5DU0A

Crystal structure of rsfolder in the non-fluorescent off-state
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
228
structure length
227
Chain Sequence
SKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLVLCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKSNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Rational design of ultrastable and reversibly photoswitchable fluorescent proteins for super-resolution imaging of the bacterial periplasm.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 58
structure length 227
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 5du0A00
2YDZA 4XOVA 3SVNA 3AI4A 3I19A 4PFEA 2OKYA 2HFCA 2HQKA 5HZTA 3CB9A 1EMCA 3ZUFA 2ZMWA 4LJBA 2QT2A 2WHTA 3OSQA 4KA9A 1KYRA 2OTBA 3SVSA 1Q4BA 2Z6YA 3E5WA 4W6KA 4DXQA 3NEDA 4KGFA 4R6BA 4EDOA 4ZF3A 4KW9A 1EMGA 3M22A 4P1QA 2HGDA 4B30B 4AR7A 4W73A 2FZUA 2G6EA 2AHAA 3W1CA 4DXPA 1YZWA 5H89A 3DQCA 5EXUA 2OKWA 4JC2A 3EK8A 1RRXA 3EVPA 4IZNA 2QLHA 3CBEA 4W7EA 4RYSA 1F09A 1ZGOA 3BXBA 3U0LA 2GW4B 2G5ZB 2O24A 5LTPA 4JEOA 3ZTFA 3LF3A 4W69A 5H88A 4KW4A 4H3LA 4HE4A 5DTZA 4H48A 2RH7A 4L12A 4Q7RA 3VHTB 3WCKA 4LJDA 2H6VA 3ST3A 1W7TA 3CGLA 1YHIA 4LJCA 2QRFA 4KW8A 1Q4AA 5DQMA 1YJFA 4GESB 4W7RA 3VK1A 4ZFSA 3H1RA 1Q4CA 1Z1PA 4EN1A 3DQJA 4DXIA 3PJ5A 4H47A 4ZF4A 3DQIA 2H5RA 1EMKA 2IOVA 2H5PA 3ED8A 1YJ2A 1UISA 3EVRA 1HCJA 2A56B 2DDCA 3G9AA 5BQLA 5DY6A 1OXEA 1EMBA 4Q7TA 2C9JA 1OXDA 2OTEA 3SSPA 2ZMUA 4W6UA 2HQZA 4Z4MA 2QLEA 3DQ9A 2HCGA 2DUFA 3UG0A 3ZULA 2GX0A 2A48A 3VHTA 1BFPA 2B3PA 2H8QA 5FHVA 3DQ8A 3SV5A 3U8CA 2Z6ZA 3SG2A 2ICRA 4BDUA 3O78A 4TZGA 1XSSA 3NT9A 5HW9A 2QLGB 4KF4A 4W6JA 3RWAA 4W7AA 2DUIA 2Q6PA 4GOBA 2V4EA 2A47A 5DRGA 4W7DA 4Z4KA 4ZINA 1JC0A 4W6AA 4DXOA 2HRSA 3SG4A 4W6OA 2QU1A 3SSYA 3LSAA 3EKHA 4W7CA 3LS3A 5FVGA 3M24A 5EJUA 1KP5A 4PPKA 4H3NA 3LVDA 3PJ7A 1S6ZA 1OXFA 4W6DA 4W6GA 2A46A 2FWQA 4LQTA 3DQOA 4JF9A 2Z1OA 3U0NA 4KEXA 4NWSA 5DPGA 4N3DA 3SVEA 3TMRA 3U8AA 4AS8A 4DKNA 4ZIOA 4W6NA 3SVRA 2EMDA 5DPIA 3SSVA 2DD9A 2HPWA 2WSOA 2POXA 2EMNA 4ZB1A 5LK4A 4Q9WA 2QLGA 2AH8A 3SSKA 4W6FA 4J88A 4W74A 3ST0A 4W7XA 3DQ2A 4ZF5A 2IB6A 3OGOA 4R6DA 3DQAA 5T3IA 4OQWA 4W6SA 1Q4DA 5EB6A 2WISA 3BX9A 4HQ8A 2OGRA 4I2YA 4PPJA 2Q57A 4TZAA 3GL4A 1MOVA 3TMTA 1QYFA 3GB3A 4KAGA 4GF6B 3DQUA 5LTQA 2DD7A 3LVAA 4B5YA 3CD1A 4W6RA 3U8PA 1RMMA 2QLIA 4HQCA 4IK1A 2B3QA 1Z1QA 2Y0GA 5HZOA 4B30A 4ORNA 2AWKA 1XMZA 5KTGA 2P4MA 3IR8A 1H4UA 4Q7UA 4EDSA 2FL1A 5BTTB 2WIQA 2H9WA 4J89A 2G3DB 1RMOA 4W6LA 2WSNA 3DQEA 1JC1A 5DTYA 4W6PA 2ZO6A 3DQ1A 4PPLA 4UTSA 4DXMA 5FVIA 4Q9XA 2VVJA 1MOUA 2GX2A 4IK5A 2PXSA 5LTRA 4L13A 4KF5C 1QYQA 1YHHA 3DPXA 3SRYA 1XQMA 1QXTA 4JGEA 3DQLA 3SSLA 5DPJA 1H6RA 2A53B 2AWLA 3DQNA 4U2VA 2DDDA 3OSRA 4KPIA 3SG6A 3S05A 4J8AA 3SVOA 2A54B 3DQ3A 1XAEA 3DQDA 3EK7A 5H87A 4IK9A 4OJ0A 3V3DA 1QYOA 1EMEA 5HBDA 3LVCA 4ZBLA 3VICA 2EMOA 2HGYA 3BXCA 1JBZA 2G16B 3EKJA 1EMLA 1G7KA 3E5TA 1Q4EA 5DTXA 3AKOA 3DPWA 3CD9A 4DXNA 3A8SA 3H1OA 3SG5A 1MYWA 3GJ1A 3NT3A 2VAEA 3SVUA 1XA9A 1W7UA 4XL5A 1YHGA 3MGFA 4W77A 2YE1A 3LA1A 2AWMA 3ADFA 3DQ5A 3SSHA 2HJOA 4IK4A 4LQUA 2AWJA 3LF4B 2G3OA 4P76A 3KCTA 1W7SA 4OGSA 1EMAA 2OJKA 1RM9A 3CFHA 2DUEA 5EHUA 3DQHA 3E5VA 4KGEA 2VVHA 1ZGPA 3SG3A 2WHUA 3BXAA 5HZUA 5DRFA 4W76A 5DQBA 1C4FA 1CV7A 3DQ7A 2O29A 3U0KA 3WLCA 4IK8A 4XOWA 1QY3A 5AQBB 3GEXA 2VADA 3DQ4A 3SG7A 3EVUA 2WURA 3K1KA 3P8UA 4RYWA 3EVVA 5HGEA 3DPZA 4JRBA 5DU0A 4ANJA 4JFGA 3GJ2A 3PIBA 2ZO7A 2DUHA 4W7FA 1B9CA 4W72A 2Z6XA 2A50B 2GW3A 5EBJA 1F0BA 2QZ0A 4HVFA 4W6HA 4W75A 4LJDC 4DKMA 2A52B 3SVCA 5EXCI 5DTLA 3SVDA 3SSTA 3KCSA 1KYSA 1GGXA 3CFFA 3UFZA 1EMMA 2H5OA 3EK4A 5EXBA 2V4EB 4H3MA 2VVIA 2YFPA 3PJBA 5DPHA 1GFLA 2G2SB 2O2BA 4XGYA 2C9IA 3WLDA 2G6XA 2IE2A 4KF5A 3ST4A 5HZSA 5F9GA 3RWTA 3SS0A 3ST2A 4L1IA 1RMPA 3SVBA 4W6MA 4OY4A 3DQ6A 1HUYA 4LW5A 2IB5A 3DQKA 3U0MA 2H5QA 2BTJA 3NEZA 1ZUXA 1Q73A 3ZUJA 3DQMA 2G6YA 4IK3A 1GL4A 4XVPA 1YFPA 2ARLA 5J2OA 4EMQA 4OHSA 2WHSA 3AI5A 2YE0A 5FVFA 5BTTA 2JADA 5BT0A 2DUGA 2VZXA 2PXWA 4W6BA 4RTCA 1ZGQA 1KYPA 3O77A 3W1DA 4HQ9A 4EULA 5EB7A 3DQFA 3NF0A 4W6TA 4W6IA 2V4EC 3CFAA 3IP2A 3P28A 1EMFA 1JBYA 4W6CA
chains in the Genus database with same CATH superfamily
2YDZA 4XOVA 3SVNA 3AI4A 3I19A 4PFEA 2OKYA 2HFCA 2HQKA 5HZTA 3CB9A 1EMCA 3ZUFA 2ZMWA 4LJBA 2QT2A 2WHTA 3OSQA 4KA9A 1KYRA 2OTBA 3SVSA 1Q4BA 2Z6YA 3E5WA 4W6KA 4DXQA 3NEDA 4KGFA 4R6BA 4EDOA 4ZF3A 4KW9A 1EMGA 3M22A 4P1QA 2HGDA 4B30B 4AR7A 4W73A 2FZUA 2G6EA 2AHAA 3W1CA 4DXPA 1YZWA 5H89A 3DQCA 5EXUA 2OKWA 4JC2A 3EK8A 1RRXA 3EVPA 4IZNA 2QLHA 3CBEA 4W7EA 4RYSA 1F09A 1ZGOA 3BXBA 3U0LA 2GW4B 2G5ZB 2O24A 5LTPA 4JEOA 3ZTFA 3LF3A 4W69A 5H88A 4KW4A 4H3LA 4HE4A 5DTZA 4H48A 2RH7A 4L12A 4Q7RA 3VHTB 3WCKA 4LJDA 2H6VA 3ST3A 1W7TA 3CGLA 1YHIA 4LJCA 2QRFA 4KW8A 1Q4AA 5DQMA 1YJFA 4GESB 4W7RA 3VK1A 4ZFSA 3H1RA 1Q4CA 1Z1PA 4EN1A 3DQJA 4DXIA 3PJ5A 4H47A 4ZF4A 3DQIA 2H5RA 1EMKA 2IOVA 2H5PA 3ED8A 1YJ2A 1UISA 3EVRA 1HCJA 2A56B 2DDCA 3G9AA 5BQLA 5DY6A 1OXEA 1EMBA 4Q7TA 2C9JA 1OXDA 2OTEA 3SSPA 2ZMUA 4W6UA 2HQZA 4Z4MA 2QLEA 3DQ9A 2HCGA 2DUFA 3UG0A 3ZULA 2GX0A 2A48A 3VHTA 1BFPA 2B3PA 2H8QA 5FHVA 3DQ8A 3SV5A 3U8CA 2Z6ZA 3SG2A 2ICRA 4BDUA 3O78A 4TZGA 1XSSA 3NT9A 5HW9A 2QLGB 4KF4A 4W6JA 3RWAA 4W7AA 2DUIA 2Q6PA 4GOBA 2V4EA 2A47A 5DRGA 4W7DA 4Z4KA 4ZINA 1JC0A 4W6AA 4DXOA 2HRSA 3SG4A 4W6OA 2QU1A 3SSYA 3LSAA 3EKHA 4W7CA 3LS3A 5FVGA 3M24A 5EJUA 1KP5A 4PPKA 4H3NA 3LVDA 3PJ7A 1S6ZA 1OXFA 4W6DA 4W6GA 2A46A 2FWQA 4LQTA 3DQOA 4JF9A 2Z1OA 3U0NA 4KEXA 4NWSA 5DPGA 4N3DA 3SVEA 3TMRA 3U8AA 4AS8A 4DKNA 4ZIOA 4W6NA 3SVRA 2EMDA 5DPIA 3SSVA 2DD9A 2HPWA 2WSOA 2POXA 2EMNA 4ZB1A 5LK4A 4Q9WA 2QLGA 2AH8A 3SSKA 4W6FA 4J88A 4W74A 3ST0A 4W7XA 3DQ2A 4ZF5A 2IB6A 3OGOA 4R6DA 3DQAA 5T3IA 4OQWA 4W6SA 1Q4DA 5EB6A 2WISA 3BX9A 4HQ8A 2OGRA 4I2YA 4PPJA 2Q57A 4TZAA 3GL4A 1MOVA 3TMTA 1QYFA 3GB3A 4KAGA 4GF6B 3DQUA 5LTQA 2DD7A 3LVAA 4B5YA 3CD1A 4W6RA 3U8PA 1RMMA 2QLIA 4HQCA 4IK1A 2B3QA 1Z1QA 2Y0GA 5HZOA 4B30A 4ORNA 2AWKA 1XMZA 5KTGA 2P4MA 3IR8A 1H4UA 4Q7UA 4EDSA 2FL1A 5BTTB 2WIQA 2H9WA 4J89A 2G3DB 1RMOA 4W6LA 2WSNA 3DQEA 1JC1A 5DTYA 4W6PA 2ZO6A 3DQ1A 4PPLA 4UTSA 4DXMA 5FVIA 4Q9XA 2VVJA 1MOUA 2GX2A 4IK5A 2PXSA 5LTRA 4L13A 4KF5C 1QYQA 1YHHA 3DPXA 3SRYA 1XQMA 1QXTA 4JGEA 3DQLA 3SSLA 5DPJA 1H6RA 2A53B 2AWLA 3DQNA 4U2VA 2DDDA 3OSRA 4KPIA 3SG6A 3S05A 4J8AA 3SVOA 2A54B 3DQ3A 1XAEA 3DQDA 3EK7A 5H87A 4IK9A 4OJ0A 3V3DA 1QYOA 1EMEA 5HBDA 3LVCA 4ZBLA 3VICA 2EMOA 2HGYA 3BXCA 1JBZA 2G16B 3EKJA 1EMLA 1G7KA 3E5TA 1Q4EA 5DTXA 3AKOA 3DPWA 3CD9A 4DXNA 3A8SA 3H1OA 3SG5A 1MYWA 3GJ1A 3NT3A 2VAEA 3SVUA 1XA9A 1W7UA 4XL5A 1YHGA 3MGFA 4W77A 2YE1A 3LA1A 2AWMA 3ADFA 3DQ5A 3SSHA 2HJOA 4IK4A 4LQUA 2AWJA 3LF4B 2G3OA 4P76A 3KCTA 1W7SA 4OGSA 1EMAA 2OJKA 1RM9A 3CFHA 2DUEA 5EHUA 3DQHA 3E5VA 4KGEA 2VVHA 1ZGPA 3SG3A 2WHUA 3BXAA 5HZUA 5DRFA 4W76A 5DQBA 1C4FA 1CV7A 3DQ7A 2O29A 3U0KA 3WLCA 4IK8A 4XOWA 1QY3A 5AQBB 3GEXA 2VADA 3DQ4A 3SG7A 3EVUA 2WURA 3K1KA 3P8UA 4RYWA 3EVVA 5HGEA 3DPZA 4JRBA 5DU0A 4ANJA 4JFGA 3GJ2A 3PIBA 2ZO7A 2DUHA 4W7FA 1B9CA 4W72A 2Z6XA 2A50B 2GW3A 5EBJA 1F0BA 2QZ0A 4HVFA 4W6HA 4W75A 4LJDC 4DKMA 2A52B 3SVCA 5EXCI 5DTLA 3SVDA 3SSTA 3KCSA 1KYSA 1GGXA 3CFFA 3UFZA 1EMMA 2H5OA 3EK4A 5EXBA 2V4EB 4H3MA 2VVIA 2YFPA 3PJBA 5DPHA 1GFLA 2G2SB 2O2BA 4XGYA 2C9IA 3WLDA 2G6XA 2IE2A 4KF5A 3ST4A 5HZSA 5F9GA 3RWTA 3SS0A 3ST2A 4L1IA 1RMPA 3SVBA 4W6MA 4OY4A 3DQ6A 1HUYA 4LW5A 2IB5A 3DQKA 3U0MA 2H5QA 2BTJA 3NEZA 1ZUXA 1Q73A 3ZUJA 3DQMA 2G6YA 4IK3A 1GL4A 4XVPA 1YFPA 2ARLA 5J2OA 4EMQA 4OHSA 2WHSA 3AI5A 2YE0A 5FVFA 5BTTA 2JADA 5BT0A 2DUGA 2VZXA 2PXWA 4W6BA 4RTCA 1ZGQA 1KYPA 3O77A 3W1DA 4HQ9A 4EULA 5EB7A 3DQFA 3NF0A 4W6TA 4W6IA 2V4EC 3CFAA 3IP2A 3P28A 1EMFA 1JBYA 4W6CA
chains in the Genus database with same CATH topology
2YDZA 4XOVA 3SVNA 3AI4A 3I19A 4PFEA 2OKYA 2HFCA 2HQKA 5HZTA 3CB9A 1EMCA 3ZUFA 2ZMWA 4LJBA 2QT2A 2WHTA 3OSQA 4KA9A 1KYRA 2OTBA 3SVSA 1Q4BA 2Z6YA 3E5WA 4W6KA 4DXQA 3NEDA 4KGFA 4R6BA 4EDOA 4ZF3A 4KW9A 1EMGA 3M22A 4P1QA 2HGDA 4B30B 4AR7A 4W73A 2FZUA 2G6EA 2AHAA 3W1CA 4DXPA 1YZWA 5H89A 3DQCA 5EXUA 2OKWA 4JC2A 3EK8A 1RRXA 3EVPA 4IZNA 2QLHA 3CBEA 4W7EA 4RYSA 1F09A 1ZGOA 3BXBA 3U0LA 2GW4B 2G5ZB 2O24A 5LTPA 4JEOA 3ZTFA 3LF3A 4W69A 5H88A 4KW4A 4H3LA 4HE4A 5DTZA 4H48A 2RH7A 4L12A 4Q7RA 3VHTB 3WCKA 4LJDA 2H6VA 3ST3A 1W7TA 3CGLA 1YHIA 4LJCA 2QRFA 4KW8A 1Q4AA 5DQMA 1YJFA 4GESB 4W7RA 3VK1A 4ZFSA 3H1RA 1Q4CA 1Z1PA 4EN1A 3DQJA 4DXIA 3PJ5A 4H47A 4ZF4A 3DQIA 2H5RA 1EMKA 2IOVA 2H5PA 3ED8A 1YJ2A 1UISA 3EVRA 1HCJA 2A56B 2DDCA 3G9AA 5BQLA 5DY6A 1OXEA 1EMBA 4Q7TA 2C9JA 1OXDA 2OTEA 3SSPA 2ZMUA 4W6UA 2HQZA 4Z4MA 2QLEA 3DQ9A 2HCGA 2DUFA 3UG0A 3ZULA 2GX0A 2A48A 3VHTA 1BFPA 2B3PA 2H8QA 5FHVA 3DQ8A 3SV5A 3U8CA 2Z6ZA 3SG2A 2ICRA 4BDUA 3O78A 4TZGA 1XSSA 3NT9A 5HW9A 2QLGB 4KF4A 4W6JA 3RWAA 4W7AA 2DUIA 2Q6PA 4GOBA 2V4EA 2A47A 5DRGA 4W7DA 4Z4KA 4ZINA 1JC0A 4W6AA 4DXOA 2HRSA 3SG4A 4W6OA 2QU1A 3SSYA 3LSAA 3EKHA 4W7CA 3LS3A 5FVGA 3M24A 5EJUA 1KP5A 4PPKA 4H3NA 3LVDA 3PJ7A 1S6ZA 1OXFA 4W6DA 4W6GA 2A46A 2FWQA 4LQTA 3DQOA 4JF9A 2Z1OA 3U0NA 4KEXA 4NWSA 5DPGA 4N3DA 3SVEA 3TMRA 3U8AA 4AS8A 4DKNA 4ZIOA 4W6NA 3SVRA 2EMDA 5DPIA 3SSVA 2DD9A 2HPWA 2WSOA 2POXA 2EMNA 4ZB1A 5LK4A 4Q9WA 2QLGA 2AH8A 3SSKA 4W6FA 4J88A 4W74A 3ST0A 4W7XA 3DQ2A 4ZF5A 2IB6A 3OGOA 4R6DA 3DQAA 5T3IA 4OQWA 4W6SA 1Q4DA 5EB6A 2WISA 3BX9A 4HQ8A 2OGRA 4I2YA 4PPJA 2Q57A 4TZAA 3GL4A 1MOVA 3TMTA 1QYFA 3GB3A 4KAGA 4GF6B 3DQUA 5LTQA 2DD7A 3LVAA 4B5YA 3CD1A 4W6RA 3U8PA 1RMMA 2QLIA 4HQCA 4IK1A 2B3QA 1Z1QA 2Y0GA 5HZOA 4B30A 4ORNA 2AWKA 1XMZA 5KTGA 2P4MA 3IR8A 1H4UA 4Q7UA 4EDSA 2FL1A 5BTTB 2WIQA 2H9WA 4J89A 2G3DB 1RMOA 4W6LA 2WSNA 3DQEA 1JC1A 5DTYA 4W6PA 2ZO6A 3DQ1A 4PPLA 4UTSA 4DXMA 5FVIA 4Q9XA 2VVJA 1MOUA 2GX2A 4IK5A 2PXSA 5LTRA 4L13A 4KF5C 1QYQA 1YHHA 3DPXA 3SRYA 1XQMA 1QXTA 4JGEA 3DQLA 3SSLA 5DPJA 1H6RA 2A53B 2AWLA 3DQNA 4U2VA 2DDDA 3OSRA 4KPIA 3SG6A 3S05A 4J8AA 3SVOA 2A54B 3DQ3A 1XAEA 3DQDA 3EK7A 5H87A 4IK9A 4OJ0A 3V3DA 1QYOA 1EMEA 5HBDA 3LVCA 4ZBLA 3VICA 2EMOA 2HGYA 3BXCA 1JBZA 2G16B 3EKJA 1EMLA 1G7KA 3E5TA 1Q4EA 5DTXA 3AKOA 3DPWA 3CD9A 4DXNA 3A8SA 3H1OA 3SG5A 1MYWA 3GJ1A 3NT3A 2VAEA 3SVUA 1XA9A 1W7UA 4XL5A 1YHGA 3MGFA 4W77A 2YE1A 3LA1A 2AWMA 3ADFA 3DQ5A 3SSHA 2HJOA 4IK4A 4LQUA 2AWJA 3LF4B 2G3OA 4P76A 3KCTA 1W7SA 4OGSA 1EMAA 2OJKA 1RM9A 3CFHA 2DUEA 5EHUA 3DQHA 3E5VA 4KGEA 2VVHA 1ZGPA 3SG3A 2WHUA 3BXAA 5HZUA 5DRFA 4W76A 5DQBA 1C4FA 1CV7A 3DQ7A 2O29A 3U0KA 3WLCA 4IK8A 4XOWA 1QY3A 5AQBB 3GEXA 2VADA 3DQ4A 3SG7A 3EVUA 2WURA 3K1KA 3P8UA 4RYWA 3EVVA 5HGEA 3DPZA 4JRBA 5DU0A 4ANJA 4JFGA 3GJ2A 3PIBA 2ZO7A 2DUHA 4W7FA 1B9CA 4W72A 2Z6XA 2A50B 2GW3A 5EBJA 1F0BA 2QZ0A 4HVFA 4W6HA 4W75A 4LJDC 4DKMA 2A52B 3SVCA 5EXCI 5DTLA 3SVDA 3SSTA 3KCSA 1KYSA 1GGXA 3CFFA 3UFZA 1EMMA 2H5OA 3EK4A 5EXBA 2V4EB 4H3MA 2VVIA 2YFPA 3PJBA 5DPHA 1GFLA 2G2SB 2O2BA 4XGYA 2C9IA 3WLDA 2G6XA 2IE2A 4KF5A 3ST4A 5HZSA 5F9GA 3RWTA 3SS0A 3ST2A 4L1IA 1RMPA 3SVBA 4W6MA 4OY4A 3DQ6A 1HUYA 4LW5A 2IB5A 3DQKA 3U0MA 2H5QA 2BTJA 3NEZA 1ZUXA 1Q73A 3ZUJA 3DQMA 2G6YA 4IK3A 1GL4A 4XVPA 1YFPA 2ARLA 5J2OA 4EMQA 4OHSA 2WHSA 3AI5A 2YE0A 5FVFA 5BTTA 2JADA 5BT0A 2DUGA 2VZXA 2PXWA 4W6BA 4RTCA 1ZGQA 1KYPA 3O77A 3W1DA 4HQ9A 4EULA 5EB7A 3DQFA 3NF0A 4W6TA 4W6IA 2V4EC 3CFAA 3IP2A 3P28A 1EMFA 1JBYA 4W6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YDZ A;  4XOV A;  3SVN A;  3AI4 A;  3I19 A;  4PFE A;  2OKY A;  2HFC A;  2HQK A;  5HZT A;  3CB9 A;  1EMC A;  3ZUF A;  2ZMW A;  4LJB A;  2QT2 A;  2WHT A;  3OSQ A;  4KA9 A;  1KYR A;  2OTB A;  3SVS A;  1Q4B A;  2Z6Y A;  3E5W A;  4W6K A;  4DXQ A;  3NED A;  4KGF A;  4R6B A;  4EDO A;  4ZF3 A;  4KW9 A;  1EMG A;  3M22 A;  4P1Q A;  2HGD A;  4B30 B;  4AR7 A;  4W73 A;  2FZU A;  2G6E A;  2AHA A;  3W1C A;  4DXP A;  1YZW A;  5H89 A;  3DQC A;  5EXU A;  2OKW A;  4JC2 A;  3EK8 A;  1RRX A;  3EVP A;  4IZN A;  2QLH A;  3CBE A;  4W7E A;  4RYS A;  1F09 A;  1ZGO A;  3BXB A;  3U0L A;  2GW4 B;  2G5Z B;  2O24 A;  5LTP A;  4JEO A;  3ZTF A;  3LF3 A;  4W69 A;  5H88 A;  4KW4 A;  4H3L A;  4HE4 A;  5DTZ A;  4H48 A;  2RH7 A;  4L12 A;  4Q7R A;  3VHT B;  3WCK A;  4LJD A;  2H6V A;  3ST3 A;  1W7T A;  3CGL A;  1YHI A;  4LJC A;  2QRF A;  4KW8 A;  1Q4A A;  5DQM A;  1YJF A;  4GES B;  4W7R A;  3VK1 A;  4ZFS A;  3H1R A;  1Q4C A;  1Z1P A;  4EN1 A;  3DQJ A;  4DXI A;  3PJ5 A;  4H47 A;  4ZF4 A;  3DQI A;  2H5R A;  1EMK A;  2IOV A;  2H5P A;  3ED8 A;  1YJ2 A;  1UIS A;  3EVR A;  1HCJ A;  2A56 B;  2DDC A;  3G9A A;  5BQL A;  5DY6 A;  1OXE A;  1EMB A;  4Q7T A;  2C9J A;  1OXD A;  2OTE A;  3SSP A;  2ZMU A;  4W6U A;  2HQZ A;  4Z4M A;  2QLE A;  3DQ9 A;  2HCG A;  2DUF A;  3UG0 A;  3ZUL A;  2GX0 A;  2A48 A;  3VHT A;  1BFP A;  2B3P A;  2H8Q A;  5FHV A;  3DQ8 A;  3SV5 A;  3U8C A;  2Z6Z A;  3SG2 A;  2ICR A;  4BDU A;  3O78 A;  4TZG A;  1XSS A;  3NT9 A;  5HW9 A;  2QLG B;  4KF4 A;  4W6J A;  3RWA A;  4W7A A;  2DUI A;  2Q6P A;  4GOB A;  2V4E A;  2A47 A;  5DRG A;  4W7D A;  4Z4K A;  4ZIN A;  1JC0 A;  4W6A A;  4DXO A;  2HRS A;  3SG4 A;  4W6O A;  2QU1 A;  3SSY A;  3LSA A;  3EKH A;  4W7C A;  3LS3 A;  5FVG A;  3M24 A;  5EJU A;  1KP5 A;  4PPK A;  4H3N A;  3LVD A;  3PJ7 A;  1S6Z A;  1OXF A;  4W6D A;  4W6G A;  2A46 A;  2FWQ A;  4LQT A;  3DQO A;  4JF9 A;  2Z1O A;  3U0N A;  4KEX A;  4NWS A;  5DPG A;  4N3D A;  3SVE A;  3TMR A;  3U8A A;  4AS8 A;  4DKN A;  4ZIO A;  4W6N A;  3SVR A;  2EMD A;  5DPI A;  3SSV A;  2DD9 A;  2HPW A;  2WSO A;  2POX A;  2EMN A;  4ZB1 A;  5LK4 A;  4Q9W A;  2QLG A;  2AH8 A;  3SSK A;  4W6F A;  4J88 A;  4W74 A;  3ST0 A;  4W7X A;  3DQ2 A;  4ZF5 A;  2IB6 A;  3OGO A;  4R6D A;  3DQA A;  5T3I A;  4OQW A;  4W6S A;  1Q4D A;  5EB6 A;  2WIS A;  3BX9 A;  4HQ8 A;  2OGR A;  4I2Y A;  4PPJ A;  2Q57 A;  4TZA A;  3GL4 A;  1MOV A;  3TMT A;  1QYF A;  3GB3 A;  4KAG A;  4GF6 B;  3DQU A;  5LTQ A;  2DD7 A;  3LVA A;  4B5Y A;  3CD1 A;  4W6R A;  3U8P A;  1RMM A;  2QLI A;  4HQC A;  4IK1 A;  2B3Q A;  1Z1Q A;  2Y0G A;  5HZO A;  4B30 A;  4ORN A;  2AWK A;  1XMZ A;  5KTG A;  2P4M A;  3IR8 A;  1H4U A;  4Q7U A;  4EDS A;  2FL1 A;  5BTT B;  2WIQ A;  2H9W A;  4J89 A;  2G3D B;  1RMO A;  4W6L A;  2WSN A;  3DQE A;  1JC1 A;  5DTY A;  4W6P A;  2ZO6 A;  3DQ1 A;  4PPL A;  4UTS A;  4DXM A;  5FVI A;  4Q9X A;  2VVJ A;  1MOU A;  2GX2 A;  4IK5 A;  2PXS A;  5LTR A;  4L13 A;  4KF5 C;  1QYQ A;  1YHH A;  3DPX A;  3SRY A;  1XQM A;  1QXT A;  4JGE A;  3DQL A;  3SSL A;  5DPJ A;  1H6R A;  2A53 B;  2AWL A;  3DQN A;  4U2V A;  2DDD A;  3OSR A;  4KPI A;  3SG6 A;  3S05 A;  4J8A A;  3SVO A;  2A54 B;  3DQ3 A;  1XAE A;  3DQD A;  3EK7 A;  5H87 A;  4IK9 A;  4OJ0 A;  3V3D A;  1QYO A;  1EME A;  5HBD A;  3LVC A;  4ZBL A;  3VIC A;  2EMO A;  2HGY A;  3BXC A;  1JBZ A;  2G16 B;  3EKJ A;  1EML A;  1G7K A;  3E5T A;  1Q4E A;  5DTX A;  3AKO A;  3DPW A;  3CD9 A;  4DXN A;  3A8S A;  3H1O A;  3SG5 A;  1MYW A;  3GJ1 A;  3NT3 A;  2VAE A;  3SVU A;  1XA9 A;  1W7U A;  4XL5 A;  1YHG A;  3MGF A;  4W77 A;  2YE1 A;  3LA1 A;  2AWM A;  3ADF A;  3DQ5 A;  3SSH A;  2HJO A;  4IK4 A;  4LQU A;  2AWJ A;  3LF4 B;  2G3O A;  4P76 A;  3KCT A;  1W7S A;  4OGS A;  1EMA A;  2OJK A;  1RM9 A;  3CFH A;  2DUE A;  5EHU A;  3DQH A;  3E5V A;  4KGE A;  2VVH A;  1ZGP A;  3SG3 A;  2WHU A;  3BXA A;  5HZU A;  5DRF A;  4W76 A;  5DQB A;  1C4F A;  1CV7 A;  3DQ7 A;  2O29 A;  3U0K A;  3WLC A;  4IK8 A;  4XOW A;  1QY3 A;  5AQB B;  3GEX A;  2VAD A;  3DQ4 A;  3SG7 A;  3EVU A;  2WUR A;  3K1K A;  3P8U A;  4RYW A;  3EVV A;  5HGE A;  3DPZ A;  4JRB A;  5DU0 A;  4ANJ A;  4JFG A;  3GJ2 A;  3PIB A;  2ZO7 A;  2DUH A;  4W7F A;  1B9C A;  4W72 A;  2Z6X A;  2A50 B;  2GW3 A;  5EBJ A;  1F0B A;  2QZ0 A;  4HVF A;  4W6H A;  4W75 A;  4LJD C;  4DKM A;  2A52 B;  3SVC A;  5EXC I;  5DTL A;  3SVD A;  3SST A;  3KCS A;  1KYS A;  1GGX A;  3CFF A;  3UFZ A;  1EMM A;  2H5O A;  3EK4 A;  5EXB A;  2V4E B;  4H3M A;  2VVI A;  2YFP A;  3PJB A;  5DPH A;  1GFL A;  2G2S B;  2O2B A;  4XGY A;  2C9I A;  3WLD A;  2G6X A;  2IE2 A;  4KF5 A;  3ST4 A;  5HZS A;  5F9G A;  3RWT A;  3SS0 A;  3ST2 A;  4L1I A;  1RMP A;  3SVB A;  4W6M A;  4OY4 A;  3DQ6 A;  1HUY A;  4LW5 A;  2IB5 A;  3DQK A;  3U0M A;  2H5Q A;  2BTJ A;  3NEZ A;  1ZUX A;  1Q73 A;  3ZUJ A;  3DQM A;  2G6Y A;  4IK3 A;  1GL4 A;  4XVP A;  1YFP A;  2ARL A;  5J2O A;  4EMQ A;  4OHS A;  2WHS A;  3AI5 A;  2YE0 A;  5FVF A;  5BTT A;  2JAD A;  5BT0 A;  2DUG A;  2VZX A;  2PXW A;  4W6B A;  4RTC A;  1ZGQ A;  1KYP A;  3O77 A;  3W1D A;  4HQ9 A;  4EUL A;  5EB7 A;  3DQF A;  3NF0 A;  4W6T A;  4W6I A;  2V4E C;  3CFA A;  3IP2 A;  3P28 A;  1EMF A;  1JBY A;  4W6C A; 
#chains in the Genus database with same CATH topology
 2YDZ A;  4XOV A;  3SVN A;  3AI4 A;  3I19 A;  4PFE A;  2OKY A;  2HFC A;  2HQK A;  5HZT A;  3CB9 A;  1EMC A;  3ZUF A;  2ZMW A;  4LJB A;  2QT2 A;  2WHT A;  3OSQ A;  4KA9 A;  1KYR A;  2OTB A;  3SVS A;  1Q4B A;  2Z6Y A;  3E5W A;  4W6K A;  4DXQ A;  3NED A;  4KGF A;  4R6B A;  4EDO A;  4ZF3 A;  4KW9 A;  1EMG A;  3M22 A;  4P1Q A;  2HGD A;  4B30 B;  4AR7 A;  4W73 A;  2FZU A;  2G6E A;  2AHA A;  3W1C A;  4DXP A;  1YZW A;  5H89 A;  3DQC A;  5EXU A;  2OKW A;  4JC2 A;  3EK8 A;  1RRX A;  3EVP A;  4IZN A;  2QLH A;  3CBE A;  4W7E A;  4RYS A;  1F09 A;  1ZGO A;  3BXB A;  3U0L A;  2GW4 B;  2G5Z B;  2O24 A;  5LTP A;  4JEO A;  3ZTF A;  3LF3 A;  4W69 A;  5H88 A;  4KW4 A;  4H3L A;  4HE4 A;  5DTZ A;  4H48 A;  2RH7 A;  4L12 A;  4Q7R A;  3VHT B;  3WCK A;  4LJD A;  2H6V A;  3ST3 A;  1W7T A;  3CGL A;  1YHI A;  4LJC A;  2QRF A;  4KW8 A;  1Q4A A;  5DQM A;  1YJF A;  4GES B;  4W7R A;  3VK1 A;  4ZFS A;  3H1R A;  1Q4C A;  1Z1P A;  4EN1 A;  3DQJ A;  4DXI A;  3PJ5 A;  4H47 A;  4ZF4 A;  3DQI A;  2H5R A;  1EMK A;  2IOV A;  2H5P A;  3ED8 A;  1YJ2 A;  1UIS A;  3EVR A;  1HCJ A;  2A56 B;  2DDC A;  3G9A A;  5BQL A;  5DY6 A;  1OXE A;  1EMB A;  4Q7T A;  2C9J A;  1OXD A;  2OTE A;  3SSP A;  2ZMU A;  4W6U A;  2HQZ A;  4Z4M A;  2QLE A;  3DQ9 A;  2HCG A;  2DUF A;  3UG0 A;  3ZUL A;  2GX0 A;  2A48 A;  3VHT A;  1BFP A;  2B3P A;  2H8Q A;  5FHV A;  3DQ8 A;  3SV5 A;  3U8C A;  2Z6Z A;  3SG2 A;  2ICR A;  4BDU A;  3O78 A;  4TZG A;  1XSS A;  3NT9 A;  5HW9 A;  2QLG B;  4KF4 A;  4W6J A;  3RWA A;  4W7A A;  2DUI A;  2Q6P A;  4GOB A;  2V4E A;  2A47 A;  5DRG A;  4W7D A;  4Z4K A;  4ZIN A;  1JC0 A;  4W6A A;  4DXO A;  2HRS A;  3SG4 A;  4W6O A;  2QU1 A;  3SSY A;  3LSA A;  3EKH A;  4W7C A;  3LS3 A;  5FVG A;  3M24 A;  5EJU A;  1KP5 A;  4PPK A;  4H3N A;  3LVD A;  3PJ7 A;  1S6Z A;  1OXF A;  4W6D A;  4W6G A;  2A46 A;  2FWQ A;  4LQT A;  3DQO A;  4JF9 A;  2Z1O A;  3U0N A;  4KEX A;  4NWS A;  5DPG A;  4N3D A;  3SVE A;  3TMR A;  3U8A A;  4AS8 A;  4DKN A;  4ZIO A;  4W6N A;  3SVR A;  2EMD A;  5DPI A;  3SSV A;  2DD9 A;  2HPW A;  2WSO A;  2POX A;  2EMN A;  4ZB1 A;  5LK4 A;  4Q9W A;  2QLG A;  2AH8 A;  3SSK A;  4W6F A;  4J88 A;  4W74 A;  3ST0 A;  4W7X A;  3DQ2 A;  4ZF5 A;  2IB6 A;  3OGO A;  4R6D A;  3DQA A;  5T3I A;  4OQW A;  4W6S A;  1Q4D A;  5EB6 A;  2WIS A;  3BX9 A;  4HQ8 A;  2OGR A;  4I2Y A;  4PPJ A;  2Q57 A;  4TZA A;  3GL4 A;  1MOV A;  3TMT A;  1QYF A;  3GB3 A;  4KAG A;  4GF6 B;  3DQU A;  5LTQ A;  2DD7 A;  3LVA A;  4B5Y A;  3CD1 A;  4W6R A;  3U8P A;  1RMM A;  2QLI A;  4HQC A;  4IK1 A;  2B3Q A;  1Z1Q A;  2Y0G A;  5HZO A;  4B30 A;  4ORN A;  2AWK A;  1XMZ A;  5KTG A;  2P4M A;  3IR8 A;  1H4U A;  4Q7U A;  4EDS A;  2FL1 A;  5BTT B;  2WIQ A;  2H9W A;  4J89 A;  2G3D B;  1RMO A;  4W6L A;  2WSN A;  3DQE A;  1JC1 A;  5DTY A;  4W6P A;  2ZO6 A;  3DQ1 A;  4PPL A;  4UTS A;  4DXM A;  5FVI A;  4Q9X A;  2VVJ A;  1MOU A;  2GX2 A;  4IK5 A;  2PXS A;  5LTR A;  4L13 A;  4KF5 C;  1QYQ A;  1YHH A;  3DPX A;  3SRY A;  1XQM A;  1QXT A;  4JGE A;  3DQL A;  3SSL A;  5DPJ A;  1H6R A;  2A53 B;  2AWL A;  3DQN A;  4U2V A;  2DDD A;  3OSR A;  4KPI A;  3SG6 A;  3S05 A;  4J8A A;  3SVO A;  2A54 B;  3DQ3 A;  1XAE A;  3DQD A;  3EK7 A;  5H87 A;  4IK9 A;  4OJ0 A;  3V3D A;  1QYO A;  1EME A;  5HBD A;  3LVC A;  4ZBL A;  3VIC A;  2EMO A;  2HGY A;  3BXC A;  1JBZ A;  2G16 B;  3EKJ A;  1EML A;  1G7K A;  3E5T A;  1Q4E A;  5DTX A;  3AKO A;  3DPW A;  3CD9 A;  4DXN A;  3A8S A;  3H1O A;  3SG5 A;  1MYW A;  3GJ1 A;  3NT3 A;  2VAE A;  3SVU A;  1XA9 A;  1W7U A;  4XL5 A;  1YHG A;  3MGF A;  4W77 A;  2YE1 A;  3LA1 A;  2AWM A;  3ADF A;  3DQ5 A;  3SSH A;  2HJO A;  4IK4 A;  4LQU A;  2AWJ A;  3LF4 B;  2G3O A;  4P76 A;  3KCT A;  1W7S A;  4OGS A;  1EMA A;  2OJK A;  1RM9 A;  3CFH A;  2DUE A;  5EHU A;  3DQH A;  3E5V A;  4KGE A;  2VVH A;  1ZGP A;  3SG3 A;  2WHU A;  3BXA A;  5HZU A;  5DRF A;  4W76 A;  5DQB A;  1C4F A;  1CV7 A;  3DQ7 A;  2O29 A;  3U0K A;  3WLC A;  4IK8 A;  4XOW A;  1QY3 A;  5AQB B;  3GEX A;  2VAD A;  3DQ4 A;  3SG7 A;  3EVU A;  2WUR A;  3K1K A;  3P8U A;  4RYW A;  3EVV A;  5HGE A;  3DPZ A;  4JRB A;  5DU0 A;  4ANJ A;  4JFG A;  3GJ2 A;  3PIB A;  2ZO7 A;  2DUH A;  4W7F A;  1B9C A;  4W72 A;  2Z6X A;  2A50 B;  2GW3 A;  5EBJ A;  1F0B A;  2QZ0 A;  4HVF A;  4W6H A;  4W75 A;  4LJD C;  4DKM A;  2A52 B;  3SVC A;  5EXC I;  5DTL A;  3SVD A;  3SST A;  3KCS A;  1KYS A;  1GGX A;  3CFF A;  3UFZ A;  1EMM A;  2H5O A;  3EK4 A;  5EXB A;  2V4E B;  4H3M A;  2VVI A;  2YFP A;  3PJB A;  5DPH A;  1GFL A;  2G2S B;  2O2B A;  4XGY A;  2C9I A;  3WLD A;  2G6X A;  2IE2 A;  4KF5 A;  3ST4 A;  5HZS A;  5F9G A;  3RWT A;  3SS0 A;  3ST2 A;  4L1I A;  1RMP A;  3SVB A;  4W6M A;  4OY4 A;  3DQ6 A;  1HUY A;  4LW5 A;  2IB5 A;  3DQK A;  3U0M A;  2H5Q A;  2BTJ A;  3NEZ A;  1ZUX A;  1Q73 A;  3ZUJ A;  3DQM A;  2G6Y A;  4IK3 A;  1GL4 A;  4XVP A;  1YFP A;  2ARL A;  5J2O A;  4EMQ A;  4OHS A;  2WHS A;  3AI5 A;  2YE0 A;  5FVF A;  5BTT A;  2JAD A;  5BT0 A;  2DUG A;  2VZX A;  2PXW A;  4W6B A;  4RTC A;  1ZGQ A;  1KYP A;  3O77 A;  3W1D A;  4HQ9 A;  4EUL A;  5EB7 A;  3DQF A;  3NF0 A;  4W6T A;  4W6I A;  2V4E C;  3CFA A;  3IP2 A;  3P28 A;  1EMF A;  1JBY A;  4W6C A; 
#chains in the Genus database with same CATH homology
 2YDZ A;  4XOV A;  3SVN A;  3AI4 A;  3I19 A;  4PFE A;  2OKY A;  2HFC A;  2HQK A;  5HZT A;  3CB9 A;  1EMC A;  3ZUF A;  2ZMW A;  4LJB A;  2QT2 A;  2WHT A;  3OSQ A;  4KA9 A;  1KYR A;  2OTB A;  3SVS A;  1Q4B A;  2Z6Y A;  3E5W A;  4W6K A;  4DXQ A;  3NED A;  4KGF A;  4R6B A;  4EDO A;  4ZF3 A;  4KW9 A;  1EMG A;  3M22 A;  4P1Q A;  2HGD A;  4B30 B;  4AR7 A;  4W73 A;  2FZU A;  2G6E A;  2AHA A;  3W1C A;  4DXP A;  1YZW A;  5H89 A;  3DQC A;  5EXU A;  2OKW A;  4JC2 A;  3EK8 A;  1RRX A;  3EVP A;  4IZN A;  2QLH A;  3CBE A;  4W7E A;  4RYS A;  1F09 A;  1ZGO A;  3BXB A;  3U0L A;  2GW4 B;  2G5Z B;  2O24 A;  5LTP A;  4JEO A;  3ZTF A;  3LF3 A;  4W69 A;  5H88 A;  4KW4 A;  4H3L A;  4HE4 A;  5DTZ A;  4H48 A;  2RH7 A;  4L12 A;  4Q7R A;  3VHT B;  3WCK A;  4LJD A;  2H6V A;  3ST3 A;  1W7T A;  3CGL A;  1YHI A;  4LJC A;  2QRF A;  4KW8 A;  1Q4A A;  5DQM A;  1YJF A;  4GES B;  4W7R A;  3VK1 A;  4ZFS A;  3H1R A;  1Q4C A;  1Z1P A;  4EN1 A;  3DQJ A;  4DXI A;  3PJ5 A;  4H47 A;  4ZF4 A;  3DQI A;  2H5R A;  1EMK A;  2IOV A;  2H5P A;  3ED8 A;  1YJ2 A;  1UIS A;  3EVR A;  1HCJ A;  2A56 B;  2DDC A;  3G9A A;  5BQL A;  5DY6 A;  1OXE A;  1EMB A;  4Q7T A;  2C9J A;  1OXD A;  2OTE A;  3SSP A;  2ZMU A;  4W6U A;  2HQZ A;  4Z4M A;  2QLE A;  3DQ9 A;  2HCG A;  2DUF A;  3UG0 A;  3ZUL A;  2GX0 A;  2A48 A;  3VHT A;  1BFP A;  2B3P A;  2H8Q A;  5FHV A;  3DQ8 A;  3SV5 A;  3U8C A;  2Z6Z A;  3SG2 A;  2ICR A;  4BDU A;  3O78 A;  4TZG A;  1XSS A;  3NT9 A;  5HW9 A;  2QLG B;  4KF4 A;  4W6J A;  3RWA A;  4W7A A;  2DUI A;  2Q6P A;  4GOB A;  2V4E A;  2A47 A;  5DRG A;  4W7D A;  4Z4K A;  4ZIN A;  1JC0 A;  4W6A A;  4DXO A;  2HRS A;  3SG4 A;  4W6O A;  2QU1 A;  3SSY A;  3LSA A;  3EKH A;  4W7C A;  3LS3 A;  5FVG A;  3M24 A;  5EJU A;  1KP5 A;  4PPK A;  4H3N A;  3LVD A;  3PJ7 A;  1S6Z A;  1OXF A;  4W6D A;  4W6G A;  2A46 A;  2FWQ A;  4LQT A;  3DQO A;  4JF9 A;  2Z1O A;  3U0N A;  4KEX A;  4NWS A;  5DPG A;  4N3D A;  3SVE A;  3TMR A;  3U8A A;  4AS8 A;  4DKN A;  4ZIO A;  4W6N A;  3SVR A;  2EMD A;  5DPI A;  3SSV A;  2DD9 A;  2HPW A;  2WSO A;  2POX A;  2EMN A;  4ZB1 A;  5LK4 A;  4Q9W A;  2QLG A;  2AH8 A;  3SSK A;  4W6F A;  4J88 A;  4W74 A;  3ST0 A;  4W7X A;  3DQ2 A;  4ZF5 A;  2IB6 A;  3OGO A;  4R6D A;  3DQA A;  5T3I A;  4OQW A;  4W6S A;  1Q4D A;  5EB6 A;  2WIS A;  3BX9 A;  4HQ8 A;  2OGR A;  4I2Y A;  4PPJ A;  2Q57 A;  4TZA A;  3GL4 A;  1MOV A;  3TMT A;  1QYF A;  3GB3 A;  4KAG A;  4GF6 B;  3DQU A;  5LTQ A;  2DD7 A;  3LVA A;  4B5Y A;  3CD1 A;  4W6R A;  3U8P A;  1RMM A;  2QLI A;  4HQC A;  4IK1 A;  2B3Q A;  1Z1Q A;  2Y0G A;  5HZO A;  4B30 A;  4ORN A;  2AWK A;  1XMZ A;  5KTG A;  2P4M A;  3IR8 A;  1H4U A;  4Q7U A;  4EDS A;  2FL1 A;  5BTT B;  2WIQ A;  2H9W A;  4J89 A;  2G3D B;  1RMO A;  4W6L A;  2WSN A;  3DQE A;  1JC1 A;  5DTY A;  4W6P A;  2ZO6 A;  3DQ1 A;  4PPL A;  4UTS A;  4DXM A;  5FVI A;  4Q9X A;  2VVJ A;  1MOU A;  2GX2 A;  4IK5 A;  2PXS A;  5LTR A;  4L13 A;  4KF5 C;  1QYQ A;  1YHH A;  3DPX A;  3SRY A;  1XQM A;  1QXT A;  4JGE A;  3DQL A;  3SSL A;  5DPJ A;  1H6R A;  2A53 B;  2AWL A;  3DQN A;  4U2V A;  2DDD A;  3OSR A;  4KPI A;  3SG6 A;  3S05 A;  4J8A A;  3SVO A;  2A54 B;  3DQ3 A;  1XAE A;  3DQD A;  3EK7 A;  5H87 A;  4IK9 A;  4OJ0 A;  3V3D A;  1QYO A;  1EME A;  5HBD A;  3LVC A;  4ZBL A;  3VIC A;  2EMO A;  2HGY A;  3BXC A;  1JBZ A;  2G16 B;  3EKJ A;  1EML A;  1G7K A;  3E5T A;  1Q4E A;  5DTX A;  3AKO A;  3DPW A;  3CD9 A;  4DXN A;  3A8S A;  3H1O A;  3SG5 A;  1MYW A;  3GJ1 A;  3NT3 A;  2VAE A;  3SVU A;  1XA9 A;  1W7U A;  4XL5 A;  1YHG A;  3MGF A;  4W77 A;  2YE1 A;  3LA1 A;  2AWM A;  3ADF A;  3DQ5 A;  3SSH A;  2HJO A;  4IK4 A;  4LQU A;  2AWJ A;  3LF4 B;  2G3O A;  4P76 A;  3KCT A;  1W7S A;  4OGS A;  1EMA A;  2OJK A;  1RM9 A;  3CFH A;  2DUE A;  5EHU A;  3DQH A;  3E5V A;  4KGE A;  2VVH A;  1ZGP A;  3SG3 A;  2WHU A;  3BXA A;  5HZU A;  5DRF A;  4W76 A;  5DQB A;  1C4F A;  1CV7 A;  3DQ7 A;  2O29 A;  3U0K A;  3WLC A;  4IK8 A;  4XOW A;  1QY3 A;  5AQB B;  3GEX A;  2VAD A;  3DQ4 A;  3SG7 A;  3EVU A;  2WUR A;  3K1K A;  3P8U A;  4RYW A;  3EVV A;  5HGE A;  3DPZ A;  4JRB A;  5DU0 A;  4ANJ A;  4JFG A;  3GJ2 A;  3PIB A;  2ZO7 A;  2DUH A;  4W7F A;  1B9C A;  4W72 A;  2Z6X A;  2A50 B;  2GW3 A;  5EBJ A;  1F0B A;  2QZ0 A;  4HVF A;  4W6H A;  4W75 A;  4LJD C;  4DKM A;  2A52 B;  3SVC A;  5EXC I;  5DTL A;  3SVD A;  3SST A;  3KCS A;  1KYS A;  1GGX A;  3CFF A;  3UFZ A;  1EMM A;  2H5O A;  3EK4 A;  5EXB A;  2V4E B;  4H3M A;  2VVI A;  2YFP A;  3PJB A;  5DPH A;  1GFL A;  2G2S B;  2O2B A;  4XGY A;  2C9I A;  3WLD A;  2G6X A;  2IE2 A;  4KF5 A;  3ST4 A;  5HZS A;  5F9G A;  3RWT A;  3SS0 A;  3ST2 A;  4L1I A;  1RMP A;  3SVB A;  4W6M A;  4OY4 A;  3DQ6 A;  1HUY A;  4LW5 A;  2IB5 A;  3DQK A;  3U0M A;  2H5Q A;  2BTJ A;  3NEZ A;  1ZUX A;  1Q73 A;  3ZUJ A;  3DQM A;  2G6Y A;  4IK3 A;  1GL4 A;  4XVP A;  1YFP A;  2ARL A;  5J2O A;  4EMQ A;  4OHS A;  2WHS A;  3AI5 A;  2YE0 A;  5FVF A;  5BTT A;  2JAD A;  5BT0 A;  2DUG A;  2VZX A;  2PXW A;  4W6B A;  4RTC A;  1ZGQ A;  1KYP A;  3O77 A;  3W1D A;  4HQ9 A;  4EUL A;  5EB7 A;  3DQF A;  3NF0 A;  4W6T A;  4W6I A;  2V4E C;  3CFA A;  3IP2 A;  3P28 A;  1EMF A;  1JBY A;  4W6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...