3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
molecule keywords Green fluorescent protein
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
3GL4A 3GB3A 1RM9A 2EORA 2G5ZB 4LJDC 3DQKA 4XOVA 4OGSA 5EBJA 5KL6A 3MHHC 3RWTA 5KL4A 2GX2A 4PFEA 2DD7A 2YTEA 1W7TA 2ZMUA 5DQBA 1RRXA 2EMLA 2EOHA 3PJ5A 5KL2A 3UK3C 3PJBA 1H4UA 3EVPA 1EMAA 4W73A 1YUJA 1TN9A 2Z6XA 3TMRA 4R2QA 4EN1A 5DRFA 2AHAA 2C9JA 1G2DC 2D9HA 2VAEA 4W6LA 3KCTA 2QLIA 2OKYA 3NEZA 1G7KA 1Q4DA 2EL4A 1JK2A 4EMQA 4Q9WA 2YSPA 1YHHA 1YHIA 5BTTA 3M24A 1X6EA 4R2PA 2HCGA 4N3DA 4DKNA 2EOOA 2RPCA 1EMGA 3SVOA 2HGHA 2DLQA 2A53B 4W75A 2H5RA 3DQDA 2HPWA 2PRTA 2YDZA 2DUIA 3DPWA 2AWJA 3LS3A 2WBTA 3EK4A 3SS0A 3E5WA 5DU0A 1X5WA 2EM5A 2EMAA 3UFZA 1EMMA 2ZO6A 1QYOA 4GF6B 4ANJA 2VVHA 2DMIA 2H5QA 2YE1A 4AR7A 2NABA 4EDOA 2LV2A 2EOXA 3IP2A 1MOUA 2YFPA 1Q73A 3ST2A 2FL1A 4IJDA 2MKNA 2HFCA 2EM7A 3H1RA 2EM8A 3SVEA 4LQTA 3WLCA 2JADA 5DY6A 4Q7TA 3P8UA 2EPUA 3W1CA 2OTBA 1A1LA 4KPIA 2EPPA 3SSPA 4XVPA 4B30B 4HQ9A 2DDDA 5HZSA 2R1FA 3ZTFA 5EB7A 5DRGA 1XMZA 1QXTA 3U0NA 4DXIA 5FVGA 4IZNA 2Z6ZA 3SSTA 2JPAA 4W6FA 2IE2A 3U0LA 2EL6A 1EMKA 3OGOA 2H5PA 4W6SA 4GZNC 4DXPA 2Q6PA 5DQMA 5KL7A 4LW5A 3SVUA 1F2IG 1WJPA 3DQ6A 4W6UA 1QY3A 2EQ3A 1RMPA 3SSHA 1DGCA 3BX9A 4Z4MA 4HE4A 4L1IA 2I13A 3U8AA 4W6BA 3CGLA 2JP9A 1OXFA 3CD9A 2GX0A 2ELZA 2EM3A 3SSKA 4IK5A 2A56B 3LF4B 4BDUA 4W7RA 1YFPA 2RSIA 2H9WA 3O77A 3DQ2A 2E72A 4ZF4A 3NF0A 1RMOA 3SV5A 4R2RA 2QT2A 4LJDA 1KYPA 4W7EA 1Q4BA 1QYQA 5EXBA 5FVIA 4W6TA 3BXBA 2BB8A 1A1GA 4I2YA 3A8SA 1MYWA 3NT3A 3CFHA 5LTPA 4R6BA 2G16B 4W7XA 3EPHA 4GESB 5KL3A 4ZFSA 1Q4CA 4DXNA 4LJCA 2ENCA 4J88A 1Q4AA 5AQBB 4IK9A 2CTDA 4W6PA 3ZULA 4KF5A 5HBDA 3U0MA 4W6JA 1CV7A 4ZIOA 3U8PA 4Z4KA 3SVSA 2EMNA 3LVAA 3MHSC 1YHGA 5DPJA 5KTGA 5DTLA 4DXMA 2IOVA 1JBZA 1A1FA 3DQUA 2EMWA 4R2DA 2ELYA 3EK7A 2YTOA 2G6XA 2ZO7A 1XSSA 2OKWA 2EN2A 5H89A 2EOEA 2EQ0A 3M22A 2YTNA 1A1HA 2V4EA 2G3OA 4KA9A 2POXA 4H3MA 3V3DA 1UISA 2DGCA 2FZUA 3VHTA 1XA9A 3KCSA 2HQZA 4DKMA 5FHVA 3OSQA 1Z1BA 1XQMA 2V4EC 2EMGA 4W7AA 5DTZA 1ZGQA 3S05A 3SG6A 4R2SA 2HJOA 5EJUA 3DQ8A 4XL5A 2QLGA 2EJ4A 5DPIA 1KJKA 3GJ2A 2EPXA 2OJKA 4EDSA 3CFAA 3ST4A 2DDCA 4R2AA 4U2VA 1LLMC 2WSNA 4LQUA 5DPGA 4EULA 2EOSA 4KW4A 4W74A 3SSVA 3LSAA 4OQWA 4PPJA 4Q9XA 3BXAA 4H48A 2GW3A 1QYFA 4JF9A 2YTDA 4J89A 2EMZA 1GFLA 1YZWA 2EQ1A 2CSHA 2EOYA 2EPZA 4KGEA 4OJ0A 2WBUA 2EMIA 2LT7A 3DQ1A 3ST0A 3SVDA 1EMEA 3LA1A 4KAGA 1B69A 3H1OA 2FWQA 2EPRA 2H8QA 5HZOA 1F09A 4RYWA 4W6RA 4XGYA 2WBSA 3DQMA 2WHTA 2DRPA 5DTYA 3TMTA 4IK1A 5F9GA 3RWAA 2G6YA 2VVIA 3EPLA 3EVRA 2A46A 3SG5A 3SG4A 2WHSA 2CT1A 2YTPA 2H6VA 3DQHA 1HUYA 4ZB1A 4F6NA 1EMBA 2AWLA 4ORNA 4W6MA 2EMCA 3DQLA 4R6DA 2EOQA 1KYRA 2B3QA 3VHTB 1TF6A 2B3PA 2H5OA 3EVUA 3ZUJA 1UBDC 2ICRA 1JBYA 2YTJA 4W72A 2EM0A 1ZAAC 1RMDA 4JGEA 4GOBA 2HQKA 4W6OA 4KEXA 3G9AA 2HGYA 3DQ7A 2QZ0A 3BXCA 4NWSA 2QLEA 2LVHA 1P47A 4TZAA 4J8AA 4LJBA 4W6GA 2LCEA 1OXDA 4HQCA 1JC0A 3SG2A 1X6HA 3EPJA 4TZGA 2A25A 1Q4EA 3SG3A 2WHUA 2EN8A 2YRHA 2RH7A 2J7JA 1XAEA 1W7SA 2A50B 1C4FA 5EXUA 2GHFA 2A54B 3UG0A 4F2JC 4B5YA 2YU5A 3SVNA 4DXQA 2EPAA 3IR8A 2O29A 2EM2A 3WLDA 2YTQA 1B9CA 2O2BA 1EMLA 2GW4B 4PPLA 4KF4A 3SG7A 3VK1A 2EM9A 3ED8A 2ZMWA 3DQNA 4H47A 2P4MA 2ENHA 2DUGA 2AH8A 4IK8A 2EOZA 2EN3A 2M9AA 3M99B 1A1IA 3U8CA 3ST3A 5BTTB 2DUHA 4PPKA 2Z1OA 3DQ5A 3WCKA 1GL4A 2A47A 3DQ9A 1EMCA 2DD9A 4KW9A 4ZBLA 3SVCA 2YRMA 2G2SB 5EXCI 4IS1C 4JC2A 1YJFA 3SRYA 4RYSA 1Z1QA 5HGEA 3SSYA 3P28A 4OHSA 5HZTA 4OY4A 2A48A 3EKJA 2WCC3 3LVCA 1BFPA 2EMOA 1S6ZA 2EMYA 1BBOA 2EOMA 2AWMA 2WURA 2DUFA 1RMMA 2HRSA 4P76A 4UTSA 4ZF5A 2YSOA 4B30A 2VRDA 3EK8A 3DQEA 1ZGPA 2DUEA 2EMFA 1JK1A 1A1JA 2EMHA 3NT9A 2EM4A 2ENAA 3LF3A 2Q57A 2Y0GA 4KF5C 4W6IA 4HVFA 1MOVA 1KP5A 2GLIA 3OSRA 4WSGA 4W6KA 3CFFA 2O24A 4DXOA 2EM6A 4Q7UA 4FK5C 1EMFA 2LO3A 2EN6A 2Z6YA 4F6MA 1TF3A 2A52B 3DQAA 2EMXA 2EN4A 2MKDA 3DPZA 1H6RA 4ZINA 5LK4A 2DLKA 2QU1A 3EPKA 4R2EA 4XOWA 3LVDA 2YE0A 2ADRA 1F0BA 2PXSA 3DPXA 1ZR9A 2VVJA 4W6HA 2EN1A 4W6CA 2G3DB 4IK4A 2ARLA 5H88A 4JFGA 5FVFA 2EMDA 4H3NA 5DTXA 5HZUA 4KW8A 1YSAC 2WIQA 1A1KA 1OXEA 4KGFA 2PXWA 2YRKA 2HGDA 2EPCA 4L12A 3CD1A 5EHUA 5J2OA 2WISA 3U0KA 5DPHA 2YU8A 1ZGOA 4W7CA 1NCSA 4HQ8A 4IK3A 4W6AA 1X3CA 4W76A 2EOIA 1MEYC 2G6EA 2EMBA 4Q7RA 4JEOA 3DQ4A 1JC1A 2EL5A 4RTCA 2C9IA 2EOFA 3CBEA 4W77A 4AS8A 2OTEA 2QRFA 3W1DA 4M9VC 5EB6A 1YJ2A 3ZUFA 2YTGA 3I19A 2EN7A 2IB6A 2YTFA 5T3IA 3ADFA 3PIBA 2IB5A 2V4EB 3MGFA 3DQFA 3GEXA 2BTJA 3DQ3A 3SVRA 3CB9A 4ZF3A 4W6DA 3SVBA 1UN6B 5KL5A 4W7FA 3DQJA 3O78A 2EE8A 2VADA 2YTIA 2QLHA 3GJ1A 4W7DA 1G2FC 2QLGB 1GGXA 1BB8A 5HW9A 4R2CA 1KYSA 3SSLA 2EOJA 1ZU1A 3DQOA 1W7UA 2WSOA 2EMKA 3DQIA 1X6FA 1YUIA 4W69A 1Z1PA 5LTRA 5H87A 2VZXA 4X9JA 5BT0A 1AAYA 4H3LA 3AI5A 3EKHA 3DQCA 3PJ7A 5BQLA 4L13A 3E5TA 3VICA 2MDGA 2EP3A 4P1QA 5LTQA 4W6NA 1ZUXA 2OGRA 1HCJA 2AWKA 3K1KA 3AKOA 3NEDA 4JRBA 3E5VA 3AI4A 3EVVA
chains in the Genus database with same CATH superfamily
4I8OA 3GL4A 1IBLE 3GB3A 4WFTA 3ECRA 1RM9A 2EORA 2I9IA 2G5ZB 4LJDC 3DQKA 4XOVA 5A6JA 4OGSA 5EBJA 5KL6A 3MHHC 3RWTA 3JAMC 2GX2A 5KL4A 4DMIA 4X8WA 4PFEA 2DD7A 2YTEA 1W7TA 2ZMUA 3HPSA 5DQBA 1RRXA 2EMLA 2EOHA 3PJ5A 1WRJA 2CPNA 3PJBA 1H4UA 3EVPA 2DSYA 5KL2A 1EMAA 4W73A 3VYYA 5A2QC 1TN9A 1YUJA 3ADIA 2Z6XA 3OMLA 5FLXC 3TMRA 4R2QA 4EN1A 5DNYA 5DRFA 2AHAA 2C9JA 3KWRA 2DB2A 4JI2E 1G2DC 2D9HA 2VAEA 4W6LA 4NZVA 3KCTA 2QLIA 2OKYA 3NEZA 3C4TA 2VQEE 1G7KA 3ADGA 4BMJA 4JI6E 5AC4A 1Q4DA 2EL4A 1JK2A 4EMQA 4Q9WA 2YSPA 1YHHA 1YHIA 5BTTA 3M24A 1X6EA 4R2PA 2HCGA 4N3DA 4DKNA 2EOOA 2RPCA 5A6KA 4B3RE 4ZYGA 4DR3E 1EMGA 3SVOA 3F6GA 2HGHA 2DLQA 1IQOA 2A53B 1IBKE 3VYXA 1UILA 4DKKA 4W75A 2UUBE 2H5RA 3DQDA 2HPWA 2PRTA 2YDZA 2DUIA 2M4IA 3DPWA 2AWJA 3LS3A 2WBTA 3C6KA 3OTOE 3EK4A 3SS0A 1ZBTA 3AUZA 3IWDA 3JTZA 3E5WA 5DU0A 4KZSA 1X5WA 2EM5A 2EMAA 4M0VA 4JI3E 3UFZA 1EMMA 4F9CB 2ZO6A 1QYOA 4GF6B 4ANJA 2VVHA 2DMIA 2H5QA 1DQ3A 2YE1A 4AR7A 2NABA 4EDOA 2LRSA 3HPZA 2LV2A 2EOXA 4X65E 3IP2A 1MOUA 2YFPA 1AH5A 4WPYA 1Q73A 3ST2A 3ZOQB 4LTYA 2FL1A 4IJDA 2MKNA 2HFCA 2EM7A 3H1RA 2EM8A 3SVEA 4LQTA 3FIGA 3HXLA 3WLCA 2JADA 1XNRE 5DY6A 4Q7TA 4BHCA 3P8UA 2EPUA 3W1CA 2OTBA 2MDRA 2L33A 1A1LA 4KPIA 2EPPA 3SSPA 4XVPA 4B30B 4HQ9A 2DDDA 5HZSA 2R1FA 3ZTFA 5EB7A 5DRGA 1XMZA 1QXTA 3U0NA 4DXIA 5FVGA 3F6HA 4IZNA 2Z6ZA 2JR1A 5CFFE 3SSTA 2FTXB 2JPAA 4W6FA 2IE2A 3U0LA 2EL6A 3BIDA 5AASA 3HQ1A 1EMKA 3OGOA 2H5PA 4DV3E 4W6SA 4GZNC 4DXPA 2Q6PA 5DQMA 5KL7A 4HEIA 2V88A 4LW5A 5AE1A 2JVAA 2NA2A 4JI8E 3SVUA 1F2IG 1WJPA 3DQ6A 4W6UA 3J7AG 1QY3A 2EQ3A 2ZM6E 1RMPA 3SSHA 1DGCA 2V89A 2ODRD 3BX9A 4Z4MA 4HE4A 4L1IA 1PJQA 2I13A 1PJTA 3U8AA 4W6BA 3CGLA 4P7DA 2JP9A 1OXFA 3CD9A 2GX0A 2V87A 2LTSA 3THNA 1N34E 2ELZA 2MC5A 1FJGE 4LF6E 2EM3A 2VF1A 3SSKA 4IK5A 2A56B 3LF4B 3HTXA 4BDUA 4W7RA 4O24A 1YFPA 4NXNE 2E5LE 2RSIA 2H9WA 3O77A 3DQ2A 2E72A 4ZF4A 3NF0A 4WSPA 1RMOA 3SV5A 4B3SE 4R2RA 2QT2A 4LJDA 2N3HA 1YYKA 1KYPA 4ZYDA 4W7EA 4L8NA 1Q4BA 1QYQA 5EXBA 5FVIA 4W6TA 3BXBA 2BB8A 1A1GA 4I2YA 4F9BB 3A8SA 5TSEA 1IMUA 1MYWA 3NT3A 3CFHA 5LTPA 4R6BA 2G16B 4O4KA 4W7XA 3UK3C 1SR9A 4HTGA 3EPHA 4GESB 5KL3A 4ZFSA 4X64E 2LUQA 1Q4CA 4DXNA 4LJCA 3T1YE 2ENCA 4J88A 1Q4AA 5AQBB 4IK9A 2CTDA 4GKJE 4W6PA 3ZULA 4KF5A 4DV1E 5HBDA 3U0MA 4W6JA 1CV7A 1RC7A 4ZIOA 3U8PA 4Z4KA 3SVSA 2EMNA 3LVAA 2YZTA 1YHGA 5DPJA 2H36X 5KTGA 2L6MA 5DTLA 3MHSC 4DXMA 2IOVA 4LF4E 1JBZA 1A1FA 2V83A 3DQUA 1MGTA 2EMWA 4ZYHA 4R2DA 2ELYA 3EK7A 2YTOA 4LFBE 2G6XA 2ZO7A 1XSSA 2OKWA 2B3TB 2EN2A 5H89A 2EOEA 2YT4A 4AQYE 2EQ0A 4BBYA 2NUGA 3M22A 2YTNA 1A1HA 2V4EA 2G3OA 4KA9A 2POXA 4H3MA 3V3DA 1UISA 2ODRC 2UUCE 2DGCA 2FZUA 1QNTA 1WHQA 3VHTA 1XA9A 3KCSA 2HQZA 5AC5A 4Q28A 1XMOE 4DKMA 4F54A 4DV6E 3C6MA 5FHVA 3OSQA 1Z1BA 1XQMA 2V4EC 2EMGA 4W7AA 5DTZA 1ZGQA 3S05A 3SG6A 5BR8E 4R2SA 2HJOA 5EJUA 2LMZA 4B3ME 3DQ8A 4XL5A 2JYAA 2QLGA 2RSMA 4ZYEA 2EJ4A 5DPIA 1KJKA 3GJ2A 5A6BA 2EPXA 2OJKA 4EDSA 2N8XA 3CFAA 3ST4A 2DDCA 3AV0A 4R2AA 4U2VA 1LLMC 2WSNA 2UXCE 4LQUA 5DPGA 4EULA 2EOSA 1YYOA 4KW4A 4DR7E 4W74A 3SSVA 3LSAA 4OQWA 4PPJA 4Q9XA 3BXAA 4H48A 4R03A 2GW3A 1PJSA 1QYFA 4JF9A 2YTDA 2UUAE 4J89A 2EMZA 1GFLA 1YZWA 2B7VA 2EQ1A 2CSHA 2EOYA 2EPZA 4KGEA 4OJ0A 2WBUA 2EMIA 4DV0E 1STUA 2LT7A 3DQ1A 3ST0A 3SVDA 1HR0E 1EMEA 2L2MA 3LA1A 4KAGA 2EPLX 2L2NA 3LMLA 4WYQB 1GTKA 4DUZE 1B69A 3H1OA 2FWQA 4BC7A 2EPRA 2F8BA 4L5NC 2H8QA 5HZOA 2V8QB 1F09A 4RYWA 4W6RA 4XGYA 2Q8UA 2WBSA 2UXDE 3DQMA 3ADJA 4DUYE 2WHTA 1WXRA 2DRPA 5DTYA 2FV4B 3TMTA 4IK1A 5F9GA 3RWAA 2G6YA 2VVIA 2EPNA 3EVRA 4J8ZA 4BCAA 5A69A 3EPLA 1I94E 2A46A 3SG5A 3SG4A 5LLQA 1EKZA 2WHSA 2CT1A 2YTPA 2H6VA 2JWOA 3DQHA 1HUYA 4ZB1A 4GEQB 1EMBA 2AWLA 4F6NA 4ORNA 4W6MA 4MLQA 2EMCA 3DQLA 4R6DA 2EOQA 1KYRA 2B3QA 3TQMA 1N3GA 3VHTB 1TF6A 4TUIA 2B3PA 1O0WA 2H5OA 3EVUA 3ZUJA 4DR2E 1UBDC 2ICRA 4KWYA 1JBYA 2YTJA 4X66E 1PDAA 4W72A 2EM0A 1ZAAC 2L8TA 2F4VE 3THOB 1RMDA 4JGEA 1EH7A 4GOBA 2HQKA 4W6OA 5AE3A 4KEXA 5IWAE 3G9AA 2HGYA 3DQ7A 2YWQA 2QZ0A 4M2ZA 3BXCA 4NWSA 1RQ0A 2QLEA 2HHHE 1IQSA 2LJUA 2LVHA 3BBGA 5T6JA 1P47A 4TZAA 4J8AA 2FGGA 3RMPA 3BF2A 3P1XA 4LJBA 4W6GA 2WZOA 2LCEA 1OXDA 1FKAE 4HQCA 4WXDA 4WX9A 1JC0A 3SG2A 1X6HA 3EPJA 4TZGA 2A25A 1Q4EA 3SG3A 2WHUA 2EN8A 2YRHA 2RH7A 2J7JA 3MSWA 2NUFA 1XAEA 2IHR1 1W7SA 4JI4E 2A50B 2LBSB 1C4FA 5IXMB 1QU6A 5EXUA 2GHFA 2A54B 3UG0A 3JU0A 2LJHA 1EH8A 4B5YA 5LL6R 4F2JC 1HNXE 1YZ9A 2YU5A 2KONA 3SVNA 4DXQA 2EPAA 1XMQE 1HNZE 4Q35B 3IR8A 1YFHA 1J5EE 2O29A 2EM2A 3WLDA 2UXBE 2YTQA 1B9CA 2O2BA 1EMLA 2GW4B 4PPLA 4KF4A 3SG7A 3VK1A 2EM9A 1ZBQA 3ED8A 2ZMWA 2KHXA 3DQNA 4H47A 2P4MA 2ENHA 5A6BD 2DUGA 2AH8A 4IK8A 2GPIA 4JI0E 4K0KE 2HC5A 2EOZA 2EN3A 1T4NA 2M9AA 3M99B 2M7QA 1A1IA 3U8CA 1N36E 4R8OA 3ST3A 5BTTB 2DUHA 4PPKA 1X47A 2Z1OA 3DQ5A 3WCKA 1GL4A 2A47A 3DQ9A 1EMCA 2DD9A 4KW9A 4ZBLA 3SVCA 2YRMA 2G2SB 5EXCI 4IS1C 4LF5E 4JC2A 1YJFA 3SRYA 4RYSA 3EQ1A 1Z1QA 5HGEA 3SSYA 3P28A 4OHSA 5HZTA 4N4RB 4OY4A 3KZZA 2A48A 3EKJA 2WCC3 2VE7C 3LVCA 1SFEA 1BFPA 4DV5E 2EMOA 1S6ZA 4JI1E 2EMYA 1BBOA 4BC9A 4LU9A 2EOMA 2EWLA 1GQEA 2AWMA 2WURA 2LE2A 2E1MA 2DUFA 1RMMA 1PKPA 4JI7E 4DR5E 2HRSA 5LMNE 3BGHA 3T1HE 1YPNA 4P76A 4UTSA 4ZF5A 2YSOA 4B30A 2B7TA 2VRDA 2B9DA 1NEIA 1T39A 3EK8A 4P78A 3DQEA 3C4BA 5LMUE 1ZGPA 4O43A 2DUEA 2EMFA 2BBGA 1JK1A 1A1JA 2EMHA 3NT9A 2EM4A 3H09A 2DIXA 4BHBA 2ENAA 3LF3A 2Q57A 1YYWA 1HNWE 2Y0GA 4KF5C 4W6IA 5F3WA 4HVFA 1L4SA 4LFCE 1MOVA 1KP5A 2GLIA 2MC6A 4JYAE 3OSRA 4WSGA 4W6KA 3CFFA 2O24A 1T4OA 4YHHE 4DXOA 2V86A 2R76A 2HJJA 2EM6A 1DI2A 4Q7UA 4FK5C 1EMFA 2EPMX 2LO3A 2EN6A 2Z6YA 4F6MA 1TF3A 4LF8E 2A52B 2EZ6A 3DQAA 2EMXA 4OX9E 2EN4A 2MKDA 1N33E 3LLHA 2KOUA 1XNQE 3DPZA 1H6RA 4ZINA 5LK4A 3DF6A 3IWBA 4BS9A 4B3TE 2DLKA 4LF9E 2QU1A 1GZ6A 3IWCA 3EPKA 2JY9A 4R2EA 4XOWA 4YY3E 3LVDA 2YE0A 2ADRA 1F0BA 2PXSA 3DPXA 5AE2A 1ZR9A 2VVJA 2YPNA 4W6HA 1KYQA 4DR6E 2EN1A 2JXPA 4X62E 4W6CA 2G3DB 4IK4A 2JOBA 2ARLA 5H88A 4MLVA 4JFGA 5FVFA 2EMDA 4H3NA 3J80C 2L3JA 5DTXA 4DV2E 5HZUA 4KW8A 1YSAC 2WIQA 1A1KA 1OXEA 4KGFA 2LUPB 2PXWA 2YRKA 2HGDA 2M1SA 1T4LB 2EPCA 5IV8B 4L12A 3CD1A 2NUEA 5EHUA 5J2OA 2WISA 2K4VA 3U0KA 5DPHA 4RH8A 2YU8A 3K6QA 1ZGOA 4W7CA 3J81C 3QG5C 3J7Yp 1NCSA 4HQ8A 2EPOA 2RQLA 4IK3A 4W6AA 1X3CA 2G7HA 4W76A 4NHRA 2LTRA 3KZYA 2EOIA 1MEYC 2G6EA 2EMBA 4Q7RA 4JEOA 3DQ4A 1JC1A 2L3CA 1X49A 2EL5A 1T38A 4NXME 4KHPE 4RTCA 2C9IA 2EOFA 3CBEA 4W77A 1N32E 4AS8A 2OTEA 2QRFA 4DR1E 3W1DA 4M9VC 5EB6A 1YJ2A 3ZUFA 1X48A 2YTGA 5ADZA 2RS6A 3I19A 1WHNA 2EN7A 2IB6A 2YTFA 5T3IA 3ADFA 4RHBB 3PIBA 2IB5A 2EPKX 2V4EB 3MGFA 3DQFA 3GEXA 2BTJA 3DQ3A 3SVRA 2VQFE 5IT9C 3CB9A 2K7IA 4ZF3A 4O5GA 4F9AB 4W6DA 3SVBA 1UN6B 4DV7E 4JI5E 5KL5A 4TUGA 4W7FA 3DQJA 3O78A 2EE8A 2VADA 2YTIA 1IBME 2QLHA 2L92A 3GJ1A 4W7DA 1G2FC 2QLGB 2V85A 1GGXA 1BB8A 5HW9A 4R2CA 1KYSA 3SSLA 3DJWA 1BBGA 4WXCA 2EOJA 2UU9E 1ZU1A 3DQOA 1W7UA 2WSOA 2EMKA 3DQIA 1X6FA 1YUIA 4DR4E 4LFAE 2RS7A 3ADLA 1UHZA 4W69A 1EH6A 4OOGC 1Z1PA 5LTRA 4GKKE 4M30A 5H87A 5A6AA 2VZXA 4X9JA 5BT0A 4LF7E 3L00A 1AAYA 4H3LA 3AI5A 2N3GA 3EKHA 3DQCA 3PJ7A 5BQLA 3VK6A 4L13A 3E5TA 3VICA 4DV4E 4JV5E 2MDGA 2JOXA 2EP3A 4P1QA 5LTQA 4W6NA 1ZUXA 2OGRA 1HCJA 2AWKA 3K1KA 3AKOA 3NEDA 4JRBA 2RTXA 3E5VA 3AI4A 3EVVA 2L2KB 1J26A 2DMYA
chains in the Genus database with same CATH topology
3GL4A 3GB3A 1RM9A 2EORA 2G5ZB 4LJDC 3DQKA 4XOVA 4OGSA 5EBJA 5KL6A 3MHHC 3RWTA 5KL4A 2GX2A 4PFEA 2DD7A 2YTEA 1W7TA 2ZMUA 5DQBA 1RRXA 2EMLA 2EOHA 3PJ5A 5KL2A 3UK3C 3PJBA 1H4UA 3EVPA 1EMAA 4W73A 1YUJA 1TN9A 2Z6XA 3TMRA 4R2QA 4EN1A 5DRFA 2AHAA 2C9JA 1G2DC 2D9HA 2VAEA 4W6LA 3KCTA 2QLIA 2OKYA 3NEZA 1G7KA 1Q4DA 2EL4A 1JK2A 4EMQA 4Q9WA 2YSPA 1YHHA 1YHIA 5BTTA 3M24A 1X6EA 4R2PA 2HCGA 4N3DA 4DKNA 2EOOA 2RPCA 1EMGA 3SVOA 2HGHA 2DLQA 2A53B 4W75A 2H5RA 3DQDA 2HPWA 2PRTA 2YDZA 2DUIA 3DPWA 2AWJA 3LS3A 2WBTA 3EK4A 3SS0A 3E5WA 5DU0A 1X5WA 2EM5A 2EMAA 3UFZA 1EMMA 2ZO6A 1QYOA 4GF6B 4ANJA 2VVHA 2DMIA 2H5QA 2YE1A 4AR7A 2NABA 4EDOA 2LV2A 2EOXA 3IP2A 1MOUA 2YFPA 1Q73A 3ST2A 2FL1A 4IJDA 2MKNA 2HFCA 2EM7A 3H1RA 2EM8A 3SVEA 4LQTA 3WLCA 2JADA 5DY6A 4Q7TA 3P8UA 2EPUA 3W1CA 2OTBA 1A1LA 4KPIA 2EPPA 3SSPA 4XVPA 4B30B 4HQ9A 2DDDA 5HZSA 2R1FA 3ZTFA 5EB7A 5DRGA 1XMZA 1QXTA 3U0NA 4DXIA 5FVGA 4IZNA 2Z6ZA 3SSTA 2JPAA 4W6FA 2IE2A 3U0LA 2EL6A 1EMKA 3OGOA 2H5PA 4W6SA 4GZNC 4DXPA 2Q6PA 5DQMA 5KL7A 4LW5A 3SVUA 1F2IG 1WJPA 3DQ6A 4W6UA 1QY3A 2EQ3A 1RMPA 3SSHA 1DGCA 3BX9A 4Z4MA 4HE4A 4L1IA 2I13A 3U8AA 4W6BA 3CGLA 2JP9A 1OXFA 3CD9A 2GX0A 2ELZA 2EM3A 3SSKA 4IK5A 2A56B 3LF4B 4BDUA 4W7RA 1YFPA 2RSIA 2H9WA 3O77A 3DQ2A 2E72A 4ZF4A 3NF0A 1RMOA 3SV5A 4R2RA 2QT2A 4LJDA 1KYPA 4W7EA 1Q4BA 1QYQA 5EXBA 5FVIA 4W6TA 3BXBA 2BB8A 1A1GA 4I2YA 3A8SA 1MYWA 3NT3A 3CFHA 5LTPA 4R6BA 2G16B 4W7XA 3EPHA 4GESB 5KL3A 4ZFSA 1Q4CA 4DXNA 4LJCA 2ENCA 4J88A 1Q4AA 5AQBB 4IK9A 2CTDA 4W6PA 3ZULA 4KF5A 5HBDA 3U0MA 4W6JA 1CV7A 4ZIOA 3U8PA 4Z4KA 3SVSA 2EMNA 3LVAA 3MHSC 1YHGA 5DPJA 5KTGA 5DTLA 4DXMA 2IOVA 1JBZA 1A1FA 3DQUA 2EMWA 4R2DA 2ELYA 3EK7A 2YTOA 2G6XA 2ZO7A 1XSSA 2OKWA 2EN2A 5H89A 2EOEA 2EQ0A 3M22A 2YTNA 1A1HA 2V4EA 2G3OA 4KA9A 2POXA 4H3MA 3V3DA 1UISA 2DGCA 2FZUA 3VHTA 1XA9A 3KCSA 2HQZA 4DKMA 5FHVA 3OSQA 1Z1BA 1XQMA 2V4EC 2EMGA 4W7AA 5DTZA 1ZGQA 3S05A 3SG6A 4R2SA 2HJOA 5EJUA 3DQ8A 4XL5A 2QLGA 2EJ4A 5DPIA 1KJKA 3GJ2A 2EPXA 2OJKA 4EDSA 3CFAA 3ST4A 2DDCA 4R2AA 4U2VA 1LLMC 2WSNA 4LQUA 5DPGA 4EULA 2EOSA 4KW4A 4W74A 3SSVA 3LSAA 4OQWA 4PPJA 4Q9XA 3BXAA 4H48A 2GW3A 1QYFA 4JF9A 2YTDA 4J89A 2EMZA 1GFLA 1YZWA 2EQ1A 2CSHA 2EOYA 2EPZA 4KGEA 4OJ0A 2WBUA 2EMIA 2LT7A 3DQ1A 3ST0A 3SVDA 1EMEA 3LA1A 4KAGA 1B69A 3H1OA 2FWQA 2EPRA 2H8QA 5HZOA 1F09A 4RYWA 4W6RA 4XGYA 2WBSA 3DQMA 2WHTA 2DRPA 5DTYA 3TMTA 4IK1A 5F9GA 3RWAA 2G6YA 2VVIA 3EPLA 3EVRA 2A46A 3SG5A 3SG4A 2WHSA 2CT1A 2YTPA 2H6VA 3DQHA 1HUYA 4ZB1A 4F6NA 1EMBA 2AWLA 4ORNA 4W6MA 2EMCA 3DQLA 4R6DA 2EOQA 1KYRA 2B3QA 3VHTB 1TF6A 2B3PA 2H5OA 3EVUA 3ZUJA 1UBDC 2ICRA 1JBYA 2YTJA 4W72A 2EM0A 1ZAAC 1RMDA 4JGEA 4GOBA 2HQKA 4W6OA 4KEXA 3G9AA 2HGYA 3DQ7A 2QZ0A 3BXCA 4NWSA 2QLEA 2LVHA 1P47A 4TZAA 4J8AA 4LJBA 4W6GA 2LCEA 1OXDA 4HQCA 1JC0A 3SG2A 1X6HA 3EPJA 4TZGA 2A25A 1Q4EA 3SG3A 2WHUA 2EN8A 2YRHA 2RH7A 2J7JA 1XAEA 1W7SA 2A50B 1C4FA 5EXUA 2GHFA 2A54B 3UG0A 4F2JC 4B5YA 2YU5A 3SVNA 4DXQA 2EPAA 3IR8A 2O29A 2EM2A 3WLDA 2YTQA 1B9CA 2O2BA 1EMLA 2GW4B 4PPLA 4KF4A 3SG7A 3VK1A 2EM9A 3ED8A 2ZMWA 3DQNA 4H47A 2P4MA 2ENHA 2DUGA 2AH8A 4IK8A 2EOZA 2EN3A 2M9AA 3M99B 1A1IA 3U8CA 3ST3A 5BTTB 2DUHA 4PPKA 2Z1OA 3DQ5A 3WCKA 1GL4A 2A47A 3DQ9A 1EMCA 2DD9A 4KW9A 4ZBLA 3SVCA 2YRMA 2G2SB 5EXCI 4IS1C 4JC2A 1YJFA 3SRYA 4RYSA 1Z1QA 5HGEA 3SSYA 3P28A 4OHSA 5HZTA 4OY4A 2A48A 3EKJA 2WCC3 3LVCA 1BFPA 2EMOA 1S6ZA 2EMYA 1BBOA 2EOMA 2AWMA 2WURA 2DUFA 1RMMA 2HRSA 4P76A 4UTSA 4ZF5A 2YSOA 4B30A 2VRDA 3EK8A 3DQEA 1ZGPA 2DUEA 2EMFA 1JK1A 1A1JA 2EMHA 3NT9A 2EM4A 2ENAA 3LF3A 2Q57A 2Y0GA 4KF5C 4W6IA 4HVFA 1MOVA 1KP5A 2GLIA 3OSRA 4WSGA 4W6KA 3CFFA 2O24A 4DXOA 2EM6A 4Q7UA 4FK5C 1EMFA 2LO3A 2EN6A 2Z6YA 4F6MA 1TF3A 2A52B 3DQAA 2EMXA 2EN4A 2MKDA 3DPZA 1H6RA 4ZINA 5LK4A 2DLKA 2QU1A 3EPKA 4R2EA 4XOWA 3LVDA 2YE0A 2ADRA 1F0BA 2PXSA 3DPXA 1ZR9A 2VVJA 4W6HA 2EN1A 4W6CA 2G3DB 4IK4A 2ARLA 5H88A 4JFGA 5FVFA 2EMDA 4H3NA 5DTXA 5HZUA 4KW8A 1YSAC 2WIQA 1A1KA 1OXEA 4KGFA 2PXWA 2YRKA 2HGDA 2EPCA 4L12A 3CD1A 5EHUA 5J2OA 2WISA 3U0KA 5DPHA 2YU8A 1ZGOA 4W7CA 1NCSA 4HQ8A 4IK3A 4W6AA 1X3CA 4W76A 2EOIA 1MEYC 2G6EA 2EMBA 4Q7RA 4JEOA 3DQ4A 1JC1A 2EL5A 4RTCA 2C9IA 2EOFA 3CBEA 4W77A 4AS8A 2OTEA 2QRFA 3W1DA 4M9VC 5EB6A 1YJ2A 3ZUFA 2YTGA 3I19A 2EN7A 2IB6A 2YTFA 5T3IA 3ADFA 3PIBA 2IB5A 2V4EB 3MGFA 3DQFA 3GEXA 2BTJA 3DQ3A 3SVRA 3CB9A 4ZF3A 4W6DA 3SVBA 1UN6B 5KL5A 4W7FA 3DQJA 3O78A 2EE8A 2VADA 2YTIA 2QLHA 3GJ1A 4W7DA 1G2FC 2QLGB 1GGXA 1BB8A 5HW9A 4R2CA 1KYSA 3SSLA 2EOJA 1ZU1A 3DQOA 1W7UA 2WSOA 2EMKA 3DQIA 1X6FA 1YUIA 4W69A 1Z1PA 5LTRA 5H87A 2VZXA 4X9JA 5BT0A 1AAYA 4H3LA 3AI5A 3EKHA 3DQCA 3PJ7A 5BQLA 4L13A 3E5TA 3VICA 2MDGA 2EP3A 4P1QA 5LTQA 4W6NA 1ZUXA 2OGRA 1HCJA 2AWKA 3K1KA 3AKOA 3NEDA 4JRBA 3E5VA 3AI4A 3EVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL4 A;  3GB3 A;  1RM9 A;  2EOR A;  2G5Z B;  4LJD C;  3DQK A;  4XOV A;  4OGS A;  5EBJ A;  5KL6 A;  3MHH C;  3RWT A;  5KL4 A;  2GX2 A;  4PFE A;  2DD7 A;  2YTE A;  1W7T A;  2ZMU A;  5DQB A;  1RRX A;  2EML A;  2EOH A;  3PJ5 A;  5KL2 A;  3UK3 C;  3PJB A;  1H4U A;  3EVP A;  1EMA A;  4W73 A;  1YUJ A;  1TN9 A;  2Z6X A;  3TMR A;  4R2Q A;  4EN1 A;  5DRF A;  2AHA A;  2C9J A;  1G2D C;  2D9H A;  2VAE A;  4W6L A;  3KCT A;  2QLI A;  2OKY A;  3NEZ A;  1G7K A;  1Q4D A;  2EL4 A;  1JK2 A;  4EMQ A;  4Q9W A;  2YSP A;  1YHH A;  1YHI A;  5BTT A;  3M24 A;  1X6E A;  4R2P A;  2HCG A;  4N3D A;  4DKN A;  2EOO A;  2RPC A;  1EMG A;  3SVO A;  2HGH A;  2DLQ A;  2A53 B;  4W75 A;  2H5R A;  3DQD A;  2HPW A;  2PRT A;  2YDZ A;  2DUI A;  3DPW A;  2AWJ A;  3LS3 A;  2WBT A;  3EK4 A;  3SS0 A;  3E5W A;  5DU0 A;  1X5W A;  2EM5 A;  2EMA A;  3UFZ A;  1EMM A;  2ZO6 A;  1QYO A;  4GF6 B;  4ANJ A;  2VVH A;  2DMI A;  2H5Q A;  2YE1 A;  4AR7 A;  2NAB A;  4EDO A;  2LV2 A;  2EOX A;  3IP2 A;  1MOU A;  2YFP A;  1Q73 A;  3ST2 A;  2FL1 A;  4IJD A;  2MKN A;  2HFC A;  2EM7 A;  3H1R A;  2EM8 A;  3SVE A;  4LQT A;  3WLC A;  2JAD A;  5DY6 A;  4Q7T A;  3P8U A;  2EPU A;  3W1C A;  2OTB A;  1A1L A;  4KPI A;  2EPP A;  3SSP A;  4XVP A;  4B30 B;  4HQ9 A;  2DDD A;  5HZS A;  2R1F A;  3ZTF A;  5EB7 A;  5DRG A;  1XMZ A;  1QXT A;  3U0N A;  4DXI A;  5FVG A;  4IZN A;  2Z6Z A;  3SST A;  2JPA A;  4W6F A;  2IE2 A;  3U0L A;  2EL6 A;  1EMK A;  3OGO A;  2H5P A;  4W6S A;  4GZN C;  4DXP A;  2Q6P A;  5DQM A;  5KL7 A;  4LW5 A;  3SVU A;  1F2I G;  1WJP A;  3DQ6 A;  4W6U A;  1QY3 A;  2EQ3 A;  1RMP A;  3SSH A;  1DGC A;  3BX9 A;  4Z4M A;  4HE4 A;  4L1I A;  2I13 A;  3U8A A;  4W6B A;  3CGL A;  2JP9 A;  1OXF A;  3CD9 A;  2GX0 A;  2ELZ A;  2EM3 A;  3SSK A;  4IK5 A;  2A56 B;  3LF4 B;  4BDU A;  4W7R A;  1YFP A;  2RSI A;  2H9W A;  3O77 A;  3DQ2 A;  2E72 A;  4ZF4 A;  3NF0 A;  1RMO A;  3SV5 A;  4R2R A;  2QT2 A;  4LJD A;  1KYP A;  4W7E A;  1Q4B A;  1QYQ A;  5EXB A;  5FVI A;  4W6T A;  3BXB A;  2BB8 A;  1A1G A;  4I2Y A;  3A8S A;  1MYW A;  3NT3 A;  3CFH A;  5LTP A;  4R6B A;  2G16 B;  4W7X A;  3EPH A;  4GES B;  5KL3 A;  4ZFS A;  1Q4C A;  4DXN A;  4LJC A;  2ENC A;  4J88 A;  1Q4A A;  5AQB B;  4IK9 A;  2CTD A;  4W6P A;  3ZUL A;  4KF5 A;  5HBD A;  3U0M A;  4W6J A;  1CV7 A;  4ZIO A;  3U8P A;  4Z4K A;  3SVS A;  2EMN A;  3LVA A;  3MHS C;  1YHG A;  5DPJ A;  5KTG A;  5DTL A;  4DXM A;  2IOV A;  1JBZ A;  1A1F A;  3DQU A;  2EMW A;  4R2D A;  2ELY A;  3EK7 A;  2YTO A;  2G6X A;  2ZO7 A;  1XSS A;  2OKW A;  2EN2 A;  5H89 A;  2EOE A;  2EQ0 A;  3M22 A;  2YTN A;  1A1H A;  2V4E A;  2G3O A;  4KA9 A;  2POX A;  4H3M A;  3V3D A;  1UIS A;  2DGC A;  2FZU A;  3VHT A;  1XA9 A;  3KCS A;  2HQZ A;  4DKM A;  5FHV A;  3OSQ A;  1Z1B A;  1XQM A;  2V4E C;  2EMG A;  4W7A A;  5DTZ A;  1ZGQ A;  3S05 A;  3SG6 A;  4R2S A;  2HJO A;  5EJU A;  3DQ8 A;  4XL5 A;  2QLG A;  2EJ4 A;  5DPI A;  1KJK A;  3GJ2 A;  2EPX A;  2OJK A;  4EDS A;  3CFA A;  3ST4 A;  2DDC A;  4R2A A;  4U2V A;  1LLM C;  2WSN A;  4LQU A;  5DPG A;  4EUL A;  2EOS A;  4KW4 A;  4W74 A;  3SSV A;  3LSA A;  4OQW A;  4PPJ A;  4Q9X A;  3BXA A;  4H48 A;  2GW3 A;  1QYF A;  4JF9 A;  2YTD A;  4J89 A;  2EMZ A;  1GFL A;  1YZW A;  2EQ1 A;  2CSH A;  2EOY A;  2EPZ A;  4KGE A;  4OJ0 A;  2WBU A;  2EMI A;  2LT7 A;  3DQ1 A;  3ST0 A;  3SVD A;  1EME A;  3LA1 A;  4KAG A;  1B69 A;  3H1O A;  2FWQ A;  2EPR A;  2H8Q A;  5HZO A;  1F09 A;  4RYW A;  4W6R A;  4XGY A;  2WBS A;  3DQM A;  2WHT A;  2DRP A;  5DTY A;  3TMT A;  4IK1 A;  5F9G A;  3RWA A;  2G6Y A;  2VVI A;  3EPL A;  3EVR A;  2A46 A;  3SG5 A;  3SG4 A;  2WHS A;  2CT1 A;  2YTP A;  2H6V A;  3DQH A;  1HUY A;  4ZB1 A;  4F6N A;  1EMB A;  2AWL A;  4ORN A;  4W6M A;  2EMC A;  3DQL A;  4R6D A;  2EOQ A;  1KYR A;  2B3Q A;  3VHT B;  1TF6 A;  2B3P A;  2H5O A;  3EVU A;  3ZUJ A;  1UBD C;  2ICR A;  1JBY A;  2YTJ A;  4W72 A;  2EM0 A;  1ZAA C;  1RMD A;  4JGE A;  4GOB A;  2HQK A;  4W6O A;  4KEX A;  3G9A A;  2HGY A;  3DQ7 A;  2QZ0 A;  3BXC A;  4NWS A;  2QLE A;  2LVH A;  1P47 A;  4TZA A;  4J8A A;  4LJB A;  4W6G A;  2LCE A;  1OXD A;  4HQC A;  1JC0 A;  3SG2 A;  1X6H A;  3EPJ A;  4TZG A;  2A25 A;  1Q4E A;  3SG3 A;  2WHU A;  2EN8 A;  2YRH A;  2RH7 A;  2J7J A;  1XAE A;  1W7S A;  2A50 B;  1C4F A;  5EXU A;  2GHF A;  2A54 B;  3UG0 A;  4F2J C;  4B5Y A;  2YU5 A;  3SVN A;  4DXQ A;  2EPA A;  3IR8 A;  2O29 A;  2EM2 A;  3WLD A;  2YTQ A;  1B9C A;  2O2B A;  1EML A;  2GW4 B;  4PPL A;  4KF4 A;  3SG7 A;  3VK1 A;  2EM9 A;  3ED8 A;  2ZMW A;  3DQN A;  4H47 A;  2P4M A;  2ENH A;  2DUG A;  2AH8 A;  4IK8 A;  2EOZ A;  2EN3 A;  2M9A A;  3M99 B;  1A1I A;  3U8C A;  3ST3 A;  5BTT B;  2DUH A;  4PPK A;  2Z1O A;  3DQ5 A;  3WCK A;  1GL4 A;  2A47 A;  3DQ9 A;  1EMC A;  2DD9 A;  4KW9 A;  4ZBL A;  3SVC A;  2YRM A;  2G2S B;  5EXC I;  4IS1 C;  4JC2 A;  1YJF A;  3SRY A;  4RYS A;  1Z1Q A;  5HGE A;  3SSY A;  3P28 A;  4OHS A;  5HZT A;  4OY4 A;  2A48 A;  3EKJ A;  2WCC 3;  3LVC A;  1BFP A;  2EMO A;  1S6Z A;  2EMY A;  1BBO A;  2EOM A;  2AWM A;  2WUR A;  2DUF A;  1RMM A;  2HRS A;  4P76 A;  4UTS A;  4ZF5 A;  2YSO A;  4B30 A;  2VRD A;  3EK8 A;  3DQE A;  1ZGP A;  2DUE A;  2EMF A;  1JK1 A;  1A1J A;  2EMH A;  3NT9 A;  2EM4 A;  2ENA A;  3LF3 A;  2Q57 A;  2Y0G A;  4KF5 C;  4W6I A;  4HVF A;  1MOV A;  1KP5 A;  2GLI A;  3OSR A;  4WSG A;  4W6K A;  3CFF A;  2O24 A;  4DXO A;  2EM6 A;  4Q7U A;  4FK5 C;  1EMF A;  2LO3 A;  2EN6 A;  2Z6Y A;  4F6M A;  1TF3 A;  2A52 B;  3DQA A;  2EMX A;  2EN4 A;  2MKD A;  3DPZ A;  1H6R A;  4ZIN A;  5LK4 A;  2DLK A;  2QU1 A;  3EPK A;  4R2E A;  4XOW A;  3LVD A;  2YE0 A;  2ADR A;  1F0B A;  2PXS A;  3DPX A;  1ZR9 A;  2VVJ A;  4W6H A;  2EN1 A;  4W6C A;  2G3D B;  4IK4 A;  2ARL A;  5H88 A;  4JFG A;  5FVF A;  2EMD A;  4H3N A;  5DTX A;  5HZU A;  4KW8 A;  1YSA C;  2WIQ A;  1A1K A;  1OXE A;  4KGF A;  2PXW A;  2YRK A;  2HGD A;  2EPC A;  4L12 A;  3CD1 A;  5EHU A;  5J2O A;  2WIS A;  3U0K A;  5DPH A;  2YU8 A;  1ZGO A;  4W7C A;  1NCS A;  4HQ8 A;  4IK3 A;  4W6A A;  1X3C A;  4W76 A;  2EOI A;  1MEY C;  2G6E A;  2EMB A;  4Q7R A;  4JEO A;  3DQ4 A;  1JC1 A;  2EL5 A;  4RTC A;  2C9I A;  2EOF A;  3CBE A;  4W77 A;  4AS8 A;  2OTE A;  2QRF A;  3W1D A;  4M9V C;  5EB6 A;  1YJ2 A;  3ZUF A;  2YTG A;  3I19 A;  2EN7 A;  2IB6 A;  2YTF A;  5T3I A;  3ADF A;  3PIB A;  2IB5 A;  2V4E B;  3MGF A;  3DQF A;  3GEX A;  2BTJ A;  3DQ3 A;  3SVR A;  3CB9 A;  4ZF3 A;  4W6D A;  3SVB A;  1UN6 B;  5KL5 A;  4W7F A;  3DQJ A;  3O78 A;  2EE8 A;  2VAD A;  2YTI A;  2QLH A;  3GJ1 A;  4W7D A;  1G2F C;  2QLG B;  1GGX A;  1BB8 A;  5HW9 A;  4R2C A;  1KYS A;  3SSL A;  2EOJ A;  1ZU1 A;  3DQO A;  1W7U A;  2WSO A;  2EMK A;  3DQI A;  1X6F A;  1YUI A;  4W69 A;  1Z1P A;  5LTR A;  5H87 A;  2VZX A;  4X9J A;  5BT0 A;  1AAY A;  4H3L A;  3AI5 A;  3EKH A;  3DQC A;  3PJ7 A;  5BQL A;  4L13 A;  3E5T A;  3VIC A;  2MDG A;  2EP3 A;  4P1Q A;  5LTQ A;  4W6N A;  1ZUX A;  2OGR A;  1HCJ A;  2AWK A;  3K1K A;  3AKO A;  3NED A;  4JRB A;  3E5V A;  3AI4 A;  3EVV A; 
#chains in the Genus database with same CATH topology
 4I8O A;  3GL4 A;  1IBL E;  3GB3 A;  4WFT A;  3ECR A;  1RM9 A;  2EOR A;  2I9I A;  2G5Z B;  4LJD C;  3DQK A;  4XOV A;  5A6J A;  4OGS A;  5EBJ A;  5KL6 A;  3MHH C;  3RWT A;  3JAM C;  2GX2 A;  5KL4 A;  4DMI A;  4X8W A;  4PFE A;  2DD7 A;  2YTE A;  1W7T A;  2ZMU A;  3HPS A;  5DQB A;  1RRX A;  2EML A;  2EOH A;  3PJ5 A;  1WRJ A;  2CPN A;  3PJB A;  1H4U A;  3EVP A;  2DSY A;  5KL2 A;  1EMA A;  4W73 A;  3VYY A;  5A2Q C;  1TN9 A;  1YUJ A;  3ADI A;  2Z6X A;  3OML A;  5FLX C;  3TMR A;  4R2Q A;  4EN1 A;  5DNY A;  5DRF A;  2AHA A;  2C9J A;  3KWR A;  2DB2 A;  4JI2 E;  1G2D C;  2D9H A;  2VAE A;  4W6L A;  4NZV A;  3KCT A;  2QLI A;  2OKY A;  3NEZ A;  3C4T A;  2VQE E;  1G7K A;  3ADG A;  4BMJ A;  4JI6 E;  5AC4 A;  1Q4D A;  2EL4 A;  1JK2 A;  4EMQ A;  4Q9W A;  2YSP A;  1YHH A;  1YHI A;  5BTT A;  3M24 A;  1X6E A;  4R2P A;  2HCG A;  4N3D A;  4DKN A;  2EOO A;  2RPC A;  5A6K A;  4B3R E;  4ZYG A;  4DR3 E;  1EMG A;  3SVO A;  3F6G A;  2HGH A;  2DLQ A;  1IQO A;  2A53 B;  1IBK E;  3VYX A;  1UIL A;  4DKK A;  4W75 A;  2UUB E;  2H5R A;  3DQD A;  2HPW A;  2PRT A;  2YDZ A;  2DUI A;  2M4I A;  3DPW A;  2AWJ A;  3LS3 A;  2WBT A;  3C6K A;  3OTO E;  3EK4 A;  3SS0 A;  1ZBT A;  3AUZ A;  3IWD A;  3JTZ A;  3E5W A;  5DU0 A;  4KZS A;  1X5W A;  2EM5 A;  2EMA A;  4M0V A;  4JI3 E;  3UFZ A;  1EMM A;  4F9C B;  2ZO6 A;  1QYO A;  4GF6 B;  4ANJ A;  2VVH A;  2DMI A;  2H5Q A;  1DQ3 A;  2YE1 A;  4AR7 A;  2NAB A;  4EDO A;  2LRS A;  3HPZ A;  2LV2 A;  2EOX A;  4X65 E;  3IP2 A;  1MOU A;  2YFP A;  1AH5 A;  4WPY A;  1Q73 A;  3ST2 A;  3ZOQ B;  4LTY A;  2FL1 A;  4IJD A;  2MKN A;  2HFC A;  2EM7 A;  3H1R A;  2EM8 A;  3SVE A;  4LQT A;  3FIG A;  3HXL A;  3WLC A;  2JAD A;  1XNR E;  5DY6 A;  4Q7T A;  4BHC A;  3P8U A;  2EPU A;  3W1C A;  2OTB A;  2MDR A;  2L33 A;  1A1L A;  4KPI A;  2EPP A;  3SSP A;  4XVP A;  4B30 B;  4HQ9 A;  2DDD A;  5HZS A;  2R1F A;  3ZTF A;  5EB7 A;  5DRG A;  1XMZ A;  1QXT A;  3U0N A;  4DXI A;  5FVG A;  3F6H A;  4IZN A;  2Z6Z A;  2JR1 A;  5CFF E;  3SST A;  2FTX B;  2JPA A;  4W6F A;  2IE2 A;  3U0L A;  2EL6 A;  3BID A;  5AAS A;  3HQ1 A;  1EMK A;  3OGO A;  2H5P A;  4DV3 E;  4W6S A;  4GZN C;  4DXP A;  2Q6P A;  5DQM A;  5KL7 A;  4HEI A;  2V88 A;  4LW5 A;  5AE1 A;  2JVA A;  2NA2 A;  4JI8 E;  3SVU A;  1F2I G;  1WJP A;  3DQ6 A;  4W6U A;  3J7A G;  1QY3 A;  2EQ3 A;  2ZM6 E;  1RMP A;  3SSH A;  1DGC A;  2V89 A;  2ODR D;  3BX9 A;  4Z4M A;  4HE4 A;  4L1I A;  1PJQ A;  2I13 A;  1PJT A;  3U8A A;  4W6B A;  3CGL A;  4P7D A;  2JP9 A;  1OXF A;  3CD9 A;  2GX0 A;  2V87 A;  2LTS A;  3THN A;  1N34 E;  2ELZ A;  2MC5 A;  1FJG E;  4LF6 E;  2EM3 A;  2VF1 A;  3SSK A;  4IK5 A;  2A56 B;  3LF4 B;  3HTX A;  4BDU A;  4W7R A;  4O24 A;  1YFP A;  4NXN E;  2E5L E;  2RSI A;  2H9W A;  3O77 A;  3DQ2 A;  2E72 A;  4ZF4 A;  3NF0 A;  4WSP A;  1RMO A;  3SV5 A;  4B3S E;  4R2R A;  2QT2 A;  4LJD A;  2N3H A;  1YYK A;  1KYP A;  4ZYD A;  4W7E A;  4L8N A;  1Q4B A;  1QYQ A;  5EXB A;  5FVI A;  4W6T A;  3BXB A;  2BB8 A;  1A1G A;  4I2Y A;  4F9B B;  3A8S A;  5TSE A;  1IMU A;  1MYW A;  3NT3 A;  3CFH A;  5LTP A;  4R6B A;  2G16 B;  4O4K A;  4W7X A;  3UK3 C;  1SR9 A;  4HTG A;  3EPH A;  4GES B;  5KL3 A;  4ZFS A;  4X64 E;  2LUQ A;  1Q4C A;  4DXN A;  4LJC A;  3T1Y E;  2ENC A;  4J88 A;  1Q4A A;  5AQB B;  4IK9 A;  2CTD A;  4GKJ E;  4W6P A;  3ZUL A;  4KF5 A;  4DV1 E;  5HBD A;  3U0M A;  4W6J A;  1CV7 A;  1RC7 A;  4ZIO A;  3U8P A;  4Z4K A;  3SVS A;  2EMN A;  3LVA A;  2YZT A;  1YHG A;  5DPJ A;  2H36 X;  5KTG A;  2L6M A;  5DTL A;  3MHS C;  4DXM A;  2IOV A;  4LF4 E;  1JBZ A;  1A1F A;  2V83 A;  3DQU A;  1MGT A;  2EMW A;  4ZYH A;  4R2D A;  2ELY A;  3EK7 A;  2YTO A;  4LFB E;  2G6X A;  2ZO7 A;  1XSS A;  2OKW A;  2B3T B;  2EN2 A;  5H89 A;  2EOE A;  2YT4 A;  4AQY E;  2EQ0 A;  4BBY A;  2NUG A;  3M22 A;  2YTN A;  1A1H A;  2V4E A;  2G3O A;  4KA9 A;  2POX A;  4H3M A;  3V3D A;  1UIS A;  2ODR C;  2UUC E;  2DGC A;  2FZU A;  1QNT A;  1WHQ A;  3VHT A;  1XA9 A;  3KCS A;  2HQZ A;  5AC5 A;  4Q28 A;  1XMO E;  4DKM A;  4F54 A;  4DV6 E;  3C6M A;  5FHV A;  3OSQ A;  1Z1B A;  1XQM A;  2V4E C;  2EMG A;  4W7A A;  5DTZ A;  1ZGQ A;  3S05 A;  3SG6 A;  5BR8 E;  4R2S A;  2HJO A;  5EJU A;  2LMZ A;  4B3M E;  3DQ8 A;  4XL5 A;  2JYA A;  2QLG A;  2RSM A;  4ZYE A;  2EJ4 A;  5DPI A;  1KJK A;  3GJ2 A;  5A6B A;  2EPX A;  2OJK A;  4EDS A;  2N8X A;  3CFA A;  3ST4 A;  2DDC A;  3AV0 A;  4R2A A;  4U2V A;  1LLM C;  2WSN A;  2UXC E;  4LQU A;  5DPG A;  4EUL A;  2EOS A;  1YYO A;  4KW4 A;  4DR7 E;  4W74 A;  3SSV A;  3LSA A;  4OQW A;  4PPJ A;  4Q9X A;  3BXA A;  4H48 A;  4R03 A;  2GW3 A;  1PJS A;  1QYF A;  4JF9 A;  2YTD A;  2UUA E;  4J89 A;  2EMZ A;  1GFL A;  1YZW A;  2B7V A;  2EQ1 A;  2CSH A;  2EOY A;  2EPZ A;  4KGE A;  4OJ0 A;  2WBU A;  2EMI A;  4DV0 E;  1STU A;  2LT7 A;  3DQ1 A;  3ST0 A;  3SVD A;  1HR0 E;  1EME A;  2L2M A;  3LA1 A;  4KAG A;  2EPL X;  2L2N A;  3LML A;  4WYQ B;  1GTK A;  4DUZ E;  1B69 A;  3H1O A;  2FWQ A;  4BC7 A;  2EPR A;  2F8B A;  4L5N C;  2H8Q A;  5HZO A;  2V8Q B;  1F09 A;  4RYW A;  4W6R A;  4XGY A;  2Q8U A;  2WBS A;  2UXD E;  3DQM A;  3ADJ A;  4DUY E;  2WHT A;  1WXR A;  2DRP A;  5DTY A;  2FV4 B;  3TMT A;  4IK1 A;  5F9G A;  3RWA A;  2G6Y A;  2VVI A;  2EPN A;  3EVR A;  4J8Z A;  4BCA A;  5A69 A;  3EPL A;  1I94 E;  2A46 A;  3SG5 A;  3SG4 A;  5LLQ A;  1EKZ A;  2WHS A;  2CT1 A;  2YTP A;  2H6V A;  2JWO A;  3DQH A;  1HUY A;  4ZB1 A;  4GEQ B;  1EMB A;  2AWL A;  4F6N A;  4ORN A;  4W6M A;  4MLQ A;  2EMC A;  3DQL A;  4R6D A;  2EOQ A;  1KYR A;  2B3Q A;  3TQM A;  1N3G A;  3VHT B;  1TF6 A;  4TUI A;  2B3P A;  1O0W A;  2H5O A;  3EVU A;  3ZUJ A;  4DR2 E;  1UBD C;  2ICR A;  4KWY A;  1JBY A;  2YTJ A;  4X66 E;  1PDA A;  4W72 A;  2EM0 A;  1ZAA C;  2L8T A;  2F4V E;  3THO B;  1RMD A;  4JGE A;  1EH7 A;  4GOB A;  2HQK A;  4W6O A;  5AE3 A;  4KEX A;  5IWA E;  3G9A A;  2HGY A;  3DQ7 A;  2YWQ A;  2QZ0 A;  4M2Z A;  3BXC A;  4NWS A;  1RQ0 A;  2QLE A;  2HHH E;  1IQS A;  2LJU A;  2LVH A;  3BBG A;  5T6J A;  1P47 A;  4TZA A;  4J8A A;  2FGG A;  3RMP A;  3BF2 A;  3P1X A;  4LJB A;  4W6G A;  2WZO A;  2LCE A;  1OXD A;  1FKA E;  4HQC A;  4WXD A;  4WX9 A;  1JC0 A;  3SG2 A;  1X6H A;  3EPJ A;  4TZG A;  2A25 A;  1Q4E A;  3SG3 A;  2WHU A;  2EN8 A;  2YRH A;  2RH7 A;  2J7J A;  3MSW A;  2NUF A;  1XAE A;  2IHR 1;  1W7S A;  4JI4 E;  2A50 B;  2LBS B;  1C4F A;  5IXM B;  1QU6 A;  5EXU A;  2GHF A;  2A54 B;  3UG0 A;  3JU0 A;  2LJH A;  1EH8 A;  4B5Y A;  5LL6 R;  4F2J C;  1HNX E;  1YZ9 A;  2YU5 A;  2KON A;  3SVN A;  4DXQ A;  2EPA A;  1XMQ E;  1HNZ E;  4Q35 B;  3IR8 A;  1YFH A;  1J5E E;  2O29 A;  2EM2 A;  3WLD A;  2UXB E;  2YTQ A;  1B9C A;  2O2B A;  1EML A;  2GW4 B;  4PPL A;  4KF4 A;  3SG7 A;  3VK1 A;  2EM9 A;  1ZBQ A;  3ED8 A;  2ZMW A;  2KHX A;  3DQN A;  4H47 A;  2P4M A;  2ENH A;  5A6B D;  2DUG A;  2AH8 A;  4IK8 A;  2GPI A;  4JI0 E;  4K0K E;  2HC5 A;  2EOZ A;  2EN3 A;  1T4N A;  2M9A A;  3M99 B;  2M7Q A;  1A1I A;  3U8C A;  1N36 E;  4R8O A;  3ST3 A;  5BTT B;  2DUH A;  4PPK A;  1X47 A;  2Z1O A;  3DQ5 A;  3WCK A;  1GL4 A;  2A47 A;  3DQ9 A;  1EMC A;  2DD9 A;  4KW9 A;  4ZBL A;  3SVC A;  2YRM A;  2G2S B;  5EXC I;  4IS1 C;  4LF5 E;  4JC2 A;  1YJF A;  3SRY A;  4RYS A;  3EQ1 A;  1Z1Q A;  5HGE A;  3SSY A;  3P28 A;  4OHS A;  5HZT A;  4N4R B;  4OY4 A;  3KZZ A;  2A48 A;  3EKJ A;  2WCC 3;  2VE7 C;  3LVC A;  1SFE A;  1BFP A;  4DV5 E;  2EMO A;  1S6Z A;  4JI1 E;  2EMY A;  1BBO A;  4BC9 A;  4LU9 A;  2EOM A;  2EWL A;  1GQE A;  2AWM A;  2WUR A;  2LE2 A;  2E1M A;  2DUF A;  1RMM A;  1PKP A;  4JI7 E;  4DR5 E;  2HRS A;  5LMN E;  3BGH A;  3T1H E;  1YPN A;  4P76 A;  4UTS A;  4ZF5 A;  2YSO A;  4B30 A;  2B7T A;  2VRD A;  2B9D A;  1NEI A;  1T39 A;  3EK8 A;  4P78 A;  3DQE A;  3C4B A;  5LMU E;  1ZGP A;  4O43 A;  2DUE A;  2EMF A;  2BBG A;  1JK1 A;  1A1J A;  2EMH A;  3NT9 A;  2EM4 A;  3H09 A;  2DIX A;  4BHB A;  2ENA A;  3LF3 A;  2Q57 A;  1YYW A;  1HNW E;  2Y0G A;  4KF5 C;  4W6I A;  5F3W A;  4HVF A;  1L4S A;  4LFC E;  1MOV A;  1KP5 A;  2GLI A;  2MC6 A;  4JYA E;  3OSR A;  4WSG A;  4W6K A;  3CFF A;  2O24 A;  1T4O A;  4YHH E;  4DXO A;  2V86 A;  2R76 A;  2HJJ A;  2EM6 A;  1DI2 A;  4Q7U A;  4FK5 C;  1EMF A;  2EPM X;  2LO3 A;  2EN6 A;  2Z6Y A;  4F6M A;  1TF3 A;  4LF8 E;  2A52 B;  2EZ6 A;  3DQA A;  2EMX A;  4OX9 E;  2EN4 A;  2MKD A;  1N33 E;  3LLH A;  2KOU A;  1XNQ E;  3DPZ A;  1H6R A;  4ZIN A;  5LK4 A;  3DF6 A;  3IWB A;  4BS9 A;  4B3T E;  2DLK A;  4LF9 E;  2QU1 A;  1GZ6 A;  3IWC A;  3EPK A;  2JY9 A;  4R2E A;  4XOW A;  4YY3 E;  3LVD A;  2YE0 A;  2ADR A;  1F0B A;  2PXS A;  3DPX A;  5AE2 A;  1ZR9 A;  2VVJ A;  2YPN A;  4W6H A;  1KYQ A;  4DR6 E;  2EN1 A;  2JXP A;  4X62 E;  4W6C A;  2G3D B;  4IK4 A;  2JOB A;  2ARL A;  5H88 A;  4MLV A;  4JFG A;  5FVF A;  2EMD A;  4H3N A;  3J80 C;  2L3J A;  5DTX A;  4DV2 E;  5HZU A;  4KW8 A;  1YSA C;  2WIQ A;  1A1K A;  1OXE A;  4KGF A;  2LUP B;  2PXW A;  2YRK A;  2HGD A;  2M1S A;  1T4L B;  2EPC A;  5IV8 B;  4L12 A;  3CD1 A;  2NUE A;  5EHU A;  5J2O A;  2WIS A;  2K4V A;  3U0K A;  5DPH A;  4RH8 A;  2YU8 A;  3K6Q A;  1ZGO A;  4W7C A;  3J81 C;  3QG5 C;  3J7Y p;  1NCS A;  4HQ8 A;  2EPO A;  2RQL A;  4IK3 A;  4W6A A;  1X3C A;  2G7H A;  4W76 A;  4NHR A;  2LTR A;  3KZY A;  2EOI A;  1MEY C;  2G6E A;  2EMB A;  4Q7R A;  4JEO A;  3DQ4 A;  1JC1 A;  2L3C A;  1X49 A;  2EL5 A;  1T38 A;  4NXM E;  4KHP E;  4RTC A;  2C9I A;  2EOF A;  3CBE A;  4W77 A;  1N32 E;  4AS8 A;  2OTE A;  2QRF A;  4DR1 E;  3W1D A;  4M9V C;  5EB6 A;  1YJ2 A;  3ZUF A;  1X48 A;  2YTG A;  5ADZ A;  2RS6 A;  3I19 A;  1WHN A;  2EN7 A;  2IB6 A;  2YTF A;  5T3I A;  3ADF A;  4RHB B;  3PIB A;  2IB5 A;  2EPK X;  2V4E B;  3MGF A;  3DQF A;  3GEX A;  2BTJ A;  3DQ3 A;  3SVR A;  2VQF E;  5IT9 C;  3CB9 A;  2K7I A;  4ZF3 A;  4O5G A;  4F9A B;  4W6D A;  3SVB A;  1UN6 B;  4DV7 E;  4JI5 E;  5KL5 A;  4TUG A;  4W7F A;  3DQJ A;  3O78 A;  2EE8 A;  2VAD A;  2YTI A;  1IBM E;  2QLH A;  2L92 A;  3GJ1 A;  4W7D A;  1G2F C;  2QLG B;  2V85 A;  1GGX A;  1BB8 A;  5HW9 A;  4R2C A;  1KYS A;  3SSL A;  3DJW A;  1BBG A;  4WXC A;  2EOJ A;  2UU9 E;  1ZU1 A;  3DQO A;  1W7U A;  2WSO A;  2EMK A;  3DQI A;  1X6F A;  1YUI A;  4DR4 E;  4LFA E;  2RS7 A;  3ADL A;  1UHZ A;  4W69 A;  1EH6 A;  4OOG C;  1Z1P A;  5LTR A;  4GKK E;  4M30 A;  5H87 A;  5A6A A;  2VZX A;  4X9J A;  5BT0 A;  4LF7 E;  3L00 A;  1AAY A;  4H3L A;  3AI5 A;  2N3G A;  3EKH A;  3DQC A;  3PJ7 A;  5BQL A;  3VK6 A;  4L13 A;  3E5T A;  3VIC A;  4DV4 E;  4JV5 E;  2MDG A;  2JOX A;  2EP3 A;  4P1Q A;  5LTQ A;  4W6N A;  1ZUX A;  2OGR A;  1HCJ A;  2AWK A;  3K1K A;  3AKO A;  3NED A;  4JRB A;  2RTX A;  3E5V A;  3AI4 A;  3EVV A;  2L2K B;  1J26 A;  2DMY A; 
#chains in the Genus database with same CATH homology
 3GL4 A;  3GB3 A;  1RM9 A;  2EOR A;  2G5Z B;  4LJD C;  3DQK A;  4XOV A;  4OGS A;  5EBJ A;  5KL6 A;  3MHH C;  3RWT A;  5KL4 A;  2GX2 A;  4PFE A;  2DD7 A;  2YTE A;  1W7T A;  2ZMU A;  5DQB A;  1RRX A;  2EML A;  2EOH A;  3PJ5 A;  5KL2 A;  3UK3 C;  3PJB A;  1H4U A;  3EVP A;  1EMA A;  4W73 A;  1YUJ A;  1TN9 A;  2Z6X A;  3TMR A;  4R2Q A;  4EN1 A;  5DRF A;  2AHA A;  2C9J A;  1G2D C;  2D9H A;  2VAE A;  4W6L A;  3KCT A;  2QLI A;  2OKY A;  3NEZ A;  1G7K A;  1Q4D A;  2EL4 A;  1JK2 A;  4EMQ A;  4Q9W A;  2YSP A;  1YHH A;  1YHI A;  5BTT A;  3M24 A;  1X6E A;  4R2P A;  2HCG A;  4N3D A;  4DKN A;  2EOO A;  2RPC A;  1EMG A;  3SVO A;  2HGH A;  2DLQ A;  2A53 B;  4W75 A;  2H5R A;  3DQD A;  2HPW A;  2PRT A;  2YDZ A;  2DUI A;  3DPW A;  2AWJ A;  3LS3 A;  2WBT A;  3EK4 A;  3SS0 A;  3E5W A;  5DU0 A;  1X5W A;  2EM5 A;  2EMA A;  3UFZ A;  1EMM A;  2ZO6 A;  1QYO A;  4GF6 B;  4ANJ A;  2VVH A;  2DMI A;  2H5Q A;  2YE1 A;  4AR7 A;  2NAB A;  4EDO A;  2LV2 A;  2EOX A;  3IP2 A;  1MOU A;  2YFP A;  1Q73 A;  3ST2 A;  2FL1 A;  4IJD A;  2MKN A;  2HFC A;  2EM7 A;  3H1R A;  2EM8 A;  3SVE A;  4LQT A;  3WLC A;  2JAD A;  5DY6 A;  4Q7T A;  3P8U A;  2EPU A;  3W1C A;  2OTB A;  1A1L A;  4KPI A;  2EPP A;  3SSP A;  4XVP A;  4B30 B;  4HQ9 A;  2DDD A;  5HZS A;  2R1F A;  3ZTF A;  5EB7 A;  5DRG A;  1XMZ A;  1QXT A;  3U0N A;  4DXI A;  5FVG A;  4IZN A;  2Z6Z A;  3SST A;  2JPA A;  4W6F A;  2IE2 A;  3U0L A;  2EL6 A;  1EMK A;  3OGO A;  2H5P A;  4W6S A;  4GZN C;  4DXP A;  2Q6P A;  5DQM A;  5KL7 A;  4LW5 A;  3SVU A;  1F2I G;  1WJP A;  3DQ6 A;  4W6U A;  1QY3 A;  2EQ3 A;  1RMP A;  3SSH A;  1DGC A;  3BX9 A;  4Z4M A;  4HE4 A;  4L1I A;  2I13 A;  3U8A A;  4W6B A;  3CGL A;  2JP9 A;  1OXF A;  3CD9 A;  2GX0 A;  2ELZ A;  2EM3 A;  3SSK A;  4IK5 A;  2A56 B;  3LF4 B;  4BDU A;  4W7R A;  1YFP A;  2RSI A;  2H9W A;  3O77 A;  3DQ2 A;  2E72 A;  4ZF4 A;  3NF0 A;  1RMO A;  3SV5 A;  4R2R A;  2QT2 A;  4LJD A;  1KYP A;  4W7E A;  1Q4B A;  1QYQ A;  5EXB A;  5FVI A;  4W6T A;  3BXB A;  2BB8 A;  1A1G A;  4I2Y A;  3A8S A;  1MYW A;  3NT3 A;  3CFH A;  5LTP A;  4R6B A;  2G16 B;  4W7X A;  3EPH A;  4GES B;  5KL3 A;  4ZFS A;  1Q4C A;  4DXN A;  4LJC A;  2ENC A;  4J88 A;  1Q4A A;  5AQB B;  4IK9 A;  2CTD A;  4W6P A;  3ZUL A;  4KF5 A;  5HBD A;  3U0M A;  4W6J A;  1CV7 A;  4ZIO A;  3U8P A;  4Z4K A;  3SVS A;  2EMN A;  3LVA A;  3MHS C;  1YHG A;  5DPJ A;  5KTG A;  5DTL A;  4DXM A;  2IOV A;  1JBZ A;  1A1F A;  3DQU A;  2EMW A;  4R2D A;  2ELY A;  3EK7 A;  2YTO A;  2G6X A;  2ZO7 A;  1XSS A;  2OKW A;  2EN2 A;  5H89 A;  2EOE A;  2EQ0 A;  3M22 A;  2YTN A;  1A1H A;  2V4E A;  2G3O A;  4KA9 A;  2POX A;  4H3M A;  3V3D A;  1UIS A;  2DGC A;  2FZU A;  3VHT A;  1XA9 A;  3KCS A;  2HQZ A;  4DKM A;  5FHV A;  3OSQ A;  1Z1B A;  1XQM A;  2V4E C;  2EMG A;  4W7A A;  5DTZ A;  1ZGQ A;  3S05 A;  3SG6 A;  4R2S A;  2HJO A;  5EJU A;  3DQ8 A;  4XL5 A;  2QLG A;  2EJ4 A;  5DPI A;  1KJK A;  3GJ2 A;  2EPX A;  2OJK A;  4EDS A;  3CFA A;  3ST4 A;  2DDC A;  4R2A A;  4U2V A;  1LLM C;  2WSN A;  4LQU A;  5DPG A;  4EUL A;  2EOS A;  4KW4 A;  4W74 A;  3SSV A;  3LSA A;  4OQW A;  4PPJ A;  4Q9X A;  3BXA A;  4H48 A;  2GW3 A;  1QYF A;  4JF9 A;  2YTD A;  4J89 A;  2EMZ A;  1GFL A;  1YZW A;  2EQ1 A;  2CSH A;  2EOY A;  2EPZ A;  4KGE A;  4OJ0 A;  2WBU A;  2EMI A;  2LT7 A;  3DQ1 A;  3ST0 A;  3SVD A;  1EME A;  3LA1 A;  4KAG A;  1B69 A;  3H1O A;  2FWQ A;  2EPR A;  2H8Q A;  5HZO A;  1F09 A;  4RYW A;  4W6R A;  4XGY A;  2WBS A;  3DQM A;  2WHT A;  2DRP A;  5DTY A;  3TMT A;  4IK1 A;  5F9G A;  3RWA A;  2G6Y A;  2VVI A;  3EPL A;  3EVR A;  2A46 A;  3SG5 A;  3SG4 A;  2WHS A;  2CT1 A;  2YTP A;  2H6V A;  3DQH A;  1HUY A;  4ZB1 A;  4F6N A;  1EMB A;  2AWL A;  4ORN A;  4W6M A;  2EMC A;  3DQL A;  4R6D A;  2EOQ A;  1KYR A;  2B3Q A;  3VHT B;  1TF6 A;  2B3P A;  2H5O A;  3EVU A;  3ZUJ A;  1UBD C;  2ICR A;  1JBY A;  2YTJ A;  4W72 A;  2EM0 A;  1ZAA C;  1RMD A;  4JGE A;  4GOB A;  2HQK A;  4W6O A;  4KEX A;  3G9A A;  2HGY A;  3DQ7 A;  2QZ0 A;  3BXC A;  4NWS A;  2QLE A;  2LVH A;  1P47 A;  4TZA A;  4J8A A;  4LJB A;  4W6G A;  2LCE A;  1OXD A;  4HQC A;  1JC0 A;  3SG2 A;  1X6H A;  3EPJ A;  4TZG A;  2A25 A;  1Q4E A;  3SG3 A;  2WHU A;  2EN8 A;  2YRH A;  2RH7 A;  2J7J A;  1XAE A;  1W7S A;  2A50 B;  1C4F A;  5EXU A;  2GHF A;  2A54 B;  3UG0 A;  4F2J C;  4B5Y A;  2YU5 A;  3SVN A;  4DXQ A;  2EPA A;  3IR8 A;  2O29 A;  2EM2 A;  3WLD A;  2YTQ A;  1B9C A;  2O2B A;  1EML A;  2GW4 B;  4PPL A;  4KF4 A;  3SG7 A;  3VK1 A;  2EM9 A;  3ED8 A;  2ZMW A;  3DQN A;  4H47 A;  2P4M A;  2ENH A;  2DUG A;  2AH8 A;  4IK8 A;  2EOZ A;  2EN3 A;  2M9A A;  3M99 B;  1A1I A;  3U8C A;  3ST3 A;  5BTT B;  2DUH A;  4PPK A;  2Z1O A;  3DQ5 A;  3WCK A;  1GL4 A;  2A47 A;  3DQ9 A;  1EMC A;  2DD9 A;  4KW9 A;  4ZBL A;  3SVC A;  2YRM A;  2G2S B;  5EXC I;  4IS1 C;  4JC2 A;  1YJF A;  3SRY A;  4RYS A;  1Z1Q A;  5HGE A;  3SSY A;  3P28 A;  4OHS A;  5HZT A;  4OY4 A;  2A48 A;  3EKJ A;  2WCC 3;  3LVC A;  1BFP A;  2EMO A;  1S6Z A;  2EMY A;  1BBO A;  2EOM A;  2AWM A;  2WUR A;  2DUF A;  1RMM A;  2HRS A;  4P76 A;  4UTS A;  4ZF5 A;  2YSO A;  4B30 A;  2VRD A;  3EK8 A;  3DQE A;  1ZGP A;  2DUE A;  2EMF A;  1JK1 A;  1A1J A;  2EMH A;  3NT9 A;  2EM4 A;  2ENA A;  3LF3 A;  2Q57 A;  2Y0G A;  4KF5 C;  4W6I A;  4HVF A;  1MOV A;  1KP5 A;  2GLI A;  3OSR A;  4WSG A;  4W6K A;  3CFF A;  2O24 A;  4DXO A;  2EM6 A;  4Q7U A;  4FK5 C;  1EMF A;  2LO3 A;  2EN6 A;  2Z6Y A;  4F6M A;  1TF3 A;  2A52 B;  3DQA A;  2EMX A;  2EN4 A;  2MKD A;  3DPZ A;  1H6R A;  4ZIN A;  5LK4 A;  2DLK A;  2QU1 A;  3EPK A;  4R2E A;  4XOW A;  3LVD A;  2YE0 A;  2ADR A;  1F0B A;  2PXS A;  3DPX A;  1ZR9 A;  2VVJ A;  4W6H A;  2EN1 A;  4W6C A;  2G3D B;  4IK4 A;  2ARL A;  5H88 A;  4JFG A;  5FVF A;  2EMD A;  4H3N A;  5DTX A;  5HZU A;  4KW8 A;  1YSA C;  2WIQ A;  1A1K A;  1OXE A;  4KGF A;  2PXW A;  2YRK A;  2HGD A;  2EPC A;  4L12 A;  3CD1 A;  5EHU A;  5J2O A;  2WIS A;  3U0K A;  5DPH A;  2YU8 A;  1ZGO A;  4W7C A;  1NCS A;  4HQ8 A;  4IK3 A;  4W6A A;  1X3C A;  4W76 A;  2EOI A;  1MEY C;  2G6E A;  2EMB A;  4Q7R A;  4JEO A;  3DQ4 A;  1JC1 A;  2EL5 A;  4RTC A;  2C9I A;  2EOF A;  3CBE A;  4W77 A;  4AS8 A;  2OTE A;  2QRF A;  3W1D A;  4M9V C;  5EB6 A;  1YJ2 A;  3ZUF A;  2YTG A;  3I19 A;  2EN7 A;  2IB6 A;  2YTF A;  5T3I A;  3ADF A;  3PIB A;  2IB5 A;  2V4E B;  3MGF A;  3DQF A;  3GEX A;  2BTJ A;  3DQ3 A;  3SVR A;  3CB9 A;  4ZF3 A;  4W6D A;  3SVB A;  1UN6 B;  5KL5 A;  4W7F A;  3DQJ A;  3O78 A;  2EE8 A;  2VAD A;  2YTI A;  2QLH A;  3GJ1 A;  4W7D A;  1G2F C;  2QLG B;  1GGX A;  1BB8 A;  5HW9 A;  4R2C A;  1KYS A;  3SSL A;  2EOJ A;  1ZU1 A;  3DQO A;  1W7U A;  2WSO A;  2EMK A;  3DQI A;  1X6F A;  1YUI A;  4W69 A;  1Z1P A;  5LTR A;  5H87 A;  2VZX A;  4X9J A;  5BT0 A;  1AAY A;  4H3L A;  3AI5 A;  3EKH A;  3DQC A;  3PJ7 A;  5BQL A;  4L13 A;  3E5T A;  3VIC A;  2MDG A;  2EP3 A;  4P1Q A;  5LTQ A;  4W6N A;  1ZUX A;  2OGR A;  1HCJ A;  2AWK A;  3K1K A;  3AKO A;  3NED A;  4JRB A;  3E5V A;  3AI4 A;  3EVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...