3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
molecule keywords Green fluorescent protein
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
1AAYA 5FVGA 1JBZA 1YHIA 3BXAA 4AS8A 4KGEA 1W7UA 2G5ZB 5LTRA 3RWTA 1YFPA 2Y0GA 3ZUFA 4DXQA 2EM2A 2FWQA 3SVDA 1A1HA 1MEYC 1DGCA 2GW3A 3E5VA 2HGYA 2CTDA 4N3DA 3AKOA 4ZBLA 3OSQA 5LTPA 4Q9WA 3EK8A 2EN8A 3CFFA 5HZSA 3PIBA 1BBOA 3CD9A 1Z1PA 1F0BA 2VVHA 2EMCA 3V3DA 2POXA 3RWAA 2ENAA 5DRGA 4R2RA 2WBSA 1EMAA 2WHUA 2A56B 2J7JA 2WCC3 4H3LA 4NWSA 1RRXA 3E5TA 1OXFA 2OJKA 3LVCA 4LJCA 4RTCA 4LJDA 3UG0A 2YRHA 4PPJA 3M24A 2OKYA 3CBEA 5BTTA 5DTLA 1ZR9A 3SSKA 3LVAA 1EMGA 3DQAA 3DQUA 1XA9A 2ZO7A 3IR8A 2DGCA 2DD7A 2EMZA 2QLEA 4EULA 2G2SB 2H6VA 2GLIA 3DPZA 3SVUA 1EMEA 2HQZA 4IK4A 5BQLA 5DQMA 1QYQA 2MKDA 3PJ7A 4HVFA 4PPLA 4B30B 2VAEA 3DQDA 4LW5A 4RYSA 2P4MA 4KW9A 1QYFA 2DUEA 4LJBA 5LK4A 1B69A 4GF6B 2HQKA 2EMNA 1F2IG 4XGYA 1MOVA 3SVOA 3DQEA 2AWLA 3EKJA 3LVDA 2EL4A 4B5YA 4KW8A 3I19A 4W7CA 3A8SA 3EKHA 3SSTA 4R2EA 2M9AA 3SVNA 4RYWA 3KCSA 3CFHA 3EPHA 4XOVA 4W72A 2ZO6A 2EQ3A 3DQKA 2YTNA 4GZNC 5HZTA 2DD9A 4F6MA 1X3CA 2G16B 2GW4B 3U8CA 2DLKA 2C9JA 1F09A 1RMDA 1GGXA 2YTJA 1ZUXA 5H87A 4JGEA 2H5OA 4EDOA 2OKWA 2QLGB 3EPLA 2Q57A 4TZGA 3VICA 2V4EB 2EOOA 5HBDA 4W6NA 4Q7RA 2A25A 3WCKA 4DXMA 2HJOA 3ADFA 3U0MA 4W6TA 2E72A 4WSGA 3DQJA 3OSRA 4KPIA 1X6HA 3SSVA 4Q7TA 4PPKA 1KP5A 2EMXA 2YSOA 4LQUA 2JP9A 2ELYA 2PXSA 4JFGA 2EMYA 2RSIA 2EOYA 3EVRA 4H48A 2C9IA 2A52B 1OXDA 3SVRA 4R2CA 3CGLA 3GB3A 4PFEA 2AWJA 2YE0A 3SG4A 2EN6A 2Q6PA 4ZF3A 3SVSA 2BB8A 1TF6A 4IJDA 2EMGA 2B3PA 4W6BA 1X5WA 5KL7A 1YUJA 5AQBB 2AHAA 1TF3A 4W6AA 4W6GA 1EMBA 1A1IA 2EM0A 2CT1A 2QLHA 2V4EC 3SG5A 4W75A 1YJFA 2G6YA 2WHSA 1RMPA 2EM4A 3LA1A 2H9WA 2PRTA 5EBJA 3EVPA 5DPIA 4W6LA 4UTSA 3LSAA 3KCTA 3O78A 2HCGA 4W7DA 1ZAAC 2WISA 4EN1A 4DKNA 2A54B 3DQLA 4J89A 2EMAA 2DUFA 2EMHA 1ZGOA 2EN7A 2HRSA 5EJUA 2A46A 5EHUA 1W7TA 5KL4A 4W7XA 5DU0A 1EMLA 5DPJA 1KJKA 2EPZA 5T3IA 4HE4A 4ZFSA 2WHTA 2IE2A 4W6SA 1Q73A 5HZOA 3WLDA 2HPWA 1Q4CA 3EVUA 2QLIA 2EM6A 3TMRA 1G2DC 4KA9A 3BX9A 2DDCA 2G3OA 2G6XA 1NCSA 5DY6A 2PXWA 5FHVA 3DQNA 4J88A 4ORNA 2LCEA 3EPJA 1ZGPA 1KYSA 3DPXA 4ANJA 2GX0A 1ZGQA 4F2JC 2EPUA 3H1RA 2QU1A 2VADA 4LQTA 2DUGA 4W6UA 2EN2A 4W6DA 2ICRA 4OJ0A 3EK4A 2EN4A 2GHFA 2OTEA 4W6MA 1A1FA 2Z6YA 4ZINA 2HGDA 3DQFA 4R2PA 2ZMWA 2LVHA 2YTQA 3SG6A 3DQIA 2EM7A 1UISA 2YU8A 4KAGA 3SSLA 3MHSC 1MOUA 2EL5A 2EJ4A 1UBDC 1BB8A 2EOSA 2QRFA 2JADA 2ELZA 3EPKA 1P47A 1JK2A 2FZUA 2EOJA 4W6PA 5EXBA 2D9HA 1A1LA 4W76A 2EN3A 2O24A 4ZF5A 4JF9A 1G7KA 2RH7A 4R2QA 4IK3A 2B3QA 5H89A 3TMTA 1RMMA 2EOIA 4XL5A 4U2VA 1XAEA 3LF3A 4H47A 4LJDC 4BDUA 2HGHA 1GFLA 3IP2A 2EMBA 3SSPA 1RM9A 4JRBA 1B9CA 1YZWA 3DQ7A 2EL6A 3NEZA 4ZB1A 3SSYA 1QY3A 2EOQA 2EM9A 5KL3A 1G2FC 1KYRA 2EMFA 4W6CA 2HFCA 5DQBA 2YTPA 2IB5A 2G3DB 2EPPA 3DQOA 2EP3A 2VVJA 3MGFA 4R2SA 2ENHA 3DQ4A 2A50B 4XVPA 3ST2A 1Q4EA 2ARLA 3SSHA 4DXNA 3MHHC 2JPAA 2EPCA 4R6BA 4KF5C 1UN6B 2H8QA 3NEDA 2MKNA 2LT7A 2VVIA 4W7AA 2EOMA 1TN9A 4OY4A 5DPHA 5DTZA 3W1CA 3ZTFA 3SVBA 2YTFA 4GESB 2YRKA 3UK3C 1C4FA 3DQ9A 5KL6A 4FK5C 3WLCA 4W73A 1KYPA 4L13A 4R2AA 3GJ2A 2LV2A 2EQ1A 1Q4AA 3CD1A 5EXUA 3DQ1A 1XSSA 2EE8A 2EOFA 3K1KA 4TZAA 3AI4A 3DQ8A 2FL1A 2ENCA 3GEXA 3UFZA 2RPCA 1XQMA 3CB9A 4KF4A 1S6ZA 1A1GA 5EB7A 1YSAC 2EMOA 3M22A 3DQHA 5F9GA 3SV5A 5LTQA 4W69A 3PJ5A 5KL2A 1XMZA 4KF5A 2V4EA 3P28A 2DUIA 4I2YA 2WBUA 4OGSA 1QYOA 3DQ6A 2O2BA 2WSOA 4GOBA 2R1FA 2A53B 5DPGA 3NT9A 2EMKA 3NT3A 3BXCA 4R6DA 1EMCA 4F6NA 3OGOA 1BFPA 2DLQA 5HW9A 1LLMC 4KEXA 2CSHA 2AWKA 2OGRA 2EOXA 1EMMA 3M99B 2QT2A 4DXOA 4IK9A 2EPXA 2YTEA 4DXIA 1YHHA 2EM5A 4JEOA 5H88A 1JBYA 2H5PA 2GX2A 4B30A 4R2DA 5DTXA 4HQCA 4OHSA 2Z6ZA 4OQWA 3BXBA 4W7FA 2QLGA 3SVEA 2EM8A 2YTIA 4W6RA 2EQ0A 2A48A 3ST0A 2QZ0A 2YTGA 5HGEA 2Z1OA 4Q9XA 3SG2A 2WIQA 4EDSA 3SG3A 3SRYA 3AI5A 3U0LA 3EK7A 2G6EA 2IOVA 2EOZA 2EMWA 2IB6A 4IK1A 4HQ9A 1HCJA 2EOHA 5DTYA 3GJ1A 2DRPA 1W7SA 2EPAA 1YJ2A 2NABA 3O77A 1YUIA 2YE1A 2EPRA 4J8AA 1MYWA 3ED8A 2YFPA 4W77A 4XOWA 2EM3A 3LS3A 2DUHA 1RMOA 1WJPA 4AR7A 5FVIA 2MDGA 4W6OA 1JC1A 4X9JA 1QXTA 4W6IA 1Q4BA 5EB6A 3DQCA 2WURA 4IZNA 3GL4A 4Z4KA 1A1KA 1EMFA 4L1IA 2Z6XA 3NF0A 2WBTA 5DRFA 3CFAA 4H3MA 4P76A 2EN1A 1Q4DA 1X6FA 1Z1QA 3DPWA 2AH8A 3LF4B 4W74A 5KL5A 1ZU1A 3S05A 1EMKA 1GL4A 4L12A 4M9VC 2A47A 5EXCI 1JC0A 2VRDA 4KGFA 2BTJA 2O29A 4EMQA 2VZXA 3VK1A 1HUYA 3DQ5A 2EOEA 3U0NA 1H4UA 2AWMA 5KTGA 3SS0A 4JC2A 2LO3A 1A1JA 3ST3A 4W6JA 4P1QA 2OTBA 5HZUA 2ZMUA 1CV7A 3EVVA 2I13A 3DQ2A 3SVCA 2YTDA 2DDDA 4H3NA 5FVFA 1Z1BA 4KW4A 4W6KA 2YDZA 1YHGA 2EMLA 3E5WA 2H5QA 3U8AA 5BTTB 4HQ8A 3VHTB 3P8UA 3W1DA 3ZULA 3ST4A 2EMDA 2DMIA 2ADRA 1OXEA 3DQ3A 4Q7UA 3PJBA 4W6HA 1H6RA 4ZF4A 4IK5A 4DKMA 5J2OA 4W6FA 3G9AA 4Z4MA 1JK1A 4IS1C 3H1OA 2H5RA 3DQMA 3U8PA 4DXPA 4W7RA 2WSNA 4IK8A 3SG7A 3U0KA 2YU5A 5BT0A 2YRMA 3ZUJA 1X6EA 2EMIA 2YTOA 3VHTA 4W7EA 2YSPA 4ZIOA 2EORA
chains in the Genus database with same CATH superfamily
1QNTA 1AAYA 4DR5E 2HC5A 2L33A 5FVGA 1JBZA 1YHIA 3BXAA 4AS8A 4KGEA 4L5NC 2DIXA 1W7UA 1DQ3A 3OMLA 5CFFE 2G5ZB 2CPNA 5IT9C 4GKKE 5LTRA 3RWTA 4B3SE 4RH8A 1YFPA 2Y0GA 3ZUFA 4DXQA 2EM2A 2FWQA 3SVDA 2JWOA 1A1HA 1MEYC 1YZ9A 1DGCA 2GW3A 3E5VA 2HGYA 2CTDA 4N3DA 3AKOA 4ZBLA 1FJGE 3OSQA 2MC5A 2LJUA 5LTPA 2RS7A 1T39A 4L8NA 4Q9WA 3EK8A 2EN8A 3CFFA 5HZSA 1SFEA 3PIBA 1BBOA 3CD9A 1Z1PA 2L92A 3H09A 2UXBE 1F0BA 2VVHA 2EMCA 1FKAE 3V3DA 2POXA 3RWAA 2ENAA 4ZYEA 5LLQA 5DRGA 4BBYA 3T1HE 4B3TE 4R2RA 2WBSA 1EMAA 2WHUA 2A56B 3MSWA 2J7JA 3IWCA 4NZVA 4H3LA 4NWSA 4JI7E 2WCC3 2KHXA 1T38A 1IBKE 1RRXA 3E5TA 1OXFA 2OJKA 3LVCA 4LJCA 4RTCA 4LJDA 3UG0A 2H36X 4F54A 2YRHA 4PPJA 3M24A 2OKYA 3CBEA 5BTTA 2E5LE 5DTLA 1ZR9A 3SSKA 3LVAA 3LMLA 1EMGA 3DQAA 3DQUA 3J7AG 1XA9A 2ZO7A 3IR8A 2F8BA 4N4RB 4TUGA 2DD7A 2EMZA 2QLEA 4EULA 2G2SB 2H6VA 2DGCA 2GLIA 3DPZA 3SVUA 4X64E 1EMEA 2HQZA 4IK4A 5BQLA 1XMQE 2UUCE 5DQMA 1QYQA 2MKDA 3IWBA 3PJ7A 4HVFA 4RHBB 4PPLA 4B30B 2VAEA 3DQDA 4DV7E 4BC9A 4LW5A 2EPNA 4RYSA 4JI8E 2P4MA 4KW9A 5AE2A 4DV4E 1QYFA 2DUEA 4LJBA 5LK4A 1B69A 4GF6B 2HQKA 2EMNA 1F2IG 4XGYA 1MOVA 3SVOA 3DQEA 2AWLA 3EKJA 3LVDA 2EL4A 4B5YA 4KW8A 3I19A 2HHHE 4W7CA 3A8SA 4OX9E 3EKHA 3SSTA 2Q8UA 4R2EA 2M9AA 3OTOE 1N32E 2EZ6A 3SVNA 3C4BA 4RYWA 3KCSA 3CFHA 5A6AA 3EPHA 4XOVA 4W72A 2ZO6A 2EQ3A 2BBGA 3DQKA 4LFBE 2YTNA 4GZNC 5HZTA 2EPKX 2JY9A 2YPNA 4WSPA 1YYKA 4JI2E 2DD9A 4F6MA 2NUEA 1X3CA 5F3WA 2G16B 2GW4B 3U8CA 2DLKA 2C9JA 1F09A 1RMDA 1GGXA 2YTJA 1ZUXA 5H87A 4JGEA 3IWDA 2H5OA 4EDOA 2UUAE 2M7QA 2OKWA 1X48A 2QLGB 3EPLA 2Q57A 4DR1E 4TZGA 3VICA 2L2NA 4DUYE 2V4EB 3DJWA 3F6GA 2EOOA 5HBDA 4YY3E 2V8QB 4W6NA 4DV5E 2LRSA 4O24A 4Q7RA 2A25A 1NEIA 3WCKA 3DF6A 4DXMA 2HJOA 3ADFA 3U0MA 4W6TA 1PJQA 2E72A 3DQJA 2RTXA 4J8ZA 4WSGA 2L6MA 4DR2E 3OSRA 4KPIA 1X6HA 3SSVA 4Q7TA 4LFAE 4PPKA 1KP5A 5IV8B 4M2ZA 2EMXA 2YSOA 4F9CB 1ZBQA 4LQUA 2V88A 2JP9A 4LF4E 1T4NA 2PXSA 4JFGA 1RQ0A 2ELYA 4ZYGA 2EMYA 2RSIA 2EOYA 3EVRA 4H48A 2C9IA 1N33E 1XNQE 2A52B 2LTRA 1OXDA 3SVRA 4R2CA 3CGLA 3GB3A 4PFEA 5BR8E 2AWJA 1UILA 2YE0A 1GTKA 3SG4A 2EN6A 4DV6E 2Q6PA 4ZF3A 3SVSA 2BB8A 2B7VA 2JOBA 4IJDA 5A6BD 4YHHE 1TF6A 2EMGA 4JYAE 2B3PA 4KHPE 4W6BA 1X5WA 5KL7A 1YUJA 5AQBB 2AHAA 1TF3A 4W6AA 2WZOA 4W6GA 1EMBA 1N36E 1A1IA 2EM0A 4ZYHA 2CT1A 4R03A 2QLHA 2E1MA 4LF8E 2V4EC 3SG5A 4W75A 1YJFA 2G6YA 2WHSA 1RMPA 1AH5A 3LA1A 2H9WA 2EM4A 2YWQA 5EBJA 3EVPA 4DMIA 2PRTA 5DPIA 3VYXA 4W6LA 4UTSA 3LSAA 3KCTA 3O78A 1SR9A 2EPMX 2HCGA 4W7DA 3JAMC 5FLXC 1ZAAC 2WISA 2UXCE 4EN1A 2YZTA 4BMJA 2NUGA 4DKNA 2A54B 3DQLA 4J89A 2EMAA 2DUFA 1EH6A 2EMHA 1ZGOA 2EN7A 2HRSA 5EJUA 4WX9A 2A46A 3BIDA 1PJTA 5EHUA 1W7TA 2JVAA 4BS9A 5KL4A 4W7XA 5AASA 2RQLA 2JXPA 5DU0A 1EH7A 1EMLA 2L2KB 4AQYE 5DPJA 1I94E 1KJKA 1RC7A 2EPZA 1STUA 1UHZA 2N3HA 5T3IA 4O4KA 3TQMA 4BHCA 4OOGC 4LU9A 3EQ1A 4JV5E 4HE4A 1HNXE 4ZFSA 4DR7E 2WHTA 2IE2A 4W6SA 1Q73A 4BC7A 3JTZA 4JI6E 5HZOA 3WLDA 2HPWA 1Q4CA 3EVUA 2MC6A 2QLIA 2B9DA 3TMRA 2EM6A 4KA9A 3BX9A 2LMZA 1G2DC 2DDCA 2G3OA 3ADIA 5LMNE 2G6XA 1NCSA 5DY6A 1XNRE 2PXWA 5FHVA 3DQNA 4J88A 4ORNA 4B3ME 2LCEA 4KZSA 1ZGPA 3EPJA 1KYSA 3DPXA 4ANJA 2GX0A 1ZGQA 2V86A 2EPUA 4F2JC 3H1RA 3C4TA 2QU1A 2KOUA 5IXMB 2VADA 4LQTA 2EWLA 2DUGA 4W6UA 2EN2A 2NUFA 1IMUA 4W6DA 4M0VA 4DR4E 2ICRA 4OJ0A 2ODRD 4DV2E 3EK4A 2EN4A 2GHFA 1O0WA 2OTEA 4W6MA 1A1FA 1HNWE 4LF7E 2Z6YA 4ZINA 1N3GA 3AUZA 2HJJA 3AV0A 2HGDA 3DQFA 4M30A 4R2PA 2ZMWA 2LVHA 2R76A 3SG6A 2YTQA 4KWYA 3DQIA 2EM7A 1UISA 4WXCA 2UXDE 2YU8A 4KAGA 3SSLA 2B7TA 1MOUA 3MHSC 3BF2A 2EL5A 2EJ4A 1UBDC 1BB8A 2EOSA 2QRFA 2JADA 2ELZA 3EPKA 1P47A 1JK2A 2FZUA 2EOJA 2LUQA 5IWAE 2L3CA 4W6PA 1T4LB 5EXBA 2D9HA 5AE1A 4W76A 2EN3A 1A1LA 2O24A 4ZF5A 4JF9A 1G7KA 2RH7A 4R2QA 3C6KA 1YSAC 4WYQB 4IK3A 2B3QA 5H89A 3TMTA 1KYQA 1WRJA 2DB2A 2I9IA 3J7Yp 1T4OA 4DR6E 1RMMA 2EOIA 4WXDA 4XL5A 4U2VA 1J26A 2EPOA 1XAEA 3LF3A 4H47A 2YT4A 2UUBE 3HQ1A 4LJDC 4BDUA 5TSEA 2HGHA 1GFLA 3IP2A 2EMBA 3SSPA 4X66E 3C6MA 1RM9A 4JRBA 1B9CA 1YZWA 3DQ7A 2EL6A 4P7DA 3NEZA 3VK6A 1XMOE 4ZB1A 3SSYA 1QY3A 3FIGA 2EOQA 2VF1A 2EM9A 5KL3A 1G2FC 1KYRA 3RMPA 2EMFA 4W6CA 2HFCA 5DQBA 2YTPA 5T6JA 3HPSA 1N34E 2IB5A 2G3DB 2IHR1 4LF5E 2EPPA 3DQOA 2FTXB 2EP3A 2V85A 2VVJA 3MGFA 2VE7C 2ENHA 4R2SA 1WHQA 3DQ4A 2A50B 4XVPA 3ST2A 2M1SA 4HEIA 4P78A 1Q4EA 2V83A 2ARLA 4ZYDA 3SSHA 4DXNA 3MHHC 2JPAA 2EPCA 4Q28A 3THNA 1L4SA 4R6BA 4KF5C 1UN6B 2H8QA 3NEDA 2MKNA 2LT7A 4K0KE 2VVIA 4W7AA 2EOMA 3T1YE 1TN9A 4OY4A 5DPHA 5DTZA 3W1CA 3ZTFA 1YPNA 5A6BA 3SVBA 2YTFA 4GESB 1HNZE 2YRKA 3UK3C 1C4FA 3DQ9A 4NHRA 5KL6A 4FK5C 1WXRA 4F9AB 1J5EE 3WLCA 4W73A 5ADZA 1KYPA 4MLQA 4L13A 2JOXA 4B3RE 1HR0E 4LTYA 4R8OA 4R2AA 3GJ2A 2LV2A 3ADGA 2EQ1A 1Q4AA 3CD1A 5EXUA 3DQ1A 1X49A 3QG5C 4JI1E 3HTXA 1XSSA 2EE8A 2V89A 2EOFA 3K6QA 3K1KA 4TZAA 3AI4A 1GZ6A 3DQ8A 2FL1A 2MDRA 3HPZA 2UU9E 2ENCA 3GEXA 3UFZA 4O43A 2RPCA 2KONA 1XQMA 3CB9A 4KF4A 1S6ZA 1BBGA 5EB7A 2GPIA 3KWRA 4DV0E 1A1GA 2EMOA 5A2QC 3M22A 3DQHA 5F9GA 3SV5A 5LTQA 1X47A 2DMYA 4JI0E 1DI2A 5A6JA 4W69A 3PJ5A 5KL2A 2FV4B 1XMZA 4KF5A 2LJHA 2V4EA 4DV1E 3P28A 2RSMA 2DUIA 4I2YA 2WBUA 3BBGA 4OGSA 1QYOA 3DQ6A 2O2BA 1IQSA 2WSOA 4GOBA 4Q35B 2R1FA 2A53B 5DPGA 3NT9A 2EMKA 4DUZE 2EPLX 3NT3A 4BHBA 3BXCA 4R6DA 1EMCA 1PKPA 3OGOA 1BFPA 2DLQA 5HW9A 4F6NA 4KEXA 1LLMC 2CSHA 2AWKA 2OGRA 2EOXA 1EMMA 3M99B 2QT2A 2LUPB 4DXOA 4IK9A 2EPXA 2YTEA 4DXIA 1YHHA 2EM5A 4JEOA 5H88A 1GQEA 1JBYA 2H5PA 2GX2A 4B30A 4R2DA 5DTXA 2VQFE 4HQCA 4OHSA 2Z6ZA 4DV3E 4NXME 3JU0A 3VYYA 4OQWA 1EKZA 3BXBA 4WPYA 1IBME 4JI5E 2L3JA 5A69A 4W7FA 2QLGA 3SVEA 2EM8A 5DNYA 2YTIA 4W6RA 2EQ0A 2A48A 5AE3A 3ST0A 2QZ0A 2YTGA 3BGHA 2LBSB 1PJSA 5HGEA 2Z1OA 3ECRA 4X62E 3ADLA 4Q9XA 3SG2A 2WIQA 4EDSA 3SG3A 3SRYA 4HTGA 3AI5A 3U0LA 3EK7A 2ODRC 2G6EA 2IOVA 2EOZA 2EMWA 2IB6A 4IK1A 4HQ9A 1HCJA 4GEQB 3KZZA 2EOHA 5DTYA 1YYOA 3GJ1A 4LFCE 5AC5A 2DRPA 4JI4E 4NXNE 1W7SA 2EPAA 1YJ2A 2NABA 3O77A 1YUIA 2YE1A 2EPRA 4J8AA 1MYWA 3ED8A 2YFPA 4W77A 4XOWA 2EM3A 2RS6A 5LL6R 3THOB 4X65E 3LS3A 2DUHA 1RMOA 1WJPA 2K7IA 4AR7A 1WHNA 5FVIA 2MDGA 4W6OA 4LF6E 1JC1A 3J81C 4X9JA 4DR3E 1QXTA 4W6IA 3LLHA 5AC4A 1Q4BA 5EB6A 3DQCA 2WURA 2LTSA 3L00A 4IZNA 2B3TB 4BCAA 3GL4A 4Z4KA 4DKKA 1A1KA 1EMFA 4L1IA 2DSYA 2Z6XA 2N3GA 3KZYA 1YYWA 3NF0A 3J80C 2WBTA 5DRFA 3CFAA 4H3MA 4P76A 2NA2A 2EN1A 2VQEE 4MLVA 4JI3E 1Q4DA 1X6FA 2L2MA 4GKJE 1Z1QA 3DPWA 2AH8A 3LF4B 4W74A 5KL5A 1ZU1A 5LMUE 4WFTA 3S05A 1EMKA 1GL4A 1EH8A 4L12A 4TUIA 1MGTA 4M9VC 2A47A 4X8WA 2V87A 5A6KA 5EXCI 1IQOA 1JC0A 2VRDA 4KGFA 2BTJA 2O29A 4EMQA 2VZXA 3VK1A 2JR1A 2K4VA 4LF9E 1HUYA 2M4IA 1YFHA 3DQ5A 2EOEA 3U0NA 1PDAA 1H4UA 2AWMA 5KTGA 3SS0A 4JC2A 2LO3A 3ZOQB 1A1JA 1ZBTA 3ST3A 4W6JA 4P1QA 2OTBA 5HZUA 2ZMUA 1CV7A 3EVVA 2I13A 3DQ2A 3SVCA 2YTDA 2DDDA 4H3NA 2LE2A 5FVFA 1Z1BA 4KW4A 4W6KA 2YDZA 3P1XA 1YHGA 2EMLA 3E5WA 2H5QA 3U8AA 2N8XA 5BTTB 4HQ8A 3VHTB 3P8UA 3W1DA 3ZULA 3ST4A 2EMDA 2DMIA 4I8OA 2ADRA 1OXEA 2G7HA 4F9BB 3DQ3A 4Q7UA 1IBLE 3PJBA 4W6HA 1H6RA 4ZF4A 2L8TA 3ADJA 4IK5A 3HXLA 4DKMA 5J2OA 4W6FA 3G9AA 4O5GA 4Z4MA 1JK1A 4IS1C 3H1OA 2H5RA 2FGGA 3DQMA 3U8PA 4DXPA 4W7RA 1QU6A 2WSNA 4IK8A 3SG7A 3U0KA 2YU5A 5BT0A 2YRMA 3F6HA 2F4VE 3ZUJA 1X6EA 2EMIA 2YTOA 3VHTA 4W7EA 2ZM6E 2YSPA 2JYAA 4ZIOA 2EORA
chains in the Genus database with same CATH topology
1AAYA 5FVGA 1JBZA 1YHIA 3BXAA 4AS8A 4KGEA 1W7UA 2G5ZB 5LTRA 3RWTA 1YFPA 2Y0GA 3ZUFA 4DXQA 2EM2A 2FWQA 3SVDA 1A1HA 1MEYC 1DGCA 2GW3A 3E5VA 2HGYA 2CTDA 4N3DA 3AKOA 4ZBLA 3OSQA 5LTPA 4Q9WA 3EK8A 2EN8A 3CFFA 5HZSA 3PIBA 1BBOA 3CD9A 1Z1PA 1F0BA 2VVHA 2EMCA 3V3DA 2POXA 3RWAA 2ENAA 5DRGA 4R2RA 2WBSA 1EMAA 2WHUA 2A56B 2J7JA 2WCC3 4H3LA 4NWSA 1RRXA 3E5TA 1OXFA 2OJKA 3LVCA 4LJCA 4RTCA 4LJDA 3UG0A 2YRHA 4PPJA 3M24A 2OKYA 3CBEA 5BTTA 5DTLA 1ZR9A 3SSKA 3LVAA 1EMGA 3DQAA 3DQUA 1XA9A 2ZO7A 3IR8A 2DGCA 2DD7A 2EMZA 2QLEA 4EULA 2G2SB 2H6VA 2GLIA 3DPZA 3SVUA 1EMEA 2HQZA 4IK4A 5BQLA 5DQMA 1QYQA 2MKDA 3PJ7A 4HVFA 4PPLA 4B30B 2VAEA 3DQDA 4LW5A 4RYSA 2P4MA 4KW9A 1QYFA 2DUEA 4LJBA 5LK4A 1B69A 4GF6B 2HQKA 2EMNA 1F2IG 4XGYA 1MOVA 3SVOA 3DQEA 2AWLA 3EKJA 3LVDA 2EL4A 4B5YA 4KW8A 3I19A 4W7CA 3A8SA 3EKHA 3SSTA 4R2EA 2M9AA 3SVNA 4RYWA 3KCSA 3CFHA 3EPHA 4XOVA 4W72A 2ZO6A 2EQ3A 3DQKA 2YTNA 4GZNC 5HZTA 2DD9A 4F6MA 1X3CA 2G16B 2GW4B 3U8CA 2DLKA 2C9JA 1F09A 1RMDA 1GGXA 2YTJA 1ZUXA 5H87A 4JGEA 2H5OA 4EDOA 2OKWA 2QLGB 3EPLA 2Q57A 4TZGA 3VICA 2V4EB 2EOOA 5HBDA 4W6NA 4Q7RA 2A25A 3WCKA 4DXMA 2HJOA 3ADFA 3U0MA 4W6TA 2E72A 4WSGA 3DQJA 3OSRA 4KPIA 1X6HA 3SSVA 4Q7TA 4PPKA 1KP5A 2EMXA 2YSOA 4LQUA 2JP9A 2ELYA 2PXSA 4JFGA 2EMYA 2RSIA 2EOYA 3EVRA 4H48A 2C9IA 2A52B 1OXDA 3SVRA 4R2CA 3CGLA 3GB3A 4PFEA 2AWJA 2YE0A 3SG4A 2EN6A 2Q6PA 4ZF3A 3SVSA 2BB8A 1TF6A 4IJDA 2EMGA 2B3PA 4W6BA 1X5WA 5KL7A 1YUJA 5AQBB 2AHAA 1TF3A 4W6AA 4W6GA 1EMBA 1A1IA 2EM0A 2CT1A 2QLHA 2V4EC 3SG5A 4W75A 1YJFA 2G6YA 2WHSA 1RMPA 2EM4A 3LA1A 2H9WA 2PRTA 5EBJA 3EVPA 5DPIA 4W6LA 4UTSA 3LSAA 3KCTA 3O78A 2HCGA 4W7DA 1ZAAC 2WISA 4EN1A 4DKNA 2A54B 3DQLA 4J89A 2EMAA 2DUFA 2EMHA 1ZGOA 2EN7A 2HRSA 5EJUA 2A46A 5EHUA 1W7TA 5KL4A 4W7XA 5DU0A 1EMLA 5DPJA 1KJKA 2EPZA 5T3IA 4HE4A 4ZFSA 2WHTA 2IE2A 4W6SA 1Q73A 5HZOA 3WLDA 2HPWA 1Q4CA 3EVUA 2QLIA 2EM6A 3TMRA 1G2DC 4KA9A 3BX9A 2DDCA 2G3OA 2G6XA 1NCSA 5DY6A 2PXWA 5FHVA 3DQNA 4J88A 4ORNA 2LCEA 3EPJA 1ZGPA 1KYSA 3DPXA 4ANJA 2GX0A 1ZGQA 4F2JC 2EPUA 3H1RA 2QU1A 2VADA 4LQTA 2DUGA 4W6UA 2EN2A 4W6DA 2ICRA 4OJ0A 3EK4A 2EN4A 2GHFA 2OTEA 4W6MA 1A1FA 2Z6YA 4ZINA 2HGDA 3DQFA 4R2PA 2ZMWA 2LVHA 2YTQA 3SG6A 3DQIA 2EM7A 1UISA 2YU8A 4KAGA 3SSLA 3MHSC 1MOUA 2EL5A 2EJ4A 1UBDC 1BB8A 2EOSA 2QRFA 2JADA 2ELZA 3EPKA 1P47A 1JK2A 2FZUA 2EOJA 4W6PA 5EXBA 2D9HA 1A1LA 4W76A 2EN3A 2O24A 4ZF5A 4JF9A 1G7KA 2RH7A 4R2QA 4IK3A 2B3QA 5H89A 3TMTA 1RMMA 2EOIA 4XL5A 4U2VA 1XAEA 3LF3A 4H47A 4LJDC 4BDUA 2HGHA 1GFLA 3IP2A 2EMBA 3SSPA 1RM9A 4JRBA 1B9CA 1YZWA 3DQ7A 2EL6A 3NEZA 4ZB1A 3SSYA 1QY3A 2EOQA 2EM9A 5KL3A 1G2FC 1KYRA 2EMFA 4W6CA 2HFCA 5DQBA 2YTPA 2IB5A 2G3DB 2EPPA 3DQOA 2EP3A 2VVJA 3MGFA 4R2SA 2ENHA 3DQ4A 2A50B 4XVPA 3ST2A 1Q4EA 2ARLA 3SSHA 4DXNA 3MHHC 2JPAA 2EPCA 4R6BA 4KF5C 1UN6B 2H8QA 3NEDA 2MKNA 2LT7A 2VVIA 4W7AA 2EOMA 1TN9A 4OY4A 5DPHA 5DTZA 3W1CA 3ZTFA 3SVBA 2YTFA 4GESB 2YRKA 3UK3C 1C4FA 3DQ9A 5KL6A 4FK5C 3WLCA 4W73A 1KYPA 4L13A 4R2AA 3GJ2A 2LV2A 2EQ1A 1Q4AA 3CD1A 5EXUA 3DQ1A 1XSSA 2EE8A 2EOFA 3K1KA 4TZAA 3AI4A 3DQ8A 2FL1A 2ENCA 3GEXA 3UFZA 2RPCA 1XQMA 3CB9A 4KF4A 1S6ZA 1A1GA 5EB7A 1YSAC 2EMOA 3M22A 3DQHA 5F9GA 3SV5A 5LTQA 4W69A 3PJ5A 5KL2A 1XMZA 4KF5A 2V4EA 3P28A 2DUIA 4I2YA 2WBUA 4OGSA 1QYOA 3DQ6A 2O2BA 2WSOA 4GOBA 2R1FA 2A53B 5DPGA 3NT9A 2EMKA 3NT3A 3BXCA 4R6DA 1EMCA 4F6NA 3OGOA 1BFPA 2DLQA 5HW9A 1LLMC 4KEXA 2CSHA 2AWKA 2OGRA 2EOXA 1EMMA 3M99B 2QT2A 4DXOA 4IK9A 2EPXA 2YTEA 4DXIA 1YHHA 2EM5A 4JEOA 5H88A 1JBYA 2H5PA 2GX2A 4B30A 4R2DA 5DTXA 4HQCA 4OHSA 2Z6ZA 4OQWA 3BXBA 4W7FA 2QLGA 3SVEA 2EM8A 2YTIA 4W6RA 2EQ0A 2A48A 3ST0A 2QZ0A 2YTGA 5HGEA 2Z1OA 4Q9XA 3SG2A 2WIQA 4EDSA 3SG3A 3SRYA 3AI5A 3U0LA 3EK7A 2G6EA 2IOVA 2EOZA 2EMWA 2IB6A 4IK1A 4HQ9A 1HCJA 2EOHA 5DTYA 3GJ1A 2DRPA 1W7SA 2EPAA 1YJ2A 2NABA 3O77A 1YUIA 2YE1A 2EPRA 4J8AA 1MYWA 3ED8A 2YFPA 4W77A 4XOWA 2EM3A 3LS3A 2DUHA 1RMOA 1WJPA 4AR7A 5FVIA 2MDGA 4W6OA 1JC1A 4X9JA 1QXTA 4W6IA 1Q4BA 5EB6A 3DQCA 2WURA 4IZNA 3GL4A 4Z4KA 1A1KA 1EMFA 4L1IA 2Z6XA 3NF0A 2WBTA 5DRFA 3CFAA 4H3MA 4P76A 2EN1A 1Q4DA 1X6FA 1Z1QA 3DPWA 2AH8A 3LF4B 4W74A 5KL5A 1ZU1A 3S05A 1EMKA 1GL4A 4L12A 4M9VC 2A47A 5EXCI 1JC0A 2VRDA 4KGFA 2BTJA 2O29A 4EMQA 2VZXA 3VK1A 1HUYA 3DQ5A 2EOEA 3U0NA 1H4UA 2AWMA 5KTGA 3SS0A 4JC2A 2LO3A 1A1JA 3ST3A 4W6JA 4P1QA 2OTBA 5HZUA 2ZMUA 1CV7A 3EVVA 2I13A 3DQ2A 3SVCA 2YTDA 2DDDA 4H3NA 5FVFA 1Z1BA 4KW4A 4W6KA 2YDZA 1YHGA 2EMLA 3E5WA 2H5QA 3U8AA 5BTTB 4HQ8A 3VHTB 3P8UA 3W1DA 3ZULA 3ST4A 2EMDA 2DMIA 2ADRA 1OXEA 3DQ3A 4Q7UA 3PJBA 4W6HA 1H6RA 4ZF4A 4IK5A 4DKMA 5J2OA 4W6FA 3G9AA 4Z4MA 1JK1A 4IS1C 3H1OA 2H5RA 3DQMA 3U8PA 4DXPA 4W7RA 2WSNA 4IK8A 3SG7A 3U0KA 2YU5A 5BT0A 2YRMA 3ZUJA 1X6EA 2EMIA 2YTOA 3VHTA 4W7EA 2YSPA 4ZIOA 2EORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAY A;  5FVG A;  1JBZ A;  1YHI A;  3BXA A;  4AS8 A;  4KGE A;  1W7U A;  2G5Z B;  5LTR A;  3RWT A;  1YFP A;  2Y0G A;  3ZUF A;  4DXQ A;  2EM2 A;  2FWQ A;  3SVD A;  1A1H A;  1MEY C;  1DGC A;  2GW3 A;  3E5V A;  2HGY A;  2CTD A;  4N3D A;  3AKO A;  4ZBL A;  3OSQ A;  5LTP A;  4Q9W A;  3EK8 A;  2EN8 A;  3CFF A;  5HZS A;  3PIB A;  1BBO A;  3CD9 A;  1Z1P A;  1F0B A;  2VVH A;  2EMC A;  3V3D A;  2POX A;  3RWA A;  2ENA A;  5DRG A;  4R2R A;  2WBS A;  1EMA A;  2WHU A;  2A56 B;  2J7J A;  2WCC 3;  4H3L A;  4NWS A;  1RRX A;  3E5T A;  1OXF A;  2OJK A;  3LVC A;  4LJC A;  4RTC A;  4LJD A;  3UG0 A;  2YRH A;  4PPJ A;  3M24 A;  2OKY A;  3CBE A;  5BTT A;  5DTL A;  1ZR9 A;  3SSK A;  3LVA A;  1EMG A;  3DQA A;  3DQU A;  1XA9 A;  2ZO7 A;  3IR8 A;  2DGC A;  2DD7 A;  2EMZ A;  2QLE A;  4EUL A;  2G2S B;  2H6V A;  2GLI A;  3DPZ A;  3SVU A;  1EME A;  2HQZ A;  4IK4 A;  5BQL A;  5DQM A;  1QYQ A;  2MKD A;  3PJ7 A;  4HVF A;  4PPL A;  4B30 B;  2VAE A;  3DQD A;  4LW5 A;  4RYS A;  2P4M A;  4KW9 A;  1QYF A;  2DUE A;  4LJB A;  5LK4 A;  1B69 A;  4GF6 B;  2HQK A;  2EMN A;  1F2I G;  4XGY A;  1MOV A;  3SVO A;  3DQE A;  2AWL A;  3EKJ A;  3LVD A;  2EL4 A;  4B5Y A;  4KW8 A;  3I19 A;  4W7C A;  3A8S A;  3EKH A;  3SST A;  4R2E A;  2M9A A;  3SVN A;  4RYW A;  3KCS A;  3CFH A;  3EPH A;  4XOV A;  4W72 A;  2ZO6 A;  2EQ3 A;  3DQK A;  2YTN A;  4GZN C;  5HZT A;  2DD9 A;  4F6M A;  1X3C A;  2G16 B;  2GW4 B;  3U8C A;  2DLK A;  2C9J A;  1F09 A;  1RMD A;  1GGX A;  2YTJ A;  1ZUX A;  5H87 A;  4JGE A;  2H5O A;  4EDO A;  2OKW A;  2QLG B;  3EPL A;  2Q57 A;  4TZG A;  3VIC A;  2V4E B;  2EOO A;  5HBD A;  4W6N A;  4Q7R A;  2A25 A;  3WCK A;  4DXM A;  2HJO A;  3ADF A;  3U0M A;  4W6T A;  2E72 A;  4WSG A;  3DQJ A;  3OSR A;  4KPI A;  1X6H A;  3SSV A;  4Q7T A;  4PPK A;  1KP5 A;  2EMX A;  2YSO A;  4LQU A;  2JP9 A;  2ELY A;  2PXS A;  4JFG A;  2EMY A;  2RSI A;  2EOY A;  3EVR A;  4H48 A;  2C9I A;  2A52 B;  1OXD A;  3SVR A;  4R2C A;  3CGL A;  3GB3 A;  4PFE A;  2AWJ A;  2YE0 A;  3SG4 A;  2EN6 A;  2Q6P A;  4ZF3 A;  3SVS A;  2BB8 A;  1TF6 A;  4IJD A;  2EMG A;  2B3P A;  4W6B A;  1X5W A;  5KL7 A;  1YUJ A;  5AQB B;  2AHA A;  1TF3 A;  4W6A A;  4W6G A;  1EMB A;  1A1I A;  2EM0 A;  2CT1 A;  2QLH A;  2V4E C;  3SG5 A;  4W75 A;  1YJF A;  2G6Y A;  2WHS A;  1RMP A;  2EM4 A;  3LA1 A;  2H9W A;  2PRT A;  5EBJ A;  3EVP A;  5DPI A;  4W6L A;  4UTS A;  3LSA A;  3KCT A;  3O78 A;  2HCG A;  4W7D A;  1ZAA C;  2WIS A;  4EN1 A;  4DKN A;  2A54 B;  3DQL A;  4J89 A;  2EMA A;  2DUF A;  2EMH A;  1ZGO A;  2EN7 A;  2HRS A;  5EJU A;  2A46 A;  5EHU A;  1W7T A;  5KL4 A;  4W7X A;  5DU0 A;  1EML A;  5DPJ A;  1KJK A;  2EPZ A;  5T3I A;  4HE4 A;  4ZFS A;  2WHT A;  2IE2 A;  4W6S A;  1Q73 A;  5HZO A;  3WLD A;  2HPW A;  1Q4C A;  3EVU A;  2QLI A;  2EM6 A;  3TMR A;  1G2D C;  4KA9 A;  3BX9 A;  2DDC A;  2G3O A;  2G6X A;  1NCS A;  5DY6 A;  2PXW A;  5FHV A;  3DQN A;  4J88 A;  4ORN A;  2LCE A;  3EPJ A;  1ZGP A;  1KYS A;  3DPX A;  4ANJ A;  2GX0 A;  1ZGQ A;  4F2J C;  2EPU A;  3H1R A;  2QU1 A;  2VAD A;  4LQT A;  2DUG A;  4W6U A;  2EN2 A;  4W6D A;  2ICR A;  4OJ0 A;  3EK4 A;  2EN4 A;  2GHF A;  2OTE A;  4W6M A;  1A1F A;  2Z6Y A;  4ZIN A;  2HGD A;  3DQF A;  4R2P A;  2ZMW A;  2LVH A;  2YTQ A;  3SG6 A;  3DQI A;  2EM7 A;  1UIS A;  2YU8 A;  4KAG A;  3SSL A;  3MHS C;  1MOU A;  2EL5 A;  2EJ4 A;  1UBD C;  1BB8 A;  2EOS A;  2QRF A;  2JAD A;  2ELZ A;  3EPK A;  1P47 A;  1JK2 A;  2FZU A;  2EOJ A;  4W6P A;  5EXB A;  2D9H A;  1A1L A;  4W76 A;  2EN3 A;  2O24 A;  4ZF5 A;  4JF9 A;  1G7K A;  2RH7 A;  4R2Q A;  4IK3 A;  2B3Q A;  5H89 A;  3TMT A;  1RMM A;  2EOI A;  4XL5 A;  4U2V A;  1XAE A;  3LF3 A;  4H47 A;  4LJD C;  4BDU A;  2HGH A;  1GFL A;  3IP2 A;  2EMB A;  3SSP A;  1RM9 A;  4JRB A;  1B9C A;  1YZW A;  3DQ7 A;  2EL6 A;  3NEZ A;  4ZB1 A;  3SSY A;  1QY3 A;  2EOQ A;  2EM9 A;  5KL3 A;  1G2F C;  1KYR A;  2EMF A;  4W6C A;  2HFC A;  5DQB A;  2YTP A;  2IB5 A;  2G3D B;  2EPP A;  3DQO A;  2EP3 A;  2VVJ A;  3MGF A;  4R2S A;  2ENH A;  3DQ4 A;  2A50 B;  4XVP A;  3ST2 A;  1Q4E A;  2ARL A;  3SSH A;  4DXN A;  3MHH C;  2JPA A;  2EPC A;  4R6B A;  4KF5 C;  1UN6 B;  2H8Q A;  3NED A;  2MKN A;  2LT7 A;  2VVI A;  4W7A A;  2EOM A;  1TN9 A;  4OY4 A;  5DPH A;  5DTZ A;  3W1C A;  3ZTF A;  3SVB A;  2YTF A;  4GES B;  2YRK A;  3UK3 C;  1C4F A;  3DQ9 A;  5KL6 A;  4FK5 C;  3WLC A;  4W73 A;  1KYP A;  4L13 A;  4R2A A;  3GJ2 A;  2LV2 A;  2EQ1 A;  1Q4A A;  3CD1 A;  5EXU A;  3DQ1 A;  1XSS A;  2EE8 A;  2EOF A;  3K1K A;  4TZA A;  3AI4 A;  3DQ8 A;  2FL1 A;  2ENC A;  3GEX A;  3UFZ A;  2RPC A;  1XQM A;  3CB9 A;  4KF4 A;  1S6Z A;  1A1G A;  5EB7 A;  1YSA C;  2EMO A;  3M22 A;  3DQH A;  5F9G A;  3SV5 A;  5LTQ A;  4W69 A;  3PJ5 A;  5KL2 A;  1XMZ A;  4KF5 A;  2V4E A;  3P28 A;  2DUI A;  4I2Y A;  2WBU A;  4OGS A;  1QYO A;  3DQ6 A;  2O2B A;  2WSO A;  4GOB A;  2R1F A;  2A53 B;  5DPG A;  3NT9 A;  2EMK A;  3NT3 A;  3BXC A;  4R6D A;  1EMC A;  4F6N A;  3OGO A;  1BFP A;  2DLQ A;  5HW9 A;  1LLM C;  4KEX A;  2CSH A;  2AWK A;  2OGR A;  2EOX A;  1EMM A;  3M99 B;  2QT2 A;  4DXO A;  4IK9 A;  2EPX A;  2YTE A;  4DXI A;  1YHH A;  2EM5 A;  4JEO A;  5H88 A;  1JBY A;  2H5P A;  2GX2 A;  4B30 A;  4R2D A;  5DTX A;  4HQC A;  4OHS A;  2Z6Z A;  4OQW A;  3BXB A;  4W7F A;  2QLG A;  3SVE A;  2EM8 A;  2YTI A;  4W6R A;  2EQ0 A;  2A48 A;  3ST0 A;  2QZ0 A;  2YTG A;  5HGE A;  2Z1O A;  4Q9X A;  3SG2 A;  2WIQ A;  4EDS A;  3SG3 A;  3SRY A;  3AI5 A;  3U0L A;  3EK7 A;  2G6E A;  2IOV A;  2EOZ A;  2EMW A;  2IB6 A;  4IK1 A;  4HQ9 A;  1HCJ A;  2EOH A;  5DTY A;  3GJ1 A;  2DRP A;  1W7S A;  2EPA A;  1YJ2 A;  2NAB A;  3O77 A;  1YUI A;  2YE1 A;  2EPR A;  4J8A A;  1MYW A;  3ED8 A;  2YFP A;  4W77 A;  4XOW A;  2EM3 A;  3LS3 A;  2DUH A;  1RMO A;  1WJP A;  4AR7 A;  5FVI A;  2MDG A;  4W6O A;  1JC1 A;  4X9J A;  1QXT A;  4W6I A;  1Q4B A;  5EB6 A;  3DQC A;  2WUR A;  4IZN A;  3GL4 A;  4Z4K A;  1A1K A;  1EMF A;  4L1I A;  2Z6X A;  3NF0 A;  2WBT A;  5DRF A;  3CFA A;  4H3M A;  4P76 A;  2EN1 A;  1Q4D A;  1X6F A;  1Z1Q A;  3DPW A;  2AH8 A;  3LF4 B;  4W74 A;  5KL5 A;  1ZU1 A;  3S05 A;  1EMK A;  1GL4 A;  4L12 A;  4M9V C;  2A47 A;  5EXC I;  1JC0 A;  2VRD A;  4KGF A;  2BTJ A;  2O29 A;  4EMQ A;  2VZX A;  3VK1 A;  1HUY A;  3DQ5 A;  2EOE A;  3U0N A;  1H4U A;  2AWM A;  5KTG A;  3SS0 A;  4JC2 A;  2LO3 A;  1A1J A;  3ST3 A;  4W6J A;  4P1Q A;  2OTB A;  5HZU A;  2ZMU A;  1CV7 A;  3EVV A;  2I13 A;  3DQ2 A;  3SVC A;  2YTD A;  2DDD A;  4H3N A;  5FVF A;  1Z1B A;  4KW4 A;  4W6K A;  2YDZ A;  1YHG A;  2EML A;  3E5W A;  2H5Q A;  3U8A A;  5BTT B;  4HQ8 A;  3VHT B;  3P8U A;  3W1D A;  3ZUL A;  3ST4 A;  2EMD A;  2DMI A;  2ADR A;  1OXE A;  3DQ3 A;  4Q7U A;  3PJB A;  4W6H A;  1H6R A;  4ZF4 A;  4IK5 A;  4DKM A;  5J2O A;  4W6F A;  3G9A A;  4Z4M A;  1JK1 A;  4IS1 C;  3H1O A;  2H5R A;  3DQM A;  3U8P A;  4DXP A;  4W7R A;  2WSN A;  4IK8 A;  3SG7 A;  3U0K A;  2YU5 A;  5BT0 A;  2YRM A;  3ZUJ A;  1X6E A;  2EMI A;  2YTO A;  3VHT A;  4W7E A;  2YSP A;  4ZIO A;  2EOR A; 
#chains in the Genus database with same CATH topology
 1QNT A;  1AAY A;  4DR5 E;  2HC5 A;  2L33 A;  5FVG A;  1JBZ A;  1YHI A;  3BXA A;  4AS8 A;  4KGE A;  4L5N C;  2DIX A;  1W7U A;  1DQ3 A;  3OML A;  5CFF E;  2G5Z B;  2CPN A;  5IT9 C;  4GKK E;  5LTR A;  3RWT A;  4B3S E;  4RH8 A;  1YFP A;  2Y0G A;  3ZUF A;  4DXQ A;  2EM2 A;  2FWQ A;  3SVD A;  2JWO A;  1A1H A;  1MEY C;  1YZ9 A;  1DGC A;  2GW3 A;  3E5V A;  2HGY A;  2CTD A;  4N3D A;  3AKO A;  4ZBL A;  1FJG E;  3OSQ A;  2MC5 A;  2LJU A;  5LTP A;  2RS7 A;  1T39 A;  4L8N A;  4Q9W A;  3EK8 A;  2EN8 A;  3CFF A;  5HZS A;  1SFE A;  3PIB A;  1BBO A;  3CD9 A;  1Z1P A;  2L92 A;  3H09 A;  2UXB E;  1F0B A;  2VVH A;  2EMC A;  1FKA E;  3V3D A;  2POX A;  3RWA A;  2ENA A;  4ZYE A;  5LLQ A;  5DRG A;  4BBY A;  3T1H E;  4B3T E;  4R2R A;  2WBS A;  1EMA A;  2WHU A;  2A56 B;  3MSW A;  2J7J A;  3IWC A;  4NZV A;  4H3L A;  4NWS A;  4JI7 E;  2WCC 3;  2KHX A;  1T38 A;  1IBK E;  1RRX A;  3E5T A;  1OXF A;  2OJK A;  3LVC A;  4LJC A;  4RTC A;  4LJD A;  3UG0 A;  2H36 X;  4F54 A;  2YRH A;  4PPJ A;  3M24 A;  2OKY A;  3CBE A;  5BTT A;  2E5L E;  5DTL A;  1ZR9 A;  3SSK A;  3LVA A;  3LML A;  1EMG A;  3DQA A;  3DQU A;  3J7A G;  1XA9 A;  2ZO7 A;  3IR8 A;  2F8B A;  4N4R B;  4TUG A;  2DD7 A;  2EMZ A;  2QLE A;  4EUL A;  2G2S B;  2H6V A;  2DGC A;  2GLI A;  3DPZ A;  3SVU A;  4X64 E;  1EME A;  2HQZ A;  4IK4 A;  5BQL A;  1XMQ E;  2UUC E;  5DQM A;  1QYQ A;  2MKD A;  3IWB A;  3PJ7 A;  4HVF A;  4RHB B;  4PPL A;  4B30 B;  2VAE A;  3DQD A;  4DV7 E;  4BC9 A;  4LW5 A;  2EPN A;  4RYS A;  4JI8 E;  2P4M A;  4KW9 A;  5AE2 A;  4DV4 E;  1QYF A;  2DUE A;  4LJB A;  5LK4 A;  1B69 A;  4GF6 B;  2HQK A;  2EMN A;  1F2I G;  4XGY A;  1MOV A;  3SVO A;  3DQE A;  2AWL A;  3EKJ A;  3LVD A;  2EL4 A;  4B5Y A;  4KW8 A;  3I19 A;  2HHH E;  4W7C A;  3A8S A;  4OX9 E;  3EKH A;  3SST A;  2Q8U A;  4R2E A;  2M9A A;  3OTO E;  1N32 E;  2EZ6 A;  3SVN A;  3C4B A;  4RYW A;  3KCS A;  3CFH A;  5A6A A;  3EPH A;  4XOV A;  4W72 A;  2ZO6 A;  2EQ3 A;  2BBG A;  3DQK A;  4LFB E;  2YTN A;  4GZN C;  5HZT A;  2EPK X;  2JY9 A;  2YPN A;  4WSP A;  1YYK A;  4JI2 E;  2DD9 A;  4F6M A;  2NUE A;  1X3C A;  5F3W A;  2G16 B;  2GW4 B;  3U8C A;  2DLK A;  2C9J A;  1F09 A;  1RMD A;  1GGX A;  2YTJ A;  1ZUX A;  5H87 A;  4JGE A;  3IWD A;  2H5O A;  4EDO A;  2UUA E;  2M7Q A;  2OKW A;  1X48 A;  2QLG B;  3EPL A;  2Q57 A;  4DR1 E;  4TZG A;  3VIC A;  2L2N A;  4DUY E;  2V4E B;  3DJW A;  3F6G A;  2EOO A;  5HBD A;  4YY3 E;  2V8Q B;  4W6N A;  4DV5 E;  2LRS A;  4O24 A;  4Q7R A;  2A25 A;  1NEI A;  3WCK A;  3DF6 A;  4DXM A;  2HJO A;  3ADF A;  3U0M A;  4W6T A;  1PJQ A;  2E72 A;  3DQJ A;  2RTX A;  4J8Z A;  4WSG A;  2L6M A;  4DR2 E;  3OSR A;  4KPI A;  1X6H A;  3SSV A;  4Q7T A;  4LFA E;  4PPK A;  1KP5 A;  5IV8 B;  4M2Z A;  2EMX A;  2YSO A;  4F9C B;  1ZBQ A;  4LQU A;  2V88 A;  2JP9 A;  4LF4 E;  1T4N A;  2PXS A;  4JFG A;  1RQ0 A;  2ELY A;  4ZYG A;  2EMY A;  2RSI A;  2EOY A;  3EVR A;  4H48 A;  2C9I A;  1N33 E;  1XNQ E;  2A52 B;  2LTR A;  1OXD A;  3SVR A;  4R2C A;  3CGL A;  3GB3 A;  4PFE A;  5BR8 E;  2AWJ A;  1UIL A;  2YE0 A;  1GTK A;  3SG4 A;  2EN6 A;  4DV6 E;  2Q6P A;  4ZF3 A;  3SVS A;  2BB8 A;  2B7V A;  2JOB A;  4IJD A;  5A6B D;  4YHH E;  1TF6 A;  2EMG A;  4JYA E;  2B3P A;  4KHP E;  4W6B A;  1X5W A;  5KL7 A;  1YUJ A;  5AQB B;  2AHA A;  1TF3 A;  4W6A A;  2WZO A;  4W6G A;  1EMB A;  1N36 E;  1A1I A;  2EM0 A;  4ZYH A;  2CT1 A;  4R03 A;  2QLH A;  2E1M A;  4LF8 E;  2V4E C;  3SG5 A;  4W75 A;  1YJF A;  2G6Y A;  2WHS A;  1RMP A;  1AH5 A;  3LA1 A;  2H9W A;  2EM4 A;  2YWQ A;  5EBJ A;  3EVP A;  4DMI A;  2PRT A;  5DPI A;  3VYX A;  4W6L A;  4UTS A;  3LSA A;  3KCT A;  3O78 A;  1SR9 A;  2EPM X;  2HCG A;  4W7D A;  3JAM C;  5FLX C;  1ZAA C;  2WIS A;  2UXC E;  4EN1 A;  2YZT A;  4BMJ A;  2NUG A;  4DKN A;  2A54 B;  3DQL A;  4J89 A;  2EMA A;  2DUF A;  1EH6 A;  2EMH A;  1ZGO A;  2EN7 A;  2HRS A;  5EJU A;  4WX9 A;  2A46 A;  3BID A;  1PJT A;  5EHU A;  1W7T A;  2JVA A;  4BS9 A;  5KL4 A;  4W7X A;  5AAS A;  2RQL A;  2JXP A;  5DU0 A;  1EH7 A;  1EML A;  2L2K B;  4AQY E;  5DPJ A;  1I94 E;  1KJK A;  1RC7 A;  2EPZ A;  1STU A;  1UHZ A;  2N3H A;  5T3I A;  4O4K A;  3TQM A;  4BHC A;  4OOG C;  4LU9 A;  3EQ1 A;  4JV5 E;  4HE4 A;  1HNX E;  4ZFS A;  4DR7 E;  2WHT A;  2IE2 A;  4W6S A;  1Q73 A;  4BC7 A;  3JTZ A;  4JI6 E;  5HZO A;  3WLD A;  2HPW A;  1Q4C A;  3EVU A;  2MC6 A;  2QLI A;  2B9D A;  3TMR A;  2EM6 A;  4KA9 A;  3BX9 A;  2LMZ A;  1G2D C;  2DDC A;  2G3O A;  3ADI A;  5LMN E;  2G6X A;  1NCS A;  5DY6 A;  1XNR E;  2PXW A;  5FHV A;  3DQN A;  4J88 A;  4ORN A;  4B3M E;  2LCE A;  4KZS A;  1ZGP A;  3EPJ A;  1KYS A;  3DPX A;  4ANJ A;  2GX0 A;  1ZGQ A;  2V86 A;  2EPU A;  4F2J C;  3H1R A;  3C4T A;  2QU1 A;  2KOU A;  5IXM B;  2VAD A;  4LQT A;  2EWL A;  2DUG A;  4W6U A;  2EN2 A;  2NUF A;  1IMU A;  4W6D A;  4M0V A;  4DR4 E;  2ICR A;  4OJ0 A;  2ODR D;  4DV2 E;  3EK4 A;  2EN4 A;  2GHF A;  1O0W A;  2OTE A;  4W6M A;  1A1F A;  1HNW E;  4LF7 E;  2Z6Y A;  4ZIN A;  1N3G A;  3AUZ A;  2HJJ A;  3AV0 A;  2HGD A;  3DQF A;  4M30 A;  4R2P A;  2ZMW A;  2LVH A;  2R76 A;  3SG6 A;  2YTQ A;  4KWY A;  3DQI A;  2EM7 A;  1UIS A;  4WXC A;  2UXD E;  2YU8 A;  4KAG A;  3SSL A;  2B7T A;  1MOU A;  3MHS C;  3BF2 A;  2EL5 A;  2EJ4 A;  1UBD C;  1BB8 A;  2EOS A;  2QRF A;  2JAD A;  2ELZ A;  3EPK A;  1P47 A;  1JK2 A;  2FZU A;  2EOJ A;  2LUQ A;  5IWA E;  2L3C A;  4W6P A;  1T4L B;  5EXB A;  2D9H A;  5AE1 A;  4W76 A;  2EN3 A;  1A1L A;  2O24 A;  4ZF5 A;  4JF9 A;  1G7K A;  2RH7 A;  4R2Q A;  3C6K A;  1YSA C;  4WYQ B;  4IK3 A;  2B3Q A;  5H89 A;  3TMT A;  1KYQ A;  1WRJ A;  2DB2 A;  2I9I A;  3J7Y p;  1T4O A;  4DR6 E;  1RMM A;  2EOI A;  4WXD A;  4XL5 A;  4U2V A;  1J26 A;  2EPO A;  1XAE A;  3LF3 A;  4H47 A;  2YT4 A;  2UUB E;  3HQ1 A;  4LJD C;  4BDU A;  5TSE A;  2HGH A;  1GFL A;  3IP2 A;  2EMB A;  3SSP A;  4X66 E;  3C6M A;  1RM9 A;  4JRB A;  1B9C A;  1YZW A;  3DQ7 A;  2EL6 A;  4P7D A;  3NEZ A;  3VK6 A;  1XMO E;  4ZB1 A;  3SSY A;  1QY3 A;  3FIG A;  2EOQ A;  2VF1 A;  2EM9 A;  5KL3 A;  1G2F C;  1KYR A;  3RMP A;  2EMF A;  4W6C A;  2HFC A;  5DQB A;  2YTP A;  5T6J A;  3HPS A;  1N34 E;  2IB5 A;  2G3D B;  2IHR 1;  4LF5 E;  2EPP A;  3DQO A;  2FTX B;  2EP3 A;  2V85 A;  2VVJ A;  3MGF A;  2VE7 C;  2ENH A;  4R2S A;  1WHQ A;  3DQ4 A;  2A50 B;  4XVP A;  3ST2 A;  2M1S A;  4HEI A;  4P78 A;  1Q4E A;  2V83 A;  2ARL A;  4ZYD A;  3SSH A;  4DXN A;  3MHH C;  2JPA A;  2EPC A;  4Q28 A;  3THN A;  1L4S A;  4R6B A;  4KF5 C;  1UN6 B;  2H8Q A;  3NED A;  2MKN A;  2LT7 A;  4K0K E;  2VVI A;  4W7A A;  2EOM A;  3T1Y E;  1TN9 A;  4OY4 A;  5DPH A;  5DTZ A;  3W1C A;  3ZTF A;  1YPN A;  5A6B A;  3SVB A;  2YTF A;  4GES B;  1HNZ E;  2YRK A;  3UK3 C;  1C4F A;  3DQ9 A;  4NHR A;  5KL6 A;  4FK5 C;  1WXR A;  4F9A B;  1J5E E;  3WLC A;  4W73 A;  5ADZ A;  1KYP A;  4MLQ A;  4L13 A;  2JOX A;  4B3R E;  1HR0 E;  4LTY A;  4R8O A;  4R2A A;  3GJ2 A;  2LV2 A;  3ADG A;  2EQ1 A;  1Q4A A;  3CD1 A;  5EXU A;  3DQ1 A;  1X49 A;  3QG5 C;  4JI1 E;  3HTX A;  1XSS A;  2EE8 A;  2V89 A;  2EOF A;  3K6Q A;  3K1K A;  4TZA A;  3AI4 A;  1GZ6 A;  3DQ8 A;  2FL1 A;  2MDR A;  3HPZ A;  2UU9 E;  2ENC A;  3GEX A;  3UFZ A;  4O43 A;  2RPC A;  2KON A;  1XQM A;  3CB9 A;  4KF4 A;  1S6Z A;  1BBG A;  5EB7 A;  2GPI A;  3KWR A;  4DV0 E;  1A1G A;  2EMO A;  5A2Q C;  3M22 A;  3DQH A;  5F9G A;  3SV5 A;  5LTQ A;  1X47 A;  2DMY A;  4JI0 E;  1DI2 A;  5A6J A;  4W69 A;  3PJ5 A;  5KL2 A;  2FV4 B;  1XMZ A;  4KF5 A;  2LJH A;  2V4E A;  4DV1 E;  3P28 A;  2RSM A;  2DUI A;  4I2Y A;  2WBU A;  3BBG A;  4OGS A;  1QYO A;  3DQ6 A;  2O2B A;  1IQS A;  2WSO A;  4GOB A;  4Q35 B;  2R1F A;  2A53 B;  5DPG A;  3NT9 A;  2EMK A;  4DUZ E;  2EPL X;  3NT3 A;  4BHB A;  3BXC A;  4R6D A;  1EMC A;  1PKP A;  3OGO A;  1BFP A;  2DLQ A;  5HW9 A;  4F6N A;  4KEX A;  1LLM C;  2CSH A;  2AWK A;  2OGR A;  2EOX A;  1EMM A;  3M99 B;  2QT2 A;  2LUP B;  4DXO A;  4IK9 A;  2EPX A;  2YTE A;  4DXI A;  1YHH A;  2EM5 A;  4JEO A;  5H88 A;  1GQE A;  1JBY A;  2H5P A;  2GX2 A;  4B30 A;  4R2D A;  5DTX A;  2VQF E;  4HQC A;  4OHS A;  2Z6Z A;  4DV3 E;  4NXM E;  3JU0 A;  3VYY A;  4OQW A;  1EKZ A;  3BXB A;  4WPY A;  1IBM E;  4JI5 E;  2L3J A;  5A69 A;  4W7F A;  2QLG A;  3SVE A;  2EM8 A;  5DNY A;  2YTI A;  4W6R A;  2EQ0 A;  2A48 A;  5AE3 A;  3ST0 A;  2QZ0 A;  2YTG A;  3BGH A;  2LBS B;  1PJS A;  5HGE A;  2Z1O A;  3ECR A;  4X62 E;  3ADL A;  4Q9X A;  3SG2 A;  2WIQ A;  4EDS A;  3SG3 A;  3SRY A;  4HTG A;  3AI5 A;  3U0L A;  3EK7 A;  2ODR C;  2G6E A;  2IOV A;  2EOZ A;  2EMW A;  2IB6 A;  4IK1 A;  4HQ9 A;  1HCJ A;  4GEQ B;  3KZZ A;  2EOH A;  5DTY A;  1YYO A;  3GJ1 A;  4LFC E;  5AC5 A;  2DRP A;  4JI4 E;  4NXN E;  1W7S A;  2EPA A;  1YJ2 A;  2NAB A;  3O77 A;  1YUI A;  2YE1 A;  2EPR A;  4J8A A;  1MYW A;  3ED8 A;  2YFP A;  4W77 A;  4XOW A;  2EM3 A;  2RS6 A;  5LL6 R;  3THO B;  4X65 E;  3LS3 A;  2DUH A;  1RMO A;  1WJP A;  2K7I A;  4AR7 A;  1WHN A;  5FVI A;  2MDG A;  4W6O A;  4LF6 E;  1JC1 A;  3J81 C;  4X9J A;  4DR3 E;  1QXT A;  4W6I A;  3LLH A;  5AC4 A;  1Q4B A;  5EB6 A;  3DQC A;  2WUR A;  2LTS A;  3L00 A;  4IZN A;  2B3T B;  4BCA A;  3GL4 A;  4Z4K A;  4DKK A;  1A1K A;  1EMF A;  4L1I A;  2DSY A;  2Z6X A;  2N3G A;  3KZY A;  1YYW A;  3NF0 A;  3J80 C;  2WBT A;  5DRF A;  3CFA A;  4H3M A;  4P76 A;  2NA2 A;  2EN1 A;  2VQE E;  4MLV A;  4JI3 E;  1Q4D A;  1X6F A;  2L2M A;  4GKJ E;  1Z1Q A;  3DPW A;  2AH8 A;  3LF4 B;  4W74 A;  5KL5 A;  1ZU1 A;  5LMU E;  4WFT A;  3S05 A;  1EMK A;  1GL4 A;  1EH8 A;  4L12 A;  4TUI A;  1MGT A;  4M9V C;  2A47 A;  4X8W A;  2V87 A;  5A6K A;  5EXC I;  1IQO A;  1JC0 A;  2VRD A;  4KGF A;  2BTJ A;  2O29 A;  4EMQ A;  2VZX A;  3VK1 A;  2JR1 A;  2K4V A;  4LF9 E;  1HUY A;  2M4I A;  1YFH A;  3DQ5 A;  2EOE A;  3U0N A;  1PDA A;  1H4U A;  2AWM A;  5KTG A;  3SS0 A;  4JC2 A;  2LO3 A;  3ZOQ B;  1A1J A;  1ZBT A;  3ST3 A;  4W6J A;  4P1Q A;  2OTB A;  5HZU A;  2ZMU A;  1CV7 A;  3EVV A;  2I13 A;  3DQ2 A;  3SVC A;  2YTD A;  2DDD A;  4H3N A;  2LE2 A;  5FVF A;  1Z1B A;  4KW4 A;  4W6K A;  2YDZ A;  3P1X A;  1YHG A;  2EML A;  3E5W A;  2H5Q A;  3U8A A;  2N8X A;  5BTT B;  4HQ8 A;  3VHT B;  3P8U A;  3W1D A;  3ZUL A;  3ST4 A;  2EMD A;  2DMI A;  4I8O A;  2ADR A;  1OXE A;  2G7H A;  4F9B B;  3DQ3 A;  4Q7U A;  1IBL E;  3PJB A;  4W6H A;  1H6R A;  4ZF4 A;  2L8T A;  3ADJ A;  4IK5 A;  3HXL A;  4DKM A;  5J2O A;  4W6F A;  3G9A A;  4O5G A;  4Z4M A;  1JK1 A;  4IS1 C;  3H1O A;  2H5R A;  2FGG A;  3DQM A;  3U8P A;  4DXP A;  4W7R A;  1QU6 A;  2WSN A;  4IK8 A;  3SG7 A;  3U0K A;  2YU5 A;  5BT0 A;  2YRM A;  3F6H A;  2F4V E;  3ZUJ A;  1X6E A;  2EMI A;  2YTO A;  3VHT A;  4W7E A;  2ZM6 E;  2YSP A;  2JYA A;  4ZIO A;  2EOR A; 
#chains in the Genus database with same CATH homology
 1AAY A;  5FVG A;  1JBZ A;  1YHI A;  3BXA A;  4AS8 A;  4KGE A;  1W7U A;  2G5Z B;  5LTR A;  3RWT A;  1YFP A;  2Y0G A;  3ZUF A;  4DXQ A;  2EM2 A;  2FWQ A;  3SVD A;  1A1H A;  1MEY C;  1DGC A;  2GW3 A;  3E5V A;  2HGY A;  2CTD A;  4N3D A;  3AKO A;  4ZBL A;  3OSQ A;  5LTP A;  4Q9W A;  3EK8 A;  2EN8 A;  3CFF A;  5HZS A;  3PIB A;  1BBO A;  3CD9 A;  1Z1P A;  1F0B A;  2VVH A;  2EMC A;  3V3D A;  2POX A;  3RWA A;  2ENA A;  5DRG A;  4R2R A;  2WBS A;  1EMA A;  2WHU A;  2A56 B;  2J7J A;  2WCC 3;  4H3L A;  4NWS A;  1RRX A;  3E5T A;  1OXF A;  2OJK A;  3LVC A;  4LJC A;  4RTC A;  4LJD A;  3UG0 A;  2YRH A;  4PPJ A;  3M24 A;  2OKY A;  3CBE A;  5BTT A;  5DTL A;  1ZR9 A;  3SSK A;  3LVA A;  1EMG A;  3DQA A;  3DQU A;  1XA9 A;  2ZO7 A;  3IR8 A;  2DGC A;  2DD7 A;  2EMZ A;  2QLE A;  4EUL A;  2G2S B;  2H6V A;  2GLI A;  3DPZ A;  3SVU A;  1EME A;  2HQZ A;  4IK4 A;  5BQL A;  5DQM A;  1QYQ A;  2MKD A;  3PJ7 A;  4HVF A;  4PPL A;  4B30 B;  2VAE A;  3DQD A;  4LW5 A;  4RYS A;  2P4M A;  4KW9 A;  1QYF A;  2DUE A;  4LJB A;  5LK4 A;  1B69 A;  4GF6 B;  2HQK A;  2EMN A;  1F2I G;  4XGY A;  1MOV A;  3SVO A;  3DQE A;  2AWL A;  3EKJ A;  3LVD A;  2EL4 A;  4B5Y A;  4KW8 A;  3I19 A;  4W7C A;  3A8S A;  3EKH A;  3SST A;  4R2E A;  2M9A A;  3SVN A;  4RYW A;  3KCS A;  3CFH A;  3EPH A;  4XOV A;  4W72 A;  2ZO6 A;  2EQ3 A;  3DQK A;  2YTN A;  4GZN C;  5HZT A;  2DD9 A;  4F6M A;  1X3C A;  2G16 B;  2GW4 B;  3U8C A;  2DLK A;  2C9J A;  1F09 A;  1RMD A;  1GGX A;  2YTJ A;  1ZUX A;  5H87 A;  4JGE A;  2H5O A;  4EDO A;  2OKW A;  2QLG B;  3EPL A;  2Q57 A;  4TZG A;  3VIC A;  2V4E B;  2EOO A;  5HBD A;  4W6N A;  4Q7R A;  2A25 A;  3WCK A;  4DXM A;  2HJO A;  3ADF A;  3U0M A;  4W6T A;  2E72 A;  4WSG A;  3DQJ A;  3OSR A;  4KPI A;  1X6H A;  3SSV A;  4Q7T A;  4PPK A;  1KP5 A;  2EMX A;  2YSO A;  4LQU A;  2JP9 A;  2ELY A;  2PXS A;  4JFG A;  2EMY A;  2RSI A;  2EOY A;  3EVR A;  4H48 A;  2C9I A;  2A52 B;  1OXD A;  3SVR A;  4R2C A;  3CGL A;  3GB3 A;  4PFE A;  2AWJ A;  2YE0 A;  3SG4 A;  2EN6 A;  2Q6P A;  4ZF3 A;  3SVS A;  2BB8 A;  1TF6 A;  4IJD A;  2EMG A;  2B3P A;  4W6B A;  1X5W A;  5KL7 A;  1YUJ A;  5AQB B;  2AHA A;  1TF3 A;  4W6A A;  4W6G A;  1EMB A;  1A1I A;  2EM0 A;  2CT1 A;  2QLH A;  2V4E C;  3SG5 A;  4W75 A;  1YJF A;  2G6Y A;  2WHS A;  1RMP A;  2EM4 A;  3LA1 A;  2H9W A;  2PRT A;  5EBJ A;  3EVP A;  5DPI A;  4W6L A;  4UTS A;  3LSA A;  3KCT A;  3O78 A;  2HCG A;  4W7D A;  1ZAA C;  2WIS A;  4EN1 A;  4DKN A;  2A54 B;  3DQL A;  4J89 A;  2EMA A;  2DUF A;  2EMH A;  1ZGO A;  2EN7 A;  2HRS A;  5EJU A;  2A46 A;  5EHU A;  1W7T A;  5KL4 A;  4W7X A;  5DU0 A;  1EML A;  5DPJ A;  1KJK A;  2EPZ A;  5T3I A;  4HE4 A;  4ZFS A;  2WHT A;  2IE2 A;  4W6S A;  1Q73 A;  5HZO A;  3WLD A;  2HPW A;  1Q4C A;  3EVU A;  2QLI A;  2EM6 A;  3TMR A;  1G2D C;  4KA9 A;  3BX9 A;  2DDC A;  2G3O A;  2G6X A;  1NCS A;  5DY6 A;  2PXW A;  5FHV A;  3DQN A;  4J88 A;  4ORN A;  2LCE A;  3EPJ A;  1ZGP A;  1KYS A;  3DPX A;  4ANJ A;  2GX0 A;  1ZGQ A;  4F2J C;  2EPU A;  3H1R A;  2QU1 A;  2VAD A;  4LQT A;  2DUG A;  4W6U A;  2EN2 A;  4W6D A;  2ICR A;  4OJ0 A;  3EK4 A;  2EN4 A;  2GHF A;  2OTE A;  4W6M A;  1A1F A;  2Z6Y A;  4ZIN A;  2HGD A;  3DQF A;  4R2P A;  2ZMW A;  2LVH A;  2YTQ A;  3SG6 A;  3DQI A;  2EM7 A;  1UIS A;  2YU8 A;  4KAG A;  3SSL A;  3MHS C;  1MOU A;  2EL5 A;  2EJ4 A;  1UBD C;  1BB8 A;  2EOS A;  2QRF A;  2JAD A;  2ELZ A;  3EPK A;  1P47 A;  1JK2 A;  2FZU A;  2EOJ A;  4W6P A;  5EXB A;  2D9H A;  1A1L A;  4W76 A;  2EN3 A;  2O24 A;  4ZF5 A;  4JF9 A;  1G7K A;  2RH7 A;  4R2Q A;  4IK3 A;  2B3Q A;  5H89 A;  3TMT A;  1RMM A;  2EOI A;  4XL5 A;  4U2V A;  1XAE A;  3LF3 A;  4H47 A;  4LJD C;  4BDU A;  2HGH A;  1GFL A;  3IP2 A;  2EMB A;  3SSP A;  1RM9 A;  4JRB A;  1B9C A;  1YZW A;  3DQ7 A;  2EL6 A;  3NEZ A;  4ZB1 A;  3SSY A;  1QY3 A;  2EOQ A;  2EM9 A;  5KL3 A;  1G2F C;  1KYR A;  2EMF A;  4W6C A;  2HFC A;  5DQB A;  2YTP A;  2IB5 A;  2G3D B;  2EPP A;  3DQO A;  2EP3 A;  2VVJ A;  3MGF A;  4R2S A;  2ENH A;  3DQ4 A;  2A50 B;  4XVP A;  3ST2 A;  1Q4E A;  2ARL A;  3SSH A;  4DXN A;  3MHH C;  2JPA A;  2EPC A;  4R6B A;  4KF5 C;  1UN6 B;  2H8Q A;  3NED A;  2MKN A;  2LT7 A;  2VVI A;  4W7A A;  2EOM A;  1TN9 A;  4OY4 A;  5DPH A;  5DTZ A;  3W1C A;  3ZTF A;  3SVB A;  2YTF A;  4GES B;  2YRK A;  3UK3 C;  1C4F A;  3DQ9 A;  5KL6 A;  4FK5 C;  3WLC A;  4W73 A;  1KYP A;  4L13 A;  4R2A A;  3GJ2 A;  2LV2 A;  2EQ1 A;  1Q4A A;  3CD1 A;  5EXU A;  3DQ1 A;  1XSS A;  2EE8 A;  2EOF A;  3K1K A;  4TZA A;  3AI4 A;  3DQ8 A;  2FL1 A;  2ENC A;  3GEX A;  3UFZ A;  2RPC A;  1XQM A;  3CB9 A;  4KF4 A;  1S6Z A;  1A1G A;  5EB7 A;  1YSA C;  2EMO A;  3M22 A;  3DQH A;  5F9G A;  3SV5 A;  5LTQ A;  4W69 A;  3PJ5 A;  5KL2 A;  1XMZ A;  4KF5 A;  2V4E A;  3P28 A;  2DUI A;  4I2Y A;  2WBU A;  4OGS A;  1QYO A;  3DQ6 A;  2O2B A;  2WSO A;  4GOB A;  2R1F A;  2A53 B;  5DPG A;  3NT9 A;  2EMK A;  3NT3 A;  3BXC A;  4R6D A;  1EMC A;  4F6N A;  3OGO A;  1BFP A;  2DLQ A;  5HW9 A;  1LLM C;  4KEX A;  2CSH A;  2AWK A;  2OGR A;  2EOX A;  1EMM A;  3M99 B;  2QT2 A;  4DXO A;  4IK9 A;  2EPX A;  2YTE A;  4DXI A;  1YHH A;  2EM5 A;  4JEO A;  5H88 A;  1JBY A;  2H5P A;  2GX2 A;  4B30 A;  4R2D A;  5DTX A;  4HQC A;  4OHS A;  2Z6Z A;  4OQW A;  3BXB A;  4W7F A;  2QLG A;  3SVE A;  2EM8 A;  2YTI A;  4W6R A;  2EQ0 A;  2A48 A;  3ST0 A;  2QZ0 A;  2YTG A;  5HGE A;  2Z1O A;  4Q9X A;  3SG2 A;  2WIQ A;  4EDS A;  3SG3 A;  3SRY A;  3AI5 A;  3U0L A;  3EK7 A;  2G6E A;  2IOV A;  2EOZ A;  2EMW A;  2IB6 A;  4IK1 A;  4HQ9 A;  1HCJ A;  2EOH A;  5DTY A;  3GJ1 A;  2DRP A;  1W7S A;  2EPA A;  1YJ2 A;  2NAB A;  3O77 A;  1YUI A;  2YE1 A;  2EPR A;  4J8A A;  1MYW A;  3ED8 A;  2YFP A;  4W77 A;  4XOW A;  2EM3 A;  3LS3 A;  2DUH A;  1RMO A;  1WJP A;  4AR7 A;  5FVI A;  2MDG A;  4W6O A;  1JC1 A;  4X9J A;  1QXT A;  4W6I A;  1Q4B A;  5EB6 A;  3DQC A;  2WUR A;  4IZN A;  3GL4 A;  4Z4K A;  1A1K A;  1EMF A;  4L1I A;  2Z6X A;  3NF0 A;  2WBT A;  5DRF A;  3CFA A;  4H3M A;  4P76 A;  2EN1 A;  1Q4D A;  1X6F A;  1Z1Q A;  3DPW A;  2AH8 A;  3LF4 B;  4W74 A;  5KL5 A;  1ZU1 A;  3S05 A;  1EMK A;  1GL4 A;  4L12 A;  4M9V C;  2A47 A;  5EXC I;  1JC0 A;  2VRD A;  4KGF A;  2BTJ A;  2O29 A;  4EMQ A;  2VZX A;  3VK1 A;  1HUY A;  3DQ5 A;  2EOE A;  3U0N A;  1H4U A;  2AWM A;  5KTG A;  3SS0 A;  4JC2 A;  2LO3 A;  1A1J A;  3ST3 A;  4W6J A;  4P1Q A;  2OTB A;  5HZU A;  2ZMU A;  1CV7 A;  3EVV A;  2I13 A;  3DQ2 A;  3SVC A;  2YTD A;  2DDD A;  4H3N A;  5FVF A;  1Z1B A;  4KW4 A;  4W6K A;  2YDZ A;  1YHG A;  2EML A;  3E5W A;  2H5Q A;  3U8A A;  5BTT B;  4HQ8 A;  3VHT B;  3P8U A;  3W1D A;  3ZUL A;  3ST4 A;  2EMD A;  2DMI A;  2ADR A;  1OXE A;  3DQ3 A;  4Q7U A;  3PJB A;  4W6H A;  1H6R A;  4ZF4 A;  4IK5 A;  4DKM A;  5J2O A;  4W6F A;  3G9A A;  4Z4M A;  1JK1 A;  4IS1 C;  3H1O A;  2H5R A;  3DQM A;  3U8P A;  4DXP A;  4W7R A;  2WSN A;  4IK8 A;  3SG7 A;  3U0K A;  2YU5 A;  5BT0 A;  2YRM A;  3ZUJ A;  1X6E A;  2EMI A;  2YTO A;  3VHT A;  4W7E A;  2YSP A;  4ZIO A;  2EOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...