5BTTA

Switching gfp fluorescence using genetically encoded phenyl azide chemistry through two different non-native post-translational modifications routes at the same position.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
226
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Molecular basis for functional switching of GFP by two disparate non-native post-translational modifications of a phenyl azide reaction handle.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 61
structure length 226
sequence length 228
ec nomenclature
pdb deposition date 2015-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5bttA00
2OTEA 3ZUJA 1KYSA 2FWQA 5T3IA 2WHSA 1EMBA 2HGDA 5EXBA 5HW9A 1GFLA 1OXEA 4PPLA 3U8CA 2VVJA 2HQZA 1KYRA 2QZ0A 5KTGA 1YHIA 5HGEA 3DQKA 4W77A 3NEZA 3SG2A 5DRFA 3DQOA 4OQWA 2HPWA 2YE1A 1EMCA 3BX9A 3GJ2A 4EDSA 3WLCA 3SVSA 2RH7A 3AKOA 1QXTA 2ZO6A 3CB9A 2QT2A 2QLHA 1G7KA 4XOVA 4W6JA 5FVGA 1XQMA 3ADFA 4IK4A 3ST0A 4W6SA 3SVBA 3CD1A 2QLGB 2Z6YA 1EMFA 3P8UA 5HBDA 2H5RA 3DQ7A 3WLDA 4W7FA 3DQ3A 4TZAA 4EDOA 5DPJA 4KF4A 4EULA 2HFCA 4IK8A 2G6YA 4RYSA 3UFZA 4H48A 4W6UA 2Z6ZA 3CD9A 3AI5A 4DKMA 2VZXA 2VAEA 3DPZA 3OGOA 4RTCA 3SG7A 5H87A 4EMQA 1B9CA 3SSLA 3SVRA 2DDCA 3GB3A 4IK1A 2WHUA 3DQNA 3SV5A 1C4FA 3K1KA 1ZGPA 2G6EA 3SG6A 3P28A 3SG3A 1KYPA 4W6LA 5LTQA 1F09A 1EMGA 2POXA 2YFPA 2VVIA 1W7UA 5DTZA 3DQIA 2IB5A 4W6PA 3OSRA 4W72A 4GESB 3SSTA 4PPKA 3SRYA 1OXDA 3VK1A 2OJKA 2A54B 2DUHA 3PJ7A 3DPWA 4L12A 2EMOA 2G2SB 5EB7A 4W6TA 1EMMA 2DDDA 1RRXA 4DXNA 3SVEA 2A46A 3RWTA 2OGRA 1RMPA 2PXWA 3ZUFA 3LS3A 5EB6A 1RM9A 4OGSA 3SSYA 1Q4DA 1KP5A 1UISA 4B5YA 4RYWA 2A47A 4ZINA 4ZFSA 5DQBA 2V4EC 2EMDA 3CGLA 3NT3A 4HQ8A 2ARLA 2IE2A 2O2BA 3SSKA 4W7EA 3KCTA 4ZF3A 2G3DB 3LSAA 4W73A 4IZNA 4W6CA 1CV7A 2WSOA 4W6HA 3DQ1A 2A50B 4JRBA 3NT9A 4LJBA 1QYQA 1YHGA 3SG4A 2VADA 4XL5A 4JFGA 3E5TA 4KA9A 5DPGA 5LK4A 3LA1A 1BFPA 2AWJA 2BTJA 2HJOA 3EK7A 1Q73A 3O77A 2HQKA 4NWSA 4W6NA 3DQHA 4HQ9A 4W74A 1QYFA 3UG0A 1H6RA 4GF6B 4LW5A 2A52B 2ICRA 4B30A 4ZIOA 3PJ5A 1JBZA 4OJ0A 3DQ4A 4IK9A 2DUIA 4W6BA 3LF3A 1RMOA 1Q4EA 1JBYA 1JC1A 4Q9XA 3S05A 4XGYA 2OKWA 3NF0A 3W1DA 1QYOA 4JEOA 2Y0GA 4P1QA 5BT0A 2O24A 4W76A 2H5OA 5EXCI 3ST3A 3VHTA 4W6KA 4OY4A 1EMLA 5H88A 3SVUA 1H4UA 2G16B 3SVCA 5LTPA 4ZF5A 3H1RA 3U0MA 2AH8A 2H9WA 1YFPA 4U2VA 2EMNA 5DU0A 1YHHA 3LVAA 4Q9WA 4XVPA 5FVFA 3TMTA 3VICA 2P4MA 1GL4A 4Q7UA 4R6DA 3OSQA 3DQJA 4W6DA 3PJBA 4DXQA 4ZF4A 5HZTA 2WHTA 5AQBB 4LJDC 3EK8A 5EHUA 5HZSA 1Q4BA 2IOVA 3EKHA 3CFFA 4W7AA 4J89A 5FVIA 1XMZA 4B30B 3O78A 3DPXA 3WCKA 2PXSA 3BXAA 5HZUA 5BTTA 2WIQA 1EMEA 4W7DA 4JF9A 3DQUA 3LVCA 2ZMWA 4KF5A 3DQ2A 1Q4AA 4ZB1A 1S6ZA 2OTBA 3DQ6A 5J2OA 4Z4KA 2Z1OA 1OXFA 3DQEA 3CFAA 3TMRA 2OKYA 5EBJA 3DQFA 1MOVA 2IB6A 2DUEA 3DQ8A 4UTSA 3SVDA 3DQ5A 1MYWA 1ZGOA 4H3NA 4KPIA 4J88A 2GX2A 2A56B 4ORNA 4KGFA 1RMMA 4KEXA 2WISA 4W69A 2GX0A 4PFEA 4DXPA 5F9GA 4BDUA 3CFHA 1Z1QA 1HUYA 4R6BA 2GW4B 4P76A 3DQLA 3KCSA 3AI4A 5FHVA 4W6IA 2QLIA 2H8QA 2HGYA 4W6RA 3W1CA 1XA9A 4W6GA 3BXBA 4L13A 4L1IA 5BTTB 1GGXA 3EKJA 1QY3A 3EVVA 2QLEA 1EMKA 4W75A 2G5ZB 4DXMA 1YJ2A 1Z1PA 5DRGA 4W6MA 4W6OA 2GW3A 5DTLA 3LF4B 3MGFA 3SG5A 3SS0A 5H89A 5DPIA 2DUGA 4HE4A 2V4EA 5DY6A 5BQLA 2HRSA 4OHSA 2H5QA 4AS8A 2B3PA 3M24A 4KW9A 4HQCA 4W7XA 5DQMA 3DQ9A 2DD9A 2VVHA 4KW4A 4KW8A 5DPHA 3U0KA 4H47A 3ED8A 3DQMA 4J8AA 3ZULA 3EVRA 5EXUA 4H3LA 4KAGA 4KF5C 4IK3A 3IR8A 2AWMA 4Q7TA 4H3MA 3I19A 3DQCA 2AHAA 4ZBLA 3E5VA 2QU1A 4AR7A 2DUFA 2DD7A 3BXCA 3LVDA 4I2YA 3ZTFA 4W7CA 3EK4A 2ZMUA 3U8PA 3U0LA 2G3OA 4W7RA 3SVNA 3PIBA 3ST2A 4IK5A 4DKNA 2ZO7A 2Q57A 3V3DA 4DXIA 1W7TA 3A8SA 4HVFA 2WURA 3M22A 4W6AA 3IP2A 3SSVA 1Q4CA 3G9AA 2AWLA 4W6FA 2FZUA 2A48A 2Q6PA 4LQTA 1JC0A 2G6XA 3EVPA 1XAEA 1W7SA 3H1OA 3GL4A 2C9JA 3NEDA 2WSNA 2HCGA 2V4EB 5DTXA 3U8AA 4N3DA 4Q7RA 1ZUXA 2H5PA 2YDZA 4Z4MA 5EJUA 2H6VA 4PPJA 4DXOA 1ZGQA 3U0NA 5HZOA 2AWKA 1MOUA 2Z6XA 2QRFA 3VHTB 3SSHA 3GEXA 1YZWA 1HCJA 3DQDA 3DQAA 4JGEA 2QLGA 4TZGA 3E5WA 3GJ1A 1EMAA 2C9IA 4GOBA 4LQUA 1F0BA 4KGEA 4LJDA 2B3QA 2O29A 4EN1A 2FL1A 3ST4A 3SSPA 1YJFA 3CBEA 3SVOA 4JC2A 4XOWA 1XSSA 2YE0A 2JADA 4LJCA 2A53B 3RWAA 5DTYA 4ANJA 5LTRA 3EVUA
chains in the Genus database with same CATH superfamily
2OTEA 3ZUJA 1KYSA 2FWQA 5T3IA 2WHSA 1EMBA 2HGDA 5EXBA 5HW9A 1GFLA 1OXEA 4PPLA 3U8CA 2VVJA 2HQZA 1KYRA 2QZ0A 5KTGA 1YHIA 5HGEA 3DQKA 4W77A 3NEZA 3SG2A 5DRFA 3DQOA 4OQWA 2HPWA 2YE1A 1EMCA 3BX9A 3GJ2A 4EDSA 3WLCA 3SVSA 2RH7A 3AKOA 1QXTA 2ZO6A 3CB9A 2QT2A 2QLHA 1G7KA 4XOVA 4W6JA 5FVGA 1XQMA 3ADFA 4IK4A 3ST0A 4W6SA 3SVBA 3CD1A 2QLGB 2Z6YA 1EMFA 3P8UA 5HBDA 2H5RA 3DQ7A 3WLDA 4W7FA 3DQ3A 4TZAA 4EDOA 5DPJA 4KF4A 4EULA 2HFCA 4IK8A 2G6YA 4RYSA 3UFZA 4H48A 4W6UA 2Z6ZA 3CD9A 3AI5A 4DKMA 2VZXA 2VAEA 3DPZA 3OGOA 4RTCA 3SG7A 5H87A 4EMQA 1B9CA 3SSLA 3SVRA 2DDCA 3GB3A 4IK1A 2WHUA 3DQNA 3SV5A 1C4FA 3K1KA 1ZGPA 2G6EA 3SG6A 3P28A 3SG3A 1KYPA 4W6LA 5LTQA 1F09A 1EMGA 2POXA 2YFPA 2VVIA 1W7UA 5DTZA 3DQIA 2IB5A 4W6PA 3OSRA 4W72A 4GESB 3SSTA 4PPKA 3SRYA 1OXDA 3VK1A 2OJKA 2A54B 2DUHA 3PJ7A 3DPWA 4L12A 2EMOA 2G2SB 5EB7A 4W6TA 1EMMA 2DDDA 1RRXA 4DXNA 3SVEA 2A46A 3RWTA 2OGRA 1RMPA 2PXWA 3ZUFA 3LS3A 5EB6A 1RM9A 4OGSA 3SSYA 1Q4DA 1KP5A 1UISA 4B5YA 4RYWA 2A47A 4ZINA 4ZFSA 5DQBA 2V4EC 2EMDA 3CGLA 3NT3A 4HQ8A 2ARLA 2IE2A 2O2BA 3SSKA 4W7EA 3KCTA 4ZF3A 2G3DB 3LSAA 4W73A 4IZNA 4W6CA 1CV7A 2WSOA 4W6HA 3DQ1A 2A50B 4JRBA 3NT9A 4LJBA 1QYQA 1YHGA 3SG4A 2VADA 4XL5A 4JFGA 3E5TA 4KA9A 5DPGA 5LK4A 3LA1A 1BFPA 2AWJA 2BTJA 2HJOA 3EK7A 1Q73A 3O77A 2HQKA 4NWSA 4W6NA 3DQHA 4HQ9A 4W74A 1QYFA 3UG0A 1H6RA 4GF6B 4LW5A 2A52B 2ICRA 4B30A 4ZIOA 3PJ5A 1JBZA 4OJ0A 3DQ4A 4IK9A 2DUIA 4W6BA 3LF3A 1RMOA 1Q4EA 1JBYA 1JC1A 4Q9XA 3S05A 4XGYA 2OKWA 3NF0A 3W1DA 1QYOA 4JEOA 2Y0GA 4P1QA 5BT0A 2O24A 4W76A 2H5OA 5EXCI 3ST3A 3VHTA 4W6KA 4OY4A 1EMLA 5H88A 3SVUA 1H4UA 2G16B 3SVCA 5LTPA 4ZF5A 3H1RA 3U0MA 2AH8A 2H9WA 1YFPA 4U2VA 2EMNA 5DU0A 1YHHA 3LVAA 4Q9WA 4XVPA 5FVFA 3TMTA 3VICA 2P4MA 1GL4A 4Q7UA 4R6DA 3OSQA 3DQJA 4W6DA 3PJBA 4DXQA 4ZF4A 5HZTA 2WHTA 5AQBB 4LJDC 3EK8A 5EHUA 5HZSA 1Q4BA 2IOVA 3EKHA 3CFFA 4W7AA 4J89A 5FVIA 1XMZA 4B30B 3O78A 3DPXA 3WCKA 2PXSA 3BXAA 5HZUA 5BTTA 2WIQA 1EMEA 4W7DA 4JF9A 3DQUA 3LVCA 2ZMWA 4KF5A 3DQ2A 1Q4AA 4ZB1A 1S6ZA 2OTBA 3DQ6A 5J2OA 4Z4KA 2Z1OA 1OXFA 3DQEA 3CFAA 3TMRA 2OKYA 5EBJA 3DQFA 1MOVA 2IB6A 2DUEA 3DQ8A 4UTSA 3SVDA 3DQ5A 1MYWA 1ZGOA 4H3NA 4KPIA 4J88A 2GX2A 2A56B 4ORNA 4KGFA 1RMMA 4KEXA 2WISA 4W69A 2GX0A 4PFEA 4DXPA 5F9GA 4BDUA 3CFHA 1Z1QA 1HUYA 4R6BA 2GW4B 4P76A 3DQLA 3KCSA 3AI4A 5FHVA 4W6IA 2QLIA 2H8QA 2HGYA 4W6RA 3W1CA 1XA9A 4W6GA 3BXBA 4L13A 4L1IA 5BTTB 1GGXA 3EKJA 1QY3A 3EVVA 2QLEA 1EMKA 4W75A 2G5ZB 4DXMA 1YJ2A 1Z1PA 5DRGA 4W6MA 4W6OA 2GW3A 5DTLA 3LF4B 3MGFA 3SG5A 3SS0A 5H89A 5DPIA 2DUGA 4HE4A 2V4EA 5DY6A 5BQLA 2HRSA 4OHSA 2H5QA 4AS8A 2B3PA 3M24A 4KW9A 4HQCA 4W7XA 5DQMA 3DQ9A 2DD9A 2VVHA 4KW4A 4KW8A 5DPHA 3U0KA 4H47A 3ED8A 3DQMA 4J8AA 3ZULA 3EVRA 5EXUA 4H3LA 4KAGA 4KF5C 4IK3A 3IR8A 2AWMA 4Q7TA 4H3MA 3I19A 3DQCA 2AHAA 4ZBLA 3E5VA 2QU1A 4AR7A 2DUFA 2DD7A 3BXCA 3LVDA 4I2YA 3ZTFA 4W7CA 3EK4A 2ZMUA 3U8PA 3U0LA 2G3OA 4W7RA 3SVNA 3PIBA 3ST2A 4IK5A 4DKNA 2ZO7A 2Q57A 3V3DA 4DXIA 1W7TA 3A8SA 4HVFA 2WURA 3M22A 4W6AA 3IP2A 3SSVA 1Q4CA 3G9AA 2AWLA 4W6FA 2FZUA 2A48A 2Q6PA 4LQTA 1JC0A 2G6XA 3EVPA 1XAEA 1W7SA 3H1OA 3GL4A 2C9JA 3NEDA 2WSNA 2HCGA 2V4EB 5DTXA 3U8AA 4N3DA 4Q7RA 1ZUXA 2H5PA 2YDZA 4Z4MA 5EJUA 2H6VA 4PPJA 4DXOA 1ZGQA 3U0NA 5HZOA 2AWKA 1MOUA 2Z6XA 2QRFA 3VHTB 3SSHA 3GEXA 1YZWA 1HCJA 3DQDA 3DQAA 4JGEA 2QLGA 4TZGA 3E5WA 3GJ1A 1EMAA 2C9IA 4GOBA 4LQUA 1F0BA 4KGEA 4LJDA 2B3QA 2O29A 4EN1A 2FL1A 3ST4A 3SSPA 1YJFA 3CBEA 3SVOA 4JC2A 4XOWA 1XSSA 2YE0A 2JADA 4LJCA 2A53B 3RWAA 5DTYA 4ANJA 5LTRA 3EVUA
chains in the Genus database with same CATH topology
2OTEA 3ZUJA 1KYSA 2FWQA 5T3IA 2WHSA 1EMBA 2HGDA 5EXBA 5HW9A 1GFLA 1OXEA 4PPLA 3U8CA 2VVJA 2HQZA 1KYRA 2QZ0A 5KTGA 1YHIA 5HGEA 3DQKA 4W77A 3NEZA 3SG2A 5DRFA 3DQOA 4OQWA 2HPWA 2YE1A 1EMCA 3BX9A 3GJ2A 4EDSA 3WLCA 3SVSA 2RH7A 3AKOA 1QXTA 2ZO6A 3CB9A 2QT2A 2QLHA 1G7KA 4XOVA 4W6JA 5FVGA 1XQMA 3ADFA 4IK4A 3ST0A 4W6SA 3SVBA 3CD1A 2QLGB 2Z6YA 1EMFA 3P8UA 5HBDA 2H5RA 3DQ7A 3WLDA 4W7FA 3DQ3A 4TZAA 4EDOA 5DPJA 4KF4A 4EULA 2HFCA 4IK8A 2G6YA 4RYSA 3UFZA 4H48A 4W6UA 2Z6ZA 3CD9A 3AI5A 4DKMA 2VZXA 2VAEA 3DPZA 3OGOA 4RTCA 3SG7A 5H87A 4EMQA 1B9CA 3SSLA 3SVRA 2DDCA 3GB3A 4IK1A 2WHUA 3DQNA 3SV5A 1C4FA 3K1KA 1ZGPA 2G6EA 3SG6A 3P28A 3SG3A 1KYPA 4W6LA 5LTQA 1F09A 1EMGA 2POXA 2YFPA 2VVIA 1W7UA 5DTZA 3DQIA 2IB5A 4W6PA 3OSRA 4W72A 4GESB 3SSTA 4PPKA 3SRYA 1OXDA 3VK1A 2OJKA 2A54B 2DUHA 3PJ7A 3DPWA 4L12A 2EMOA 2G2SB 5EB7A 4W6TA 1EMMA 2DDDA 1RRXA 4DXNA 3SVEA 2A46A 3RWTA 2OGRA 1RMPA 2PXWA 3ZUFA 3LS3A 5EB6A 1RM9A 4OGSA 3SSYA 1Q4DA 1KP5A 1UISA 4B5YA 4RYWA 2A47A 4ZINA 4ZFSA 5DQBA 2V4EC 2EMDA 3CGLA 3NT3A 4HQ8A 2ARLA 2IE2A 2O2BA 3SSKA 4W7EA 3KCTA 4ZF3A 2G3DB 3LSAA 4W73A 4IZNA 4W6CA 1CV7A 2WSOA 4W6HA 3DQ1A 2A50B 4JRBA 3NT9A 4LJBA 1QYQA 1YHGA 3SG4A 2VADA 4XL5A 4JFGA 3E5TA 4KA9A 5DPGA 5LK4A 3LA1A 1BFPA 2AWJA 2BTJA 2HJOA 3EK7A 1Q73A 3O77A 2HQKA 4NWSA 4W6NA 3DQHA 4HQ9A 4W74A 1QYFA 3UG0A 1H6RA 4GF6B 4LW5A 2A52B 2ICRA 4B30A 4ZIOA 3PJ5A 1JBZA 4OJ0A 3DQ4A 4IK9A 2DUIA 4W6BA 3LF3A 1RMOA 1Q4EA 1JBYA 1JC1A 4Q9XA 3S05A 4XGYA 2OKWA 3NF0A 3W1DA 1QYOA 4JEOA 2Y0GA 4P1QA 5BT0A 2O24A 4W76A 2H5OA 5EXCI 3ST3A 3VHTA 4W6KA 4OY4A 1EMLA 5H88A 3SVUA 1H4UA 2G16B 3SVCA 5LTPA 4ZF5A 3H1RA 3U0MA 2AH8A 2H9WA 1YFPA 4U2VA 2EMNA 5DU0A 1YHHA 3LVAA 4Q9WA 4XVPA 5FVFA 3TMTA 3VICA 2P4MA 1GL4A 4Q7UA 4R6DA 3OSQA 3DQJA 4W6DA 3PJBA 4DXQA 4ZF4A 5HZTA 2WHTA 5AQBB 4LJDC 3EK8A 5EHUA 5HZSA 1Q4BA 2IOVA 3EKHA 3CFFA 4W7AA 4J89A 5FVIA 1XMZA 4B30B 3O78A 3DPXA 3WCKA 2PXSA 3BXAA 5HZUA 5BTTA 2WIQA 1EMEA 4W7DA 4JF9A 3DQUA 3LVCA 2ZMWA 4KF5A 3DQ2A 1Q4AA 4ZB1A 1S6ZA 2OTBA 3DQ6A 5J2OA 4Z4KA 2Z1OA 1OXFA 3DQEA 3CFAA 3TMRA 2OKYA 5EBJA 3DQFA 1MOVA 2IB6A 2DUEA 3DQ8A 4UTSA 3SVDA 3DQ5A 1MYWA 1ZGOA 4H3NA 4KPIA 4J88A 2GX2A 2A56B 4ORNA 4KGFA 1RMMA 4KEXA 2WISA 4W69A 2GX0A 4PFEA 4DXPA 5F9GA 4BDUA 3CFHA 1Z1QA 1HUYA 4R6BA 2GW4B 4P76A 3DQLA 3KCSA 3AI4A 5FHVA 4W6IA 2QLIA 2H8QA 2HGYA 4W6RA 3W1CA 1XA9A 4W6GA 3BXBA 4L13A 4L1IA 5BTTB 1GGXA 3EKJA 1QY3A 3EVVA 2QLEA 1EMKA 4W75A 2G5ZB 4DXMA 1YJ2A 1Z1PA 5DRGA 4W6MA 4W6OA 2GW3A 5DTLA 3LF4B 3MGFA 3SG5A 3SS0A 5H89A 5DPIA 2DUGA 4HE4A 2V4EA 5DY6A 5BQLA 2HRSA 4OHSA 2H5QA 4AS8A 2B3PA 3M24A 4KW9A 4HQCA 4W7XA 5DQMA 3DQ9A 2DD9A 2VVHA 4KW4A 4KW8A 5DPHA 3U0KA 4H47A 3ED8A 3DQMA 4J8AA 3ZULA 3EVRA 5EXUA 4H3LA 4KAGA 4KF5C 4IK3A 3IR8A 2AWMA 4Q7TA 4H3MA 3I19A 3DQCA 2AHAA 4ZBLA 3E5VA 2QU1A 4AR7A 2DUFA 2DD7A 3BXCA 3LVDA 4I2YA 3ZTFA 4W7CA 3EK4A 2ZMUA 3U8PA 3U0LA 2G3OA 4W7RA 3SVNA 3PIBA 3ST2A 4IK5A 4DKNA 2ZO7A 2Q57A 3V3DA 4DXIA 1W7TA 3A8SA 4HVFA 2WURA 3M22A 4W6AA 3IP2A 3SSVA 1Q4CA 3G9AA 2AWLA 4W6FA 2FZUA 2A48A 2Q6PA 4LQTA 1JC0A 2G6XA 3EVPA 1XAEA 1W7SA 3H1OA 3GL4A 2C9JA 3NEDA 2WSNA 2HCGA 2V4EB 5DTXA 3U8AA 4N3DA 4Q7RA 1ZUXA 2H5PA 2YDZA 4Z4MA 5EJUA 2H6VA 4PPJA 4DXOA 1ZGQA 3U0NA 5HZOA 2AWKA 1MOUA 2Z6XA 2QRFA 3VHTB 3SSHA 3GEXA 1YZWA 1HCJA 3DQDA 3DQAA 4JGEA 2QLGA 4TZGA 3E5WA 3GJ1A 1EMAA 2C9IA 4GOBA 4LQUA 1F0BA 4KGEA 4LJDA 2B3QA 2O29A 4EN1A 2FL1A 3ST4A 3SSPA 1YJFA 3CBEA 3SVOA 4JC2A 4XOWA 1XSSA 2YE0A 2JADA 4LJCA 2A53B 3RWAA 5DTYA 4ANJA 5LTRA 3EVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTE A;  3ZUJ A;  1KYS A;  2FWQ A;  5T3I A;  2WHS A;  1EMB A;  2HGD A;  5EXB A;  5HW9 A;  1GFL A;  1OXE A;  4PPL A;  3U8C A;  2VVJ A;  2HQZ A;  1KYR A;  2QZ0 A;  5KTG A;  1YHI A;  5HGE A;  3DQK A;  4W77 A;  3NEZ A;  3SG2 A;  5DRF A;  3DQO A;  4OQW A;  2HPW A;  2YE1 A;  1EMC A;  3BX9 A;  3GJ2 A;  4EDS A;  3WLC A;  3SVS A;  2RH7 A;  3AKO A;  1QXT A;  2ZO6 A;  3CB9 A;  2QT2 A;  2QLH A;  1G7K A;  4XOV A;  4W6J A;  5FVG A;  1XQM A;  3ADF A;  4IK4 A;  3ST0 A;  4W6S A;  3SVB A;  3CD1 A;  2QLG B;  2Z6Y A;  1EMF A;  3P8U A;  5HBD A;  2H5R A;  3DQ7 A;  3WLD A;  4W7F A;  3DQ3 A;  4TZA A;  4EDO A;  5DPJ A;  4KF4 A;  4EUL A;  2HFC A;  4IK8 A;  2G6Y A;  4RYS A;  3UFZ A;  4H48 A;  4W6U A;  2Z6Z A;  3CD9 A;  3AI5 A;  4DKM A;  2VZX A;  2VAE A;  3DPZ A;  3OGO A;  4RTC A;  3SG7 A;  5H87 A;  4EMQ A;  1B9C A;  3SSL A;  3SVR A;  2DDC A;  3GB3 A;  4IK1 A;  2WHU A;  3DQN A;  3SV5 A;  1C4F A;  3K1K A;  1ZGP A;  2G6E A;  3SG6 A;  3P28 A;  3SG3 A;  1KYP A;  4W6L A;  5LTQ A;  1F09 A;  1EMG A;  2POX A;  2YFP A;  2VVI A;  1W7U A;  5DTZ A;  3DQI A;  2IB5 A;  4W6P A;  3OSR A;  4W72 A;  4GES B;  3SST A;  4PPK A;  3SRY A;  1OXD A;  3VK1 A;  2OJK A;  2A54 B;  2DUH A;  3PJ7 A;  3DPW A;  4L12 A;  2EMO A;  2G2S B;  5EB7 A;  4W6T A;  1EMM A;  2DDD A;  1RRX A;  4DXN A;  3SVE A;  2A46 A;  3RWT A;  2OGR A;  1RMP A;  2PXW A;  3ZUF A;  3LS3 A;  5EB6 A;  1RM9 A;  4OGS A;  3SSY A;  1Q4D A;  1KP5 A;  1UIS A;  4B5Y A;  4RYW A;  2A47 A;  4ZIN A;  4ZFS A;  5DQB A;  2V4E C;  2EMD A;  3CGL A;  3NT3 A;  4HQ8 A;  2ARL A;  2IE2 A;  2O2B A;  3SSK A;  4W7E A;  3KCT A;  4ZF3 A;  2G3D B;  3LSA A;  4W73 A;  4IZN A;  4W6C A;  1CV7 A;  2WSO A;  4W6H A;  3DQ1 A;  2A50 B;  4JRB A;  3NT9 A;  4LJB A;  1QYQ A;  1YHG A;  3SG4 A;  2VAD A;  4XL5 A;  4JFG A;  3E5T A;  4KA9 A;  5DPG A;  5LK4 A;  3LA1 A;  1BFP A;  2AWJ A;  2BTJ A;  2HJO A;  3EK7 A;  1Q73 A;  3O77 A;  2HQK A;  4NWS A;  4W6N A;  3DQH A;  4HQ9 A;  4W74 A;  1QYF A;  3UG0 A;  1H6R A;  4GF6 B;  4LW5 A;  2A52 B;  2ICR A;  4B30 A;  4ZIO A;  3PJ5 A;  1JBZ A;  4OJ0 A;  3DQ4 A;  4IK9 A;  2DUI A;  4W6B A;  3LF3 A;  1RMO A;  1Q4E A;  1JBY A;  1JC1 A;  4Q9X A;  3S05 A;  4XGY A;  2OKW A;  3NF0 A;  3W1D A;  1QYO A;  4JEO A;  2Y0G A;  4P1Q A;  5BT0 A;  2O24 A;  4W76 A;  2H5O A;  5EXC I;  3ST3 A;  3VHT A;  4W6K A;  4OY4 A;  1EML A;  5H88 A;  3SVU A;  1H4U A;  2G16 B;  3SVC A;  5LTP A;  4ZF5 A;  3H1R A;  3U0M A;  2AH8 A;  2H9W A;  1YFP A;  4U2V A;  2EMN A;  5DU0 A;  1YHH A;  3LVA A;  4Q9W A;  4XVP A;  5FVF A;  3TMT A;  3VIC A;  2P4M A;  1GL4 A;  4Q7U A;  4R6D A;  3OSQ A;  3DQJ A;  4W6D A;  3PJB A;  4DXQ A;  4ZF4 A;  5HZT A;  2WHT A;  5AQB B;  4LJD C;  3EK8 A;  5EHU A;  5HZS A;  1Q4B A;  2IOV A;  3EKH A;  3CFF A;  4W7A A;  4J89 A;  5FVI A;  1XMZ A;  4B30 B;  3O78 A;  3DPX A;  3WCK A;  2PXS A;  3BXA A;  5HZU A;  5BTT A;  2WIQ A;  1EME A;  4W7D A;  4JF9 A;  3DQU A;  3LVC A;  2ZMW A;  4KF5 A;  3DQ2 A;  1Q4A A;  4ZB1 A;  1S6Z A;  2OTB A;  3DQ6 A;  5J2O A;  4Z4K A;  2Z1O A;  1OXF A;  3DQE A;  3CFA A;  3TMR A;  2OKY A;  5EBJ A;  3DQF A;  1MOV A;  2IB6 A;  2DUE A;  3DQ8 A;  4UTS A;  3SVD A;  3DQ5 A;  1MYW A;  1ZGO A;  4H3N A;  4KPI A;  4J88 A;  2GX2 A;  2A56 B;  4ORN A;  4KGF A;  1RMM A;  4KEX A;  2WIS A;  4W69 A;  2GX0 A;  4PFE A;  4DXP A;  5F9G A;  4BDU A;  3CFH A;  1Z1Q A;  1HUY A;  4R6B A;  2GW4 B;  4P76 A;  3DQL A;  3KCS A;  3AI4 A;  5FHV A;  4W6I A;  2QLI A;  2H8Q A;  2HGY A;  4W6R A;  3W1C A;  1XA9 A;  4W6G A;  3BXB A;  4L13 A;  4L1I A;  5BTT B;  1GGX A;  3EKJ A;  1QY3 A;  3EVV A;  2QLE A;  1EMK A;  4W75 A;  2G5Z B;  4DXM A;  1YJ2 A;  1Z1P A;  5DRG A;  4W6M A;  4W6O A;  2GW3 A;  5DTL A;  3LF4 B;  3MGF A;  3SG5 A;  3SS0 A;  5H89 A;  5DPI A;  2DUG A;  4HE4 A;  2V4E A;  5DY6 A;  5BQL A;  2HRS A;  4OHS A;  2H5Q A;  4AS8 A;  2B3P A;  3M24 A;  4KW9 A;  4HQC A;  4W7X A;  5DQM A;  3DQ9 A;  2DD9 A;  2VVH A;  4KW4 A;  4KW8 A;  5DPH A;  3U0K A;  4H47 A;  3ED8 A;  3DQM A;  4J8A A;  3ZUL A;  3EVR A;  5EXU A;  4H3L A;  4KAG A;  4KF5 C;  4IK3 A;  3IR8 A;  2AWM A;  4Q7T A;  4H3M A;  3I19 A;  3DQC A;  2AHA A;  4ZBL A;  3E5V A;  2QU1 A;  4AR7 A;  2DUF A;  2DD7 A;  3BXC A;  3LVD A;  4I2Y A;  3ZTF A;  4W7C A;  3EK4 A;  2ZMU A;  3U8P A;  3U0L A;  2G3O A;  4W7R A;  3SVN A;  3PIB A;  3ST2 A;  4IK5 A;  4DKN A;  2ZO7 A;  2Q57 A;  3V3D A;  4DXI A;  1W7T A;  3A8S A;  4HVF A;  2WUR A;  3M22 A;  4W6A A;  3IP2 A;  3SSV A;  1Q4C A;  3G9A A;  2AWL A;  4W6F A;  2FZU A;  2A48 A;  2Q6P A;  4LQT A;  1JC0 A;  2G6X A;  3EVP A;  1XAE A;  1W7S A;  3H1O A;  3GL4 A;  2C9J A;  3NED A;  2WSN A;  2HCG A;  2V4E B;  5DTX A;  3U8A A;  4N3D A;  4Q7R A;  1ZUX A;  2H5P A;  2YDZ A;  4Z4M A;  5EJU A;  2H6V A;  4PPJ A;  4DXO A;  1ZGQ A;  3U0N A;  5HZO A;  2AWK A;  1MOU A;  2Z6X A;  2QRF A;  3VHT B;  3SSH A;  3GEX A;  1YZW A;  1HCJ A;  3DQD A;  3DQA A;  4JGE A;  2QLG A;  4TZG A;  3E5W A;  3GJ1 A;  1EMA A;  2C9I A;  4GOB A;  4LQU A;  1F0B A;  4KGE A;  4LJD A;  2B3Q A;  2O29 A;  4EN1 A;  2FL1 A;  3ST4 A;  3SSP A;  1YJF A;  3CBE A;  3SVO A;  4JC2 A;  4XOW A;  1XSS A;  2YE0 A;  2JAD A;  4LJC A;  2A53 B;  3RWA A;  5DTY A;  4ANJ A;  5LTR A;  3EVU A; 
#chains in the Genus database with same CATH topology
 2OTE A;  3ZUJ A;  1KYS A;  2FWQ A;  5T3I A;  2WHS A;  1EMB A;  2HGD A;  5EXB A;  5HW9 A;  1GFL A;  1OXE A;  4PPL A;  3U8C A;  2VVJ A;  2HQZ A;  1KYR A;  2QZ0 A;  5KTG A;  1YHI A;  5HGE A;  3DQK A;  4W77 A;  3NEZ A;  3SG2 A;  5DRF A;  3DQO A;  4OQW A;  2HPW A;  2YE1 A;  1EMC A;  3BX9 A;  3GJ2 A;  4EDS A;  3WLC A;  3SVS A;  2RH7 A;  3AKO A;  1QXT A;  2ZO6 A;  3CB9 A;  2QT2 A;  2QLH A;  1G7K A;  4XOV A;  4W6J A;  5FVG A;  1XQM A;  3ADF A;  4IK4 A;  3ST0 A;  4W6S A;  3SVB A;  3CD1 A;  2QLG B;  2Z6Y A;  1EMF A;  3P8U A;  5HBD A;  2H5R A;  3DQ7 A;  3WLD A;  4W7F A;  3DQ3 A;  4TZA A;  4EDO A;  5DPJ A;  4KF4 A;  4EUL A;  2HFC A;  4IK8 A;  2G6Y A;  4RYS A;  3UFZ A;  4H48 A;  4W6U A;  2Z6Z A;  3CD9 A;  3AI5 A;  4DKM A;  2VZX A;  2VAE A;  3DPZ A;  3OGO A;  4RTC A;  3SG7 A;  5H87 A;  4EMQ A;  1B9C A;  3SSL A;  3SVR A;  2DDC A;  3GB3 A;  4IK1 A;  2WHU A;  3DQN A;  3SV5 A;  1C4F A;  3K1K A;  1ZGP A;  2G6E A;  3SG6 A;  3P28 A;  3SG3 A;  1KYP A;  4W6L A;  5LTQ A;  1F09 A;  1EMG A;  2POX A;  2YFP A;  2VVI A;  1W7U A;  5DTZ A;  3DQI A;  2IB5 A;  4W6P A;  3OSR A;  4W72 A;  4GES B;  3SST A;  4PPK A;  3SRY A;  1OXD A;  3VK1 A;  2OJK A;  2A54 B;  2DUH A;  3PJ7 A;  3DPW A;  4L12 A;  2EMO A;  2G2S B;  5EB7 A;  4W6T A;  1EMM A;  2DDD A;  1RRX A;  4DXN A;  3SVE A;  2A46 A;  3RWT A;  2OGR A;  1RMP A;  2PXW A;  3ZUF A;  3LS3 A;  5EB6 A;  1RM9 A;  4OGS A;  3SSY A;  1Q4D A;  1KP5 A;  1UIS A;  4B5Y A;  4RYW A;  2A47 A;  4ZIN A;  4ZFS A;  5DQB A;  2V4E C;  2EMD A;  3CGL A;  3NT3 A;  4HQ8 A;  2ARL A;  2IE2 A;  2O2B A;  3SSK A;  4W7E A;  3KCT A;  4ZF3 A;  2G3D B;  3LSA A;  4W73 A;  4IZN A;  4W6C A;  1CV7 A;  2WSO A;  4W6H A;  3DQ1 A;  2A50 B;  4JRB A;  3NT9 A;  4LJB A;  1QYQ A;  1YHG A;  3SG4 A;  2VAD A;  4XL5 A;  4JFG A;  3E5T A;  4KA9 A;  5DPG A;  5LK4 A;  3LA1 A;  1BFP A;  2AWJ A;  2BTJ A;  2HJO A;  3EK7 A;  1Q73 A;  3O77 A;  2HQK A;  4NWS A;  4W6N A;  3DQH A;  4HQ9 A;  4W74 A;  1QYF A;  3UG0 A;  1H6R A;  4GF6 B;  4LW5 A;  2A52 B;  2ICR A;  4B30 A;  4ZIO A;  3PJ5 A;  1JBZ A;  4OJ0 A;  3DQ4 A;  4IK9 A;  2DUI A;  4W6B A;  3LF3 A;  1RMO A;  1Q4E A;  1JBY A;  1JC1 A;  4Q9X A;  3S05 A;  4XGY A;  2OKW A;  3NF0 A;  3W1D A;  1QYO A;  4JEO A;  2Y0G A;  4P1Q A;  5BT0 A;  2O24 A;  4W76 A;  2H5O A;  5EXC I;  3ST3 A;  3VHT A;  4W6K A;  4OY4 A;  1EML A;  5H88 A;  3SVU A;  1H4U A;  2G16 B;  3SVC A;  5LTP A;  4ZF5 A;  3H1R A;  3U0M A;  2AH8 A;  2H9W A;  1YFP A;  4U2V A;  2EMN A;  5DU0 A;  1YHH A;  3LVA A;  4Q9W A;  4XVP A;  5FVF A;  3TMT A;  3VIC A;  2P4M A;  1GL4 A;  4Q7U A;  4R6D A;  3OSQ A;  3DQJ A;  4W6D A;  3PJB A;  4DXQ A;  4ZF4 A;  5HZT A;  2WHT A;  5AQB B;  4LJD C;  3EK8 A;  5EHU A;  5HZS A;  1Q4B A;  2IOV A;  3EKH A;  3CFF A;  4W7A A;  4J89 A;  5FVI A;  1XMZ A;  4B30 B;  3O78 A;  3DPX A;  3WCK A;  2PXS A;  3BXA A;  5HZU A;  5BTT A;  2WIQ A;  1EME A;  4W7D A;  4JF9 A;  3DQU A;  3LVC A;  2ZMW A;  4KF5 A;  3DQ2 A;  1Q4A A;  4ZB1 A;  1S6Z A;  2OTB A;  3DQ6 A;  5J2O A;  4Z4K A;  2Z1O A;  1OXF A;  3DQE A;  3CFA A;  3TMR A;  2OKY A;  5EBJ A;  3DQF A;  1MOV A;  2IB6 A;  2DUE A;  3DQ8 A;  4UTS A;  3SVD A;  3DQ5 A;  1MYW A;  1ZGO A;  4H3N A;  4KPI A;  4J88 A;  2GX2 A;  2A56 B;  4ORN A;  4KGF A;  1RMM A;  4KEX A;  2WIS A;  4W69 A;  2GX0 A;  4PFE A;  4DXP A;  5F9G A;  4BDU A;  3CFH A;  1Z1Q A;  1HUY A;  4R6B A;  2GW4 B;  4P76 A;  3DQL A;  3KCS A;  3AI4 A;  5FHV A;  4W6I A;  2QLI A;  2H8Q A;  2HGY A;  4W6R A;  3W1C A;  1XA9 A;  4W6G A;  3BXB A;  4L13 A;  4L1I A;  5BTT B;  1GGX A;  3EKJ A;  1QY3 A;  3EVV A;  2QLE A;  1EMK A;  4W75 A;  2G5Z B;  4DXM A;  1YJ2 A;  1Z1P A;  5DRG A;  4W6M A;  4W6O A;  2GW3 A;  5DTL A;  3LF4 B;  3MGF A;  3SG5 A;  3SS0 A;  5H89 A;  5DPI A;  2DUG A;  4HE4 A;  2V4E A;  5DY6 A;  5BQL A;  2HRS A;  4OHS A;  2H5Q A;  4AS8 A;  2B3P A;  3M24 A;  4KW9 A;  4HQC A;  4W7X A;  5DQM A;  3DQ9 A;  2DD9 A;  2VVH A;  4KW4 A;  4KW8 A;  5DPH A;  3U0K A;  4H47 A;  3ED8 A;  3DQM A;  4J8A A;  3ZUL A;  3EVR A;  5EXU A;  4H3L A;  4KAG A;  4KF5 C;  4IK3 A;  3IR8 A;  2AWM A;  4Q7T A;  4H3M A;  3I19 A;  3DQC A;  2AHA A;  4ZBL A;  3E5V A;  2QU1 A;  4AR7 A;  2DUF A;  2DD7 A;  3BXC A;  3LVD A;  4I2Y A;  3ZTF A;  4W7C A;  3EK4 A;  2ZMU A;  3U8P A;  3U0L A;  2G3O A;  4W7R A;  3SVN A;  3PIB A;  3ST2 A;  4IK5 A;  4DKN A;  2ZO7 A;  2Q57 A;  3V3D A;  4DXI A;  1W7T A;  3A8S A;  4HVF A;  2WUR A;  3M22 A;  4W6A A;  3IP2 A;  3SSV A;  1Q4C A;  3G9A A;  2AWL A;  4W6F A;  2FZU A;  2A48 A;  2Q6P A;  4LQT A;  1JC0 A;  2G6X A;  3EVP A;  1XAE A;  1W7S A;  3H1O A;  3GL4 A;  2C9J A;  3NED A;  2WSN A;  2HCG A;  2V4E B;  5DTX A;  3U8A A;  4N3D A;  4Q7R A;  1ZUX A;  2H5P A;  2YDZ A;  4Z4M A;  5EJU A;  2H6V A;  4PPJ A;  4DXO A;  1ZGQ A;  3U0N A;  5HZO A;  2AWK A;  1MOU A;  2Z6X A;  2QRF A;  3VHT B;  3SSH A;  3GEX A;  1YZW A;  1HCJ A;  3DQD A;  3DQA A;  4JGE A;  2QLG A;  4TZG A;  3E5W A;  3GJ1 A;  1EMA A;  2C9I A;  4GOB A;  4LQU A;  1F0B A;  4KGE A;  4LJD A;  2B3Q A;  2O29 A;  4EN1 A;  2FL1 A;  3ST4 A;  3SSP A;  1YJF A;  3CBE A;  3SVO A;  4JC2 A;  4XOW A;  1XSS A;  2YE0 A;  2JAD A;  4LJC A;  2A53 B;  3RWA A;  5DTY A;  4ANJ A;  5LTR A;  3EVU A; 
#chains in the Genus database with same CATH homology
 2OTE A;  3ZUJ A;  1KYS A;  2FWQ A;  5T3I A;  2WHS A;  1EMB A;  2HGD A;  5EXB A;  5HW9 A;  1GFL A;  1OXE A;  4PPL A;  3U8C A;  2VVJ A;  2HQZ A;  1KYR A;  2QZ0 A;  5KTG A;  1YHI A;  5HGE A;  3DQK A;  4W77 A;  3NEZ A;  3SG2 A;  5DRF A;  3DQO A;  4OQW A;  2HPW A;  2YE1 A;  1EMC A;  3BX9 A;  3GJ2 A;  4EDS A;  3WLC A;  3SVS A;  2RH7 A;  3AKO A;  1QXT A;  2ZO6 A;  3CB9 A;  2QT2 A;  2QLH A;  1G7K A;  4XOV A;  4W6J A;  5FVG A;  1XQM A;  3ADF A;  4IK4 A;  3ST0 A;  4W6S A;  3SVB A;  3CD1 A;  2QLG B;  2Z6Y A;  1EMF A;  3P8U A;  5HBD A;  2H5R A;  3DQ7 A;  3WLD A;  4W7F A;  3DQ3 A;  4TZA A;  4EDO A;  5DPJ A;  4KF4 A;  4EUL A;  2HFC A;  4IK8 A;  2G6Y A;  4RYS A;  3UFZ A;  4H48 A;  4W6U A;  2Z6Z A;  3CD9 A;  3AI5 A;  4DKM A;  2VZX A;  2VAE A;  3DPZ A;  3OGO A;  4RTC A;  3SG7 A;  5H87 A;  4EMQ A;  1B9C A;  3SSL A;  3SVR A;  2DDC A;  3GB3 A;  4IK1 A;  2WHU A;  3DQN A;  3SV5 A;  1C4F A;  3K1K A;  1ZGP A;  2G6E A;  3SG6 A;  3P28 A;  3SG3 A;  1KYP A;  4W6L A;  5LTQ A;  1F09 A;  1EMG A;  2POX A;  2YFP A;  2VVI A;  1W7U A;  5DTZ A;  3DQI A;  2IB5 A;  4W6P A;  3OSR A;  4W72 A;  4GES B;  3SST A;  4PPK A;  3SRY A;  1OXD A;  3VK1 A;  2OJK A;  2A54 B;  2DUH A;  3PJ7 A;  3DPW A;  4L12 A;  2EMO A;  2G2S B;  5EB7 A;  4W6T A;  1EMM A;  2DDD A;  1RRX A;  4DXN A;  3SVE A;  2A46 A;  3RWT A;  2OGR A;  1RMP A;  2PXW A;  3ZUF A;  3LS3 A;  5EB6 A;  1RM9 A;  4OGS A;  3SSY A;  1Q4D A;  1KP5 A;  1UIS A;  4B5Y A;  4RYW A;  2A47 A;  4ZIN A;  4ZFS A;  5DQB A;  2V4E C;  2EMD A;  3CGL A;  3NT3 A;  4HQ8 A;  2ARL A;  2IE2 A;  2O2B A;  3SSK A;  4W7E A;  3KCT A;  4ZF3 A;  2G3D B;  3LSA A;  4W73 A;  4IZN A;  4W6C A;  1CV7 A;  2WSO A;  4W6H A;  3DQ1 A;  2A50 B;  4JRB A;  3NT9 A;  4LJB A;  1QYQ A;  1YHG A;  3SG4 A;  2VAD A;  4XL5 A;  4JFG A;  3E5T A;  4KA9 A;  5DPG A;  5LK4 A;  3LA1 A;  1BFP A;  2AWJ A;  2BTJ A;  2HJO A;  3EK7 A;  1Q73 A;  3O77 A;  2HQK A;  4NWS A;  4W6N A;  3DQH A;  4HQ9 A;  4W74 A;  1QYF A;  3UG0 A;  1H6R A;  4GF6 B;  4LW5 A;  2A52 B;  2ICR A;  4B30 A;  4ZIO A;  3PJ5 A;  1JBZ A;  4OJ0 A;  3DQ4 A;  4IK9 A;  2DUI A;  4W6B A;  3LF3 A;  1RMO A;  1Q4E A;  1JBY A;  1JC1 A;  4Q9X A;  3S05 A;  4XGY A;  2OKW A;  3NF0 A;  3W1D A;  1QYO A;  4JEO A;  2Y0G A;  4P1Q A;  5BT0 A;  2O24 A;  4W76 A;  2H5O A;  5EXC I;  3ST3 A;  3VHT A;  4W6K A;  4OY4 A;  1EML A;  5H88 A;  3SVU A;  1H4U A;  2G16 B;  3SVC A;  5LTP A;  4ZF5 A;  3H1R A;  3U0M A;  2AH8 A;  2H9W A;  1YFP A;  4U2V A;  2EMN A;  5DU0 A;  1YHH A;  3LVA A;  4Q9W A;  4XVP A;  5FVF A;  3TMT A;  3VIC A;  2P4M A;  1GL4 A;  4Q7U A;  4R6D A;  3OSQ A;  3DQJ A;  4W6D A;  3PJB A;  4DXQ A;  4ZF4 A;  5HZT A;  2WHT A;  5AQB B;  4LJD C;  3EK8 A;  5EHU A;  5HZS A;  1Q4B A;  2IOV A;  3EKH A;  3CFF A;  4W7A A;  4J89 A;  5FVI A;  1XMZ A;  4B30 B;  3O78 A;  3DPX A;  3WCK A;  2PXS A;  3BXA A;  5HZU A;  5BTT A;  2WIQ A;  1EME A;  4W7D A;  4JF9 A;  3DQU A;  3LVC A;  2ZMW A;  4KF5 A;  3DQ2 A;  1Q4A A;  4ZB1 A;  1S6Z A;  2OTB A;  3DQ6 A;  5J2O A;  4Z4K A;  2Z1O A;  1OXF A;  3DQE A;  3CFA A;  3TMR A;  2OKY A;  5EBJ A;  3DQF A;  1MOV A;  2IB6 A;  2DUE A;  3DQ8 A;  4UTS A;  3SVD A;  3DQ5 A;  1MYW A;  1ZGO A;  4H3N A;  4KPI A;  4J88 A;  2GX2 A;  2A56 B;  4ORN A;  4KGF A;  1RMM A;  4KEX A;  2WIS A;  4W69 A;  2GX0 A;  4PFE A;  4DXP A;  5F9G A;  4BDU A;  3CFH A;  1Z1Q A;  1HUY A;  4R6B A;  2GW4 B;  4P76 A;  3DQL A;  3KCS A;  3AI4 A;  5FHV A;  4W6I A;  2QLI A;  2H8Q A;  2HGY A;  4W6R A;  3W1C A;  1XA9 A;  4W6G A;  3BXB A;  4L13 A;  4L1I A;  5BTT B;  1GGX A;  3EKJ A;  1QY3 A;  3EVV A;  2QLE A;  1EMK A;  4W75 A;  2G5Z B;  4DXM A;  1YJ2 A;  1Z1P A;  5DRG A;  4W6M A;  4W6O A;  2GW3 A;  5DTL A;  3LF4 B;  3MGF A;  3SG5 A;  3SS0 A;  5H89 A;  5DPI A;  2DUG A;  4HE4 A;  2V4E A;  5DY6 A;  5BQL A;  2HRS A;  4OHS A;  2H5Q A;  4AS8 A;  2B3P A;  3M24 A;  4KW9 A;  4HQC A;  4W7X A;  5DQM A;  3DQ9 A;  2DD9 A;  2VVH A;  4KW4 A;  4KW8 A;  5DPH A;  3U0K A;  4H47 A;  3ED8 A;  3DQM A;  4J8A A;  3ZUL A;  3EVR A;  5EXU A;  4H3L A;  4KAG A;  4KF5 C;  4IK3 A;  3IR8 A;  2AWM A;  4Q7T A;  4H3M A;  3I19 A;  3DQC A;  2AHA A;  4ZBL A;  3E5V A;  2QU1 A;  4AR7 A;  2DUF A;  2DD7 A;  3BXC A;  3LVD A;  4I2Y A;  3ZTF A;  4W7C A;  3EK4 A;  2ZMU A;  3U8P A;  3U0L A;  2G3O A;  4W7R A;  3SVN A;  3PIB A;  3ST2 A;  4IK5 A;  4DKN A;  2ZO7 A;  2Q57 A;  3V3D A;  4DXI A;  1W7T A;  3A8S A;  4HVF A;  2WUR A;  3M22 A;  4W6A A;  3IP2 A;  3SSV A;  1Q4C A;  3G9A A;  2AWL A;  4W6F A;  2FZU A;  2A48 A;  2Q6P A;  4LQT A;  1JC0 A;  2G6X A;  3EVP A;  1XAE A;  1W7S A;  3H1O A;  3GL4 A;  2C9J A;  3NED A;  2WSN A;  2HCG A;  2V4E B;  5DTX A;  3U8A A;  4N3D A;  4Q7R A;  1ZUX A;  2H5P A;  2YDZ A;  4Z4M A;  5EJU A;  2H6V A;  4PPJ A;  4DXO A;  1ZGQ A;  3U0N A;  5HZO A;  2AWK A;  1MOU A;  2Z6X A;  2QRF A;  3VHT B;  3SSH A;  3GEX A;  1YZW A;  1HCJ A;  3DQD A;  3DQA A;  4JGE A;  2QLG A;  4TZG A;  3E5W A;  3GJ1 A;  1EMA A;  2C9I A;  4GOB A;  4LQU A;  1F0B A;  4KGE A;  4LJD A;  2B3Q A;  2O29 A;  4EN1 A;  2FL1 A;  3ST4 A;  3SSP A;  1YJF A;  3CBE A;  3SVO A;  4JC2 A;  4XOW A;  1XSS A;  2YE0 A;  2JAD A;  4LJC A;  2A53 B;  3RWA A;  5DTY A;  4ANJ A;  5LTR A;  3EVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...