A;  3H1O A;  2YTF A;  3V3D A;  2ENH A;  4KGF A;  2QLG B;  5EBJ A;  2G2S B;  1F0B A;  3CD9 A;  5HBD A;  2EOF A;  5AQB B;  4R2C A;  2QLH A;  2LO3 A;  1B69 A;  2G5Z B;  5KL6 A;  1UN6 B;  2HGD A;  2V4E A;  2EPU A;  3EK8 A;  4H48 A;  3LSA A;  3AI4 A;  1RRX A;  3DQF A;  2YU8 A;  2OKY A;  2EMY A;  4B30 A;  4GOB A;  3EVV A;  1MOU A;  4XL5 A;  2VRD A;  5BTT B;  4L13 A;  4DXN A;  3DQ7 A;  2HQZ A;  5DRF A;  2WBU A;  4N3D A;  5DTY A;  2EMO A;  1Z1B A;  2EM5 A;  3DQD A;  4OQW A;  2EM6 A;  2YTD A;  1GGX A;  2FWQ A;  3EVR A;  2HPW A;  4W75 A;  1QY3 A;  4EUL A;  3EKJ A;  4ZIN A;  2DLK A;  1ZGO A;  1YUJ A;  1ZU1 A;  2DUE A;  3VHT B;  1NCS A;  2H5R A;  2HGY A;  3DQC A;  3E5T A;  1X5W A;  4ZF3 A;  3SG6 A;  1HUY A;  2EMI A;  5EXB A;  1QYO A;  3SVO A;  2HFC A;  4HVF A;  3SVR A;  5KL4 A;  2EPR A;  2VVH A;  5DPG A;  2WBS A;  3O77 A;  4W6I A;  5KTG A;  2YTQ A;  2A50 B;  4H47 A;  3GJ1 A;  2EOX A;  2LVH A;  4LJB A;  1XQM A;  1Z1P A;  2JPA A;  4W7C A;  4DXM A;  3GJ2 A;  2EM7 A;  2A52 B;  3MGF A;  2V4E C;  2YDZ A;  3CB9 A;  4W7R A;  4P1Q A;  1Q4C A;  5DPH A;  1W7U A;  5T3I A;  2ICR A;  2YE0 A;  3M22 A;  2YRK A;  3EK7 A;  2OTE A;  4I2Y A;  4R2E A;  1F09 A;  2QU1 A;  2Q6P A;  3IR8 A;  4W6A A;  3BX9 A;  3PJB A;  4PPL A;  3WLC A;  4L12 A;  2EOR A;  1ZGP A;  2Y0G A;  3U8P A;  4W6H A;  3SSL A;  2IB5 A;  4HQ9 A;  2YE1 A;  2GW4 B;  3SSP A;  2MKN A;  4IK3 A;  1XSS A;  4TZA A;  3PJ5 A;  2DD7 A;  2EMW A;  2EM3 A;  4R2S A;  3NT3 A;  3BXB A;  2HJO A;  4OJ0 A;  1YUI A;  2DLQ A;  2EN4 A;  1OXF A;  2PXS A;  4ANJ A;  2Z6X A;  5LTQ A;  3ST3 A;  3AKO A;  2VVJ A;  3SVB A;  1KYR A;  4HE4 A;  5HZU A;  4GF6 B;  2NAB A;  2YTI A;  5FVI A;  5HGE A;  1KYS A;  4DKM A;  3MHS C;  4LJD A;  4KA9 A;  3AI5 A;  2G3O A;  3DQN A;  3RWA A;  4W69 A;  2YRH A;  3UG0 A;  1RMP A;  1ZAA C;  4JC2 A;  2IOV A;  3SG5 A;  4WSG A;  3DQL A;  2ZO7 A;  4ZFS A;  3SSK A;  4W6G A;  5DQM A;  1C4F A;  3NED A;  2MKD A;  2QZ0 A;  2ELY A;  2A48 A;  3H1R A;  4KF5 A;  3ZUF A;  3ZUL A;  3WLD A;  2YSP A;  3DQH A;  1A1G A;  4P76 A;  2WHT A;  4W74 A;  4Q7U A;  2EL5 A;  2EPA A;  2A47 A;  5DPJ A;  4U2V A;  1CV7 A;  3DQI A;  2HQK A;  3G9A A;  4W6C A;  5FVF A;  1GL4 A;  4JGE A;  2V4E B;  1Q4E A;  3A8S A;  1RMO A;  2OKW A;  4RYW A;  3M99 B;  2EPZ A;  3UFZ A;  1JK2 A;  1A1K A;  4JEO A;  5EXU A;  2EOY A;  3DQ1 A;  1JC1 A;  3SS0 A;  4W6O A;  4B30 B;  2JAD A;  3DQA A;  2E72 A;  1HCJ A;  1YZW A;  4EDO A;  2EOJ A;  2BB8 A;  1YJF A;  4HQC A;  2YTO A;  2EE8 A;  1OXE A;  3DQ5 A;  2C9I A;  2EQ3 A;  1W7T A;  2EPX A;  4W76 A;  3NEZ A;  2EPP A;  2A53 B;  4PPK A;  2O2B A;  2ADR A;  3EPL A;  2LT7 A;  4XOV A;  3SRY A;  2EML A;  1MYW A;  5DRG A;  5H87 A;  4GZN C;  2JP9 A;  2HGH A;  3DQM A;  4ZF5 A;  4LJD C;  4R2A A;  1EML A;  2GX0 A;  4IK4 A;  2EOI A;  3DQ3 A;  2Q57 A;  3U0L A;  2EMG A;  2VAD A;  4W7F A;  3LS3 A;  1MEY C;  2DDD A;  5DY6 A;  1KJK A;  5HW9 A;  4IS1 C;  3EPH A;  2EM4 A;  4EN1 A;  2WSN A;  4H3M A;  1A1F A;  4IK5 A;  1EMM A;  4Q9W A;  1RMD A;  4XGY A;  3DQJ A;  4KF5 C;  2ENA A;  4LW5 A;  4DXQ A;  2HRS A;  3ADF A;  3LVC A;  1KYP A;  2H6V A;  4F6N A;  2H5Q A;  3DPX A;  2EMX A;  3EPJ A;  3EPK A;  2EMF A;  3MHH C;  2LV2 A;  4KF4 A;  2J7J A;  2O29 A;  2G6Y A;  3KCS A;  2EL6 A;  1YJ2 A;  3DQ2 A;  2DD9 A;  3SVE A;  5LTP A;  4BDU A;  4F6M A;  1KP5 A;  5F9G A;  1X6H A;  4NWS A;  2C9J A;  3GL4 A;  2EMN A;  4W6K A;  4W6N A;  2GX2 A;  3IP2 A;  3ZUJ A;  4KGE A;  2Z1O A;  1G7K A;  4AS8 A;  1RMM A;  1BBO A;  2YTP A;  2EM2 A;  1Q4B A;  4W6U A;  3DQU A;  4KW4 A;  2EN2 A;  1G2F C;  1TN9 A;  2EOE A;  1JBY A;  2G6E A;  2AWK A;  1A1L A;  1A1J A;  2O24 A;  5H89 A;  4TZG A;  4L1I A;  3K1K A;  2GW3 A;  1TF3 A;  2ZMU A;  3SG3 A;  4Q7T A;  2OGR A;  3E5V A;  3VIC A;  1XMZ A;  5EB6 A;  2YFP A;  2P4M A;  2DUG A;  2YTN A;  2B3P A;  2H8Q A;  1RM9 A;  4W6R A;  4DKN A;  3BXC A;  5HZS A;  4J8A A;  3ST2 A;  1G2D C;  2EOO A;  3P28 A;  2AWJ A;  1QYF A;  2G16 B;  5DPI A;  2ENC A;  3DPW A;  4RTC A;  2A46 A;  4W6P A;  4Q9X A;  4W7D A;  4X9J A;  2EMC A;  1BFP A;  2WIS A;  2QLE A;  2YTJ A;  2G3D B;  3LA1 A;  2EPC A;  3U8A A;  3ZTF A;  4R2P A;  4LJC A;  1Z1Q A;  4B5Y A;  3TMR A;  1S6Z A;  3CGL A;  2VVI A;  4M9V C;  2A54 B;  4ZF4 A;  2EN1 A;  4IK1 A;  2ELZ A;  4EMQ A;  2ZO6 A;  3NT9 A;  3CD1 A;  2EM8 A;  4F2J C;  3NF0 A;  1H6R A;  4W6D A;  5EJU A;  1X6F A;  2EP3 A;  3LVA A;  1UIS A;  3S05 A;  4UTS A;  2YRM A;  2YSO A;  4W6L A;  1JK1 A;  3PJ7 A;  2EL4 A;  4W77 A;  2H5O A;  4Q7R A;  3DPZ A;  5FHV A;  4XOW A;  5KL3 A;  2DGC A;  3OSQ A;  2AHA A;  3U0K A;  1DGC A;  2DUH A;  4LQU A;  4R6D A;  1JBZ A;  1EMC A;  1YSA C;  3U8C A;  2FL1 A;  4DXI A;  2LCE A;  1XAE A;  3SVN A;  3SG4 A;  3TMT A;  2EN8 A;  5KL7 A;  2Z6Z A;  1A1H A;  5H88 A;  2DUF A;  3DQ6 A;  3EK4 A;  4R2R A;  1BB8 A;  5DTZ A;  2WCC 3;  2DUI A;  4XVP A;  2EJ4 A;  2BTJ A;  3LF3 A;  4W6B A;  1YHI A;  4IZN A;  4KAG A;  2EN6 A;  2EN3 A;  4ORN A;  4PPJ A;  2WUR A;  3DQE A;  4W73 A;  4HQ8 A;  2YU5 A;  3CFH A;  2WHS A;  3EKH A;  3DQ9 A;  2WHU A;  2EOS A;  1LLM C;  4W6F A;  1YHH A;  2EM9 A;  2EOQ A;  4IJD A;  2VZX A;  3CBE A;  2RSI A;  5EB7 A;  4J89 A;  2IE2 A;  1ZGQ A;  2CT1 A;  1W7S A;  1XA9 A;  2QLG A;  3BXA A;  2FZU A;  3OGO A;  2H5P A;  3CFA A;  5FVG A;  3GEX A;  4RYS A;  5KL2 A;  2Z6Y A;  4KEX A;  3OSR A;  4W7A A;  3SG2 A;  1ZR9 A;  3W1C A;  4R6B A;  3KCT A;  1OXD A;  2GHF A;  4LQT A;  4R2D A;  3SST A;  1TF6 A;  4Z4K A;  2QRF A;  2AWL A;  3SVC A;  2VAE A;  2YTE A;  2POX A;  2HCG A;  3SVU A;  4W7X A;  2EM0 A;  1EME A;  1QXT A;  1H4U A;  1WJP A;  5BTT A;  2WBT A;  2EMZ A;  2M9A A;  3ST4 A;  4EDS A;  1AAY A;  2EN7 A;  4W7E A;  4AR7 A;  2RPC A;  2EOM A;  3UK3 C;  4IK8 A;  4IK9 A;  3U0M A;  1P47 A;  3SV5 A;  1EMB A;  2D9H A;  5EHU A;  3U0N A;  1UBD C;  2AH8 A;  4OHS A;  4FK5 C;  5DTL A;  3VHT A;  5KL5 A;  3SVS A;  4W72 A;  4J88 A;  3O78 A;  2DRP A;  2EMD A;  1JC0 A;  4DXO A;  5LTR A;  2EOZ A;  2H9W A;  3P8U A;  4KW9 A;  3E5W A;  2PRT A;  1A1I A;  3VK1 A;  4H3N A;  4JFG A;  2PXW A;  2EOH A;  2DMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...