3VHTB

Crystal structure of gfp-wrnip1 ubz domain fusion protein in complex with ubiquitin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
267
structure length
259
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGISQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein/protein binding
total genus 72
structure length 259
sequence length 267
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01353 GFP Green fluorescent protein
B PF18279 zf-WRNIP1_ubi Werner helicase-interacting protein 1 ubiquitin-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3vhtB01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 3vhtB02
1OXFA 2FZUA 1YZWA 2O2BA 4LJDA 2HGDA 2WHSA 4JC2A 3LSAA 1H6RA 1QYFA 2H5PA 4I2YA 4ZFSA 5LTPA 3U0LA 1ZU1A 2EMWA 2YTFA 2EM7A 4OGSA 5EJUA 3SVNA 5KL6A 3MHHC 4ZINA 4KW4A 4XOWA 2WSOA 3DQEA 3EK7A 2IB6A 1JC0A 3EPHA 4W6UA 1EMLA 4JRBA 5KL2A 1YHIA 4ANJA 4ZF5A 2EMOA 2DUFA 1WJPA 2AH8A 2H9WA 2ENHA 2HGHA 2LT7A 3BXCA 2EM5A 2EN3A 2G6XA 5DPHA 4HVFA 3NF0A 3U0MA 2YTDA 4W6RA 4Q9XA 4HQ9A 2A50B 3CBEA 3PJBA 2EOSA 1KYPA 1YUJA 2FL1A 3UG0A 3W1DA 2DDCA 2MDGA 3UK3C 2WBUA 1MYWA 3SS0A 2QRFA 2HQKA 5HW9A 2EPCA 2WBTA 1RRXA 3DQOA 2EOIA 2A48A 4KA9A 3OSQA 2YE0A 3CD9A 1LLMC 3DPZA 1BFPA 2H5RA 4W6GA 5DPGA 4DXPA 1CV7A 4W7CA 2RSIA 4LQUA 2EORA 5DY6A 1RM9A 4EULA 4PPLA 4W7AA 4KW9A 4LJDC 2DD7A 2ELYA 3ZULA 1QYOA 3SVEA 4DXNA 3AKOA 1Q4BA 5DQBA 3U0NA 2EP3A 1W7UA 4RYSA 2EMGA 2R1FA 4BDUA 3SG6A 1A1HA 4W6JA 4WSGA 2Q6PA 2QU1A 3DQ1A 4B5YA 2YU5A 4JF9A 2DRPA 1F0BA 2VVJA 4R2CA 2QZ0A 2BB8A 3SVUA 3ST0A 4ZB1A 2HPWA 3SVOA 4M9VC 2MKNA 5EXUA 1MOUA 1YFPA 5HGEA 3WLDA 2WCC3 1OXEA 4IK4A 2YTNA 3DQAA 5T3IA 4IJDA 2DUIA 4R6BA 4W7XA 2HQZA 4B30B 4PFEA 2EM6A 1A1IA 2O29A 2A56B 4W6CA 1GL4A 3O78A 3CFAA 2PXSA 5H87A 3SG2A 2YRKA 4W6DA 4TZGA 2EM4A 4JEOA 3DQMA 2EN7A 4R2PA 3DQ9A 5LTRA 3AI4A 1GGXA 1BB8A 5FHVA 1AAYA 2JADA 1YUIA 2AWMA 4N3DA 1EMGA 4IS1C 2EOQA 2EPZA 4W74A 2EPPA 3EKJA 4W6FA 2G3DB 4KF4A 4W77A 2CTDA 3M22A 2EPAA 5HZTA 4W7DA 1XA9A 5HZOA 3S05A 3LF3A 1KP5A 4DKNA 1C4FA 3DQHA 2AWLA 3SSTA 3SG3A 3EPLA 3BX9A 2LO3A 2QLGB 3LS3A 1XAEA 3VICA 1KYSA 3H1OA 4U2VA 3A8SA 1RMPA 1JBYA 4AS8A 2YRHA 2EOOA 4F6NA 5HZUA 3DQ4A 1F09A 4KEXA 2GLIA 4AR7A 2EOHA 2EQ1A 1MOVA 3KCTA 1Z1BA 4LJCA 1EMBA 3CFHA 2M9AA 4P1QA 3EK4A 2GX0A 4W73A 3DQDA 3TMTA 2IB5A 2OKWA 1EMAA 2YDZA 1A1FA 1ZGOA 3CGLA 1JK1A 3DQCA 2EMNA 4EDOA 2C9JA 4J89A 2OTBA 3DQUA 1DGCA 3CB9A 2JP9A 5KTGA 2EOYA 2J7JA 2EPRA 3DQJA 2DUEA 3P8UA 3DQ8A 5DRFA 4XGYA 1JC1A 3SVCA 2EMCA 2DD9A 2G5ZB 4TZAA 1X6EA 4W6PA 2HGYA 4F2JC 4W6SA 3ED8A 1JBZA 2EOXA 4B30A 4OY4A 4ZBLA 3I19A 2EM8A 1S6ZA 1HCJA 2HRSA 4UTSA 5DTZA 2EL4A 3LVCA 2RH7A 4H48A 3LA1A 1X6FA 5DTYA 2EMHA 1KJKA 3PIBA 3M24A 5EXCI 4W6IA 2ZO6A 4PPKA 3EPKA 4EDSA 4Q9WA 2VAEA 3BXBA 2YTGA 3V3DA 2G6YA 5DU0A 3SSYA 3LF4B 4OJ0A 2WBSA 5F9GA 4XL5A 3IR8A 3DPWA 2IOVA 2DMIA 1X6HA 2EMYA 1TF3A 4RYWA 2YTIA 3P28A 3H1RA 3DQ6A 2AWJA 1UN6B 1QXTA 4ZF4A 4LQTA 3SSPA 5FVGA 2EMBA 5EBJA 1BBOA 2OKYA 4OQWA 3ZUJA 4OHSA 2YTJA 2O24A 4NWSA 2EL5A 3NT9A 3DQIA 5LTQA 1ZR9A 1JK2A 2GHFA 2YTOA 5FVIA 1A1JA 2I13A 4Z4KA 2EM3A 5KL4A 3OGOA 2VRDA 1UISA 5HZSA 1ZAAC 4KAGA 2EMZA 1H4UA 4XOVA 3K1KA 3VK1A 2EOMA 3MGFA 4W7EA 4ZF3A 3GEXA 2VVHA 5LK4A 4W6TA 2JPAA 2WSNA 1P47A 4L13A 5BT0A 3SRYA 3SSKA 3RWTA 5DPIA 2YSPA 2FWQA 4H3LA 2DUHA 4JFGA 1EMMA 3GL4A 1X5WA 2ADRA 2YE1A 2EMAA 4KPIA 2GW3A 4KF5A 1B9CA 4IK3A 1A1LA 2A47A 1TF6A 2EN2A 2Y0GA 2EJ4A 4HQ8A 4P76A 3U8PA 4W6OA 2A52B 5EB6A 4LJBA 4DXIA 4DXQA 2ENCA 2EQ3A 2B3PA 3DQFA 5DTXA 4IK8A 4HE4A 4J8AA 3ST3A 2HCGA 2C9IA 2Z6YA 1ZUXA 3EVRA 3NT3A 1Q4CA 2EOJA 5KL3A 4Q7RA 4Z4MA 1G2DC 2A53B 2V4EB 1X3CA 1GFLA 2HJOA 1G7KA 3LVDA 3EVUA 3KCSA 1EMCA 2GX2A 2H5OA 4KGEA 5AQBB 3G9AA 4EN1A 1Z1PA 4GOBA 2EMXA 2QLEA 3WLCA 4F6MA 2WIQA 1YJFA 1RMDA 2B3QA 2G16B 3DQ5A 4PPJA 2A25A 2VZXA 3ZTFA 5BTTB 3ZUFA 1HUYA 3CFFA 3DQ3A 4W6LA 4W6KA 4KF5C 5BQLA 4XVPA 5DPJA 2EOFA 5DQMA 3SSHA 4J88A 4W7RA 2WHTA 3U0KA 2EE8A 3DPXA 1XQMA 2ICRA 3DQNA 2YSOA 4Q7UA 2DLQA 2EN1A 2H8QA 2CT1A 4IZNA 2E72A 2EN8A 2ENAA 2EM0A 1XMZA 3EPJA 1Q73A 4GF6B 4IK5A 2PXWA 5H88A 3OSRA 2ZMWA 3LVAA 4W72A 1QYQA 4R2RA 3PJ5A 5H89A 2AWKA 2EOZA 2PRTA 2Z6XA 2CSHA 2QLIA 2EM2A 2LVHA 5KL7A 4HQCA 2EOEA 4RTCA 2ELZA 3VHTB 1EMEA 1QY3A 4Q7TA 2NABA 4W76A 1EMKA 3UFZA 2DLKA 4W69A 2GW4B 1NCSA 2BTJA 2EPUA 4L1IA 2YTPA 3DQLA 4L12A 2YU8A 1Q4DA 3RWAA 5EB7A 5HBDA 2EMIA 2LV2A 2Z1OA 1RMOA 1YSAC 3EKHA 2RPCA 3DQKA 2G6EA 4IK1A 4W75A 2QLGA 4DXOA 2H5QA 3E5VA 4W6AA 2VADA 2Q57A 3E5TA 2MKDA 2OTEA 3SVDA 2D9HA 3M99B 4LW5A 3SVBA 4IK9A 2ZMUA 5FVFA 1YJ2A 2V4EA 1EMFA 3IP2A 2A46A 5EXBA 4R2SA 4R2AA 3EK8A 5DRGA 2EL6A 2G2SB 3GJ1A 5KL5A 4R2EA 3SSVA 2VVIA 1G2FC 3NEDA 3SG7A 3U8CA 2QLHA 4ORNA 4GZNC 1Q4AA 2EMKA 2WURA 4R2DA 4X9JA 3SVSA 1W7TA 2YTQA 1KYRA 2QT2A 2EPXA 3WCKA 3DQ7A 3AI5A 3SV5A 1RMMA 5BTTA 4W6BA 2ARLA 2G3OA 3E5WA 3SVRA 3BXAA 3ST2A 1ZGQA 2WHUA 1UBDC 4W7FA 4W6MA 4DXMA 2WISA 5J2OA 2YRMA 1XSSA 1W7SA 3DQ2A 3SSLA 1A1GA 1B69A 4W6NA 2DDDA 3ADFA 2EMFA 4H3NA 2ZO7A 4DKMA 4H47A 4W6HA 2EM9A 3SG4A 4FK5C 2EN6A 2AHAA 4JGEA 2POXA 3NEZA 2DGCA 1OXDA 2Z6ZA 4R2QA 3GB3A 1ZGPA 3ST4A 2OGRA 2A54B 3O77A 3W1CA 1MEYC 3MHSC 1F2IG 4ZIOA 2EN4A 3PJ7A 1YHGA 2V4EC 1TN9A 3EVPA 2EMLA 1Q4EA 1YHHA 2H6VA 4R6DA 2DUGA 2IE2A 1A1KA 4KW8A 2P4MA 3U8AA 3VHTA 5EHUA 3GJ2A 3EVVA 5DTLA 4GESB 4EMQA 1Z1QA 2OJKA 2EQ0A 2YTEA 2YFPA 2HFCA 2LCEA 3CD1A 4KGFA 4H3MA 2EMDA 3SG5A 3TMRA
chains in the Genus database with same CATH superfamily
1OXFA 2FZUA 4O24A 1YZWA 2O2BA 4LJDA 2HGDA 2WHSA 4JC2A 3LSAA 1H6RA 1QYFA 2H5PA 4I2YA 4ZFSA 5LTPA 3U0LA 1ZU1A 2DIXA 2EMWA 2YTFA 3JTZA 1UHZA 4N4RB 2EM7A 5IV8B 4K0KE 4OGSA 5EJUA 3SVNA 5KL6A 3MHHC 4LU9A 4X62E 4ZINA 2NUEA 4KW4A 4XOWA 5AC4A 2WSOA 3DQEA 3EK7A 3ADLA 2IB6A 4DV7E 1JC0A 3EPHA 4W6UA 1EMLA 4JRBA 1MGTA 4X66E 5KL2A 1YHIA 2F8BA 3HPZA 1HNXE 2LUPB 4ANJA 2MC6A 4ZF5A 2EMOA 4DR2E 1KYQA 2DUFA 1WJPA 2AH8A 2H9WA 2ENHA 1RQ0A 1J26A 2HGHA 3HTXA 1L4SA 2LT7A 3BXCA 2EM5A 2EN3A 5IXMB 2G6XA 5DPHA 4B3ME 4HVFA 2K4VA 3NF0A 5LLQA 2UUAE 2VQFE 3U0MA 1QU6A 2YTDA 1HNWE 5CFFE 4W6RA 2JXPA 4F9BB 1PKPA 4Q9XA 4HQ9A 5DNYA 4YHHE 4MLQA 4LF5E 2A50B 3CBEA 3PJBA 2EOSA 1KYPA 3DF6A 2FL1A 3UG0A 3W1DA 2HC5A 2DDCA 5A6BD 5FLXC 2MDGA 3UK3C 2WBUA 1MYWA 3SS0A 2QRFA 2Q8UA 2E5LE 2HQKA 5HW9A 2EPCA 2WBTA 2UUCE 1RRXA 3DQOA 2EOIA 2A48A 4KA9A 3OSQA 2YE0A 3CD9A 2RS7A 1LLMC 2JOBA 3DPZA 1BFPA 2H5RA 4W6GA 5DPGA 4DXPA 1CV7A 3IWBA 4LF8E 4W7CA 2RSIA 2M1SA 2L3CA 4LQUA 2EORA 1YYWA 5DY6A 1RM9A 4EULA 4PPLA 1IBKE 2HJJA 2M7QA 4W7AA 4KW9A 4LJDC 2DD7A 2ELYA 3ZULA 1QYOA 3SVEA 4YY3E 4JI5E 4DXNA 2N3GA 3AKOA 1Q4BA 5DQBA 3U0NA 2EP3A 2L2MA 5LL6R 1W7UA 4RYSA 2EMGA 2R1FA 4BDUA 3SG6A 1A1HA 4W6JA 1NEIA 2KOUA 4BCAA 4WSGA 2Q6PA 2QU1A 3DQ1A 4B5YA 2YU5A 4JF9A 1PJSA 4F9CB 5A6BA 1F0BA 3J81C 2DRPA 2VVJA 4R2CA 2QZ0A 2BB8A 3SVUA 3ST0A 4ZB1A 1T4NA 4LF7E 2HPWA 3ADGA 3SVOA 4M9VC 4ZYHA 2MKNA 5EXUA 1MOUA 1YFPA 5HGEA 2ODRD 3WLDA 2WCC3 1OXEA 4IK4A 2YTNA 3DQAA 5T3IA 2DSYA 2V83A 4IJDA 4J8ZA 4JI0E 2DUIA 1YZ9A 4R6BA 4W7XA 2HQZA 4B30B 4KWYA 4TUGA 4PFEA 2EM6A 2RS6A 1A1IA 1IBLE 2O29A 2A56B 4I8OA 4W6CA 1GL4A 3O78A 3CFAA 2PXSA 4JI7E 1IQOA 5H87A 3SG2A 1N36E 2YRKA 3KZYA 1EH6A 4W6DA 4TZGA 1WRJA 4R03A 2EM4A 4JEOA 3DQMA 2EN7A 2EWLA 2L92A 4R2PA 3DQ9A 5LTRA 3AI4A 2ZM6E 1GGXA 2YT4A 1BB8A 3C6KA 5FHVA 1AAYA 2JADA 1YUIA 2EZ6A 1EH8A 3KWRA 4DUZE 2AWMA 1XMOE 4N3DA 1EMGA 3AUZA 2EOQA 2EPZA 4W74A 2EPPA 4IS1C 1DQ3A 3EKJA 5ADZA 2RTXA 4W6FA 2G3DB 4KF4A 4F54A 4W77A 2CTDA 3M22A 2EPAA 2VF1A 5A6AA 4KHPE 5IWAE 2L8TA 5HZTA 4W7DA 1XA9A 5HZOA 3DJWA 3S05A 3LF3A 1KP5A 4DKNA 1C4FA 3DQHA 2AWLA 3SSTA 3FIGA 3SG3A 3EPLA 3BX9A 2LO3A 2QLGB 4BC9A 4KZSA 3LS3A 4DV5E 1XAEA 3VICA 2LE2A 1KYSA 4BMJA 1YFHA 3H1OA 4U2VA 4MLVA 2L6MA 3A8SA 1WXRA 4BHBA 1RMPA 1JBYA 4LF4E 4ZYEA 1N32E 4AS8A 2YRHA 2EOOA 4F6NA 2EPNA 5HZUA 3DQ4A 1F09A 4KEXA 2GLIA 4AR7A 1STUA 2EOHA 2EQ1A 2B7TA 5AE2A 1MOVA 1BBGA 3KCTA 2YPNA 3HPSA 1Z1BA 1HNZE 4LJCA 1EMBA 3CFHA 5LMNE 4JI8E 2E1MA 2UU9E 2M9AA 4P1QA 3EK4A 3ZOQB 3JAMC 2NA2A 2GX0A 4W73A 3DQDA 3TMTA 5A6JA 4RH8A 5LMUE 2IB5A 2OKWA 2UXBE 1EMAA 2YDZA 1PJQA 2JWOA 2V87A 2L2NA 4DV6E 1A1FA 1ZGOA 3CGLA 1JK1A 2M4IA 1YYKA 2LMZA 3DQCA 3K6QA 2EMNA 4DR1E 2L2KB 4EDOA 3OMLA 2C9JA 4J89A 2OTBA 3DQUA 1DGCA 3CB9A 2JP9A 2L3JA 4GKJE 3LMLA 5KTGA 2ODRC 2EOYA 2J7JA 2EPRA 3DQJA 2DUEA 3P8UA 3DQ8A 5DRFA 4XGYA 2JOXA 1JC1A 1SFEA 3SVCA 1X48A 2EMCA 5TSEA 2DD9A 2G5ZB 4TZAA 4WYQB 1X6EA 4W6PA 2HGYA 4F2JC 4W6SA 4WSPA 3ED8A 1JBZA 2EOXA 4B30A 4OY4A 4ZBLA 1FJGE 3ECRA 3I19A 2EM8A 2UXCE 3VYXA 3C4BA 4LTYA 1S6ZA 1HCJA 2KHXA 4Q35B 2HRSA 4UTSA 5DTZA 2EL4A 3LVCA 2RH7A 2H36X 4H48A 3LA1A 1X6FA 5DTYA 2EMHA 1KJKA 3PIBA 3M24A 5EXCI 4W6IA 2ZO6A 4PPKA 1IQSA 3AV0A 3EPKA 4EDSA 4Q9WA 2VAEA 3BXBA 2YTGA 5AE3A 3V3DA 2GPIA 4P7DA 2UXDE 2G6YA 5DU0A 3SSYA 3LF4B 4OJ0A 2WBSA 5F9GA 4XL5A 3IR8A 3DPWA 4B3RE 2IOVA 2DMIA 1X6HA 2EMYA 5T6JA 1TF3A 4RYWA 2YTIA 3P28A 3H1RA 3DQ6A 2AWJA 4DV3E 1UN6B 1QXTA 4ZF4A 4LQTA 3SSPA 5FVGA 4AQYE 2EMBA 5EBJA 1BBOA 2OKYA 3KZZA 4WPYA 4X8WA 4OQWA 3ZUJA 2B7VA 4OHSA 2LJUA 2YTJA 2O24A 4OOGC 4NWSA 2R76A 2EL5A 2LUQA 4OX9E 3NT9A 3DQIA 1WHNA 4JI3E 5LTQA 4JI1E 1ZR9A 1JK2A 2GHFA 2YTOA 5FVIA 2V85A 3IWDA 3TQMA 1A1JA 4Z4KA 2EM3A 5KL4A 3OGOA 2I13A 4LF9E 2VRDA 1UISA 5HZSA 1ZAAC 4KAGA 2EMZA 1H4UA 2CPNA 3OTOE 2KONA 4XOVA 3K1KA 3VK1A 2EOMA 3VYYA 3MGFA 4W7EA 4ZF3A 2YWQA 3GEXA 2VE7C 2VVHA 5LK4A 4W6TA 4DR5E 2JPAA 2WSNA 1P47A 4L13A 5BT0A 3SRYA 3SSKA 3RWTA 5DPIA 2YSPA 3EQ1A 2FWQA 4H3LA 2DUHA 4JFGA 1EMMA 3GL4A 1X5WA 2ADRA 2YE1A 2EMAA 2JR1A 4KPIA 4TUIA 2GW3A 4KF5A 2NUGA 1B9CA 4IK3A 2DB2A 2A47A 1A1LA 4GKKE 1TF6A 1ZBTA 2EN2A 2Y0GA 2EJ4A 2JYAA 4BHCA 4HQ8A 4P76A 3U8PA 4WX9A 4X65E 2K7IA 4W6OA 2V86A 2A52B 5EB6A 4LJBA 4DXIA 5AC5A 3T1YE 5A6KA 4DXQA 2ENCA 2EQ3A 3BIDA 1UILA 2V8QB 2B3PA 3DQFA 5DTXA 2HHHE 4IK8A 2FTXB 4HE4A 4J8AA 3ST3A 2G7HA 4DMIA 4M2ZA 2HCGA 2C9IA 4LFAE 2Z6YA 1GZ6A 1ZUXA 3EVRA 3NT3A 1Q4CA 2EOJA 5KL3A 4Q7RA 4Z4MA 1G2DC 2A53B 4DUYE 3VK6A 2V4EB 1X3CA 5F3WA 1GFLA 2HJOA 1G7KA 3LVDA 3EVUA 2B9DA 3BGHA 3J7AG 3KCSA 1EH7A 1EMCA 2GX2A 4HTGA 2H5OA 4KGEA 4DV4E 3BF2A 4JV5E 5AQBB 3G9AA 4EN1A 2YZTA 4NXNE 1Z1PA 4GOBA 2EMXA 2QLEA 3WLCA 4F6MA 2WIQA 1YJFA 1RMDA 2B3QA 2G16B 3DQ5A 3C6MA 1IMUA 4PPJA 4DR4E 2A25A 2FGGA 2VZXA 2MC5A 3ZTFA 5BTTB 2NUFA 4DV2E 3ZUFA 3THOB 1HUYA 3CFFA 3DQ3A 4W6LA 1YUJA 4W6KA 4KF5C 5BQLA 4XVPA 4JYAE 5IT9C 5DPJA 2EOFA 5DQMA 3SSHA 4J88A 4W7RA 2LBSB 2RQLA 3RMPA 2WHTA 4LFBE 3U0KA 2EE8A 3DPXA 1XQMA 2ICRA 3DQNA 2YSOA 4Q7UA 2DLQA 2EN1A 1SR9A 2BBGA 2H8QA 2CT1A 4WXCA 1I94E 4IZNA 2E72A 4BS9A 2LRSA 2EN8A 3C4TA 4JI6E 2ENAA 2EM0A 1XMZA 3EPJA 1HR0E 1IBME 1Q73A 4GF6B 4IK5A 2PXWA 5H88A 3OSRA 4O43A 4DR6E 2ZMWA 2B3TB 3LVAA 4W72A 1QYQA 4R2RA 4B3SE 3PJ5A 5H89A 2AWKA 2EOZA 4NZVA 5A69A 2PRTA 2Z6XA 2CSHA 2QLIA 2EM2A 2LVHA 5KL7A 4HQCA 2EOEA 4RTCA 2L33A 2ELZA 3VHTB 4F9AB 1EMEA 1PJTA 1QY3A 4Q7TA 2DMYA 2NABA 1YYOA 4W76A 1EMKA 4O5GA 3UFZA 3H09A 2DLKA 3BBGA 4W69A 2GW4B 1NCSA 1DI2A 3T1HE 2BTJA 5BR8E 2EPUA 4L1IA 4RHBB 2YTPA 3DQLA 4L12A 2YU8A 4WXDA 1Q4DA 3JU0A 3RWAA 5AASA 1RC7A 5EB7A 5HBDA 2EMIA 1AH5A 2LV2A 2MDRA 2Z1OA 1RMOA 3HQ1A 1J5EE 1YSAC 3EKHA 4WFTA 2RPCA 2EPKX 1X49A 2N8XA 3DQKA 2G6EA 4IK1A 4W75A 1O0WA 2QLGA 4DXOA 2H5QA 3E5VA 4W6AA 2VADA 2Q57A 3E5TA 1ZBQA 2MKDA 2RSMA 3QG5C 2OTEA 3SVDA 2D9HA 3M99B 4L5NC 4LW5A 3SVBA 4IK9A 1N33E 2ZMUA 5FVFA 1YJ2A 4DR7E 2V4EA 2EPOA 4B3TE 1EMFA 4LFCE 2N3HA 3IP2A 2A46A 5EXBA 4L8NA 4R2SA 4R2AA 3EK8A 5DRGA 2EL6A 4BBYA 2G2SB 3GJ1A 5KL5A 1XNQE 4R2EA 3F6GA 3SSVA 2VVIA 1G2FC 3NEDA 3SG7A 3U8CA 2QLHA 4ORNA 4GZNC 4DV0E 1Q4AA 2EMKA 2WURA 4P78A 4R2DA 4DR3E 4X9JA 3SVSA 1W7TA 2YTQA 1KYRA 2QT2A 2EPXA 3WCKA 2LTRA 4NXME 1T4LB 3DQ7A 3AI5A 1T38A 1T39A 4X64E 3SV5A 1RMMA 5BTTA 4W6BA 2ARLA 2EPMX 1XMQE 2G3OA 3E5WA 3SVRA 3BXAA 3ST2A 4ZYGA 4M0VA 1ZGQA 2WZOA 2WHUA 2F4VE 1T4OA 1UBDC 1WHQA 1N3GA 4W7FA 1EKZA 4W6MA 4DXMA 2V89A 4DKKA 2WISA 4R8OA 5J2OA 2YRMA 1XSSA 1W7SA 3DQ2A 3SSLA 4NHRA 4Q28A 1A1GA 2EPLX 4GEQB 1B69A 2LTSA 2V88A 4W6NA 4JI2E 2DDDA 3ADFA 2UUBE 2EMFA 4H3NA 2ZO7A 1X47A 4HEIA 3L00A 1GTKA 4DKMA 3HXLA 4H47A 1GQEA 4W6HA 2EM9A 1QNTA 3SG4A 4FK5C 2EN6A 2AHAA 3J80C 4JGEA 2POXA 3NEZA 2DGCA 1OXDA 2LJHA 4ZYDA 4BC7A 3ADIA 4M30A 2Z6ZA 3ADJA 3GB3A 4R2QA 1ZGPA 3ST4A 4JI4E 2OGRA 2A54B 3O77A 2JY9A 2IHR1 3W1CA 1PDAA 2JVAA 3MHSC 1MEYC 1F2IG 4ZIOA 2EN4A 3PJ7A 1YHGA 2V4EC 2VQEE 3EVPA 1TN9A 2EMLA 3F6HA 1FKAE 1Q4EA 1YPNA 1YHHA 2H6VA 1N34E 4R6DA 2DUGA 2IE2A 3J7Yp 1A1KA 4KW8A 2P4MA 3U8AA 3THNA 3VHTA 5EHUA 3GJ2A 2I9IA 3EVVA 5DTLA 4GESB 4EMQA 2FV4B 1Z1QA 5A2QC 4DV1E 4LF6E 1XNRE 2OJKA 2EQ0A 2YTEA 2YFPA 3IWCA 2HFCA 3LLHA 3MSWA 2LCEA 4O4KA 3CD1A 5AE1A 4KGFA 3P1XA 4H3MA 2EMDA 3SG5A 3TMRA
chains in the Genus database with same CATH topology
1OXFA 2FZUA 1YZWA 2O2BA 4LJDA 2HGDA 2WHSA 4JC2A 3LSAA 1H6RA 1QYFA 2H5PA 4I2YA 4ZFSA 5LTPA 3U0LA 1ZU1A 2EMWA 2YTFA 2EM7A 4OGSA 5EJUA 3SVNA 5KL6A 3MHHC 4ZINA 4KW4A 4XOWA 2WSOA 3DQEA 3EK7A 2IB6A 1JC0A 3EPHA 4W6UA 1EMLA 4JRBA 5KL2A 1YHIA 4ANJA 4ZF5A 2EMOA 2DUFA 1WJPA 2AH8A 2H9WA 2ENHA 2HGHA 2LT7A 3BXCA 2EM5A 2EN3A 2G6XA 5DPHA 4HVFA 3NF0A 3U0MA 2YTDA 4W6RA 4Q9XA 4HQ9A 2A50B 3CBEA 3PJBA 2EOSA 1KYPA 1YUJA 2FL1A 3UG0A 3W1DA 2DDCA 2MDGA 3UK3C 2WBUA 1MYWA 3SS0A 2QRFA 2HQKA 5HW9A 2EPCA 2WBTA 1RRXA 3DQOA 2EOIA 2A48A 4KA9A 3OSQA 2YE0A 3CD9A 1LLMC 3DPZA 1BFPA 2H5RA 4W6GA 5DPGA 4DXPA 1CV7A 4W7CA 2RSIA 4LQUA 2EORA 5DY6A 1RM9A 4EULA 4PPLA 4W7AA 4KW9A 4LJDC 2DD7A 2ELYA 3ZULA 1QYOA 3SVEA 4DXNA 3AKOA 1Q4BA 5DQBA 3U0NA 2EP3A 1W7UA 4RYSA 2EMGA 2R1FA 4BDUA 3SG6A 1A1HA 4W6JA 4WSGA 2Q6PA 2QU1A 3DQ1A 4B5YA 2YU5A 4JF9A 2DRPA 1F0BA 2VVJA 4R2CA 2QZ0A 2BB8A 3SVUA 3ST0A 4ZB1A 2HPWA 3SVOA 4M9VC 2MKNA 5EXUA 1MOUA 1YFPA 5HGEA 3WLDA 2WCC3 1OXEA 4IK4A 2YTNA 3DQAA 5T3IA 4IJDA 2DUIA 4R6BA 4W7XA 2HQZA 4B30B 4PFEA 2EM6A 1A1IA 2O29A 2A56B 4W6CA 1GL4A 3O78A 3CFAA 2PXSA 5H87A 3SG2A 2YRKA 4W6DA 4TZGA 2EM4A 4JEOA 3DQMA 2EN7A 4R2PA 3DQ9A 5LTRA 3AI4A 1GGXA 1BB8A 5FHVA 1AAYA 2JADA 1YUIA 2AWMA 4N3DA 1EMGA 4IS1C 2EOQA 2EPZA 4W74A 2EPPA 3EKJA 4W6FA 2G3DB 4KF4A 4W77A 2CTDA 3M22A 2EPAA 5HZTA 4W7DA 1XA9A 5HZOA 3S05A 3LF3A 1KP5A 4DKNA 1C4FA 3DQHA 2AWLA 3SSTA 3SG3A 3EPLA 3BX9A 2LO3A 2QLGB 3LS3A 1XAEA 3VICA 1KYSA 3H1OA 4U2VA 3A8SA 1RMPA 1JBYA 4AS8A 2YRHA 2EOOA 4F6NA 5HZUA 3DQ4A 1F09A 4KEXA 2GLIA 4AR7A 2EOHA 2EQ1A 1MOVA 3KCTA 1Z1BA 4LJCA 1EMBA 3CFHA 2M9AA 4P1QA 3EK4A 2GX0A 4W73A 3DQDA 3TMTA 2IB5A 2OKWA 1EMAA 2YDZA 1A1FA 1ZGOA 3CGLA 1JK1A 3DQCA 2EMNA 4EDOA 2C9JA 4J89A 2OTBA 3DQUA 1DGCA 3CB9A 2JP9A 5KTGA 2EOYA 2J7JA 2EPRA 3DQJA 2DUEA 3P8UA 3DQ8A 5DRFA 4XGYA 1JC1A 3SVCA 2EMCA 2DD9A 2G5ZB 4TZAA 1X6EA 4W6PA 2HGYA 4F2JC 4W6SA 3ED8A 1JBZA 2EOXA 4B30A 4OY4A 4ZBLA 3I19A 2EM8A 1S6ZA 1HCJA 2HRSA 4UTSA 5DTZA 2EL4A 3LVCA 2RH7A 4H48A 3LA1A 1X6FA 5DTYA 2EMHA 1KJKA 3PIBA 3M24A 5EXCI 4W6IA 2ZO6A 4PPKA 3EPKA 4EDSA 4Q9WA 2VAEA 3BXBA 2YTGA 3V3DA 2G6YA 5DU0A 3SSYA 3LF4B 4OJ0A 2WBSA 5F9GA 4XL5A 3IR8A 3DPWA 2IOVA 2DMIA 1X6HA 2EMYA 1TF3A 4RYWA 2YTIA 3P28A 3H1RA 3DQ6A 2AWJA 1UN6B 1QXTA 4ZF4A 4LQTA 3SSPA 5FVGA 2EMBA 5EBJA 1BBOA 2OKYA 4OQWA 3ZUJA 4OHSA 2YTJA 2O24A 4NWSA 2EL5A 3NT9A 3DQIA 5LTQA 1ZR9A 1JK2A 2GHFA 2YTOA 5FVIA 1A1JA 2I13A 4Z4KA 2EM3A 5KL4A 3OGOA 2VRDA 1UISA 5HZSA 1ZAAC 4KAGA 2EMZA 1H4UA 4XOVA 3K1KA 3VK1A 2EOMA 3MGFA 4W7EA 4ZF3A 3GEXA 2VVHA 5LK4A 4W6TA 2JPAA 2WSNA 1P47A 4L13A 5BT0A 3SRYA 3SSKA 3RWTA 5DPIA 2YSPA 2FWQA 4H3LA 2DUHA 4JFGA 1EMMA 3GL4A 1X5WA 2ADRA 2YE1A 2EMAA 4KPIA 2GW3A 4KF5A 1B9CA 4IK3A 1A1LA 2A47A 1TF6A 2EN2A 2Y0GA 2EJ4A 4HQ8A 4P76A 3U8PA 4W6OA 2A52B 5EB6A 4LJBA 4DXIA 4DXQA 2ENCA 2EQ3A 2B3PA 3DQFA 5DTXA 4IK8A 4HE4A 4J8AA 3ST3A 2HCGA 2C9IA 2Z6YA 1ZUXA 3EVRA 3NT3A 1Q4CA 2EOJA 5KL3A 4Q7RA 4Z4MA 1G2DC 2A53B 2V4EB 1X3CA 1GFLA 2HJOA 1G7KA 3LVDA 3EVUA 3KCSA 1EMCA 2GX2A 2H5OA 4KGEA 5AQBB 3G9AA 4EN1A 1Z1PA 4GOBA 2EMXA 2QLEA 3WLCA 4F6MA 2WIQA 1YJFA 1RMDA 2B3QA 2G16B 3DQ5A 4PPJA 2A25A 2VZXA 3ZTFA 5BTTB 3ZUFA 1HUYA 3CFFA 3DQ3A 4W6LA 4W6KA 4KF5C 5BQLA 4XVPA 5DPJA 2EOFA 5DQMA 3SSHA 4J88A 4W7RA 2WHTA 3U0KA 2EE8A 3DPXA 1XQMA 2ICRA 3DQNA 2YSOA 4Q7UA 2DLQA 2EN1A 2H8QA 2CT1A 4IZNA 2E72A 2EN8A 2ENAA 2EM0A 1XMZA 3EPJA 1Q73A 4GF6B 4IK5A 2PXWA 5H88A 3OSRA 2ZMWA 3LVAA 4W72A 1QYQA 4R2RA 3PJ5A 5H89A 2AWKA 2EOZA 2PRTA 2Z6XA 2CSHA 2QLIA 2EM2A 2LVHA 5KL7A 4HQCA 2EOEA 4RTCA 2ELZA 3VHTB 1EMEA 1QY3A 4Q7TA 2NABA 4W76A 1EMKA 3UFZA 2DLKA 4W69A 2GW4B 1NCSA 2BTJA 2EPUA 4L1IA 2YTPA 3DQLA 4L12A 2YU8A 1Q4DA 3RWAA 5EB7A 5HBDA 2EMIA 2LV2A 2Z1OA 1RMOA 1YSAC 3EKHA 2RPCA 3DQKA 2G6EA 4IK1A 4W75A 2QLGA 4DXOA 2H5QA 3E5VA 4W6AA 2VADA 2Q57A 3E5TA 2MKDA 2OTEA 3SVDA 2D9HA 3M99B 4LW5A 3SVBA 4IK9A 2ZMUA 5FVFA 1YJ2A 2V4EA 1EMFA 3IP2A 2A46A 5EXBA 4R2SA 4R2AA 3EK8A 5DRGA 2EL6A 2G2SB 3GJ1A 5KL5A 4R2EA 3SSVA 2VVIA 1G2FC 3NEDA 3SG7A 3U8CA 2QLHA 4ORNA 4GZNC 1Q4AA 2EMKA 2WURA 4R2DA 4X9JA 3SVSA 1W7TA 2YTQA 1KYRA 2QT2A 2EPXA 3WCKA 3DQ7A 3AI5A 3SV5A 1RMMA 5BTTA 4W6BA 2ARLA 2G3OA 3E5WA 3SVRA 3BXAA 3ST2A 1ZGQA 2WHUA 1UBDC 4W7FA 4W6MA 4DXMA 2WISA 5J2OA 2YRMA 1XSSA 1W7SA 3DQ2A 3SSLA 1A1GA 1B69A 4W6NA 2DDDA 3ADFA 2EMFA 4H3NA 2ZO7A 4DKMA 4H47A 4W6HA 2EM9A 3SG4A 4FK5C 2EN6A 2AHAA 4JGEA 2POXA 3NEZA 2DGCA 1OXDA 2Z6ZA 4R2QA 3GB3A 1ZGPA 3ST4A 2OGRA 2A54B 3O77A 3W1CA 1MEYC 3MHSC 1F2IG 4ZIOA 2EN4A 3PJ7A 1YHGA 2V4EC 1TN9A 3EVPA 2EMLA 1Q4EA 1YHHA 2H6VA 4R6DA 2DUGA 2IE2A 1A1KA 4KW8A 2P4MA 3U8AA 3VHTA 5EHUA 3GJ2A 3EVVA 5DTLA 4GESB 4EMQA 1Z1QA 2OJKA 2EQ0A 2YTEA 2YFPA 2HFCA 2LCEA 3CD1A 4KGFA 4H3MA 2EMDA 3SG5A 3TMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXF A;  2FZU A;  1YZW A;  2O2B A;  4LJD A;  2HGD A;  2WHS A;  4JC2 A;  3LSA A;  1H6R A;  1QYF A;  2H5P A;  4I2Y A;  4ZFS A;  5LTP A;  3U0L A;  1ZU1 A;  2EMW A;  2YTF A;  2EM7 A;  4OGS A;  5EJU A;  3SVN A;  5KL6 A;  3MHH C;  4ZIN A;  4KW4 A;  4XOW A;  2WSO A;  3DQE A;  3EK7 A;  2IB6 A;  1JC0 A;  3EPH A;  4W6U A;  1EML A;  4JRB A;  5KL2 A;  1YHI A;  4ANJ A;  4ZF5 A;  2EMO A;  2DUF A;  1WJP A;  2AH8 A;  2H9W A;  2ENH A;  2HGH A;  2LT7 A;  3BXC A;  2EM5 A;  2EN3 A;  2G6X A;  5DPH A;  4HVF A;  3NF0 A;  3U0M A;  2YTD A;  4W6R A;  4Q9X A;  4HQ9 A;  2A50 B;  3CBE A;  3PJB A;  2EOS A;  1KYP A;  1YUJ A;  2FL1 A;  3UG0 A;  3W1D A;  2DDC A;  2MDG A;  3UK3 C;  2WBU A;  1MYW A;  3SS0 A;  2QRF A;  2HQK A;  5HW9 A;  2EPC A;  2WBT A;  1RRX A;  3DQO A;  2EOI A;  2A48 A;  4KA9 A;  3OSQ A;  2YE0 A;  3CD9 A;  1LLM C;  3DPZ A;  1BFP A;  2H5R A;  4W6G A;  5DPG A;  4DXP A;  1CV7 A;  4W7C A;  2RSI A;  4LQU A;  2EOR A;  5DY6 A;  1RM9 A;  4EUL A;  4PPL A;  4W7A A;  4KW9 A;  4LJD C;  2DD7 A;  2ELY A;  3ZUL A;  1QYO A;  3SVE A;  4DXN A;  3AKO A;  1Q4B A;  5DQB A;  3U0N A;  2EP3 A;  1W7U A;  4RYS A;  2EMG A;  2R1F A;  4BDU A;  3SG6 A;  1A1H A;  4W6J A;  4WSG A;  2Q6P A;  2QU1 A;  3DQ1 A;  4B5Y A;  2YU5 A;  4JF9 A;  2DRP A;  1F0B A;  2VVJ A;  4R2C A;  2QZ0 A;  2BB8 A;  3SVU A;  3ST0 A;  4ZB1 A;  2HPW A;  3SVO A;  4M9V C;  2MKN A;  5EXU A;  1MOU A;  1YFP A;  5HGE A;  3WLD A;  2WCC 3;  1OXE A;  4IK4 A;  2YTN A;  3DQA A;  5T3I A;  4IJD A;  2DUI A;  4R6B A;  4W7X A;  2HQZ A;  4B30 B;  4PFE A;  2EM6 A;  1A1I A;  2O29 A;  2A56 B;  4W6C A;  1GL4 A;  3O78 A;  3CFA A;  2PXS A;  5H87 A;  3SG2 A;  2YRK A;  4W6D A;  4TZG A;  2EM4 A;  4JEO A;  3DQM A;  2EN7 A;  4R2P A;  3DQ9 A;  5LTR A;  3AI4 A;  1GGX A;  1BB8 A;  5FHV A;  1AAY A;  2JAD A;  1YUI A;  2AWM A;  4N3D A;  1EMG A;  4IS1 C;  2EOQ A;  2EPZ A;  4W74 A;  2EPP A;  3EKJ A;  4W6F A;  2G3D B;  4KF4 A;  4W77 A;  2CTD A;  3M22 A;  2EPA A;  5HZT A;  4W7D A;  1XA9 A;  5HZO A;  3S05 A;  3LF3 A;  1KP5 A;  4DKN A;  1C4F A;  3DQH A;  2AWL A;  3SST A;  3SG3 A;  3EPL A;  3BX9 A;  2LO3 A;  2QLG B;  3LS3 A;  1XAE A;  3VIC A;  1KYS A;  3H1O A;  4U2V A;  3A8S A;  1RMP A;  1JBY A;  4AS8 A;  2YRH A;  2EOO A;  4F6N A;  5HZU A;  3DQ4 A;  1F09 A;  4KEX A;  2GLI A;  4AR7 A;  2EOH A;  2EQ1 A;  1MOV A;  3KCT A;  1Z1B A;  4LJC A;  1EMB A;  3CFH A;  2M9A A;  4P1Q A;  3EK4 A;  2GX0 A;  4W73 A;  3DQD A;  3TMT A;  2IB5 A;  2OKW A;  1EMA A;  2YDZ A;  1A1F A;  1ZGO A;  3CGL A;  1JK1 A;  3DQC A;  2EMN A;  4EDO A;  2C9J A;  4J89 A;  2OTB A;  3DQU A;  1DGC A;  3CB9 A;  2JP9 A;  5KTG A;  2EOY A;  2J7J A;  2EPR A;  3DQJ A;  2DUE A;  3P8U A;  3DQ8 A;  5DRF A;  4XGY A;  1JC1 A;  3SVC A;  2EMC A;  2DD9 A;  2G5Z B;  4TZA A;  1X6E A;  4W6P A;  2HGY A;  4F2J C;  4W6S A;  3ED8 A;  1JBZ A;  2EOX A;  4B30 A;  4OY4 A;  4ZBL A;  3I19 A;  2EM8 A;  1S6Z A;  1HCJ A;  2HRS A;  4UTS A;  5DTZ A;  2EL4 A;  3LVC A;  2RH7 A;  4H48 A;  3LA1 A;  1X6F A;  5DTY A;  2EMH A;  1KJK A;  3PIB A;  3M24 A;  5EXC I;  4W6I A;  2ZO6 A;  4PPK A;  3EPK A;  4EDS A;  4Q9W A;  2VAE A;  3BXB A;  2YTG A;  3V3D A;  2G6Y A;  5DU0 A;  3SSY A;  3LF4 B;  4OJ0 A;  2WBS A;  5F9G A;  4XL5 A;  3IR8 A;  3DPW A;  2IOV A;  2DMI A;  1X6H A;  2EMY A;  1TF3 A;  4RYW A;  2YTI A;  3P28 A;  3H1R A;  3DQ6 A;  2AWJ A;  1UN6 B;  1QXT A;  4ZF4 A;  4LQT A;  3SSP A;  5FVG A;  2EMB A;  5EBJ A;  1BBO A;  2OKY A;  4OQW A;  3ZUJ A;  4OHS A;  2YTJ A;  2O24 A;  4NWS A;  2EL5 A;  3NT9 A;  3DQI A;  5LTQ A;  1ZR9 A;  1JK2 A;  2GHF A;  2YTO A;  5FVI A;  1A1J A;  2I13 A;  4Z4K A;  2EM3 A;  5KL4 A;  3OGO A;  2VRD A;  1UIS A;  5HZS A;  1ZAA C;  4KAG A;  2EMZ A;  1H4U A;  4XOV A;  3K1K A;  3VK1 A;  2EOM A;  3MGF A;  4W7E A;  4ZF3 A;  3GEX A;  2VVH A;  5LK4 A;  4W6T A;  2JPA A;  2WSN A;  1P47 A;  4L13 A;  5BT0 A;  3SRY A;  3SSK A;  3RWT A;  5DPI A;  2YSP A;  2FWQ A;  4H3L A;  2DUH A;  4JFG A;  1EMM A;  3GL4 A;  1X5W A;  2ADR A;  2YE1 A;  2EMA A;  4KPI A;  2GW3 A;  4KF5 A;  1B9C A;  4IK3 A;  1A1L A;  2A47 A;  1TF6 A;  2EN2 A;  2Y0G A;  2EJ4 A;  4HQ8 A;  4P76 A;  3U8P A;  4W6O A;  2A52 B;  5EB6 A;  4LJB A;  4DXI A;  4DXQ A;  2ENC A;  2EQ3 A;  2B3P A;  3DQF A;  5DTX A;  4IK8 A;  4HE4 A;  4J8A A;  3ST3 A;  2HCG A;  2C9I A;  2Z6Y A;  1ZUX A;  3EVR A;  3NT3 A;  1Q4C A;  2EOJ A;  5KL3 A;  4Q7R A;  4Z4M A;  1G2D C;  2A53 B;  2V4E B;  1X3C A;  1GFL A;  2HJO A;  1G7K A;  3LVD A;  3EVU A;  3KCS A;  1EMC A;  2GX2 A;  2H5O A;  4KGE A;  5AQB B;  3G9A A;  4EN1 A;  1Z1P A;  4GOB A;  2EMX A;  2QLE A;  3WLC A;  4F6M A;  2WIQ A;  1YJF A;  1RMD A;  2B3Q A;  2G16 B;  3DQ5 A;  4PPJ A;  2A25 A;  2VZX A;  3ZTF A;  5BTT B;  3ZUF A;  1HUY A;  3CFF A;  3DQ3 A;  4W6L A;  4W6K A;  4KF5 C;  5BQL A;  4XVP A;  5DPJ A;  2EOF A;  5DQM A;  3SSH A;  4J88 A;  4W7R A;  2WHT A;  3U0K A;  2EE8 A;  3DPX A;  1XQM A;  2ICR A;  3DQN A;  2YSO A;  4Q7U A;  2DLQ A;  2EN1 A;  2H8Q A;  2CT1 A;  4IZN A;  2E72 A;  2EN8 A;  2ENA A;  2EM0 A;  1XMZ A;  3EPJ A;  1Q73 A;  4GF6 B;  4IK5 A;  2PXW A;  5H88 A;  3OSR A;  2ZMW A;  3LVA A;  4W72 A;  1QYQ A;  4R2R A;  3PJ5 A;  5H89 A;  2AWK A;  2EOZ A;  2PRT A;  2Z6X A;  2CSH A;  2QLI A;  2EM2 A;  2LVH A;  5KL7 A;  4HQC A;  2EOE A;  4RTC A;  2ELZ A;  3VHT B;  1EME A;  1QY3 A;  4Q7T A;  2NAB A;  4W76 A;  1EMK A;  3UFZ A;  2DLK A;  4W69 A;  2GW4 B;  1NCS A;  2BTJ A;  2EPU A;  4L1I A;  2YTP A;  3DQL A;  4L12 A;  2YU8 A;  1Q4D A;  3RWA A;  5EB7 A;  5HBD A;  2EMI A;  2LV2 A;  2Z1O A;  1RMO A;  1YSA C;  3EKH A;  2RPC A;  3DQK A;  2G6E A;  4IK1 A;  4W75 A;  2QLG A;  4DXO A;  2H5Q A;  3E5V A;  4W6A A;  2VAD A;  2Q57 A;  3E5T A;  2MKD A;  2OTE A;  3SVD A;  2D9H A;  3M99 B;  4LW5 A;  3SVB A;  4IK9 A;  2ZMU A;  5FVF A;  1YJ2 A;  2V4E A;  1EMF A;  3IP2 A;  2A46 A;  5EXB A;  4R2S A;  4R2A A;  3EK8 A;  5DRG A;  2EL6 A;  2G2S B;  3GJ1 A;  5KL5 A;  4R2E A;  3SSV A;  2VVI A;  1G2F C;  3NED A;  3SG7 A;  3U8C A;  2QLH A;  4ORN A;  4GZN C;  1Q4A A;  2EMK A;  2WUR A;  4R2D A;  4X9J A;  3SVS A;  1W7T A;  2YTQ A;  1KYR A;  2QT2 A;  2EPX A;  3WCK A;  3DQ7 A;  3AI5 A;  3SV5 A;  1RMM A;  5BTT A;  4W6B A;  2ARL A;  2G3O A;  3E5W A;  3SVR A;  3BXA A;  3ST2 A;  1ZGQ A;  2WHU A;  1UBD C;  4W7F A;  4W6M A;  4DXM A;  2WIS A;  5J2O A;  2YRM A;  1XSS A;  1W7S A;  3DQ2 A;  3SSL A;  1A1G A;  1B69 A;  4W6N A;  2DDD A;  3ADF A;  2EMF A;  4H3N A;  2ZO7 A;  4DKM A;  4H47 A;  4W6H A;  2EM9 A;  3SG4 A;  4FK5 C;  2EN6 A;  2AHA A;  4JGE A;  2POX A;  3NEZ A;  2DGC A;  1OXD A;  2Z6Z A;  4R2Q A;  3GB3 A;  1ZGP A;  3ST4 A;  2OGR A;  2A54 B;  3O77 A;  3W1C A;  1MEY C;  3MHS C;  1F2I G;  4ZIO A;  2EN4 A;  3PJ7 A;  1YHG A;  2V4E C;  1TN9 A;  3EVP A;  2EML A;  1Q4E A;  1YHH A;  2H6V A;  4R6D A;  2DUG A;  2IE2 A;  1A1K A;  4KW8 A;  2P4M A;  3U8A A;  3VHT A;  5EHU A;  3GJ2 A;  3EVV A;  5DTL A;  4GES B;  4EMQ A;  1Z1Q A;  2OJK A;  2EQ0 A;  2YTE A;  2YFP A;  2HFC A;  2LCE A;  3CD1 A;  4KGF A;  4H3M A;  2EMD A;  3SG5 A;  3TMR A; 
#chains in the Genus database with same CATH topology
 1OXF A;  2FZU A;  4O24 A;  1YZW A;  2O2B A;  4LJD A;  2HGD A;  2WHS A;  4JC2 A;  3LSA A;  1H6R A;  1QYF A;  2H5P A;  4I2Y A;  4ZFS A;  5LTP A;  3U0L A;  1ZU1 A;  2DIX A;  2EMW A;  2YTF A;  3JTZ A;  1UHZ A;  4N4R B;  2EM7 A;  5IV8 B;  4K0K E;  4OGS A;  5EJU A;  3SVN A;  5KL6 A;  3MHH C;  4LU9 A;  4X62 E;  4ZIN A;  2NUE A;  4KW4 A;  4XOW A;  5AC4 A;  2WSO A;  3DQE A;  3EK7 A;  3ADL A;  2IB6 A;  4DV7 E;  1JC0 A;  3EPH A;  4W6U A;  1EML A;  4JRB A;  1MGT A;  4X66 E;  5KL2 A;  1YHI A;  2F8B A;  3HPZ A;  1HNX E;  2LUP B;  4ANJ A;  2MC6 A;  4ZF5 A;  2EMO A;  4DR2 E;  1KYQ A;  2DUF A;  1WJP A;  2AH8 A;  2H9W A;  2ENH A;  1RQ0 A;  1J26 A;  2HGH A;  3HTX A;  1L4S A;  2LT7 A;  3BXC A;  2EM5 A;  2EN3 A;  5IXM B;  2G6X A;  5DPH A;  4B3M E;  4HVF A;  2K4V A;  3NF0 A;  5LLQ A;  2UUA E;  2VQF E;  3U0M A;  1QU6 A;  2YTD A;  1HNW E;  5CFF E;  4W6R A;  2JXP A;  4F9B B;  1PKP A;  4Q9X A;  4HQ9 A;  5DNY A;  4YHH E;  4MLQ A;  4LF5 E;  2A50 B;  3CBE A;  3PJB A;  2EOS A;  1KYP A;  3DF6 A;  2FL1 A;  3UG0 A;  3W1D A;  2HC5 A;  2DDC A;  5A6B D;  5FLX C;  2MDG A;  3UK3 C;  2WBU A;  1MYW A;  3SS0 A;  2QRF A;  2Q8U A;  2E5L E;  2HQK A;  5HW9 A;  2EPC A;  2WBT A;  2UUC E;  1RRX A;  3DQO A;  2EOI A;  2A48 A;  4KA9 A;  3OSQ A;  2YE0 A;  3CD9 A;  2RS7 A;  1LLM C;  2JOB A;  3DPZ A;  1BFP A;  2H5R A;  4W6G A;  5DPG A;  4DXP A;  1CV7 A;  3IWB A;  4LF8 E;  4W7C A;  2RSI A;  2M1S A;  2L3C A;  4LQU A;  2EOR A;  1YYW A;  5DY6 A;  1RM9 A;  4EUL A;  4PPL A;  1IBK E;  2HJJ A;  2M7Q A;  4W7A A;  4KW9 A;  4LJD C;  2DD7 A;  2ELY A;  3ZUL A;  1QYO A;  3SVE A;  4YY3 E;  4JI5 E;  4DXN A;  2N3G A;  3AKO A;  1Q4B A;  5DQB A;  3U0N A;  2EP3 A;  2L2M A;  5LL6 R;  1W7U A;  4RYS A;  2EMG A;  2R1F A;  4BDU A;  3SG6 A;  1A1H A;  4W6J A;  1NEI A;  2KOU A;  4BCA A;  4WSG A;  2Q6P A;  2QU1 A;  3DQ1 A;  4B5Y A;  2YU5 A;  4JF9 A;  1PJS A;  4F9C B;  5A6B A;  1F0B A;  3J81 C;  2DRP A;  2VVJ A;  4R2C A;  2QZ0 A;  2BB8 A;  3SVU A;  3ST0 A;  4ZB1 A;  1T4N A;  4LF7 E;  2HPW A;  3ADG A;  3SVO A;  4M9V C;  4ZYH A;  2MKN A;  5EXU A;  1MOU A;  1YFP A;  5HGE A;  2ODR D;  3WLD A;  2WCC 3;  1OXE A;  4IK4 A;  2YTN A;  3DQA A;  5T3I A;  2DSY A;  2V83 A;  4IJD A;  4J8Z A;  4JI0 E;  2DUI A;  1YZ9 A;  4R6B A;  4W7X A;  2HQZ A;  4B30 B;  4KWY A;  4TUG A;  4PFE A;  2EM6 A;  2RS6 A;  1A1I A;  1IBL E;  2O29 A;  2A56 B;  4I8O A;  4W6C A;  1GL4 A;  3O78 A;  3CFA A;  2PXS A;  4JI7 E;  1IQO A;  5H87 A;  3SG2 A;  1N36 E;  2YRK A;  3KZY A;  1EH6 A;  4W6D A;  4TZG A;  1WRJ A;  4R03 A;  2EM4 A;  4JEO A;  3DQM A;  2EN7 A;  2EWL A;  2L92 A;  4R2P A;  3DQ9 A;  5LTR A;  3AI4 A;  2ZM6 E;  1GGX A;  2YT4 A;  1BB8 A;  3C6K A;  5FHV A;  1AAY A;  2JAD A;  1YUI A;  2EZ6 A;  1EH8 A;  3KWR A;  4DUZ E;  2AWM A;  1XMO E;  4N3D A;  1EMG A;  3AUZ A;  2EOQ A;  2EPZ A;  4W74 A;  2EPP A;  4IS1 C;  1DQ3 A;  3EKJ A;  5ADZ A;  2RTX A;  4W6F A;  2G3D B;  4KF4 A;  4F54 A;  4W77 A;  2CTD A;  3M22 A;  2EPA A;  2VF1 A;  5A6A A;  4KHP E;  5IWA E;  2L8T A;  5HZT A;  4W7D A;  1XA9 A;  5HZO A;  3DJW A;  3S05 A;  3LF3 A;  1KP5 A;  4DKN A;  1C4F A;  3DQH A;  2AWL A;  3SST A;  3FIG A;  3SG3 A;  3EPL A;  3BX9 A;  2LO3 A;  2QLG B;  4BC9 A;  4KZS A;  3LS3 A;  4DV5 E;  1XAE A;  3VIC A;  2LE2 A;  1KYS A;  4BMJ A;  1YFH A;  3H1O A;  4U2V A;  4MLV A;  2L6M A;  3A8S A;  1WXR A;  4BHB A;  1RMP A;  1JBY A;  4LF4 E;  4ZYE A;  1N32 E;  4AS8 A;  2YRH A;  2EOO A;  4F6N A;  2EPN A;  5HZU A;  3DQ4 A;  1F09 A;  4KEX A;  2GLI A;  4AR7 A;  1STU A;  2EOH A;  2EQ1 A;  2B7T A;  5AE2 A;  1MOV A;  1BBG A;  3KCT A;  2YPN A;  3HPS A;  1Z1B A;  1HNZ E;  4LJC A;  1EMB A;  3CFH A;  5LMN E;  4JI8 E;  2E1M A;  2UU9 E;  2M9A A;  4P1Q A;  3EK4 A;  3ZOQ B;  3JAM C;  2NA2 A;  2GX0 A;  4W73 A;  3DQD A;  3TMT A;  5A6J A;  4RH8 A;  5LMU E;  2IB5 A;  2OKW A;  2UXB E;  1EMA A;  2YDZ A;  1PJQ A;  2JWO A;  2V87 A;  2L2N A;  4DV6 E;  1A1F A;  1ZGO A;  3CGL A;  1JK1 A;  2M4I A;  1YYK A;  2LMZ A;  3DQC A;  3K6Q A;  2EMN A;  4DR1 E;  2L2K B;  4EDO A;  3OML A;  2C9J A;  4J89 A;  2OTB A;  3DQU A;  1DGC A;  3CB9 A;  2JP9 A;  2L3J A;  4GKJ E;  3LML A;  5KTG A;  2ODR C;  2EOY A;  2J7J A;  2EPR A;  3DQJ A;  2DUE A;  3P8U A;  3DQ8 A;  5DRF A;  4XGY A;  2JOX A;  1JC1 A;  1SFE A;  3SVC A;  1X48 A;  2EMC A;  5TSE A;  2DD9 A;  2G5Z B;  4TZA A;  4WYQ B;  1X6E A;  4W6P A;  2HGY A;  4F2J C;  4W6S A;  4WSP A;  3ED8 A;  1JBZ A;  2EOX A;  4B30 A;  4OY4 A;  4ZBL A;  1FJG E;  3ECR A;  3I19 A;  2EM8 A;  2UXC E;  3VYX A;  3C4B A;  4LTY A;  1S6Z A;  1HCJ A;  2KHX A;  4Q35 B;  2HRS A;  4UTS A;  5DTZ A;  2EL4 A;  3LVC A;  2RH7 A;  2H36 X;  4H48 A;  3LA1 A;  1X6F A;  5DTY A;  2EMH A;  1KJK A;  3PIB A;  3M24 A;  5EXC I;  4W6I A;  2ZO6 A;  4PPK A;  1IQS A;  3AV0 A;  3EPK A;  4EDS A;  4Q9W A;  2VAE A;  3BXB A;  2YTG A;  5AE3 A;  3V3D A;  2GPI A;  4P7D A;  2UXD E;  2G6Y A;  5DU0 A;  3SSY A;  3LF4 B;  4OJ0 A;  2WBS A;  5F9G A;  4XL5 A;  3IR8 A;  3DPW A;  4B3R E;  2IOV A;  2DMI A;  1X6H A;  2EMY A;  5T6J A;  1TF3 A;  4RYW A;  2YTI A;  3P28 A;  3H1R A;  3DQ6 A;  2AWJ A;  4DV3 E;  1UN6 B;  1QXT A;  4ZF4 A;  4LQT A;  3SSP A;  5FVG A;  4AQY E;  2EMB A;  5EBJ A;  1BBO A;  2OKY A;  3KZZ A;  4WPY A;  4X8W A;  4OQW A;  3ZUJ A;  2B7V A;  4OHS A;  2LJU A;  2YTJ A;  2O24 A;  4OOG C;  4NWS A;  2R76 A;  2EL5 A;  2LUQ A;  4OX9 E;  3NT9 A;  3DQI A;  1WHN A;  4JI3 E;  5LTQ A;  4JI1 E;  1ZR9 A;  1JK2 A;  2GHF A;  2YTO A;  5FVI A;  2V85 A;  3IWD A;  3TQM A;  1A1J A;  4Z4K A;  2EM3 A;  5KL4 A;  3OGO A;  2I13 A;  4LF9 E;  2VRD A;  1UIS A;  5HZS A;  1ZAA C;  4KAG A;  2EMZ A;  1H4U A;  2CPN A;  3OTO E;  2KON A;  4XOV A;  3K1K A;  3VK1 A;  2EOM A;  3VYY A;  3MGF A;  4W7E A;  4ZF3 A;  2YWQ A;  3GEX A;  2VE7 C;  2VVH A;  5LK4 A;  4W6T A;  4DR5 E;  2JPA A;  2WSN A;  1P47 A;  4L13 A;  5BT0 A;  3SRY A;  3SSK A;  3RWT A;  5DPI A;  2YSP A;  3EQ1 A;  2FWQ A;  4H3L A;  2DUH A;  4JFG A;  1EMM A;  3GL4 A;  1X5W A;  2ADR A;  2YE1 A;  2EMA A;  2JR1 A;  4KPI A;  4TUI A;  2GW3 A;  4KF5 A;  2NUG A;  1B9C A;  4IK3 A;  2DB2 A;  2A47 A;  1A1L A;  4GKK E;  1TF6 A;  1ZBT A;  2EN2 A;  2Y0G A;  2EJ4 A;  2JYA A;  4BHC A;  4HQ8 A;  4P76 A;  3U8P A;  4WX9 A;  4X65 E;  2K7I A;  4W6O A;  2V86 A;  2A52 B;  5EB6 A;  4LJB A;  4DXI A;  5AC5 A;  3T1Y E;  5A6K A;  4DXQ A;  2ENC A;  2EQ3 A;  3BID A;  1UIL A;  2V8Q B;  2B3P A;  3DQF A;  5DTX A;  2HHH E;  4IK8 A;  2FTX B;  4HE4 A;  4J8A A;  3ST3 A;  2G7H A;  4DMI A;  4M2Z A;  2HCG A;  2C9I A;  4LFA E;  2Z6Y A;  1GZ6 A;  1ZUX A;  3EVR A;  3NT3 A;  1Q4C A;  2EOJ A;  5KL3 A;  4Q7R A;  4Z4M A;  1G2D C;  2A53 B;  4DUY E;  3VK6 A;  2V4E B;  1X3C A;  5F3W A;  1GFL A;  2HJO A;  1G7K A;  3LVD A;  3EVU A;  2B9D A;  3BGH A;  3J7A G;  3KCS A;  1EH7 A;  1EMC A;  2GX2 A;  4HTG A;  2H5O A;  4KGE A;  4DV4 E;  3BF2 A;  4JV5 E;  5AQB B;  3G9A A;  4EN1 A;  2YZT A;  4NXN E;  1Z1P A;  4GOB A;  2EMX A;  2QLE A;  3WLC A;  4F6M A;  2WIQ A;  1YJF A;  1RMD A;  2B3Q A;  2G16 B;  3DQ5 A;  3C6M A;  1IMU A;  4PPJ A;  4DR4 E;  2A25 A;  2FGG A;  2VZX A;  2MC5 A;  3ZTF A;  5BTT B;  2NUF A;  4DV2 E;  3ZUF A;  3THO B;  1HUY A;  3CFF A;  3DQ3 A;  4W6L A;  1YUJ A;  4W6K A;  4KF5 C;  5BQL A;  4XVP A;  4JYA E;  5IT9 C;  5DPJ A;  2EOF A;  5DQM A;  3SSH A;  4J88 A;  4W7R A;  2LBS B;  2RQL A;  3RMP A;  2WHT A;  4LFB E;  3U0K A;  2EE8 A;  3DPX A;  1XQM A;  2ICR A;  3DQN A;  2YSO A;  4Q7U A;  2DLQ A;  2EN1 A;  1SR9 A;  2BBG A;  2H8Q A;  2CT1 A;  4WXC A;  1I94 E;  4IZN A;  2E72 A;  4BS9 A;  2LRS A;  2EN8 A;  3C4T A;  4JI6 E;  2ENA A;  2EM0 A;  1XMZ A;  3EPJ A;  1HR0 E;  1IBM E;  1Q73 A;  4GF6 B;  4IK5 A;  2PXW A;  5H88 A;  3OSR A;  4O43 A;  4DR6 E;  2ZMW A;  2B3T B;  3LVA A;  4W72 A;  1QYQ A;  4R2R A;  4B3S E;  3PJ5 A;  5H89 A;  2AWK A;  2EOZ A;  4NZV A;  5A69 A;  2PRT A;  2Z6X A;  2CSH A;  2QLI A;  2EM2 A;  2LVH A;  5KL7 A;  4HQC A;  2EOE A;  4RTC A;  2L33 A;  2ELZ A;  3VHT B;  4F9A B;  1EME A;  1PJT A;  1QY3 A;  4Q7T A;  2DMY A;  2NAB A;  1YYO A;  4W76 A;  1EMK A;  4O5G A;  3UFZ A;  3H09 A;  2DLK A;  3BBG A;  4W69 A;  2GW4 B;  1NCS A;  1DI2 A;  3T1H E;  2BTJ A;  5BR8 E;  2EPU A;  4L1I A;  4RHB B;  2YTP A;  3DQL A;  4L12 A;  2YU8 A;  4WXD A;  1Q4D A;  3JU0 A;  3RWA A;  5AAS A;  1RC7 A;  5EB7 A;  5HBD A;  2EMI A;  1AH5 A;  2LV2 A;  2MDR A;  2Z1O A;  1RMO A;  3HQ1 A;  1J5E E;  1YSA C;  3EKH A;  4WFT A;  2RPC A;  2EPK X;  1X49 A;  2N8X A;  3DQK A;  2G6E A;  4IK1 A;  4W75 A;  1O0W A;  2QLG A;  4DXO A;  2H5Q A;  3E5V A;  4W6A A;  2VAD A;  2Q57 A;  3E5T A;  1ZBQ A;  2MKD A;  2RSM A;  3QG5 C;  2OTE A;  3SVD A;  2D9H A;  3M99 B;  4L5N C;  4LW5 A;  3SVB A;  4IK9 A;  1N33 E;  2ZMU A;  5FVF A;  1YJ2 A;  4DR7 E;  2V4E A;  2EPO A;  4B3T E;  1EMF A;  4LFC E;  2N3H A;  3IP2 A;  2A46 A;  5EXB A;  4L8N A;  4R2S A;  4R2A A;  3EK8 A;  5DRG A;  2EL6 A;  4BBY A;  2G2S B;  3GJ1 A;  5KL5 A;  1XNQ E;  4R2E A;  3F6G A;  3SSV A;  2VVI A;  1G2F C;  3NED A;  3SG7 A;  3U8C A;  2QLH A;  4ORN A;  4GZN C;  4DV0 E;  1Q4A A;  2EMK A;  2WUR A;  4P78 A;  4R2D A;  4DR3 E;  4X9J A;  3SVS A;  1W7T A;  2YTQ A;  1KYR A;  2QT2 A;  2EPX A;  3WCK A;  2LTR A;  4NXM E;  1T4L B;  3DQ7 A;  3AI5 A;  1T38 A;  1T39 A;  4X64 E;  3SV5 A;  1RMM A;  5BTT A;  4W6B A;  2ARL A;  2EPM X;  1XMQ E;  2G3O A;  3E5W A;  3SVR A;  3BXA A;  3ST2 A;  4ZYG A;  4M0V A;  1ZGQ A;  2WZO A;  2WHU A;  2F4V E;  1T4O A;  1UBD C;  1WHQ A;  1N3G A;  4W7F A;  1EKZ A;  4W6M A;  4DXM A;  2V89 A;  4DKK A;  2WIS A;  4R8O A;  5J2O A;  2YRM A;  1XSS A;  1W7S A;  3DQ2 A;  3SSL A;  4NHR A;  4Q28 A;  1A1G A;  2EPL X;  4GEQ B;  1B69 A;  2LTS A;  2V88 A;  4W6N A;  4JI2 E;  2DDD A;  3ADF A;  2UUB E;  2EMF A;  4H3N A;  2ZO7 A;  1X47 A;  4HEI A;  3L00 A;  1GTK A;  4DKM A;  3HXL A;  4H47 A;  1GQE A;  4W6H A;  2EM9 A;  1QNT A;  3SG4 A;  4FK5 C;  2EN6 A;  2AHA A;  3J80 C;  4JGE A;  2POX A;  3NEZ A;  2DGC A;  1OXD A;  2LJH A;  4ZYD A;  4BC7 A;  3ADI A;  4M30 A;  2Z6Z A;  3ADJ A;  3GB3 A;  4R2Q A;  1ZGP A;  3ST4 A;  4JI4 E;  2OGR A;  2A54 B;  3O77 A;  2JY9 A;  2IHR 1;  3W1C A;  1PDA A;  2JVA A;  3MHS C;  1MEY C;  1F2I G;  4ZIO A;  2EN4 A;  3PJ7 A;  1YHG A;  2V4E C;  2VQE E;  3EVP A;  1TN9 A;  2EML A;  3F6H A;  1FKA E;  1Q4E A;  1YPN A;  1YHH A;  2H6V A;  1N34 E;  4R6D A;  2DUG A;  2IE2 A;  3J7Y p;  1A1K A;  4KW8 A;  2P4M A;  3U8A A;  3THN A;  3VHT A;  5EHU A;  3GJ2 A;  2I9I A;  3EVV A;  5DTL A;  4GES B;  4EMQ A;  2FV4 B;  1Z1Q A;  5A2Q C;  4DV1 E;  4LF6 E;  1XNR E;  2OJK A;  2EQ0 A;  2YTE A;  2YFP A;  3IWC A;  2HFC A;  3LLH A;  3MSW A;  2LCE A;  4O4K A;  3CD1 A;  5AE1 A;  4KGF A;  3P1X A;  4H3M A;  2EMD A;  3SG5 A;  3TMR A; 
#chains in the Genus database with same CATH homology
 1OXF A;  2FZU A;  1YZW A;  2O2B A;  4LJD A;  2HGD A;  2WHS A;  4JC2 A;  3LSA A;  1H6R A;  1QYF A;  2H5P A;  4I2Y A;  4ZFS A;  5LTP A;  3U0L A;  1ZU1 A;  2EMW A;  2YTF A;  2EM7 A;  4OGS A;  5EJU A;  3SVN A;  5KL6 A;  3MHH C;  4ZIN A;  4KW4 A;  4XOW A;  2WSO A;  3DQE A;  3EK7 A;  2IB6 A;  1JC0 A;  3EPH A;  4W6U A;  1EML A;  4JRB A;  5KL2 A;  1YHI A;  4ANJ A;  4ZF5 A;  2EMO A;  2DUF A;  1WJP A;  2AH8 A;  2H9W A;  2ENH A;  2HGH A;  2LT7 A;  3BXC A;  2EM5 A;  2EN3 A;  2G6X A;  5DPH A;  4HVF A;  3NF0 A;  3U0M A;  2YTD A;  4W6R A;  4Q9X A;  4HQ9 A;  2A50 B;  3CBE A;  3PJB A;  2EOS A;  1KYP A;  1YUJ A;  2FL1 A;  3UG0 A;  3W1D A;  2DDC A;  2MDG A;  3UK3 C;  2WBU A;  1MYW A;  3SS0 A;  2QRF A;  2HQK A;  5HW9 A;  2EPC A;  2WBT A;  1RRX A;  3DQO A;  2EOI A;  2A48 A;  4KA9 A;  3OSQ A;  2YE0 A;  3CD9 A;  1LLM C;  3DPZ A;  1BFP A;  2H5R A;  4W6G A;  5DPG A;  4DXP A;  1CV7 A;  4W7C A;  2RSI A;  4LQU A;  2EOR A;  5DY6 A;  1RM9 A;  4EUL A;  4PPL A;  4W7A A;  4KW9 A;  4LJD C;  2DD7 A;  2ELY A;  3ZUL A;  1QYO A;  3SVE A;  4DXN A;  3AKO A;  1Q4B A;  5DQB A;  3U0N A;  2EP3 A;  1W7U A;  4RYS A;  2EMG A;  2R1F A;  4BDU A;  3SG6 A;  1A1H A;  4W6J A;  4WSG A;  2Q6P A;  2QU1 A;  3DQ1 A;  4B5Y A;  2YU5 A;  4JF9 A;  2DRP A;  1F0B A;  2VVJ A;  4R2C A;  2QZ0 A;  2BB8 A;  3SVU A;  3ST0 A;  4ZB1 A;  2HPW A;  3SVO A;  4M9V C;  2MKN A;  5EXU A;  1MOU A;  1YFP A;  5HGE A;  3WLD A;  2WCC 3;  1OXE A;  4IK4 A;  2YTN A;  3DQA A;  5T3I A;  4IJD A;  2DUI A;  4R6B A;  4W7X A;  2HQZ A;  4B30 B;  4PFE A;  2EM6 A;  1A1I A;  2O29 A;  2A56 B;  4W6C A;  1GL4 A;  3O78 A;  3CFA A;  2PXS A;  5H87 A;  3SG2 A;  2YRK A;  4W6D A;  4TZG A;  2EM4 A;  4JEO A;  3DQM A;  2EN7 A;  4R2P A;  3DQ9 A;  5LTR A;  3AI4 A;  1GGX A;  1BB8 A;  5FHV A;  1AAY A;  2JAD A;  1YUI A;  2AWM A;  4N3D A;  1EMG A;  4IS1 C;  2EOQ A;  2EPZ A;  4W74 A;  2EPP A;  3EKJ A;  4W6F A;  2G3D B;  4KF4 A;  4W77 A;  2CTD A;  3M22 A;  2EPA A;  5HZT A;  4W7D A;  1XA9 A;  5HZO A;  3S05 A;  3LF3 A;  1KP5 A;  4DKN A;  1C4F A;  3DQH A;  2AWL A;  3SST A;  3SG3 A;  3EPL A;  3BX9 A;  2LO3 A;  2QLG B;  3LS3 A;  1XAE A;  3VIC A;  1KYS A;  3H1O A;  4U2V A;  3A8S A;  1RMP A;  1JBY A;  4AS8 A;  2YRH A;  2EOO A;  4F6N A;  5HZU A;  3DQ4 A;  1F09 A;  4KEX A;  2GLI A;  4AR7 A;  2EOH A;  2EQ1 A;  1MOV A;  3KCT A;  1Z1B A;  4LJC A;  1EMB A;  3CFH A;  2M9A A;  4P1Q A;  3EK4 A;  2GX0 A;  4W73 A;  3DQD A;  3TMT A;  2IB5 A;  2OKW A;  1EMA A;  2YDZ A;  1A1F A;  1ZGO A;  3CGL A;  1JK1 A;  3DQC A;  2EMN A;  4EDO A;  2C9J A;  4J89 A;  2OTB A;  3DQU A;  1DGC A;  3CB9 A;  2JP9 A;  5KTG A;  2EOY A;  2J7J A;  2EPR A;  3DQJ A;  2DUE A;  3P8U A;  3DQ8 A;  5DRF A;  4XGY A;  1JC1 A;  3SVC A;  2EMC A;  2DD9 A;  2G5Z B;  4TZA A;  1X6E A;  4W6P A;  2HGY A;  4F2J C;  4W6S A;  3ED8 A;  1JBZ A;  2EOX A;  4B30 A;  4OY4 A;  4ZBL A;  3I19 A;  2EM8 A;  1S6Z A;  1HCJ A;  2HRS A;  4UTS A;  5DTZ A;  2EL4 A;  3LVC A;  2RH7 A;  4H48 A;  3LA1 A;  1X6F A;  5DTY A;  2EMH A;  1KJK A;  3PIB A;  3M24 A;  5EXC I;  4W6I A;  2ZO6 A;  4PPK A;  3EPK A;  4EDS A;  4Q9W A;  2VAE A;  3BXB A;  2YTG A;  3V3D A;  2G6Y A;  5DU0 A;  3SSY A;  3LF4 B;  4OJ0 A;  2WBS A;  5F9G A;  4XL5 A;  3IR8 A;  3DPW A;  2IOV A;  2DMI A;  1X6H A;  2EMY A;  1TF3 A;  4RYW A;  2YTI A;  3P28 A;  3H1R A;  3DQ6 A;  2AWJ A;  1UN6 B;  1QXT A;  4ZF4 A;  4LQT A;  3SSP A;  5FVG A;  2EMB A;  5EBJ A;  1BBO A;  2OKY A;  4OQW A;  3ZUJ A;  4OHS A;  2YTJ A;  2O24 A;  4NWS A;  2EL5 A;  3NT9 A;  3DQI A;  5LTQ A;  1ZR9 A;  1JK2 A;  2GHF A;  2YTO A;  5FVI A;  1A1J A;  2I13 A;  4Z4K A;  2EM3 A;  5KL4 A;  3OGO A;  2VRD A;  1UIS A;  5HZS A;  1ZAA C;  4KAG A;  2EMZ A;  1H4U A;  4XOV A;  3K1K A;  3VK1 A;  2EOM A;  3MGF A;  4W7E A;  4ZF3 A;  3GEX A;  2VVH A;  5LK4 A;  4W6T A;  2JPA A;  2WSN A;  1P47 A;  4L13 A;  5BT0 A;  3SRY A;  3SSK A;  3RWT A;  5DPI A;  2YSP A;  2FWQ A;  4H3L A;  2DUH A;  4JFG A;  1EMM A;  3GL4 A;  1X5W A;  2ADR A;  2YE1 A;  2EMA A;  4KPI A;  2GW3 A;  4KF5 A;  1B9C A;  4IK3 A;  1A1L A;  2A47 A;  1TF6 A;  2EN2 A;  2Y0G A;  2EJ4 A;  4HQ8 A;  4P76 A;  3U8P A;  4W6O A;  2A52 B;  5EB6 A;  4LJB A;  4DXI A;  4DXQ A;  2ENC A;  2EQ3 A;  2B3P A;  3DQF A;  5DTX A;  4IK8 A;  4HE4 A;  4J8A A;  3ST3 A;  2HCG A;  2C9I A;  2Z6Y A;  1ZUX A;  3EVR A;  3NT3 A;  1Q4C A;  2EOJ A;  5KL3 A;  4Q7R A;  4Z4M A;  1G2D C;  2A53 B;  2V4E B;  1X3C A;  1GFL A;  2HJO A;  1G7K A;  3LVD A;  3EVU A;  3KCS A;  1EMC A;  2GX2 A;  2H5O A;  4KGE A;  5AQB B;  3G9A A;  4EN1 A;  1Z1P A;  4GOB A;  2EMX A;  2QLE A;  3WLC A;  4F6M A;  2WIQ A;  1YJF A;  1RMD A;  2B3Q A;  2G16 B;  3DQ5 A;  4PPJ A;  2A25 A;  2VZX A;  3ZTF A;  5BTT B;  3ZUF A;  1HUY A;  3CFF A;  3DQ3 A;  4W6L A;  4W6K A;  4KF5 C;  5BQL A;  4XVP A;  5DPJ A;  2EOF A;  5DQM A;  3SSH A;  4J88 A;  4W7R A;  2WHT A;  3U0K A;  2EE8 A;  3DPX A;  1XQM A;  2ICR A;  3DQN A;  2YSO A;  4Q7U A;  2DLQ A;  2EN1 A;  2H8Q A;  2CT1 A;  4IZN A;  2E72 A;  2EN8 A;  2ENA A;  2EM0 A;  1XMZ A;  3EPJ A;  1Q73 A;  4GF6 B;  4IK5 A;  2PXW A;  5H88 A;  3OSR A;  2ZMW A;  3LVA A;  4W72 A;  1QYQ A;  4R2R A;  3PJ5 A;  5H89 A;  2AWK A;  2EOZ A;  2PRT A;  2Z6X A;  2CSH A;  2QLI A;  2EM2 A;  2LVH A;  5KL7 A;  4HQC A;  2EOE A;  4RTC A;  2ELZ A;  3VHT B;  1EME A;  1QY3 A;  4Q7T A;  2NAB A;  4W76 A;  1EMK A;  3UFZ A;  2DLK A;  4W69 A;  2GW4 B;  1NCS A;  2BTJ A;  2EPU A;  4L1I A;  2YTP A;  3DQL A;  4L12 A;  2YU8 A;  1Q4D A;  3RWA A;  5EB7 A;  5HBD A;  2EMI A;  2LV2 A;  2Z1O A;  1RMO A;  1YSA C;  3EKH A;  2RPC A;  3DQK A;  2G6E A;  4IK1 A;  4W75 A;  2QLG A;  4DXO A;  2H5Q A;  3E5V A;  4W6A A;  2VAD A;  2Q57 A;  3E5T A;  2MKD A;  2OTE A;  3SVD A;  2D9H A;  3M99 B;  4LW5 A;  3SVB A;  4IK9 A;  2ZMU A;  5FVF A;  1YJ2 A;  2V4E A;  1EMF A;  3IP2 A;  2A46 A;  5EXB A;  4R2S A;  4R2A A;  3EK8 A;  5DRG A;  2EL6 A;  2G2S B;  3GJ1 A;  5KL5 A;  4R2E A;  3SSV A;  2VVI A;  1G2F C;  3NED A;  3SG7 A;  3U8C A;  2QLH A;  4ORN A;  4GZN C;  1Q4A A;  2EMK A;  2WUR A;  4R2D A;  4X9J A;  3SVS A;  1W7T A;  2YTQ A;  1KYR A;  2QT2 A;  2EPX A;  3WCK A;  3DQ7 A;  3AI5 A;  3SV5 A;  1RMM A;  5BTT A;  4W6B A;  2ARL A;  2G3O A;  3E5W A;  3SVR A;  3BXA A;  3ST2 A;  1ZGQ A;  2WHU A;  1UBD C;  4W7F A;  4W6M A;  4DXM A;  2WIS A;  5J2O A;  2YRM A;  1XSS A;  1W7S A;  3DQ2 A;  3SSL A;  1A1G A;  1B69 A;  4W6N A;  2DDD A;  3ADF A;  2EMF A;  4H3N A;  2ZO7 A;  4DKM A;  4H47 A;  4W6H A;  2EM9 A;  3SG4 A;  4FK5 C;  2EN6 A;  2AHA A;  4JGE A;  2POX A;  3NEZ A;  2DGC A;  1OXD A;  2Z6Z A;  4R2Q A;  3GB3 A;  1ZGP A;  3ST4 A;  2OGR A;  2A54 B;  3O77 A;  3W1C A;  1MEY C;  3MHS C;  1F2I G;  4ZIO A;  2EN4 A;  3PJ7 A;  1YHG A;  2V4E C;  1TN9 A;  3EVP A;  2EML A;  1Q4E A;  1YHH A;  2H6V A;  4R6D A;  2DUG A;  2IE2 A;  1A1K A;  4KW8 A;  2P4M A;  3U8A A;  3VHT A;  5EHU A;  3GJ2 A;  3EVV A;  5DTL A;  4GES B;  4EMQ A;  1Z1Q A;  2OJK A;  2EQ0 A;  2YTE A;  2YFP A;  2HFC A;  2LCE A;  3CD1 A;  4KGF A;  4H3M A;  2EMD A;  3SG5 A;  3TMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...