3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
3UK3C 2A56B 2VZXA 5J2OA 4ZB1A 5HZOA 2Z6YA 2EORA 5DPJA 3MHHC 4P76A 2EOMA 2EOFA 2DLKA 1W7SA 4W72A 2HGDA 1JBYA 2FL1A 4H3MA 2GHFA 2Q6PA 1G2DC 4B30A 1YFPA 3SG5A 1BFPA 2OKWA 2QU1A 4HQCA 2JP9A 2A52B 3PJ5A 4W6PA 2GW4B 3SVUA 3ZTFA 4IK1A 3DQUA 3DQ7A 4R2PA 3W1DA 3DQEA 4L12A 3WLCA 2EJ4A 2EM9A 2EOQA 2A54B 5F9GA 1H4UA 4JF9A 2AH8A 3VHTA 2YE1A 3U8AA 1MOUA 3NT9A 4FK5C 3WLDA 3DQLA 1AAYA 1Q4DA 2DD9A 4DXOA 2EOYA 3AI4A 2DUGA 3BXBA 2EMKA 1BB8A 2NABA 4PPJA 3ST4A 1Q4CA 3CB9A 5DPIA 3CBEA 3OGOA 4IS1C 3DQ5A 2PRTA 2WSNA 3U0LA 1ZGPA 2FWQA 3EKJA 3KCSA 3U8CA 1XAEA 1ZR9A 4N3DA 3SSYA 2IB5A 2EN6A 2RSIA 3E5WA 2EMHA 5BQLA 3S05A 3SVNA 2HRSA 1UBDC 3GL4A 4ZBLA 2J7JA 2EMWA 5HW9A 2WIQA 4KAGA 2QZ0A 1ZUXA 2H5OA 4W76A 4EDOA 1Q4BA 3DQ4A 4NWSA 3DQ6A 2AWMA 3NEDA 2HFCA 3M99B 5H89A 2WHTA 2YTNA 5DTYA 4KW4A 2Y0GA 2V4EC 2LO3A 2IB6A 4DKNA 4J8AA 5LTRA 4W7CA 5KL7A 4LW5A 4KEXA 2MKDA 2Q57A 3CFAA 4XOVA 3SSHA 4Q7RA 4GESB 2WBSA 2MKNA 3DPWA 2V4EA 3DQFA 3SG2A 2ENCA 1Q73A 4JC2A 1XMZA 3ZULA 2YTPA 4HVFA 2DUEA 1S6ZA 1GL4A 2WSOA 5EXBA 4W6CA 1EMAA 3SV5A 4H48A 4B5YA 1C4FA 2EQ1A 1Q4EA 4GF6B 5EXUA 2G2SB 2VVJA 1ZGOA 2EM0A 4J88A 2AWJA 3SVOA 4R2EA 2O2BA 1QXTA 5DTXA 5KL4A 2G3DB 1OXDA 1TF6A 3OSQA 3U0KA 4W6AA 3OSRA 2VAEA 4GOBA 4R2QA 1A1GA 3DQHA 1JBZA 5HZSA 4KGFA 1QYFA 2WHSA 2DD7A 2HQZA 4Q7TA 3EK8A 2HCGA 2HJOA 4P1QA 1F0BA 1Z1BA 2ZMWA 2A25A 3M24A 3H1RA 4I2YA 2EM5A 2EM3A 3BXCA 2EPZA 3NT3A 4R6DA 4W7RA 2IE2A 4W6JA 4WSGA 2EPAA 2EOZA 3GB3A 4W6SA 3P8UA 1KP5A 3ST0A 5BTTB 2QRFA 2EM4A 1X5WA 4HQ9A 4W6MA 2YTFA 4LQTA 3WCKA 4ZIOA 4W6OA 2EMBA 4OQWA 1P47A 3PJ7A 2DUHA 4KA9A 3EVPA 3DPZA 3DQMA 3LVCA 4H3NA 4XL5A 4W6TA 2ENAA 3DQKA 4R2AA 4IK3A 5KL2A 3NF0A 2OJKA 5KL6A 4JGEA 2YTOA 3LF3A 2EM2A 4IJDA 3TMRA 1TF3A 4L13A 2E72A 2H5QA 4DXIA 4H47A 3DPXA 4W6LA 4BDUA 2EN3A 3E5TA 4W74A 4ZINA 1RMOA 2MDGA 4R2RA 5H87A 1ZU1A 4RYWA 1QY3A 2G6YA 5DTZA 3SSPA 2I13A 2EN4A 4W6HA 3IR8A 2EMAA 4LJDC 1Z1PA 4PPLA 4W6RA 1MEYC 2OGRA 4W6UA 2B3QA 2YTJA 1JC0A 1KYSA 2LCEA 2G6EA 3VICA 1EMFA 2CSHA 3IP2A 4OJ0A 2LT7A 4TZGA 4PFEA 4LJDA 1F09A 2DDDA 3EPKA 1ZGQA 2EL4A 1EMEA 2EM6A 3DQAA 2OTEA 2PXSA 4GZNC 3GJ1A 1G7KA 2EMGA 3SVDA 1JC1A 1GFLA 4W7AA 5DRGA 2EMCA 5EB7A 4Q9WA 5FVIA 2EMZA 2YDZA 4Z4MA 5EBJA 3SG4A 3SG7A 3TMTA 4IK4A 2JADA 4W6BA 3SSKA 2EMLA 1F2IG 2WBTA 2EM8A 1OXEA 1RMPA 1YHHA 5LTQA 2YRKA 1YZWA 3DQ9A 1UN6B 2H9WA 2POXA 4DXQA 2EOIA 1YJ2A 4W75A 2WURA 4W6DA 2YTQA 2YSPA 4XGYA 2EPRA 3V3DA 3LF4B 2H5RA 2HPWA 2WHUA 2EP3A 5LK4A 2A53B 2VRDA 4KPIA 5DQMA 5EHUA 3AKOA 2YTEA 2EN1A 2EMOA 4W77A 3DQDA 3SSVA 2YRMA 2YTIA 4TZAA 2A50B 3CFFA 4H3LA 2Z6ZA 3A8SA 2VVHA 4ANJA 2EPUA 3RWAA 2VVIA 1RMMA 2WISA 2G5ZB 4XOWA 2AHAA 2EN7A 1Q4AA 5DRFA 3M22A 2OTBA 2EQ0A 2QT2A 3W1CA 3LVDA 2EL5A 5BTTA 2GX2A 1CV7A 2YTGA 2GW3A 2EMYA 2A48A 3SVSA 2O24A 2EPXA 1KYRA 2JPAA 2PXWA 3LS3A 1KJKA 4OHSA 4W7FA 5EJUA 1YJFA 4W73A 4EDSA 4U2VA 2EN2A 2EMFA 5DQBA 2EE8A 2AWLA 3DQIA 1OXFA 4M9VC 4W6IA 3DQNA 1QYOA 2WBUA 4PPKA 1H6RA 2EOSA 3VK1A 4DXMA 5HZUA 2LV2A 1HCJA 2YU5A 1EMMA 4KW8A 2EOOA 2H5PA 2B3PA 2QLGB 4X9JA 2IOVA 1GGXA 1X6FA 1B69A 3DQ2A 2GLIA 3EPLA 3EK4A 2EOXA 1A1FA 4ZF5A 2DGCA 4W7XA 2DUIA 3SS0A 5KL5A 4UTSA 4IZNA 2H8QA 5BT0A 1A1HA 2A47A 1QYQA 3U0NA 1YUJA 3P28A 4XVPA 1G2FC 1TN9A 1W7UA 2Z6XA 4LQUA 5AQBB 4F6NA 1XA9A 3EK7A 2EN8A 3O78A 2R1FA 2DMIA 2C9JA 2OKYA 3U8PA 1X3CA 4J89A 3SG3A 4EN1A 2ELZA 1KYPA 2EMIA 5DPGA 4LJCA 4R2CA 2HGYA 3DQJA 2A46A 2ZO7A 3SSTA 5H88A 2FZUA 2CT1A 2M9AA 5DTLA 2RPCA 2Z1OA 4B30B 4LJBA 5HBDA 1A1IA 3ST2A 2VADA 5EB6A 2YU8A 3CGLA 3SVRA 4KF5C 3LSAA 2YE0A 1B9CA 3CFHA 3AI5A 4DXNA 2EL6A 3DQOA 1YHIA 1XSSA 1YHGA 3ADFA 3SVBA 1BBOA 1DGCA 4OY4A 2EOEA 4L1IA 4R2DA 3SSLA 2DLQA 3EPJA 2P4MA 4W6GA 4JFGA 1YUIA 3GEXA 5T3IA 2ELYA 1Z1QA 4KF5A 5FHVA 3ST3A 3VHTB 2YTDA 2QLEA 5FVGA 2YSOA 2O29A 2EPPA 2LVHA 1JK2A 2EPCA 4ZF4A 1EMGA 2ZO6A 1EMKA 3NEZA 3SG6A 3O77A 5DU0A 4W69A 2EQ3A 4W7EA 1EMLA 1X6HA 3EKHA 3BXAA 4R6BA 1UISA 3UG0A 3ZUJA 2EOHA 2GX0A 2QLHA 2ENHA 4ZFSA 2DRPA 3PJBA 4DXPA 2EOJA 2G6XA 3LA1A 1LLMC 3CD9A 3PIBA 3MHSC 1RM9A 1RRXA 1HUYA 2EMDA 2ZMUA 3CD1A 2ADRA 2CTDA 4F2JC 3G9AA 3SRYA 2DDCA 4HE4A 1A1LA 4RTCA 1EMBA 4JRBA 5DY6A 4AS8A 2D9HA 3H1OA 1W7TA 3GJ2A 3ZUFA 4F6MA 4W7DA 1X6EA 1MOVA 5FVFA 2EMXA 1JK1A 1RMDA 4KF4A 2BTJA 1ZAAC 3I19A 3DQ1A 1XQMA 1EMCA 4W6KA 2WCC3 3SVCA 3UFZA 3MGFA 4HQ8A 1MYWA 5KTGA 1A1JA 3E5VA 1WJPA 4KGEA 2QLGA 2DUFA 2EMNA 2YFPA 3DQ3A 2C9IA 3KCTA 5LTPA 4DKMA 5HZTA 5EXCI 2EM7A 3DQCA 5DPHA 2HGHA 4W6NA 2G3OA 4RYSA 4R2SA 3EVVA 4IK8A 4KW9A 4Q7UA 4IK9A 4Z4KA 5HGEA 2YRHA 4EULA 3ED8A 2HQKA 2RH7A 5KL3A 3EVUA 4ORNA 2AWKA 2QLIA 2V4EB 3DQ8A 1NCSA 3RWTA 4AR7A 4W6FA 1A1KA 3EPHA 3EVRA 3K1KA 4IK5A 4ZF3A 3LVAA 4JEOA 2BB8A 4EMQA 2ICRA 1YSAC 3SVEA 2ARLA 4OGSA 3U0MA 2H6VA 2G16B 3BX9A 4Q9XA
chains in the Genus database with same CATH superfamily
4BC7A 3UK3C 3AV0A 2A56B 2VZXA 5J2OA 2WZOA 4X8WA 5CFFE 2GPIA 1EKZA 4ZB1A 5HZOA 2Z6YA 2EORA 4LF5E 5DPJA 3MHHC 2L2MA 4JI3E 4P76A 2EOMA 3AUZA 2V83A 4KZSA 2EOFA 2DLKA 4NHRA 1W7SA 1PJQA 4W72A 2HGDA 1JBYA 2FL1A 4H3MA 2GHFA 2Q6PA 4JI1E 1YYOA 4DV2E 2N3GA 4DV6E 1G2DC 2VQFE 4B30A 4RHBB 1YFPA 3SG5A 1BFPA 2OKWA 2QU1A 4HQCA 2JP9A 1IBKE 4O4KA 3IWDA 2A52B 3PJ5A 4W6PA 2GW4B 3SVUA 5TSEA 3ZTFA 4DR4E 4IK1A 2ODRD 3DQUA 1N3GA 3DQ7A 4R2PA 1N34E 3W1DA 3DQEA 4L12A 3WLCA 2EJ4A 2JWOA 4LTYA 4DMIA 1X47A 2EM9A 2EOQA 2A54B 5F9GA 1H4UA 4JF9A 2JVAA 2KOUA 4NZVA 2AH8A 3VHTA 2YE1A 3U8AA 1MOUA 4LU9A 3NT9A 5FLXC 1SR9A 4FK5C 3WLDA 3DQLA 2Q8UA 1AAYA 1WHQA 2DIXA 3J80C 1Q4DA 2DD9A 4DXOA 2EOYA 3AI4A 4WXDA 4L8NA 3BGHA 4GKJE 2DUGA 3BXBA 2EMKA 2VF1A 1BB8A 2NABA 4PPJA 3ST4A 3TQMA 1Q4CA 1T4LB 3CB9A 2LE2A 4LF6E 1UHZA 5DPIA 2IHR1 3CBEA 3OGOA 4IS1C 3DQ5A 3RMPA 3QG5C 1WXRA 2PRTA 2EPOA 2WSNA 3U0LA 4Q28A 1L4SA 1ZGPA 2FWQA 1T38A 3EKJA 3KCSA 2NUEA 3U8CA 1XAEA 1ZR9A 4N3DA 3SSYA 2IB5A 2EN6A 2RSIA 3E5WA 2EMHA 5BQLA 3S05A 3SVNA 2HRSA 1UBDC 3GL4A 4ZBLA 2J7JA 2UU9E 1J5EE 2EMWA 5HW9A 2WIQA 4DV0E 4KAGA 2M7QA 2QZ0A 1ZUXA 2H5OA 4W76A 1IBME 1PDAA 2VE7C 4EDOA 1Q4BA 3DQ4A 4NWSA 3DQ6A 3T1HE 1YFHA 2AWMA 5A6BD 3NEDA 5LMNE 2HFCA 4JI4E 2JYAA 3M99B 5H89A 4K0KE 4O43A 2WHTA 1BBGA 4OX9E 2YTNA 5DTYA 1NEIA 2JY9A 4KW4A 2Y0GA 4LF9E 4M2ZA 2V4EC 3J81C 2LO3A 1FKAE 2IB6A 1EH6A 4DKNA 4J8AA 5LTRA 4W7CA 5KL7A 4LW5A 4KEXA 2LRSA 2MKDA 4F54A 2Q57A 1WHNA 4I8OA 5IWAE 4DV5E 1XMOE 4O24A 4WSPA 3CFAA 4XOVA 3SSHA 4Q7RA 4GESB 4ZYDA 2WBSA 2H36X 3DPWA 4YY3E 2MKNA 2V4EA 3DQFA 3SG2A 2ENCA 1Q73A 4JC2A 1XMZA 3ZULA 1XNQE 2YTPA 4HVFA 2DUEA 1S6ZA 1GL4A 1PKPA 1IMUA 2WSOA 5EXBA 4W6CA 2LTRA 1EMAA 3SV5A 4H48A 4B5YA 4BBYA 1HNXE 1C4FA 2EQ1A 1Q4EA 4RH8A 2L8TA 4GF6B 5EXUA 2G2SB 2VVJA 4DR7E 1ZGOA 4WFTA 2EM0A 4J88A 2AWJA 3SVOA 4R2EA 2O2BA 1QXTA 5DTXA 3DF6A 5KL4A 2G3DB 1OXDA 1TF6A 2DMYA 3OSQA 3U0KA 2B3TB 4W6AA 1PJTA 1T39A 2EZ6A 3OSRA 4WXCA 2HJJA 2VAEA 4GOBA 4R2QA 1A1GA 2L2KB 2LTSA 3DQHA 1JBZA 5AE1A 2EPLX 5HZSA 4KGFA 1QYFA 2WHSA 2DD7A 2HQZA 4Q7TA 3H09A 4GEQB 3EK8A 1STUA 2HCGA 2HJOA 4P1QA 1F0BA 3LMLA 1Z1BA 1YYWA 4DR6E 2RQLA 1IQSA 4LFBE 1ZBQA 2ZMWA 2L92A 2A25A 3M24A 3H1RA 4I2YA 2EM5A 2EM3A 3BXCA 2EPZA 3NT3A 4R6DA 4W7RA 2IE2A 4W6JA 4WSGA 4DUYE 2EPAA 2EOZA 3GB3A 4W6SA 3P8UA 1KP5A 3ST0A 5BTTB 2QRFA 2EM4A 2L3JA 2G7HA 1X5WA 5F3WA 4J8ZA 4HQ9A 4F9CB 4W6MA 1EH7A 4LQTA 3WCKA 4ZIOA 4W6OA 2EMBA 2YTFA 3LLHA 5IXMB 4OQWA 1P47A 3PJ7A 2DUHA 4KA9A 3EVPA 1O0WA 3DPZA 2NUFA 3DQMA 1GTKA 3LVCA 4H3NA 4XL5A 4W6TA 2ENAA 3DQKA 5IT9C 4R2AA 4IK3A 5KL2A 4OOGC 3NF0A 2DB2A 5AE3A 2OJKA 5KL6A 3T1YE 4JGEA 4JI7E 2YTOA 3LF3A 1AH5A 2EM2A 4IJDA 3TMRA 2V8QB 2FTXB 1TF3A 4NXNE 2UUBE 4L13A 2EWLA 2E72A 2H5QA 4DXIA 4H47A 3DPXA 4W6LA 4BDUA 2EN3A 3E5TA 2L6MA 4W74A 4ZINA 4AQYE 1RMOA 2MDGA 4R2RA 4KHPE 5H87A 1ZU1A 4RYWA 2MC6A 2YWQA 3HTXA 1QY3A 2G6YA 5DTZA 3SSPA 2I13A 2EN4A 2K4VA 4W6HA 1RC7A 1XMQE 3IR8A 2LJHA 2EMAA 4LJDC 1Z1PA 4PPLA 4W6RA 1HR0E 1MEYC 2OGRA 4W6UA 2B3QA 2YTJA 3BIDA 1JC0A 1KYSA 1MGTA 1ZBTA 2LCEA 2G6EA 3VICA 2V89A 1EMFA 2CSHA 3IP2A 4OJ0A 4LF4E 4JI5E 2LT7A 4TZGA 4PFEA 1HNWE 4LJDA 1F09A 2RTXA 2DDDA 3EPKA 3MHSC 1ZGQA 2EL4A 3IWCA 1EMEA 2EM6A 4BMJA 3ECRA 3DQAA 2OTEA 2PXSA 4GZNC 3GJ1A 1G7KA 2EMGA 3SVDA 1JC1A 4M0VA 4JV5E 2HC5A 1GFLA 4W7AA 5DRGA 2EMCA 5EB7A 4F9BB 4Q9WA 5FVIA 2EMZA 5AASA 2YDZA 4Z4MA 5ADZA 5EBJA 3SG4A 3SG7A 1SFEA 1EH8A 3TMTA 4IK4A 3HQ1A 4GKKE 2JADA 4W6BA 3SSKA 2YPNA 1I94E 2LUQA 2EMLA 1F2IG 4NXME 2B9DA 1YPNA 5A6AA 2WBTA 4BHBA 4BC9A 3KZZA 2N3HA 4JI2E 2EM8A 1OXEA 1RMPA 1YHHA 4DR3E 3KZYA 5LTQA 2YRKA 1YZWA 4DV4E 2I9IA 4ZYGA 3DQ9A 1UN6B 3ADIA 2E5LE 2H9WA 2POXA 4DXQA 2EOIA 1YJ2A 4W75A 2WURA 4W6DA 2YTQA 2YSPA 4XGYA 4X65E 4R03A 2BBGA 2EPRA 4DKKA 1XNRE 3V3DA 1RQ0A 3LF4B 2H5RA 2HPWA 2WHUA 2EP3A 5LK4A 2A53B 2VRDA 4KPIA 5DQMA 5EHUA 4ZYHA 4X62E 3AKOA 2YTEA 2HHHE 2EN1A 3HXLA 4B3ME 2EMOA 4W77A 3DQDA 3SSVA 1UILA 2YRMA 3C6KA 2YTIA 4TZAA 2A50B 3CFFA 4H3LA 2Z6ZA 3A8SA 2VVHA 1X48A 1FJGE 4ANJA 2EPUA 5A6BA 2NUGA 3RWAA 2VVIA 1RMMA 2WISA 2JOXA 4P78A 2G5ZB 4XOWA 2AHAA 2EN7A 1Q4AA 5DRFA 2UUCE 3M22A 2OTBA 2EQ0A 2QT2A 3W1CA 3LVDA 2EL5A 5BTTA 2GX2A 1CV7A 2YTGA 2GW3A 2EMYA 2A48A 3SVSA 3FIGA 3ZOQB 2O24A 1YUJA 2YT4A 2EPXA 1KYRA 2V85A 2EPMX 2EPNA 2JPAA 2PXWA 3LS3A 1KJKA 4OHSA 4W7FA 3BF2A 5EJUA 3L00A 1YJFA 4W73A 4EDSA 4U2VA 5IV8B 2EN2A 2EMFA 2M1SA 4ZYEA 5DQBA 2EE8A 2AWLA 3DQIA 1OXFA 4M9VC 4W6IA 4MLVA 4BCAA 3DQNA 1QYOA 2WBUA 4PPKA 1GZ6A 1H6RA 2EOSA 3VK1A 2RSMA 3KWRA 4DXMA 5HZUA 2LV2A 4MLQA 1HNZE 1HCJA 3J7Yp 2YU5A 1EMMA 4KW8A 3DJWA 4JYAE 4HTGA 2EOOA 2H5PA 2B3PA 2QLGB 4X9JA 2IOVA 1GGXA 1X6FA 3THOB 4Q35B 1B69A 2L2NA 3DQ2A 2GLIA 2JR1A 4P7DA 1N36E 3EPLA 3EK4A 4WPYA 2FV4B 2EOXA 1A1FA 4ZF5A 5AE2A 2DGCA 1PJSA 4W7XA 2DUIA 3SS0A 2VQEE 5KL5A 4UTSA 4IZNA 2H8QA 5BT0A 3C6MA 1A1HA 1GQEA 2A47A 1QYQA 3U0NA 1KYQA 4L5NC 4DV3E 3P28A 4XVPA 3C4TA 1G2FC 1W7UA 1TN9A 2Z6XA 4LQUA 5AQBB 4LF7E 4F6NA 1XA9A 3EK7A 2EN8A 3O78A 2DSYA 1DI2A 2R1FA 2DMIA 2C9JA 2OKYA 3U8PA 1X3CA 3VYYA 4J89A 3SG3A 4EN1A 2ELZA 1KYPA 2EMIA 4LFAE 2B7VA 5DPGA 4LJCA 2ODRC 3ADJA 4R2CA 3VYXA 2HGYA 3DQJA 2A46A 2ZO7A 3SSTA 1N33E 5H88A 2FZUA 2CT1A 4BHCA 4X66E 5A6JA 2M9AA 3IWBA 5DTLA 4DR2E 2F4VE 2RPCA 2F8BA 2Z1OA 4B30B 5DNYA 4LJBA 5LL6R 5HBDA 2UUAE 1A1IA 3ST2A 2VADA 2UXCE 5EB6A 2YU8A 3CGLA 3SVRA 1X49A 1N32E 4KF5C 3LSAA 2YE0A 1B9CA 3CFHA 2L33A 3AI5A 4DXNA 2EL6A 2N8XA 3DQOA 3MSWA 1YHIA 5A69A 1XSSA 1YHGA 3ADFA 3SVBA 1BBOA 1DGCA 2MDRA 4OY4A 2EOEA 4DV1E 3J7AG 4L1IA 4R2DA 4JI6E 3SSLA 2DLQA 4TUIA 3EPJA 2P4MA 4W6GA 3HPZA 4JFGA 1YUIA 3GEXA 5T3IA 2ELYA 1Z1QA 4KF5A 5FHVA 3ST3A 3VHTB 2YTDA 2QLEA 5FVGA 2YSOA 2O29A 1T4OA 2EPKX 2EPPA 2LVHA 1J26A 2MC5A 2LBSB 4B3TE 1JK2A 2EPCA 4ZF4A 1EMGA 4JI8E 4JI0E 1YZ9A 4X64E 1IQOA 2ZO6A 4TUGA 1EMKA 3NEZA 3SG6A 2NA2A 3O77A 3THNA 4M30A 2FGGA 4BS9A 5DU0A 5LMUE 4W69A 2EQ3A 4DR1E 4W7EA 2UXDE 1EMLA 1X6HA 3EKHA 3BXAA 2LJUA 4R6BA 1UISA 3UG0A 3ZUJA 2EOHA 3F6HA 2GX0A 2UXBE 2QLHA 3P1XA 2ENHA 4ZFSA 3JAMC 3PJBA 2DRPA 4DXPA 2EOJA 2G6XA 2LUPB 3JTZA 3LA1A 2E1MA 5A2QC 2LMZA 1LLMC 3CD9A 5LLQA 3PIBA 2JOBA 1RM9A 1RRXA 1HUYA 2EMDA 2ZMUA 3CD1A 2ADRA 2CTDA 3HPSA 3G9AA 3SRYA 4F2JC 2DDCA 4HE4A 1A1LA 4RTCA 3JU0A 1EMBA 3K6QA 3BBGA 4JRBA 5DY6A 2M4IA 2KONA 4AS8A 2D9HA 2V88A 3H1OA 4F9AB 1W7TA 3GJ2A 3ZUFA 1QNTA 5A6KA 3F6GA 4F6MA 4W7DA 1X6EA 4YHHE 4KWYA 1MOVA 5FVFA 2EMXA 4WX9A 1JK1A 1RMDA 3EQ1A 4WYQB 4LFCE 4KF4A 2BTJA 4DV7E 1ZAAC 3I19A 3OMLA 4N4RB 5BR8E 3DQ1A 1XQMA 1EMCA 4W6KA 2WCC3 5AC5A 3SVCA 3UFZA 3MGFA 1T4NA 5T6JA 4HQ8A 1MYWA 4O5GA 4B3RE 5KTGA 2L3CA 1A1JA 3E5VA 1WJPA 4KGEA 2V87A 5AC4A 2JXPA 4B3SE 2QLGA 2DUFA 2EMNA 2YFPA 3DQ3A 2C9IA 3KCTA 5LTPA 4DKMA 5HZTA 5EXCI 2EM7A 3DQCA 5DPHA 2HGHA 1IBLE 4W6NA 2G3OA 2K7IA 4RYSA 2YZTA 2CPNA 3EVVA 4R2SA 4IK8A 1WRJA 3ADLA 4KW9A 4Q7UA 4IK9A 4Z4KA 5HGEA 1QU6A 2YRHA 4EULA 3VK6A 3ED8A 2HQKA 2RH7A 5KL3A 3EVUA 4ORNA 2AWKA 2QLIA 2V4EB 3ADGA 3DQ8A 1NCSA 3RWTA 2KHXA 3C4BA 4DUZE 4AR7A 4W6FA 1DQ3A 1A1KA 4DR5E 2V86A 3EPHA 3EVRA 2R76A 1YYKA 2RS7A 3K1KA 4IK5A 4ZF3A 3LVAA 4JEOA 2BB8A 4R8OA 3OTOE 4EMQA 2ICRA 4HEIA 2ZM6E 3SVEA 2ARLA 4OGSA 1YSAC 2B7TA 2RS6A 3U0MA 4LF8E 2H6VA 2G16B 3BX9A 4Q9XA
chains in the Genus database with same CATH topology
3UK3C 2A56B 2VZXA 5J2OA 4ZB1A 5HZOA 2Z6YA 2EORA 5DPJA 3MHHC 4P76A 2EOMA 2EOFA 2DLKA 1W7SA 4W72A 2HGDA 1JBYA 2FL1A 4H3MA 2GHFA 2Q6PA 1G2DC 4B30A 1YFPA 3SG5A 1BFPA 2OKWA 2QU1A 4HQCA 2JP9A 2A52B 3PJ5A 4W6PA 2GW4B 3SVUA 3ZTFA 4IK1A 3DQUA 3DQ7A 4R2PA 3W1DA 3DQEA 4L12A 3WLCA 2EJ4A 2EM9A 2EOQA 2A54B 5F9GA 1H4UA 4JF9A 2AH8A 3VHTA 2YE1A 3U8AA 1MOUA 3NT9A 4FK5C 3WLDA 3DQLA 1AAYA 1Q4DA 2DD9A 4DXOA 2EOYA 3AI4A 2DUGA 3BXBA 2EMKA 1BB8A 2NABA 4PPJA 3ST4A 1Q4CA 3CB9A 5DPIA 3CBEA 3OGOA 4IS1C 3DQ5A 2PRTA 2WSNA 3U0LA 1ZGPA 2FWQA 3EKJA 3KCSA 3U8CA 1XAEA 1ZR9A 4N3DA 3SSYA 2IB5A 2EN6A 2RSIA 3E5WA 2EMHA 5BQLA 3S05A 3SVNA 2HRSA 1UBDC 3GL4A 4ZBLA 2J7JA 2EMWA 5HW9A 2WIQA 4KAGA 2QZ0A 1ZUXA 2H5OA 4W76A 4EDOA 1Q4BA 3DQ4A 4NWSA 3DQ6A 2AWMA 3NEDA 2HFCA 3M99B 5H89A 2WHTA 2YTNA 5DTYA 4KW4A 2Y0GA 2V4EC 2LO3A 2IB6A 4DKNA 4J8AA 5LTRA 4W7CA 5KL7A 4LW5A 4KEXA 2MKDA 2Q57A 3CFAA 4XOVA 3SSHA 4Q7RA 4GESB 2WBSA 2MKNA 3DPWA 2V4EA 3DQFA 3SG2A 2ENCA 1Q73A 4JC2A 1XMZA 3ZULA 2YTPA 4HVFA 2DUEA 1S6ZA 1GL4A 2WSOA 5EXBA 4W6CA 1EMAA 3SV5A 4H48A 4B5YA 1C4FA 2EQ1A 1Q4EA 4GF6B 5EXUA 2G2SB 2VVJA 1ZGOA 2EM0A 4J88A 2AWJA 3SVOA 4R2EA 2O2BA 1QXTA 5DTXA 5KL4A 2G3DB 1OXDA 1TF6A 3OSQA 3U0KA 4W6AA 3OSRA 2VAEA 4GOBA 4R2QA 1A1GA 3DQHA 1JBZA 5HZSA 4KGFA 1QYFA 2WHSA 2DD7A 2HQZA 4Q7TA 3EK8A 2HCGA 2HJOA 4P1QA 1F0BA 1Z1BA 2ZMWA 2A25A 3M24A 3H1RA 4I2YA 2EM5A 2EM3A 3BXCA 2EPZA 3NT3A 4R6DA 4W7RA 2IE2A 4W6JA 4WSGA 2EPAA 2EOZA 3GB3A 4W6SA 3P8UA 1KP5A 3ST0A 5BTTB 2QRFA 2EM4A 1X5WA 4HQ9A 4W6MA 2YTFA 4LQTA 3WCKA 4ZIOA 4W6OA 2EMBA 4OQWA 1P47A 3PJ7A 2DUHA 4KA9A 3EVPA 3DPZA 3DQMA 3LVCA 4H3NA 4XL5A 4W6TA 2ENAA 3DQKA 4R2AA 4IK3A 5KL2A 3NF0A 2OJKA 5KL6A 4JGEA 2YTOA 3LF3A 2EM2A 4IJDA 3TMRA 1TF3A 4L13A 2E72A 2H5QA 4DXIA 4H47A 3DPXA 4W6LA 4BDUA 2EN3A 3E5TA 4W74A 4ZINA 1RMOA 2MDGA 4R2RA 5H87A 1ZU1A 4RYWA 1QY3A 2G6YA 5DTZA 3SSPA 2I13A 2EN4A 4W6HA 3IR8A 2EMAA 4LJDC 1Z1PA 4PPLA 4W6RA 1MEYC 2OGRA 4W6UA 2B3QA 2YTJA 1JC0A 1KYSA 2LCEA 2G6EA 3VICA 1EMFA 2CSHA 3IP2A 4OJ0A 2LT7A 4TZGA 4PFEA 4LJDA 1F09A 2DDDA 3EPKA 1ZGQA 2EL4A 1EMEA 2EM6A 3DQAA 2OTEA 2PXSA 4GZNC 3GJ1A 1G7KA 2EMGA 3SVDA 1JC1A 1GFLA 4W7AA 5DRGA 2EMCA 5EB7A 4Q9WA 5FVIA 2EMZA 2YDZA 4Z4MA 5EBJA 3SG4A 3SG7A 3TMTA 4IK4A 2JADA 4W6BA 3SSKA 2EMLA 1F2IG 2WBTA 2EM8A 1OXEA 1RMPA 1YHHA 5LTQA 2YRKA 1YZWA 3DQ9A 1UN6B 2H9WA 2POXA 4DXQA 2EOIA 1YJ2A 4W75A 2WURA 4W6DA 2YTQA 2YSPA 4XGYA 2EPRA 3V3DA 3LF4B 2H5RA 2HPWA 2WHUA 2EP3A 5LK4A 2A53B 2VRDA 4KPIA 5DQMA 5EHUA 3AKOA 2YTEA 2EN1A 2EMOA 4W77A 3DQDA 3SSVA 2YRMA 2YTIA 4TZAA 2A50B 3CFFA 4H3LA 2Z6ZA 3A8SA 2VVHA 4ANJA 2EPUA 3RWAA 2VVIA 1RMMA 2WISA 2G5ZB 4XOWA 2AHAA 2EN7A 1Q4AA 5DRFA 3M22A 2OTBA 2EQ0A 2QT2A 3W1CA 3LVDA 2EL5A 5BTTA 2GX2A 1CV7A 2YTGA 2GW3A 2EMYA 2A48A 3SVSA 2O24A 2EPXA 1KYRA 2JPAA 2PXWA 3LS3A 1KJKA 4OHSA 4W7FA 5EJUA 1YJFA 4W73A 4EDSA 4U2VA 2EN2A 2EMFA 5DQBA 2EE8A 2AWLA 3DQIA 1OXFA 4M9VC 4W6IA 3DQNA 1QYOA 2WBUA 4PPKA 1H6RA 2EOSA 3VK1A 4DXMA 5HZUA 2LV2A 1HCJA 2YU5A 1EMMA 4KW8A 2EOOA 2H5PA 2B3PA 2QLGB 4X9JA 2IOVA 1GGXA 1X6FA 1B69A 3DQ2A 2GLIA 3EPLA 3EK4A 2EOXA 1A1FA 4ZF5A 2DGCA 4W7XA 2DUIA 3SS0A 5KL5A 4UTSA 4IZNA 2H8QA 5BT0A 1A1HA 2A47A 1QYQA 3U0NA 1YUJA 3P28A 4XVPA 1G2FC 1TN9A 1W7UA 2Z6XA 4LQUA 5AQBB 4F6NA 1XA9A 3EK7A 2EN8A 3O78A 2R1FA 2DMIA 2C9JA 2OKYA 3U8PA 1X3CA 4J89A 3SG3A 4EN1A 2ELZA 1KYPA 2EMIA 5DPGA 4LJCA 4R2CA 2HGYA 3DQJA 2A46A 2ZO7A 3SSTA 5H88A 2FZUA 2CT1A 2M9AA 5DTLA 2RPCA 2Z1OA 4B30B 4LJBA 5HBDA 1A1IA 3ST2A 2VADA 5EB6A 2YU8A 3CGLA 3SVRA 4KF5C 3LSAA 2YE0A 1B9CA 3CFHA 3AI5A 4DXNA 2EL6A 3DQOA 1YHIA 1XSSA 1YHGA 3ADFA 3SVBA 1BBOA 1DGCA 4OY4A 2EOEA 4L1IA 4R2DA 3SSLA 2DLQA 3EPJA 2P4MA 4W6GA 4JFGA 1YUIA 3GEXA 5T3IA 2ELYA 1Z1QA 4KF5A 5FHVA 3ST3A 3VHTB 2YTDA 2QLEA 5FVGA 2YSOA 2O29A 2EPPA 2LVHA 1JK2A 2EPCA 4ZF4A 1EMGA 2ZO6A 1EMKA 3NEZA 3SG6A 3O77A 5DU0A 4W69A 2EQ3A 4W7EA 1EMLA 1X6HA 3EKHA 3BXAA 4R6BA 1UISA 3UG0A 3ZUJA 2EOHA 2GX0A 2QLHA 2ENHA 4ZFSA 2DRPA 3PJBA 4DXPA 2EOJA 2G6XA 3LA1A 1LLMC 3CD9A 3PIBA 3MHSC 1RM9A 1RRXA 1HUYA 2EMDA 2ZMUA 3CD1A 2ADRA 2CTDA 4F2JC 3G9AA 3SRYA 2DDCA 4HE4A 1A1LA 4RTCA 1EMBA 4JRBA 5DY6A 4AS8A 2D9HA 3H1OA 1W7TA 3GJ2A 3ZUFA 4F6MA 4W7DA 1X6EA 1MOVA 5FVFA 2EMXA 1JK1A 1RMDA 4KF4A 2BTJA 1ZAAC 3I19A 3DQ1A 1XQMA 1EMCA 4W6KA 2WCC3 3SVCA 3UFZA 3MGFA 4HQ8A 1MYWA 5KTGA 1A1JA 3E5VA 1WJPA 4KGEA 2QLGA 2DUFA 2EMNA 2YFPA 3DQ3A 2C9IA 3KCTA 5LTPA 4DKMA 5HZTA 5EXCI 2EM7A 3DQCA 5DPHA 2HGHA 4W6NA 2G3OA 4RYSA 4R2SA 3EVVA 4IK8A 4KW9A 4Q7UA 4IK9A 4Z4KA 5HGEA 2YRHA 4EULA 3ED8A 2HQKA 2RH7A 5KL3A 3EVUA 4ORNA 2AWKA 2QLIA 2V4EB 3DQ8A 1NCSA 3RWTA 4AR7A 4W6FA 1A1KA 3EPHA 3EVRA 3K1KA 4IK5A 4ZF3A 3LVAA 4JEOA 2BB8A 4EMQA 2ICRA 1YSAC 3SVEA 2ARLA 4OGSA 3U0MA 2H6VA 2G16B 3BX9A 4Q9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UK3 C;  2A56 B;  2VZX A;  5J2O A;  4ZB1 A;  5HZO A;  2Z6Y A;  2EOR A;  5DPJ A;  3MHH C;  4P76 A;  2EOM A;  2EOF A;  2DLK A;  1W7S A;  4W72 A;  2HGD A;  1JBY A;  2FL1 A;  4H3M A;  2GHF A;  2Q6P A;  1G2D C;  4B30 A;  1YFP A;  3SG5 A;  1BFP A;  2OKW A;  2QU1 A;  4HQC A;  2JP9 A;  2A52 B;  3PJ5 A;  4W6P A;  2GW4 B;  3SVU A;  3ZTF A;  4IK1 A;  3DQU A;  3DQ7 A;  4R2P A;  3W1D A;  3DQE A;  4L12 A;  3WLC A;  2EJ4 A;  2EM9 A;  2EOQ A;  2A54 B;  5F9G A;  1H4U A;  4JF9 A;  2AH8 A;  3VHT A;  2YE1 A;  3U8A A;  1MOU A;  3NT9 A;  4FK5 C;  3WLD A;  3DQL A;  1AAY A;  1Q4D A;  2DD9 A;  4DXO A;  2EOY A;  3AI4 A;  2DUG A;  3BXB A;  2EMK A;  1BB8 A;  2NAB A;  4PPJ A;  3ST4 A;  1Q4C A;  3CB9 A;  5DPI A;  3CBE A;  3OGO A;  4IS1 C;  3DQ5 A;  2PRT A;  2WSN A;  3U0L A;  1ZGP A;  2FWQ A;  3EKJ A;  3KCS A;  3U8C A;  1XAE A;  1ZR9 A;  4N3D A;  3SSY A;  2IB5 A;  2EN6 A;  2RSI A;  3E5W A;  2EMH A;  5BQL A;  3S05 A;  3SVN A;  2HRS A;  1UBD C;  3GL4 A;  4ZBL A;  2J7J A;  2EMW A;  5HW9 A;  2WIQ A;  4KAG A;  2QZ0 A;  1ZUX A;  2H5O A;  4W76 A;  4EDO A;  1Q4B A;  3DQ4 A;  4NWS A;  3DQ6 A;  2AWM A;  3NED A;  2HFC A;  3M99 B;  5H89 A;  2WHT A;  2YTN A;  5DTY A;  4KW4 A;  2Y0G A;  2V4E C;  2LO3 A;  2IB6 A;  4DKN A;  4J8A A;  5LTR A;  4W7C A;  5KL7 A;  4LW5 A;  4KEX A;  2MKD A;  2Q57 A;  3CFA A;  4XOV A;  3SSH A;  4Q7R A;  4GES B;  2WBS A;  2MKN A;  3DPW A;  2V4E A;  3DQF A;  3SG2 A;  2ENC A;  1Q73 A;  4JC2 A;  1XMZ A;  3ZUL A;  2YTP A;  4HVF A;  2DUE A;  1S6Z A;  1GL4 A;  2WSO A;  5EXB A;  4W6C A;  1EMA A;  3SV5 A;  4H48 A;  4B5Y A;  1C4F A;  2EQ1 A;  1Q4E A;  4GF6 B;  5EXU A;  2G2S B;  2VVJ A;  1ZGO A;  2EM0 A;  4J88 A;  2AWJ A;  3SVO A;  4R2E A;  2O2B A;  1QXT A;  5DTX A;  5KL4 A;  2G3D B;  1OXD A;  1TF6 A;  3OSQ A;  3U0K A;  4W6A A;  3OSR A;  2VAE A;  4GOB A;  4R2Q A;  1A1G A;  3DQH A;  1JBZ A;  5HZS A;  4KGF A;  1QYF A;  2WHS A;  2DD7 A;  2HQZ A;  4Q7T A;  3EK8 A;  2HCG A;  2HJO A;  4P1Q A;  1F0B A;  1Z1B A;  2ZMW A;  2A25 A;  3M24 A;  3H1R A;  4I2Y A;  2EM5 A;  2EM3 A;  3BXC A;  2EPZ A;  3NT3 A;  4R6D A;  4W7R A;  2IE2 A;  4W6J A;  4WSG A;  2EPA A;  2EOZ A;  3GB3 A;  4W6S A;  3P8U A;  1KP5 A;  3ST0 A;  5BTT B;  2QRF A;  2EM4 A;  1X5W A;  4HQ9 A;  4W6M A;  2YTF A;  4LQT A;  3WCK A;  4ZIO A;  4W6O A;  2EMB A;  4OQW A;  1P47 A;  3PJ7 A;  2DUH A;  4KA9 A;  3EVP A;  3DPZ A;  3DQM A;  3LVC A;  4H3N A;  4XL5 A;  4W6T A;  2ENA A;  3DQK A;  4R2A A;  4IK3 A;  5KL2 A;  3NF0 A;  2OJK A;  5KL6 A;  4JGE A;  2YTO A;  3LF3 A;  2EM2 A;  4IJD A;  3TMR A;  1TF3 A;  4L13 A;  2E72 A;  2H5Q A;  4DXI A;  4H47 A;  3DPX A;  4W6L A;  4BDU A;  2EN3 A;  3E5T A;  4W74 A;  4ZIN A;  1RMO A;  2MDG A;  4R2R A;  5H87 A;  1ZU1 A;  4RYW A;  1QY3 A;  2G6Y A;  5DTZ A;  3SSP A;  2I13 A;  2EN4 A;  4W6H A;  3IR8 A;  2EMA A;  4LJD C;  1Z1P A;  4PPL A;  4W6R A;  1MEY C;  2OGR A;  4W6U A;  2B3Q A;  2YTJ A;  1JC0 A;  1KYS A;  2LCE A;  2G6E A;  3VIC A;  1EMF A;  2CSH A;  3IP2 A;  4OJ0 A;  2LT7 A;  4TZG A;  4PFE A;  4LJD A;  1F09 A;  2DDD A;  3EPK A;  1ZGQ A;  2EL4 A;  1EME A;  2EM6 A;  3DQA A;  2OTE A;  2PXS A;  4GZN C;  3GJ1 A;  1G7K A;  2EMG A;  3SVD A;  1JC1 A;  1GFL A;  4W7A A;  5DRG A;  2EMC A;  5EB7 A;  4Q9W A;  5FVI A;  2EMZ A;  2YDZ A;  4Z4M A;  5EBJ A;  3SG4 A;  3SG7 A;  3TMT A;  4IK4 A;  2JAD A;  4W6B A;  3SSK A;  2EML A;  1F2I G;  2WBT A;  2EM8 A;  1OXE A;  1RMP A;  1YHH A;  5LTQ A;  2YRK A;  1YZW A;  3DQ9 A;  1UN6 B;  2H9W A;  2POX A;  4DXQ A;  2EOI A;  1YJ2 A;  4W75 A;  2WUR A;  4W6D A;  2YTQ A;  2YSP A;  4XGY A;  2EPR A;  3V3D A;  3LF4 B;  2H5R A;  2HPW A;  2WHU A;  2EP3 A;  5LK4 A;  2A53 B;  2VRD A;  4KPI A;  5DQM A;  5EHU A;  3AKO A;  2YTE A;  2EN1 A;  2EMO A;  4W77 A;  3DQD A;  3SSV A;  2YRM A;  2YTI A;  4TZA A;  2A50 B;  3CFF A;  4H3L A;  2Z6Z A;  3A8S A;  2VVH A;  4ANJ A;  2EPU A;  3RWA A;  2VVI A;  1RMM A;  2WIS A;  2G5Z B;  4XOW A;  2AHA A;  2EN7 A;  1Q4A A;  5DRF A;  3M22 A;  2OTB A;  2EQ0 A;  2QT2 A;  3W1C A;  3LVD A;  2EL5 A;  5BTT A;  2GX2 A;  1CV7 A;  2YTG A;  2GW3 A;  2EMY A;  2A48 A;  3SVS A;  2O24 A;  2EPX A;  1KYR A;  2JPA A;  2PXW A;  3LS3 A;  1KJK A;  4OHS A;  4W7F A;  5EJU A;  1YJF A;  4W73 A;  4EDS A;  4U2V A;  2EN2 A;  2EMF A;  5DQB A;  2EE8 A;  2AWL A;  3DQI A;  1OXF A;  4M9V C;  4W6I A;  3DQN A;  1QYO A;  2WBU A;  4PPK A;  1H6R A;  2EOS A;  3VK1 A;  4DXM A;  5HZU A;  2LV2 A;  1HCJ A;  2YU5 A;  1EMM A;  4KW8 A;  2EOO A;  2H5P A;  2B3P A;  2QLG B;  4X9J A;  2IOV A;  1GGX A;  1X6F A;  1B69 A;  3DQ2 A;  2GLI A;  3EPL A;  3EK4 A;  2EOX A;  1A1F A;  4ZF5 A;  2DGC A;  4W7X A;  2DUI A;  3SS0 A;  5KL5 A;  4UTS A;  4IZN A;  2H8Q A;  5BT0 A;  1A1H A;  2A47 A;  1QYQ A;  3U0N A;  1YUJ A;  3P28 A;  4XVP A;  1G2F C;  1TN9 A;  1W7U A;  2Z6X A;  4LQU A;  5AQB B;  4F6N A;  1XA9 A;  3EK7 A;  2EN8 A;  3O78 A;  2R1F A;  2DMI A;  2C9J A;  2OKY A;  3U8P A;  1X3C A;  4J89 A;  3SG3 A;  4EN1 A;  2ELZ A;  1KYP A;  2EMI A;  5DPG A;  4LJC A;  4R2C A;  2HGY A;  3DQJ A;  2A46 A;  2ZO7 A;  3SST A;  5H88 A;  2FZU A;  2CT1 A;  2M9A A;  5DTL A;  2RPC A;  2Z1O A;  4B30 B;  4LJB A;  5HBD A;  1A1I A;  3ST2 A;  2VAD A;  5EB6 A;  2YU8 A;  3CGL A;  3SVR A;  4KF5 C;  3LSA A;  2YE0 A;  1B9C A;  3CFH A;  3AI5 A;  4DXN A;  2EL6 A;  3DQO A;  1YHI A;  1XSS A;  1YHG A;  3ADF A;  3SVB A;  1BBO A;  1DGC A;  4OY4 A;  2EOE A;  4L1I A;  4R2D A;  3SSL A;  2DLQ A;  3EPJ A;  2P4M A;  4W6G A;  4JFG A;  1YUI A;  3GEX A;  5T3I A;  2ELY A;  1Z1Q A;  4KF5 A;  5FHV A;  3ST3 A;  3VHT B;  2YTD A;  2QLE A;  5FVG A;  2YSO A;  2O29 A;  2EPP A;  2LVH A;  1JK2 A;  2EPC A;  4ZF4 A;  1EMG A;  2ZO6 A;  1EMK A;  3NEZ A;  3SG6 A;  3O77 A;  5DU0 A;  4W69 A;  2EQ3 A;  4W7E A;  1EML A;  1X6H A;  3EKH A;  3BXA A;  4R6B A;  1UIS A;  3UG0 A;  3ZUJ A;  2EOH A;  2GX0 A;  2QLH A;  2ENH A;  4ZFS A;  2DRP A;  3PJB A;  4DXP A;  2EOJ A;  2G6X A;  3LA1 A;  1LLM C;  3CD9 A;  3PIB A;  3MHS C;  1RM9 A;  1RRX A;  1HUY A;  2EMD A;  2ZMU A;  3CD1 A;  2ADR A;  2CTD A;  4F2J C;  3G9A A;  3SRY A;  2DDC A;  4HE4 A;  1A1L A;  4RTC A;  1EMB A;  4JRB A;  5DY6 A;  4AS8 A;  2D9H A;  3H1O A;  1W7T A;  3GJ2 A;  3ZUF A;  4F6M A;  4W7D A;  1X6E A;  1MOV A;  5FVF A;  2EMX A;  1JK1 A;  1RMD A;  4KF4 A;  2BTJ A;  1ZAA C;  3I19 A;  3DQ1 A;  1XQM A;  1EMC A;  4W6K A;  2WCC 3;  3SVC A;  3UFZ A;  3MGF A;  4HQ8 A;  1MYW A;  5KTG A;  1A1J A;  3E5V A;  1WJP A;  4KGE A;  2QLG A;  2DUF A;  2EMN A;  2YFP A;  3DQ3 A;  2C9I A;  3KCT A;  5LTP A;  4DKM A;  5HZT A;  5EXC I;  2EM7 A;  3DQC A;  5DPH A;  2HGH A;  4W6N A;  2G3O A;  4RYS A;  4R2S A;  3EVV A;  4IK8 A;  4KW9 A;  4Q7U A;  4IK9 A;  4Z4K A;  5HGE A;  2YRH A;  4EUL A;  3ED8 A;  2HQK A;  2RH7 A;  5KL3 A;  3EVU A;  4ORN A;  2AWK A;  2QLI A;  2V4E B;  3DQ8 A;  1NCS A;  3RWT A;  4AR7 A;  4W6F A;  1A1K A;  3EPH A;  3EVR A;  3K1K A;  4IK5 A;  4ZF3 A;  3LVA A;  4JEO A;  2BB8 A;  4EMQ A;  2ICR A;  1YSA C;  3SVE A;  2ARL A;  4OGS A;  3U0M A;  2H6V A;  2G16 B;  3BX9 A;  4Q9X A; 
#chains in the Genus database with same CATH topology
 4BC7 A;  3UK3 C;  3AV0 A;  2A56 B;  2VZX A;  5J2O A;  2WZO A;  4X8W A;  5CFF E;  2GPI A;  1EKZ A;  4ZB1 A;  5HZO A;  2Z6Y A;  2EOR A;  4LF5 E;  5DPJ A;  3MHH C;  2L2M A;  4JI3 E;  4P76 A;  2EOM A;  3AUZ A;  2V83 A;  4KZS A;  2EOF A;  2DLK A;  4NHR A;  1W7S A;  1PJQ A;  4W72 A;  2HGD A;  1JBY A;  2FL1 A;  4H3M A;  2GHF A;  2Q6P A;  4JI1 E;  1YYO A;  4DV2 E;  2N3G A;  4DV6 E;  1G2D C;  2VQF E;  4B30 A;  4RHB B;  1YFP A;  3SG5 A;  1BFP A;  2OKW A;  2QU1 A;  4HQC A;  2JP9 A;  1IBK E;  4O4K A;  3IWD A;  2A52 B;  3PJ5 A;  4W6P A;  2GW4 B;  3SVU A;  5TSE A;  3ZTF A;  4DR4 E;  4IK1 A;  2ODR D;  3DQU A;  1N3G A;  3DQ7 A;  4R2P A;  1N34 E;  3W1D A;  3DQE A;  4L12 A;  3WLC A;  2EJ4 A;  2JWO A;  4LTY A;  4DMI A;  1X47 A;  2EM9 A;  2EOQ A;  2A54 B;  5F9G A;  1H4U A;  4JF9 A;  2JVA A;  2KOU A;  4NZV A;  2AH8 A;  3VHT A;  2YE1 A;  3U8A A;  1MOU A;  4LU9 A;  3NT9 A;  5FLX C;  1SR9 A;  4FK5 C;  3WLD A;  3DQL A;  2Q8U A;  1AAY A;  1WHQ A;  2DIX A;  3J80 C;  1Q4D A;  2DD9 A;  4DXO A;  2EOY A;  3AI4 A;  4WXD A;  4L8N A;  3BGH A;  4GKJ E;  2DUG A;  3BXB A;  2EMK A;  2VF1 A;  1BB8 A;  2NAB A;  4PPJ A;  3ST4 A;  3TQM A;  1Q4C A;  1T4L B;  3CB9 A;  2LE2 A;  4LF6 E;  1UHZ A;  5DPI A;  2IHR 1;  3CBE A;  3OGO A;  4IS1 C;  3DQ5 A;  3RMP A;  3QG5 C;  1WXR A;  2PRT A;  2EPO A;  2WSN A;  3U0L A;  4Q28 A;  1L4S A;  1ZGP A;  2FWQ A;  1T38 A;  3EKJ A;  3KCS A;  2NUE A;  3U8C A;  1XAE A;  1ZR9 A;  4N3D A;  3SSY A;  2IB5 A;  2EN6 A;  2RSI A;  3E5W A;  2EMH A;  5BQL A;  3S05 A;  3SVN A;  2HRS A;  1UBD C;  3GL4 A;  4ZBL A;  2J7J A;  2UU9 E;  1J5E E;  2EMW A;  5HW9 A;  2WIQ A;  4DV0 E;  4KAG A;  2M7Q A;  2QZ0 A;  1ZUX A;  2H5O A;  4W76 A;  1IBM E;  1PDA A;  2VE7 C;  4EDO A;  1Q4B A;  3DQ4 A;  4NWS A;  3DQ6 A;  3T1H E;  1YFH A;  2AWM A;  5A6B D;  3NED A;  5LMN E;  2HFC A;  4JI4 E;  2JYA A;  3M99 B;  5H89 A;  4K0K E;  4O43 A;  2WHT A;  1BBG A;  4OX9 E;  2YTN A;  5DTY A;  1NEI A;  2JY9 A;  4KW4 A;  2Y0G A;  4LF9 E;  4M2Z A;  2V4E C;  3J81 C;  2LO3 A;  1FKA E;  2IB6 A;  1EH6 A;  4DKN A;  4J8A A;  5LTR A;  4W7C A;  5KL7 A;  4LW5 A;  4KEX A;  2LRS A;  2MKD A;  4F54 A;  2Q57 A;  1WHN A;  4I8O A;  5IWA E;  4DV5 E;  1XMO E;  4O24 A;  4WSP A;  3CFA A;  4XOV A;  3SSH A;  4Q7R A;  4GES B;  4ZYD A;  2WBS A;  2H36 X;  3DPW A;  4YY3 E;  2MKN A;  2V4E A;  3DQF A;  3SG2 A;  2ENC A;  1Q73 A;  4JC2 A;  1XMZ A;  3ZUL A;  1XNQ E;  2YTP A;  4HVF A;  2DUE A;  1S6Z A;  1GL4 A;  1PKP A;  1IMU A;  2WSO A;  5EXB A;  4W6C A;  2LTR A;  1EMA A;  3SV5 A;  4H48 A;  4B5Y A;  4BBY A;  1HNX E;  1C4F A;  2EQ1 A;  1Q4E A;  4RH8 A;  2L8T A;  4GF6 B;  5EXU A;  2G2S B;  2VVJ A;  4DR7 E;  1ZGO A;  4WFT A;  2EM0 A;  4J88 A;  2AWJ A;  3SVO A;  4R2E A;  2O2B A;  1QXT A;  5DTX A;  3DF6 A;  5KL4 A;  2G3D B;  1OXD A;  1TF6 A;  2DMY A;  3OSQ A;  3U0K A;  2B3T B;  4W6A A;  1PJT A;  1T39 A;  2EZ6 A;  3OSR A;  4WXC A;  2HJJ A;  2VAE A;  4GOB A;  4R2Q A;  1A1G A;  2L2K B;  2LTS A;  3DQH A;  1JBZ A;  5AE1 A;  2EPL X;  5HZS A;  4KGF A;  1QYF A;  2WHS A;  2DD7 A;  2HQZ A;  4Q7T A;  3H09 A;  4GEQ B;  3EK8 A;  1STU A;  2HCG A;  2HJO A;  4P1Q A;  1F0B A;  3LML A;  1Z1B A;  1YYW A;  4DR6 E;  2RQL A;  1IQS A;  4LFB E;  1ZBQ A;  2ZMW A;  2L92 A;  2A25 A;  3M24 A;  3H1R A;  4I2Y A;  2EM5 A;  2EM3 A;  3BXC A;  2EPZ A;  3NT3 A;  4R6D A;  4W7R A;  2IE2 A;  4W6J A;  4WSG A;  4DUY E;  2EPA A;  2EOZ A;  3GB3 A;  4W6S A;  3P8U A;  1KP5 A;  3ST0 A;  5BTT B;  2QRF A;  2EM4 A;  2L3J A;  2G7H A;  1X5W A;  5F3W A;  4J8Z A;  4HQ9 A;  4F9C B;  4W6M A;  1EH7 A;  4LQT A;  3WCK A;  4ZIO A;  4W6O A;  2EMB A;  2YTF A;  3LLH A;  5IXM B;  4OQW A;  1P47 A;  3PJ7 A;  2DUH A;  4KA9 A;  3EVP A;  1O0W A;  3DPZ A;  2NUF A;  3DQM A;  1GTK A;  3LVC A;  4H3N A;  4XL5 A;  4W6T A;  2ENA A;  3DQK A;  5IT9 C;  4R2A A;  4IK3 A;  5KL2 A;  4OOG C;  3NF0 A;  2DB2 A;  5AE3 A;  2OJK A;  5KL6 A;  3T1Y E;  4JGE A;  4JI7 E;  2YTO A;  3LF3 A;  1AH5 A;  2EM2 A;  4IJD A;  3TMR A;  2V8Q B;  2FTX B;  1TF3 A;  4NXN E;  2UUB E;  4L13 A;  2EWL A;  2E72 A;  2H5Q A;  4DXI A;  4H47 A;  3DPX A;  4W6L A;  4BDU A;  2EN3 A;  3E5T A;  2L6M A;  4W74 A;  4ZIN A;  4AQY E;  1RMO A;  2MDG A;  4R2R A;  4KHP E;  5H87 A;  1ZU1 A;  4RYW A;  2MC6 A;  2YWQ A;  3HTX A;  1QY3 A;  2G6Y A;  5DTZ A;  3SSP A;  2I13 A;  2EN4 A;  2K4V A;  4W6H A;  1RC7 A;  1XMQ E;  3IR8 A;  2LJH A;  2EMA A;  4LJD C;  1Z1P A;  4PPL A;  4W6R A;  1HR0 E;  1MEY C;  2OGR A;  4W6U A;  2B3Q A;  2YTJ A;  3BID A;  1JC0 A;  1KYS A;  1MGT A;  1ZBT A;  2LCE A;  2G6E A;  3VIC A;  2V89 A;  1EMF A;  2CSH A;  3IP2 A;  4OJ0 A;  4LF4 E;  4JI5 E;  2LT7 A;  4TZG A;  4PFE A;  1HNW E;  4LJD A;  1F09 A;  2RTX A;  2DDD A;  3EPK A;  3MHS C;  1ZGQ A;  2EL4 A;  3IWC A;  1EME A;  2EM6 A;  4BMJ A;  3ECR A;  3DQA A;  2OTE A;  2PXS A;  4GZN C;  3GJ1 A;  1G7K A;  2EMG A;  3SVD A;  1JC1 A;  4M0V A;  4JV5 E;  2HC5 A;  1GFL A;  4W7A A;  5DRG A;  2EMC A;  5EB7 A;  4F9B B;  4Q9W A;  5FVI A;  2EMZ A;  5AAS A;  2YDZ A;  4Z4M A;  5ADZ A;  5EBJ A;  3SG4 A;  3SG7 A;  1SFE A;  1EH8 A;  3TMT A;  4IK4 A;  3HQ1 A;  4GKK E;  2JAD A;  4W6B A;  3SSK A;  2YPN A;  1I94 E;  2LUQ A;  2EML A;  1F2I G;  4NXM E;  2B9D A;  1YPN A;  5A6A A;  2WBT A;  4BHB A;  4BC9 A;  3KZZ A;  2N3H A;  4JI2 E;  2EM8 A;  1OXE A;  1RMP A;  1YHH A;  4DR3 E;  3KZY A;  5LTQ A;  2YRK A;  1YZW A;  4DV4 E;  2I9I A;  4ZYG A;  3DQ9 A;  1UN6 B;  3ADI A;  2E5L E;  2H9W A;  2POX A;  4DXQ A;  2EOI A;  1YJ2 A;  4W75 A;  2WUR A;  4W6D A;  2YTQ A;  2YSP A;  4XGY A;  4X65 E;  4R03 A;  2BBG A;  2EPR A;  4DKK A;  1XNR E;  3V3D A;  1RQ0 A;  3LF4 B;  2H5R A;  2HPW A;  2WHU A;  2EP3 A;  5LK4 A;  2A53 B;  2VRD A;  4KPI A;  5DQM A;  5EHU A;  4ZYH A;  4X62 E;  3AKO A;  2YTE A;  2HHH E;  2EN1 A;  3HXL A;  4B3M E;  2EMO A;  4W77 A;  3DQD A;  3SSV A;  1UIL A;  2YRM A;  3C6K A;  2YTI A;  4TZA A;  2A50 B;  3CFF A;  4H3L A;  2Z6Z A;  3A8S A;  2VVH A;  1X48 A;  1FJG E;  4ANJ A;  2EPU A;  5A6B A;  2NUG A;  3RWA A;  2VVI A;  1RMM A;  2WIS A;  2JOX A;  4P78 A;  2G5Z B;  4XOW A;  2AHA A;  2EN7 A;  1Q4A A;  5DRF A;  2UUC E;  3M22 A;  2OTB A;  2EQ0 A;  2QT2 A;  3W1C A;  3LVD A;  2EL5 A;  5BTT A;  2GX2 A;  1CV7 A;  2YTG A;  2GW3 A;  2EMY A;  2A48 A;  3SVS A;  3FIG A;  3ZOQ B;  2O24 A;  1YUJ A;  2YT4 A;  2EPX A;  1KYR A;  2V85 A;  2EPM X;  2EPN A;  2JPA A;  2PXW A;  3LS3 A;  1KJK A;  4OHS A;  4W7F A;  3BF2 A;  5EJU A;  3L00 A;  1YJF A;  4W73 A;  4EDS A;  4U2V A;  5IV8 B;  2EN2 A;  2EMF A;  2M1S A;  4ZYE A;  5DQB A;  2EE8 A;  2AWL A;  3DQI A;  1OXF A;  4M9V C;  4W6I A;  4MLV A;  4BCA A;  3DQN A;  1QYO A;  2WBU A;  4PPK A;  1GZ6 A;  1H6R A;  2EOS A;  3VK1 A;  2RSM A;  3KWR A;  4DXM A;  5HZU A;  2LV2 A;  4MLQ A;  1HNZ E;  1HCJ A;  3J7Y p;  2YU5 A;  1EMM A;  4KW8 A;  3DJW A;  4JYA E;  4HTG A;  2EOO A;  2H5P A;  2B3P A;  2QLG B;  4X9J A;  2IOV A;  1GGX A;  1X6F A;  3THO B;  4Q35 B;  1B69 A;  2L2N A;  3DQ2 A;  2GLI A;  2JR1 A;  4P7D A;  1N36 E;  3EPL A;  3EK4 A;  4WPY A;  2FV4 B;  2EOX A;  1A1F A;  4ZF5 A;  5AE2 A;  2DGC A;  1PJS A;  4W7X A;  2DUI A;  3SS0 A;  2VQE E;  5KL5 A;  4UTS A;  4IZN A;  2H8Q A;  5BT0 A;  3C6M A;  1A1H A;  1GQE A;  2A47 A;  1QYQ A;  3U0N A;  1KYQ A;  4L5N C;  4DV3 E;  3P28 A;  4XVP A;  3C4T A;  1G2F C;  1W7U A;  1TN9 A;  2Z6X A;  4LQU A;  5AQB B;  4LF7 E;  4F6N A;  1XA9 A;  3EK7 A;  2EN8 A;  3O78 A;  2DSY A;  1DI2 A;  2R1F A;  2DMI A;  2C9J A;  2OKY A;  3U8P A;  1X3C A;  3VYY A;  4J89 A;  3SG3 A;  4EN1 A;  2ELZ A;  1KYP A;  2EMI A;  4LFA E;  2B7V A;  5DPG A;  4LJC A;  2ODR C;  3ADJ A;  4R2C A;  3VYX A;  2HGY A;  3DQJ A;  2A46 A;  2ZO7 A;  3SST A;  1N33 E;  5H88 A;  2FZU A;  2CT1 A;  4BHC A;  4X66 E;  5A6J A;  2M9A A;  3IWB A;  5DTL A;  4DR2 E;  2F4V E;  2RPC A;  2F8B A;  2Z1O A;  4B30 B;  5DNY A;  4LJB A;  5LL6 R;  5HBD A;  2UUA E;  1A1I A;  3ST2 A;  2VAD A;  2UXC E;  5EB6 A;  2YU8 A;  3CGL A;  3SVR A;  1X49 A;  1N32 E;  4KF5 C;  3LSA A;  2YE0 A;  1B9C A;  3CFH A;  2L33 A;  3AI5 A;  4DXN A;  2EL6 A;  2N8X A;  3DQO A;  3MSW A;  1YHI A;  5A69 A;  1XSS A;  1YHG A;  3ADF A;  3SVB A;  1BBO A;  1DGC A;  2MDR A;  4OY4 A;  2EOE A;  4DV1 E;  3J7A G;  4L1I A;  4R2D A;  4JI6 E;  3SSL A;  2DLQ A;  4TUI A;  3EPJ A;  2P4M A;  4W6G A;  3HPZ A;  4JFG A;  1YUI A;  3GEX A;  5T3I A;  2ELY A;  1Z1Q A;  4KF5 A;  5FHV A;  3ST3 A;  3VHT B;  2YTD A;  2QLE A;  5FVG A;  2YSO A;  2O29 A;  1T4O A;  2EPK X;  2EPP A;  2LVH A;  1J26 A;  2MC5 A;  2LBS B;  4B3T E;  1JK2 A;  2EPC A;  4ZF4 A;  1EMG A;  4JI8 E;  4JI0 E;  1YZ9 A;  4X64 E;  1IQO A;  2ZO6 A;  4TUG A;  1EMK A;  3NEZ A;  3SG6 A;  2NA2 A;  3O77 A;  3THN A;  4M30 A;  2FGG A;  4BS9 A;  5DU0 A;  5LMU E;  4W69 A;  2EQ3 A;  4DR1 E;  4W7E A;  2UXD E;  1EML A;  1X6H A;  3EKH A;  3BXA A;  2LJU A;  4R6B A;  1UIS A;  3UG0 A;  3ZUJ A;  2EOH A;  3F6H A;  2GX0 A;  2UXB E;  2QLH A;  3P1X A;  2ENH A;  4ZFS A;  3JAM C;  3PJB A;  2DRP A;  4DXP A;  2EOJ A;  2G6X A;  2LUP B;  3JTZ A;  3LA1 A;  2E1M A;  5A2Q C;  2LMZ A;  1LLM C;  3CD9 A;  5LLQ A;  3PIB A;  2JOB A;  1RM9 A;  1RRX A;  1HUY A;  2EMD A;  2ZMU A;  3CD1 A;  2ADR A;  2CTD A;  3HPS A;  3G9A A;  3SRY A;  4F2J C;  2DDC A;  4HE4 A;  1A1L A;  4RTC A;  3JU0 A;  1EMB A;  3K6Q A;  3BBG A;  4JRB A;  5DY6 A;  2M4I A;  2KON A;  4AS8 A;  2D9H A;  2V88 A;  3H1O A;  4F9A B;  1W7T A;  3GJ2 A;  3ZUF A;  1QNT A;  5A6K A;  3F6G A;  4F6M A;  4W7D A;  1X6E A;  4YHH E;  4KWY A;  1MOV A;  5FVF A;  2EMX A;  4WX9 A;  1JK1 A;  1RMD A;  3EQ1 A;  4WYQ B;  4LFC E;  4KF4 A;  2BTJ A;  4DV7 E;  1ZAA C;  3I19 A;  3OML A;  4N4R B;  5BR8 E;  3DQ1 A;  1XQM A;  1EMC A;  4W6K A;  2WCC 3;  5AC5 A;  3SVC A;  3UFZ A;  3MGF A;  1T4N A;  5T6J A;  4HQ8 A;  1MYW A;  4O5G A;  4B3R E;  5KTG A;  2L3C A;  1A1J A;  3E5V A;  1WJP A;  4KGE A;  2V87 A;  5AC4 A;  2JXP A;  4B3S E;  2QLG A;  2DUF A;  2EMN A;  2YFP A;  3DQ3 A;  2C9I A;  3KCT A;  5LTP A;  4DKM A;  5HZT A;  5EXC I;  2EM7 A;  3DQC A;  5DPH A;  2HGH A;  1IBL E;  4W6N A;  2G3O A;  2K7I A;  4RYS A;  2YZT A;  2CPN A;  3EVV A;  4R2S A;  4IK8 A;  1WRJ A;  3ADL A;  4KW9 A;  4Q7U A;  4IK9 A;  4Z4K A;  5HGE A;  1QU6 A;  2YRH A;  4EUL A;  3VK6 A;  3ED8 A;  2HQK A;  2RH7 A;  5KL3 A;  3EVU A;  4ORN A;  2AWK A;  2QLI A;  2V4E B;  3ADG A;  3DQ8 A;  1NCS A;  3RWT A;  2KHX A;  3C4B A;  4DUZ E;  4AR7 A;  4W6F A;  1DQ3 A;  1A1K A;  4DR5 E;  2V86 A;  3EPH A;  3EVR A;  2R76 A;  1YYK A;  2RS7 A;  3K1K A;  4IK5 A;  4ZF3 A;  3LVA A;  4JEO A;  2BB8 A;  4R8O A;  3OTO E;  4EMQ A;  2ICR A;  4HEI A;  2ZM6 E;  3SVE A;  2ARL A;  4OGS A;  1YSA C;  2B7T A;  2RS6 A;  3U0M A;  4LF8 E;  2H6V A;  2G16 B;  3BX9 A;  4Q9X A; 
#chains in the Genus database with same CATH homology
 3UK3 C;  2A56 B;  2VZX A;  5J2O A;  4ZB1 A;  5HZO A;  2Z6Y A;  2EOR A;  5DPJ A;  3MHH C;  4P76 A;  2EOM A;  2EOF A;  2DLK A;  1W7S A;  4W72 A;  2HGD A;  1JBY A;  2FL1 A;  4H3M A;  2GHF A;  2Q6P A;  1G2D C;  4B30 A;  1YFP A;  3SG5 A;  1BFP A;  2OKW A;  2QU1 A;  4HQC A;  2JP9 A;  2A52 B;  3PJ5 A;  4W6P A;  2GW4 B;  3SVU A;  3ZTF A;  4IK1 A;  3DQU A;  3DQ7 A;  4R2P A;  3W1D A;  3DQE A;  4L12 A;  3WLC A;  2EJ4 A;  2EM9 A;  2EOQ A;  2A54 B;  5F9G A;  1H4U A;  4JF9 A;  2AH8 A;  3VHT A;  2YE1 A;  3U8A A;  1MOU A;  3NT9 A;  4FK5 C;  3WLD A;  3DQL A;  1AAY A;  1Q4D A;  2DD9 A;  4DXO A;  2EOY A;  3AI4 A;  2DUG A;  3BXB A;  2EMK A;  1BB8 A;  2NAB A;  4PPJ A;  3ST4 A;  1Q4C A;  3CB9 A;  5DPI A;  3CBE A;  3OGO A;  4IS1 C;  3DQ5 A;  2PRT A;  2WSN A;  3U0L A;  1ZGP A;  2FWQ A;  3EKJ A;  3KCS A;  3U8C A;  1XAE A;  1ZR9 A;  4N3D A;  3SSY A;  2IB5 A;  2EN6 A;  2RSI A;  3E5W A;  2EMH A;  5BQL A;  3S05 A;  3SVN A;  2HRS A;  1UBD C;  3GL4 A;  4ZBL A;  2J7J A;  2EMW A;  5HW9 A;  2WIQ A;  4KAG A;  2QZ0 A;  1ZUX A;  2H5O A;  4W76 A;  4EDO A;  1Q4B A;  3DQ4 A;  4NWS A;  3DQ6 A;  2AWM A;  3NED A;  2HFC A;  3M99 B;  5H89 A;  2WHT A;  2YTN A;  5DTY A;  4KW4 A;  2Y0G A;  2V4E C;  2LO3 A;  2IB6 A;  4DKN A;  4J8A A;  5LTR A;  4W7C A;  5KL7 A;  4LW5 A;  4KEX A;  2MKD A;  2Q57 A;  3CFA A;  4XOV A;  3SSH A;  4Q7R A;  4GES B;  2WBS A;  2MKN A;  3DPW A;  2V4E A;  3DQF A;  3SG2 A;  2ENC A;  1Q73 A;  4JC2 A;  1XMZ A;  3ZUL A;  2YTP A;  4HVF A;  2DUE A;  1S6Z A;  1GL4 A;  2WSO A;  5EXB A;  4W6C A;  1EMA A;  3SV5 A;  4H48 A;  4B5Y A;  1C4F A;  2EQ1 A;  1Q4E A;  4GF6 B;  5EXU A;  2G2S B;  2VVJ A;  1ZGO A;  2EM0 A;  4J88 A;  2AWJ A;  3SVO A;  4R2E A;  2O2B A;  1QXT A;  5DTX A;  5KL4 A;  2G3D B;  1OXD A;  1TF6 A;  3OSQ A;  3U0K A;  4W6A A;  3OSR A;  2VAE A;  4GOB A;  4R2Q A;  1A1G A;  3DQH A;  1JBZ A;  5HZS A;  4KGF A;  1QYF A;  2WHS A;  2DD7 A;  2HQZ A;  4Q7T A;  3EK8 A;  2HCG A;  2HJO A;  4P1Q A;  1F0B A;  1Z1B A;  2ZMW A;  2A25 A;  3M24 A;  3H1R A;  4I2Y A;  2EM5 A;  2EM3 A;  3BXC A;  2EPZ A;  3NT3 A;  4R6D A;  4W7R A;  2IE2 A;  4W6J A;  4WSG A;  2EPA A;  2EOZ A;  3GB3 A;  4W6S A;  3P8U A;  1KP5 A;  3ST0 A;  5BTT B;  2QRF A;  2EM4 A;  1X5W A;  4HQ9 A;  4W6M A;  2YTF A;  4LQT A;  3WCK A;  4ZIO A;  4W6O A;  2EMB A;  4OQW A;  1P47 A;  3PJ7 A;  2DUH A;  4KA9 A;  3EVP A;  3DPZ A;  3DQM A;  3LVC A;  4H3N A;  4XL5 A;  4W6T A;  2ENA A;  3DQK A;  4R2A A;  4IK3 A;  5KL2 A;  3NF0 A;  2OJK A;  5KL6 A;  4JGE A;  2YTO A;  3LF3 A;  2EM2 A;  4IJD A;  3TMR A;  1TF3 A;  4L13 A;  2E72 A;  2H5Q A;  4DXI A;  4H47 A;  3DPX A;  4W6L A;  4BDU A;  2EN3 A;  3E5T A;  4W74 A;  4ZIN A;  1RMO A;  2MDG A;  4R2R A;  5H87 A;  1ZU1 A;  4RYW A;  1QY3 A;  2G6Y A;  5DTZ A;  3SSP A;  2I13 A;  2EN4 A;  4W6H A;  3IR8 A;  2EMA A;  4LJD C;  1Z1P A;  4PPL A;  4W6R A;  1MEY C;  2OGR A;  4W6U A;  2B3Q A;  2YTJ A;  1JC0 A;  1KYS A;  2LCE A;  2G6E A;  3VIC A;  1EMF A;  2CSH A;  3IP2 A;  4OJ0 A;  2LT7 A;  4TZG A;  4PFE A;  4LJD A;  1F09 A;  2DDD A;  3EPK A;  1ZGQ A;  2EL4 A;  1EME A;  2EM6 A;  3DQA A;  2OTE A;  2PXS A;  4GZN C;  3GJ1 A;  1G7K A;  2EMG A;  3SVD A;  1JC1 A;  1GFL A;  4W7A A;  5DRG A;  2EMC A;  5EB7 A;  4Q9W A;  5FVI A;  2EMZ A;  2YDZ A;  4Z4M A;  5EBJ A;  3SG4 A;  3SG7 A;  3TMT A;  4IK4 A;  2JAD A;  4W6B A;  3SSK A;  2EML A;  1F2I G;  2WBT A;  2EM8 A;  1OXE A;  1RMP A;  1YHH A;  5LTQ A;  2YRK A;  1YZW A;  3DQ9 A;  1UN6 B;  2H9W A;  2POX A;  4DXQ A;  2EOI A;  1YJ2 A;  4W75 A;  2WUR A;  4W6D A;  2YTQ A;  2YSP A;  4XGY A;  2EPR A;  3V3D A;  3LF4 B;  2H5R A;  2HPW A;  2WHU A;  2EP3 A;  5LK4 A;  2A53 B;  2VRD A;  4KPI A;  5DQM A;  5EHU A;  3AKO A;  2YTE A;  2EN1 A;  2EMO A;  4W77 A;  3DQD A;  3SSV A;  2YRM A;  2YTI A;  4TZA A;  2A50 B;  3CFF A;  4H3L A;  2Z6Z A;  3A8S A;  2VVH A;  4ANJ A;  2EPU A;  3RWA A;  2VVI A;  1RMM A;  2WIS A;  2G5Z B;  4XOW A;  2AHA A;  2EN7 A;  1Q4A A;  5DRF A;  3M22 A;  2OTB A;  2EQ0 A;  2QT2 A;  3W1C A;  3LVD A;  2EL5 A;  5BTT A;  2GX2 A;  1CV7 A;  2YTG A;  2GW3 A;  2EMY A;  2A48 A;  3SVS A;  2O24 A;  2EPX A;  1KYR A;  2JPA A;  2PXW A;  3LS3 A;  1KJK A;  4OHS A;  4W7F A;  5EJU A;  1YJF A;  4W73 A;  4EDS A;  4U2V A;  2EN2 A;  2EMF A;  5DQB A;  2EE8 A;  2AWL A;  3DQI A;  1OXF A;  4M9V C;  4W6I A;  3DQN A;  1QYO A;  2WBU A;  4PPK A;  1H6R A;  2EOS A;  3VK1 A;  4DXM A;  5HZU A;  2LV2 A;  1HCJ A;  2YU5 A;  1EMM A;  4KW8 A;  2EOO A;  2H5P A;  2B3P A;  2QLG B;  4X9J A;  2IOV A;  1GGX A;  1X6F A;  1B69 A;  3DQ2 A;  2GLI A;  3EPL A;  3EK4 A;  2EOX A;  1A1F A;  4ZF5 A;  2DGC A;  4W7X A;  2DUI A;  3SS0 A;  5KL5 A;  4UTS A;  4IZN A;  2H8Q A;  5BT0 A;  1A1H A;  2A47 A;  1QYQ A;  3U0N A;  1YUJ A;  3P28 A;  4XVP A;  1G2F C;  1TN9 A;  1W7U A;  2Z6X A;  4LQU A;  5AQB B;  4F6N A;  1XA9 A;  3EK7 A;  2EN8 A;  3O78 A;  2R1F A;  2DMI A;  2C9J A;  2OKY A;  3U8P A;  1X3C A;  4J89 A;  3SG3 A;  4EN1 A;  2ELZ A;  1KYP A;  2EMI A;  5DPG A;  4LJC A;  4R2C A;  2HGY A;  3DQJ A;  2A46 A;  2ZO7 A;  3SST A;  5H88 A;  2FZU A;  2CT1 A;  2M9A A;  5DTL A;  2RPC A;  2Z1O A;  4B30 B;  4LJB A;  5HBD A;  1A1I A;  3ST2 A;  2VAD A;  5EB6 A;  2YU8 A;  3CGL A;  3SVR A;  4KF5 C;  3LSA A;  2YE0 A;  1B9C A;  3CFH A;  3AI5 A;  4DXN A;  2EL6 A;  3DQO A;  1YHI A;  1XSS A;  1YHG A;  3ADF A;  3SVB A;  1BBO A;  1DGC A;  4OY4 A;  2EOE A;  4L1I A;  4R2D A;  3SSL A;  2DLQ A;  3EPJ A;  2P4M A;  4W6G A;  4JFG A;  1YUI A;  3GEX A;  5T3I A;  2ELY A;  1Z1Q A;  4KF5 A;  5FHV A;  3ST3 A;  3VHT B;  2YTD A;  2QLE A;  5FVG A;  2YSO A;  2O29 A;  2EPP A;  2LVH A;  1JK2 A;  2EPC A;  4ZF4 A;  1EMG A;  2ZO6 A;  1EMK A;  3NEZ A;  3SG6 A;  3O77 A;  5DU0 A;  4W69 A;  2EQ3 A;  4W7E A;  1EML A;  1X6H A;  3EKH A;  3BXA A;  4R6B A;  1UIS A;  3UG0 A;  3ZUJ A;  2EOH A;  2GX0 A;  2QLH A;  2ENH A;  4ZFS A;  2DRP A;  3PJB A;  4DXP A;  2EOJ A;  2G6X A;  3LA1 A;  1LLM C;  3CD9 A;  3PIB A;  3MHS C;  1RM9 A;  1RRX A;  1HUY A;  2EMD A;  2ZMU A;  3CD1 A;  2ADR A;  2CTD A;  4F2J C;  3G9A A;  3SRY A;  2DDC A;  4HE4 A;  1A1L A;  4RTC A;  1EMB A;  4JRB A;  5DY6 A;  4AS8 A;  2D9H A;  3H1O A;  1W7T A;  3GJ2 A;  3ZUF A;  4F6M A;  4W7D A;  1X6E A;  1MOV A;  5FVF A;  2EMX A;  1JK1 A;  1RMD A;  4KF4 A;  2BTJ A;  1ZAA C;  3I19 A;  3DQ1 A;  1XQM A;  1EMC A;  4W6K A;  2WCC 3;  3SVC A;  3UFZ A;  3MGF A;  4HQ8 A;  1MYW A;  5KTG A;  1A1J A;  3E5V A;  1WJP A;  4KGE A;  2QLG A;  2DUF A;  2EMN A;  2YFP A;  3DQ3 A;  2C9I A;  3KCT A;  5LTP A;  4DKM A;  5HZT A;  5EXC I;  2EM7 A;  3DQC A;  5DPH A;  2HGH A;  4W6N A;  2G3O A;  4RYS A;  4R2S A;  3EVV A;  4IK8 A;  4KW9 A;  4Q7U A;  4IK9 A;  4Z4K A;  5HGE A;  2YRH A;  4EUL A;  3ED8 A;  2HQK A;  2RH7 A;  5KL3 A;  3EVU A;  4ORN A;  2AWK A;  2QLI A;  2V4E B;  3DQ8 A;  1NCS A;  3RWT A;  4AR7 A;  4W6F A;  1A1K A;  3EPH A;  3EVR A;  3K1K A;  4IK5 A;  4ZF3 A;  3LVA A;  4JEO A;  2BB8 A;  4EMQ A;  2ICR A;  1YSA C;  3SVE A;  2ARL A;  4OGS A;  3U0M A;  2H6V A;  2G16 B;  3BX9 A;  4Q9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...