4W6PA

Crystal structure of full-length split gfp mutant d102c disulfide dimer, p 21 21 21 space group
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
217
Chain Sequence
GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQAFSRYPDHDFFKSAMPEGYVQERTIYFKCDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDGDLPDDHYLSTQTILSKDLNEKRDHMVLLEYVTAAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein D102C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 53
structure length 217
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w6pA00
1S6ZA 2EMDA 2AWJA 3GB3A 3U8AA 4JEOA 1Z1PA 2G5ZB 4EULA 4Q7RA 3PJ7A 5KTGA 5LTPA 4OJ0A 3GJ1A 1W7UA 2H5RA 3WCKA 3M22A 4W6JA 1KP5A 1MOVA 2FZUA 2HFCA 3NT9A 5LTQA 4Q7UA 3DQ4A 2G6XA 4W7AA 1Q4AA 3P8UA 3ADFA 2Z6ZA 3U0LA 1RMMA 3AI5A 2A56B 5EB6A 4EDSA 2ZO6A 1Q4CA 4HE4A 2C9JA 1Q4DA 4U2VA 3GL4A 4TZAA 2QLGB 5FHVA 2GW3A 2QRFA 1OXEA 3DQEA 1QY3A 2HRSA 3OSRA 2A47A 3LF4B 2WURA 1EMCA 4PPLA 3KCSA 1GFLA 1RM9A 3SG4A 5DTXA 4W75A 5BT0A 3CD1A 4AR7A 2OKYA 3SG3A 2QLHA 3DQKA 4JF9A 3G9AA 2AWKA 3U8CA 4JC2A 1G7KA 1EMFA 4HVFA 4L13A 3ST2A 2G6YA 3CBEA 5DTLA 4LQTA 2ARLA 1HCJA 5BQLA 2IB6A 4W6AA 2H5PA 1YFPA 2ICRA 2V4EA 3WLDA 3RWAA 1B9CA 3CD9A 4H3LA 4LJDA 3DQAA 3NF0A 3E5TA 4ZB1A 3ZTFA 2DDDA 2QLIA 3DPZA 3CGLA 4XVPA 4GOBA 3PJ5A 4XOWA 4Z4MA 3E5WA 4ZIOA 4LQUA 3UG0A 2OKWA 4W6HA 3SVBA 4JFGA 1GL4A 2IOVA 3DQMA 2H9WA 1YHGA 4LJDC 4XGYA 2QT2A 3SS0A 4Z4KA 4R6DA 2HGYA 3ST3A 3DPXA 1JC1A 2OGRA 2HPWA 4I2YA 3DQHA 3OGOA 3IP2A 2PXSA 3DQFA 5H89A 4LJBA 2WISA 4Q7TA 4W6KA 4EN1A 2WHTA 1EMBA 1W7TA 5DY6A 5J2OA 2WSNA 4GESB 3LA1A 1HUYA 3H1RA 2WHSA 1EMGA 4W7DA 4ZBLA 1YJ2A 1YZWA 4W6CA 2A50B 2HGDA 3EVUA 4N3DA 5DTZA 3DQIA 3LS3A 2DUEA 3SSVA 2A52B 2YFPA 3SSPA 4W7EA 3SVOA 4OGSA 4ZINA 1JBYA 4EMQA 3EVRA 5FVGA 3W1CA 2QZ0A 5F9GA 3TMTA 4HQCA 3SSTA 3K1KA 2HCGA 1KYPA 4IK9A 4L1IA 2DD7A 3DQ8A 2DDCA 3LF3A 1XAEA 2GW4B 3DQ6A 2FL1A 2IE2A 4W6SA 2OTEA 2C9IA 3SVRA 4W6GA 1MYWA 3SRYA 3IR8A 4KF5A 3TMRA 2Y0GA 4J88A 2Z1OA 2G3OA 4W7XA 5AQBB 2O29A 2G3DB 2GX0A 3EK8A 5DPJA 2OJKA 2ZMWA 4W6LA 4NWSA 3P28A 3SVEA 2HQKA 2AWLA 2YDZA 1EMEA 5H88A 4DKMA 4KF5C 3KCTA 4DXNA 3DQJA 3UFZA 4W6FA 2H6VA 4RYWA 3DQ7A 3WLCA 1ZGPA 3SSLA 3LSAA 3EVPA 2Z6XA 2VAEA 4DXMA 2QU1A 2RH7A 4W74A 1YHHA 5DPHA 3A8SA 3ED8A 2G2SB 3W1DA 5HZSA 2H5OA 1QYFA 1XA9A 5DQMA 5BTTB 4BDUA 2O24A 3M24A 4DXIA 3U8PA 3BXCA 1Z1QA 3RWTA 2G6EA 3DQDA 3EK7A 4KW4A 4DXPA 4W77A 3ST4A 3SSKA 4J8AA 4LJCA 2G16B 5HW9A 2VVIA 4W76A 2A53B 2ZO7A 4LW5A 4ZF5A 4KPIA 2OTBA 1YHIA 4IK1A 2QLEA 4JRBA 5DQBA 3SG6A 3S05A 4XOVA 2EMNA 4DKNA 3CB9A 3U0KA 5EJUA 3E5VA 1CV7A 4IZNA 1H4UA 3LVDA 4ORNA 3U0NA 2A48A 2HQZA 4J89A 3DQCA 3VHTB 3SVNA 3EK4A 3SVCA 4B5YA 4OY4A 3GJ2A 4GF6B 4ANJA 2O2BA 1XMZA 4IK8A 3O78A 2JADA 2P4MA 1ZGQA 3NT3A 4KW9A 1RMOA 3AKOA 1Q4EA 1GGXA 3EKHA 4RTCA 2VVJA 4W7RA 4W69A 5HZUA 3ZUJA 4HQ8A 4ZFSA 2Q57A 3NEDA 5DU0A 3DQ3A 3SSYA 4RYSA 4OQWA 3EVVA 3NEZA 4KEXA 4Q9XA 1KYRA 3DQNA 3DQ9A 3EKJA 3SG7A 3ZULA 1EMLA 4JGEA 4UTSA 3VK1A 5BTTA 2Q6PA 1MOUA 3MGFA 3CFHA 2HJOA 3SG5A 4W6OA 4OHSA 1JBZA 4KW8A 4R6BA 4P76A 3PIBA 2WIQA 2FWQA 1JC0A 4PFEA 1XQMA 4W6IA 4H48A 4ZF4A 2WSOA 3DQ2A 5FVIA 2WHUA 2BTJA 2VADA 5EB7A 4IK4A 1Q4BA 4IK5A 5EXBA 3BXBA 1ZGOA 4Q9WA 3GEXA 4H3NA 2PXWA 5LK4A 2ZMUA 4W6NA 1F09A 1F0BA 1Q73A 1EMKA 1OXDA 2DUFA 4W6UA 5FVFA 1QXTA 4B30A 2DD9A 4KGFA 3ST0A 3U0MA 3VHTA 3H1OA 3DQ1A 5HZTA 3V3DA 3I19A 4ZF3A 2AH8A 5HZOA 4AS8A 5DRGA 3SV5A 4KA9A 1KYSA 4HQ9A 4W6RA 4W6DA 4DXQA 3PJBA 3VICA 2A46A 4W6MA 4H47A 3LVAA 4KAGA 2B3PA 4W7CA 3DQ5A 1UISA 4W72A 1RRXA 4W73A 2POXA 1EMAA 3O77A 3BXAA 4PPJA 4B30B 2IB5A 5DTYA 5H87A 2DUGA 2V4EC 3CFFA 4PPKA 2VVHA 3ZUFA 2YE0A 3SSHA 2AWMA 3LVCA 3DQUA 2A54B 2EMOA 4KGEA 5EHUA 5EBJA 4TZGA 3BX9A 4W6BA 1C4FA 4XL5A 5DRFA 4IK3A 1QYQA 4DXOA 1OXFA 4H3MA 3CFAA 4EDOA 5DPIA 4W7FA 5EXCI 2GX2A 5EXUA 1RMPA 1QYOA 2VZXA 5T3IA 5HBDA 3SVSA 2B3QA 5DPGA 5HGEA 3SG2A 1YJFA 2AHAA 2V4EB 2DUIA 3OSQA 3DQLA 2YE1A 4W6PA 5LTRA 2QLGA 4L12A 3DPWA 3AI4A 1ZUXA 2H8QA 1H6RA 1EMMA 4P1QA 3SVUA 3SVDA 1W7SA 1BFPA 2Z6YA 3DQOA 2H5QA 4KF4A 4W6TA 2DUHA 1XSSA
chains in the Genus database with same CATH superfamily
1S6ZA 2EMDA 2AWJA 3GB3A 3U8AA 4JEOA 1Z1PA 2G5ZB 4EULA 4Q7RA 3PJ7A 5KTGA 5LTPA 4OJ0A 3GJ1A 1W7UA 2H5RA 3WCKA 3M22A 4W6JA 1KP5A 1MOVA 2FZUA 2HFCA 3NT9A 5LTQA 4Q7UA 3DQ4A 2G6XA 4W7AA 1Q4AA 3P8UA 3ADFA 2Z6ZA 3U0LA 1RMMA 3AI5A 2A56B 5EB6A 4EDSA 2ZO6A 1Q4CA 4HE4A 2C9JA 1Q4DA 4U2VA 3GL4A 4TZAA 2QLGB 5FHVA 2GW3A 2QRFA 1OXEA 3DQEA 1QY3A 2HRSA 3OSRA 2A47A 3LF4B 2WURA 1EMCA 4PPLA 3KCSA 1GFLA 1RM9A 3SG4A 5DTXA 4W75A 5BT0A 3CD1A 4AR7A 2OKYA 3SG3A 2QLHA 3DQKA 4JF9A 3G9AA 2AWKA 3U8CA 4JC2A 1G7KA 1EMFA 4HVFA 4L13A 3ST2A 2G6YA 3CBEA 5DTLA 4LQTA 2ARLA 1HCJA 5BQLA 2IB6A 4W6AA 2H5PA 1YFPA 2ICRA 2V4EA 3WLDA 3RWAA 1B9CA 3CD9A 4H3LA 4LJDA 3DQAA 3NF0A 3E5TA 4ZB1A 3ZTFA 2DDDA 2QLIA 3DPZA 3CGLA 4XVPA 4GOBA 3PJ5A 4XOWA 4Z4MA 3E5WA 4ZIOA 4LQUA 3UG0A 2OKWA 4W6HA 3SVBA 4JFGA 1GL4A 2IOVA 3DQMA 2H9WA 1YHGA 4LJDC 4XGYA 2QT2A 3SS0A 4Z4KA 4R6DA 2HGYA 3ST3A 3DPXA 1JC1A 2OGRA 2HPWA 4I2YA 3DQHA 3OGOA 3IP2A 2PXSA 3DQFA 5H89A 4LJBA 2WISA 4Q7TA 4W6KA 4EN1A 2WHTA 1EMBA 1W7TA 5DY6A 5J2OA 2WSNA 4GESB 3LA1A 1HUYA 3H1RA 2WHSA 1EMGA 4W7DA 4ZBLA 1YJ2A 1YZWA 4W6CA 2A50B 2HGDA 3EVUA 4N3DA 5DTZA 3DQIA 3LS3A 2DUEA 3SSVA 2A52B 2YFPA 3SSPA 4W7EA 3SVOA 4OGSA 4ZINA 1JBYA 4EMQA 3EVRA 5FVGA 3W1CA 2QZ0A 5F9GA 3TMTA 4HQCA 3SSTA 3K1KA 2HCGA 1KYPA 4IK9A 4L1IA 2DD7A 3DQ8A 2DDCA 3LF3A 1XAEA 2GW4B 3DQ6A 2FL1A 2IE2A 4W6SA 2OTEA 2C9IA 3SVRA 4W6GA 1MYWA 3SRYA 3IR8A 4KF5A 3TMRA 2Y0GA 4J88A 2Z1OA 2G3OA 4W7XA 5AQBB 2O29A 2G3DB 2GX0A 3EK8A 5DPJA 2OJKA 2ZMWA 4W6LA 4NWSA 3P28A 3SVEA 2HQKA 2AWLA 2YDZA 1EMEA 5H88A 4DKMA 4KF5C 3KCTA 4DXNA 3DQJA 3UFZA 4W6FA 2H6VA 4RYWA 3DQ7A 3WLCA 1ZGPA 3SSLA 3LSAA 3EVPA 2Z6XA 2VAEA 4DXMA 2QU1A 2RH7A 4W74A 1YHHA 5DPHA 3A8SA 3ED8A 2G2SB 3W1DA 5HZSA 2H5OA 1QYFA 1XA9A 5DQMA 5BTTB 4BDUA 2O24A 3M24A 4DXIA 3U8PA 3BXCA 1Z1QA 3RWTA 2G6EA 3DQDA 3EK7A 4KW4A 4DXPA 4W77A 3ST4A 3SSKA 4J8AA 4LJCA 2G16B 5HW9A 2VVIA 4W76A 2A53B 2ZO7A 4LW5A 4ZF5A 4KPIA 2OTBA 1YHIA 4IK1A 2QLEA 4JRBA 5DQBA 3SG6A 3S05A 4XOVA 2EMNA 4DKNA 3CB9A 3U0KA 5EJUA 3E5VA 1CV7A 4IZNA 1H4UA 3LVDA 4ORNA 3U0NA 2A48A 2HQZA 4J89A 3DQCA 3VHTB 3SVNA 3EK4A 3SVCA 4B5YA 4OY4A 3GJ2A 4GF6B 4ANJA 2O2BA 1XMZA 4IK8A 3O78A 2JADA 2P4MA 1ZGQA 3NT3A 4KW9A 1RMOA 3AKOA 1Q4EA 1GGXA 3EKHA 4RTCA 2VVJA 4W7RA 4W69A 5HZUA 3ZUJA 4HQ8A 4ZFSA 2Q57A 3NEDA 5DU0A 3DQ3A 3SSYA 4RYSA 4OQWA 3EVVA 3NEZA 4KEXA 4Q9XA 1KYRA 3DQNA 3DQ9A 3EKJA 3SG7A 3ZULA 1EMLA 4JGEA 4UTSA 3VK1A 5BTTA 2Q6PA 1MOUA 3MGFA 3CFHA 2HJOA 3SG5A 4W6OA 4OHSA 1JBZA 4KW8A 4R6BA 4P76A 3PIBA 2WIQA 2FWQA 1JC0A 4PFEA 1XQMA 4W6IA 4H48A 4ZF4A 2WSOA 3DQ2A 5FVIA 2WHUA 2BTJA 2VADA 5EB7A 4IK4A 1Q4BA 4IK5A 5EXBA 3BXBA 1ZGOA 4Q9WA 3GEXA 4H3NA 2PXWA 5LK4A 2ZMUA 4W6NA 1F09A 1F0BA 1Q73A 1EMKA 1OXDA 2DUFA 4W6UA 5FVFA 1QXTA 4B30A 2DD9A 4KGFA 3ST0A 3U0MA 3VHTA 3H1OA 3DQ1A 5HZTA 3V3DA 3I19A 4ZF3A 2AH8A 5HZOA 4AS8A 5DRGA 3SV5A 4KA9A 1KYSA 4HQ9A 4W6RA 4W6DA 4DXQA 3PJBA 3VICA 2A46A 4W6MA 4H47A 3LVAA 4KAGA 2B3PA 4W7CA 3DQ5A 1UISA 4W72A 1RRXA 4W73A 2POXA 1EMAA 3O77A 3BXAA 4PPJA 4B30B 2IB5A 5DTYA 5H87A 2DUGA 2V4EC 3CFFA 4PPKA 2VVHA 3ZUFA 2YE0A 3SSHA 2AWMA 3LVCA 3DQUA 2A54B 2EMOA 4KGEA 5EHUA 5EBJA 4TZGA 3BX9A 4W6BA 1C4FA 4XL5A 5DRFA 4IK3A 1QYQA 4DXOA 1OXFA 4H3MA 3CFAA 4EDOA 5DPIA 4W7FA 5EXCI 2GX2A 5EXUA 1RMPA 1QYOA 2VZXA 5T3IA 5HBDA 3SVSA 2B3QA 5DPGA 5HGEA 3SG2A 1YJFA 2AHAA 2V4EB 2DUIA 3OSQA 3DQLA 2YE1A 4W6PA 5LTRA 2QLGA 4L12A 3DPWA 3AI4A 1ZUXA 2H8QA 1H6RA 1EMMA 4P1QA 3SVUA 3SVDA 1W7SA 1BFPA 2Z6YA 3DQOA 2H5QA 4KF4A 4W6TA 2DUHA 1XSSA
chains in the Genus database with same CATH topology
1S6ZA 2EMDA 2AWJA 3GB3A 3U8AA 4JEOA 1Z1PA 2G5ZB 4EULA 4Q7RA 3PJ7A 5KTGA 5LTPA 4OJ0A 3GJ1A 1W7UA 2H5RA 3WCKA 3M22A 4W6JA 1KP5A 1MOVA 2FZUA 2HFCA 3NT9A 5LTQA 4Q7UA 3DQ4A 2G6XA 4W7AA 1Q4AA 3P8UA 3ADFA 2Z6ZA 3U0LA 1RMMA 3AI5A 2A56B 5EB6A 4EDSA 2ZO6A 1Q4CA 4HE4A 2C9JA 1Q4DA 4U2VA 3GL4A 4TZAA 2QLGB 5FHVA 2GW3A 2QRFA 1OXEA 3DQEA 1QY3A 2HRSA 3OSRA 2A47A 3LF4B 2WURA 1EMCA 4PPLA 3KCSA 1GFLA 1RM9A 3SG4A 5DTXA 4W75A 5BT0A 3CD1A 4AR7A 2OKYA 3SG3A 2QLHA 3DQKA 4JF9A 3G9AA 2AWKA 3U8CA 4JC2A 1G7KA 1EMFA 4HVFA 4L13A 3ST2A 2G6YA 3CBEA 5DTLA 4LQTA 2ARLA 1HCJA 5BQLA 2IB6A 4W6AA 2H5PA 1YFPA 2ICRA 2V4EA 3WLDA 3RWAA 1B9CA 3CD9A 4H3LA 4LJDA 3DQAA 3NF0A 3E5TA 4ZB1A 3ZTFA 2DDDA 2QLIA 3DPZA 3CGLA 4XVPA 4GOBA 3PJ5A 4XOWA 4Z4MA 3E5WA 4ZIOA 4LQUA 3UG0A 2OKWA 4W6HA 3SVBA 4JFGA 1GL4A 2IOVA 3DQMA 2H9WA 1YHGA 4LJDC 4XGYA 2QT2A 3SS0A 4Z4KA 4R6DA 2HGYA 3ST3A 3DPXA 1JC1A 2OGRA 2HPWA 4I2YA 3DQHA 3OGOA 3IP2A 2PXSA 3DQFA 5H89A 4LJBA 2WISA 4Q7TA 4W6KA 4EN1A 2WHTA 1EMBA 1W7TA 5DY6A 5J2OA 2WSNA 4GESB 3LA1A 1HUYA 3H1RA 2WHSA 1EMGA 4W7DA 4ZBLA 1YJ2A 1YZWA 4W6CA 2A50B 2HGDA 3EVUA 4N3DA 5DTZA 3DQIA 3LS3A 2DUEA 3SSVA 2A52B 2YFPA 3SSPA 4W7EA 3SVOA 4OGSA 4ZINA 1JBYA 4EMQA 3EVRA 5FVGA 3W1CA 2QZ0A 5F9GA 3TMTA 4HQCA 3SSTA 3K1KA 2HCGA 1KYPA 4IK9A 4L1IA 2DD7A 3DQ8A 2DDCA 3LF3A 1XAEA 2GW4B 3DQ6A 2FL1A 2IE2A 4W6SA 2OTEA 2C9IA 3SVRA 4W6GA 1MYWA 3SRYA 3IR8A 4KF5A 3TMRA 2Y0GA 4J88A 2Z1OA 2G3OA 4W7XA 5AQBB 2O29A 2G3DB 2GX0A 3EK8A 5DPJA 2OJKA 2ZMWA 4W6LA 4NWSA 3P28A 3SVEA 2HQKA 2AWLA 2YDZA 1EMEA 5H88A 4DKMA 4KF5C 3KCTA 4DXNA 3DQJA 3UFZA 4W6FA 2H6VA 4RYWA 3DQ7A 3WLCA 1ZGPA 3SSLA 3LSAA 3EVPA 2Z6XA 2VAEA 4DXMA 2QU1A 2RH7A 4W74A 1YHHA 5DPHA 3A8SA 3ED8A 2G2SB 3W1DA 5HZSA 2H5OA 1QYFA 1XA9A 5DQMA 5BTTB 4BDUA 2O24A 3M24A 4DXIA 3U8PA 3BXCA 1Z1QA 3RWTA 2G6EA 3DQDA 3EK7A 4KW4A 4DXPA 4W77A 3ST4A 3SSKA 4J8AA 4LJCA 2G16B 5HW9A 2VVIA 4W76A 2A53B 2ZO7A 4LW5A 4ZF5A 4KPIA 2OTBA 1YHIA 4IK1A 2QLEA 4JRBA 5DQBA 3SG6A 3S05A 4XOVA 2EMNA 4DKNA 3CB9A 3U0KA 5EJUA 3E5VA 1CV7A 4IZNA 1H4UA 3LVDA 4ORNA 3U0NA 2A48A 2HQZA 4J89A 3DQCA 3VHTB 3SVNA 3EK4A 3SVCA 4B5YA 4OY4A 3GJ2A 4GF6B 4ANJA 2O2BA 1XMZA 4IK8A 3O78A 2JADA 2P4MA 1ZGQA 3NT3A 4KW9A 1RMOA 3AKOA 1Q4EA 1GGXA 3EKHA 4RTCA 2VVJA 4W7RA 4W69A 5HZUA 3ZUJA 4HQ8A 4ZFSA 2Q57A 3NEDA 5DU0A 3DQ3A 3SSYA 4RYSA 4OQWA 3EVVA 3NEZA 4KEXA 4Q9XA 1KYRA 3DQNA 3DQ9A 3EKJA 3SG7A 3ZULA 1EMLA 4JGEA 4UTSA 3VK1A 5BTTA 2Q6PA 1MOUA 3MGFA 3CFHA 2HJOA 3SG5A 4W6OA 4OHSA 1JBZA 4KW8A 4R6BA 4P76A 3PIBA 2WIQA 2FWQA 1JC0A 4PFEA 1XQMA 4W6IA 4H48A 4ZF4A 2WSOA 3DQ2A 5FVIA 2WHUA 2BTJA 2VADA 5EB7A 4IK4A 1Q4BA 4IK5A 5EXBA 3BXBA 1ZGOA 4Q9WA 3GEXA 4H3NA 2PXWA 5LK4A 2ZMUA 4W6NA 1F09A 1F0BA 1Q73A 1EMKA 1OXDA 2DUFA 4W6UA 5FVFA 1QXTA 4B30A 2DD9A 4KGFA 3ST0A 3U0MA 3VHTA 3H1OA 3DQ1A 5HZTA 3V3DA 3I19A 4ZF3A 2AH8A 5HZOA 4AS8A 5DRGA 3SV5A 4KA9A 1KYSA 4HQ9A 4W6RA 4W6DA 4DXQA 3PJBA 3VICA 2A46A 4W6MA 4H47A 3LVAA 4KAGA 2B3PA 4W7CA 3DQ5A 1UISA 4W72A 1RRXA 4W73A 2POXA 1EMAA 3O77A 3BXAA 4PPJA 4B30B 2IB5A 5DTYA 5H87A 2DUGA 2V4EC 3CFFA 4PPKA 2VVHA 3ZUFA 2YE0A 3SSHA 2AWMA 3LVCA 3DQUA 2A54B 2EMOA 4KGEA 5EHUA 5EBJA 4TZGA 3BX9A 4W6BA 1C4FA 4XL5A 5DRFA 4IK3A 1QYQA 4DXOA 1OXFA 4H3MA 3CFAA 4EDOA 5DPIA 4W7FA 5EXCI 2GX2A 5EXUA 1RMPA 1QYOA 2VZXA 5T3IA 5HBDA 3SVSA 2B3QA 5DPGA 5HGEA 3SG2A 1YJFA 2AHAA 2V4EB 2DUIA 3OSQA 3DQLA 2YE1A 4W6PA 5LTRA 2QLGA 4L12A 3DPWA 3AI4A 1ZUXA 2H8QA 1H6RA 1EMMA 4P1QA 3SVUA 3SVDA 1W7SA 1BFPA 2Z6YA 3DQOA 2H5QA 4KF4A 4W6TA 2DUHA 1XSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6Z A;  2EMD A;  2AWJ A;  3GB3 A;  3U8A A;  4JEO A;  1Z1P A;  2G5Z B;  4EUL A;  4Q7R A;  3PJ7 A;  5KTG A;  5LTP A;  4OJ0 A;  3GJ1 A;  1W7U A;  2H5R A;  3WCK A;  3M22 A;  4W6J A;  1KP5 A;  1MOV A;  2FZU A;  2HFC A;  3NT9 A;  5LTQ A;  4Q7U A;  3DQ4 A;  2G6X A;  4W7A A;  1Q4A A;  3P8U A;  3ADF A;  2Z6Z A;  3U0L A;  1RMM A;  3AI5 A;  2A56 B;  5EB6 A;  4EDS A;  2ZO6 A;  1Q4C A;  4HE4 A;  2C9J A;  1Q4D A;  4U2V A;  3GL4 A;  4TZA A;  2QLG B;  5FHV A;  2GW3 A;  2QRF A;  1OXE A;  3DQE A;  1QY3 A;  2HRS A;  3OSR A;  2A47 A;  3LF4 B;  2WUR A;  1EMC A;  4PPL A;  3KCS A;  1GFL A;  1RM9 A;  3SG4 A;  5DTX A;  4W75 A;  5BT0 A;  3CD1 A;  4AR7 A;  2OKY A;  3SG3 A;  2QLH A;  3DQK A;  4JF9 A;  3G9A A;  2AWK A;  3U8C A;  4JC2 A;  1G7K A;  1EMF A;  4HVF A;  4L13 A;  3ST2 A;  2G6Y A;  3CBE A;  5DTL A;  4LQT A;  2ARL A;  1HCJ A;  5BQL A;  2IB6 A;  4W6A A;  2H5P A;  1YFP A;  2ICR A;  2V4E A;  3WLD A;  3RWA A;  1B9C A;  3CD9 A;  4H3L A;  4LJD A;  3DQA A;  3NF0 A;  3E5T A;  4ZB1 A;  3ZTF A;  2DDD A;  2QLI A;  3DPZ A;  3CGL A;  4XVP A;  4GOB A;  3PJ5 A;  4XOW A;  4Z4M A;  3E5W A;  4ZIO A;  4LQU A;  3UG0 A;  2OKW A;  4W6H A;  3SVB A;  4JFG A;  1GL4 A;  2IOV A;  3DQM A;  2H9W A;  1YHG A;  4LJD C;  4XGY A;  2QT2 A;  3SS0 A;  4Z4K A;  4R6D A;  2HGY A;  3ST3 A;  3DPX A;  1JC1 A;  2OGR A;  2HPW A;  4I2Y A;  3DQH A;  3OGO A;  3IP2 A;  2PXS A;  3DQF A;  5H89 A;  4LJB A;  2WIS A;  4Q7T A;  4W6K A;  4EN1 A;  2WHT A;  1EMB A;  1W7T A;  5DY6 A;  5J2O A;  2WSN A;  4GES B;  3LA1 A;  1HUY A;  3H1R A;  2WHS A;  1EMG A;  4W7D A;  4ZBL A;  1YJ2 A;  1YZW A;  4W6C A;  2A50 B;  2HGD A;  3EVU A;  4N3D A;  5DTZ A;  3DQI A;  3LS3 A;  2DUE A;  3SSV A;  2A52 B;  2YFP A;  3SSP A;  4W7E A;  3SVO A;  4OGS A;  4ZIN A;  1JBY A;  4EMQ A;  3EVR A;  5FVG A;  3W1C A;  2QZ0 A;  5F9G A;  3TMT A;  4HQC A;  3SST A;  3K1K A;  2HCG A;  1KYP A;  4IK9 A;  4L1I A;  2DD7 A;  3DQ8 A;  2DDC A;  3LF3 A;  1XAE A;  2GW4 B;  3DQ6 A;  2FL1 A;  2IE2 A;  4W6S A;  2OTE A;  2C9I A;  3SVR A;  4W6G A;  1MYW A;  3SRY A;  3IR8 A;  4KF5 A;  3TMR A;  2Y0G A;  4J88 A;  2Z1O A;  2G3O A;  4W7X A;  5AQB B;  2O29 A;  2G3D B;  2GX0 A;  3EK8 A;  5DPJ A;  2OJK A;  2ZMW A;  4W6L A;  4NWS A;  3P28 A;  3SVE A;  2HQK A;  2AWL A;  2YDZ A;  1EME A;  5H88 A;  4DKM A;  4KF5 C;  3KCT A;  4DXN A;  3DQJ A;  3UFZ A;  4W6F A;  2H6V A;  4RYW A;  3DQ7 A;  3WLC A;  1ZGP A;  3SSL A;  3LSA A;  3EVP A;  2Z6X A;  2VAE A;  4DXM A;  2QU1 A;  2RH7 A;  4W74 A;  1YHH A;  5DPH A;  3A8S A;  3ED8 A;  2G2S B;  3W1D A;  5HZS A;  2H5O A;  1QYF A;  1XA9 A;  5DQM A;  5BTT B;  4BDU A;  2O24 A;  3M24 A;  4DXI A;  3U8P A;  3BXC A;  1Z1Q A;  3RWT A;  2G6E A;  3DQD A;  3EK7 A;  4KW4 A;  4DXP A;  4W77 A;  3ST4 A;  3SSK A;  4J8A A;  4LJC A;  2G16 B;  5HW9 A;  2VVI A;  4W76 A;  2A53 B;  2ZO7 A;  4LW5 A;  4ZF5 A;  4KPI A;  2OTB A;  1YHI A;  4IK1 A;  2QLE A;  4JRB A;  5DQB A;  3SG6 A;  3S05 A;  4XOV A;  2EMN A;  4DKN A;  3CB9 A;  3U0K A;  5EJU A;  3E5V A;  1CV7 A;  4IZN A;  1H4U A;  3LVD A;  4ORN A;  3U0N A;  2A48 A;  2HQZ A;  4J89 A;  3DQC A;  3VHT B;  3SVN A;  3EK4 A;  3SVC A;  4B5Y A;  4OY4 A;  3GJ2 A;  4GF6 B;  4ANJ A;  2O2B A;  1XMZ A;  4IK8 A;  3O78 A;  2JAD A;  2P4M A;  1ZGQ A;  3NT3 A;  4KW9 A;  1RMO A;  3AKO A;  1Q4E A;  1GGX A;  3EKH A;  4RTC A;  2VVJ A;  4W7R A;  4W69 A;  5HZU A;  3ZUJ A;  4HQ8 A;  4ZFS A;  2Q57 A;  3NED A;  5DU0 A;  3DQ3 A;  3SSY A;  4RYS A;  4OQW A;  3EVV A;  3NEZ A;  4KEX A;  4Q9X A;  1KYR A;  3DQN A;  3DQ9 A;  3EKJ A;  3SG7 A;  3ZUL A;  1EML A;  4JGE A;  4UTS A;  3VK1 A;  5BTT A;  2Q6P A;  1MOU A;  3MGF A;  3CFH A;  2HJO A;  3SG5 A;  4W6O A;  4OHS A;  1JBZ A;  4KW8 A;  4R6B A;  4P76 A;  3PIB A;  2WIQ A;  2FWQ A;  1JC0 A;  4PFE A;  1XQM A;  4W6I A;  4H48 A;  4ZF4 A;  2WSO A;  3DQ2 A;  5FVI A;  2WHU A;  2BTJ A;  2VAD A;  5EB7 A;  4IK4 A;  1Q4B A;  4IK5 A;  5EXB A;  3BXB A;  1ZGO A;  4Q9W A;  3GEX A;  4H3N A;  2PXW A;  5LK4 A;  2ZMU A;  4W6N A;  1F09 A;  1F0B A;  1Q73 A;  1EMK A;  1OXD A;  2DUF A;  4W6U A;  5FVF A;  1QXT A;  4B30 A;  2DD9 A;  4KGF A;  3ST0 A;  3U0M A;  3VHT A;  3H1O A;  3DQ1 A;  5HZT A;  3V3D A;  3I19 A;  4ZF3 A;  2AH8 A;  5HZO A;  4AS8 A;  5DRG A;  3SV5 A;  4KA9 A;  1KYS A;  4HQ9 A;  4W6R A;  4W6D A;  4DXQ A;  3PJB A;  3VIC A;  2A46 A;  4W6M A;  4H47 A;  3LVA A;  4KAG A;  2B3P A;  4W7C A;  3DQ5 A;  1UIS A;  4W72 A;  1RRX A;  4W73 A;  2POX A;  1EMA A;  3O77 A;  3BXA A;  4PPJ A;  4B30 B;  2IB5 A;  5DTY A;  5H87 A;  2DUG A;  2V4E C;  3CFF A;  4PPK A;  2VVH A;  3ZUF A;  2YE0 A;  3SSH A;  2AWM A;  3LVC A;  3DQU A;  2A54 B;  2EMO A;  4KGE A;  5EHU A;  5EBJ A;  4TZG A;  3BX9 A;  4W6B A;  1C4F A;  4XL5 A;  5DRF A;  4IK3 A;  1QYQ A;  4DXO A;  1OXF A;  4H3M A;  3CFA A;  4EDO A;  5DPI A;  4W7F A;  5EXC I;  2GX2 A;  5EXU A;  1RMP A;  1QYO A;  2VZX A;  5T3I A;  5HBD A;  3SVS A;  2B3Q A;  5DPG A;  5HGE A;  3SG2 A;  1YJF A;  2AHA A;  2V4E B;  2DUI A;  3OSQ A;  3DQL A;  2YE1 A;  4W6P A;  5LTR A;  2QLG A;  4L12 A;  3DPW A;  3AI4 A;  1ZUX A;  2H8Q A;  1H6R A;  1EMM A;  4P1Q A;  3SVU A;  3SVD A;  1W7S A;  1BFP A;  2Z6Y A;  3DQO A;  2H5Q A;  4KF4 A;  4W6T A;  2DUH A;  1XSS A; 
#chains in the Genus database with same CATH topology
 1S6Z A;  2EMD A;  2AWJ A;  3GB3 A;  3U8A A;  4JEO A;  1Z1P A;  2G5Z B;  4EUL A;  4Q7R A;  3PJ7 A;  5KTG A;  5LTP A;  4OJ0 A;  3GJ1 A;  1W7U A;  2H5R A;  3WCK A;  3M22 A;  4W6J A;  1KP5 A;  1MOV A;  2FZU A;  2HFC A;  3NT9 A;  5LTQ A;  4Q7U A;  3DQ4 A;  2G6X A;  4W7A A;  1Q4A A;  3P8U A;  3ADF A;  2Z6Z A;  3U0L A;  1RMM A;  3AI5 A;  2A56 B;  5EB6 A;  4EDS A;  2ZO6 A;  1Q4C A;  4HE4 A;  2C9J A;  1Q4D A;  4U2V A;  3GL4 A;  4TZA A;  2QLG B;  5FHV A;  2GW3 A;  2QRF A;  1OXE A;  3DQE A;  1QY3 A;  2HRS A;  3OSR A;  2A47 A;  3LF4 B;  2WUR A;  1EMC A;  4PPL A;  3KCS A;  1GFL A;  1RM9 A;  3SG4 A;  5DTX A;  4W75 A;  5BT0 A;  3CD1 A;  4AR7 A;  2OKY A;  3SG3 A;  2QLH A;  3DQK A;  4JF9 A;  3G9A A;  2AWK A;  3U8C A;  4JC2 A;  1G7K A;  1EMF A;  4HVF A;  4L13 A;  3ST2 A;  2G6Y A;  3CBE A;  5DTL A;  4LQT A;  2ARL A;  1HCJ A;  5BQL A;  2IB6 A;  4W6A A;  2H5P A;  1YFP A;  2ICR A;  2V4E A;  3WLD A;  3RWA A;  1B9C A;  3CD9 A;  4H3L A;  4LJD A;  3DQA A;  3NF0 A;  3E5T A;  4ZB1 A;  3ZTF A;  2DDD A;  2QLI A;  3DPZ A;  3CGL A;  4XVP A;  4GOB A;  3PJ5 A;  4XOW A;  4Z4M A;  3E5W A;  4ZIO A;  4LQU A;  3UG0 A;  2OKW A;  4W6H A;  3SVB A;  4JFG A;  1GL4 A;  2IOV A;  3DQM A;  2H9W A;  1YHG A;  4LJD C;  4XGY A;  2QT2 A;  3SS0 A;  4Z4K A;  4R6D A;  2HGY A;  3ST3 A;  3DPX A;  1JC1 A;  2OGR A;  2HPW A;  4I2Y A;  3DQH A;  3OGO A;  3IP2 A;  2PXS A;  3DQF A;  5H89 A;  4LJB A;  2WIS A;  4Q7T A;  4W6K A;  4EN1 A;  2WHT A;  1EMB A;  1W7T A;  5DY6 A;  5J2O A;  2WSN A;  4GES B;  3LA1 A;  1HUY A;  3H1R A;  2WHS A;  1EMG A;  4W7D A;  4ZBL A;  1YJ2 A;  1YZW A;  4W6C A;  2A50 B;  2HGD A;  3EVU A;  4N3D A;  5DTZ A;  3DQI A;  3LS3 A;  2DUE A;  3SSV A;  2A52 B;  2YFP A;  3SSP A;  4W7E A;  3SVO A;  4OGS A;  4ZIN A;  1JBY A;  4EMQ A;  3EVR A;  5FVG A;  3W1C A;  2QZ0 A;  5F9G A;  3TMT A;  4HQC A;  3SST A;  3K1K A;  2HCG A;  1KYP A;  4IK9 A;  4L1I A;  2DD7 A;  3DQ8 A;  2DDC A;  3LF3 A;  1XAE A;  2GW4 B;  3DQ6 A;  2FL1 A;  2IE2 A;  4W6S A;  2OTE A;  2C9I A;  3SVR A;  4W6G A;  1MYW A;  3SRY A;  3IR8 A;  4KF5 A;  3TMR A;  2Y0G A;  4J88 A;  2Z1O A;  2G3O A;  4W7X A;  5AQB B;  2O29 A;  2G3D B;  2GX0 A;  3EK8 A;  5DPJ A;  2OJK A;  2ZMW A;  4W6L A;  4NWS A;  3P28 A;  3SVE A;  2HQK A;  2AWL A;  2YDZ A;  1EME A;  5H88 A;  4DKM A;  4KF5 C;  3KCT A;  4DXN A;  3DQJ A;  3UFZ A;  4W6F A;  2H6V A;  4RYW A;  3DQ7 A;  3WLC A;  1ZGP A;  3SSL A;  3LSA A;  3EVP A;  2Z6X A;  2VAE A;  4DXM A;  2QU1 A;  2RH7 A;  4W74 A;  1YHH A;  5DPH A;  3A8S A;  3ED8 A;  2G2S B;  3W1D A;  5HZS A;  2H5O A;  1QYF A;  1XA9 A;  5DQM A;  5BTT B;  4BDU A;  2O24 A;  3M24 A;  4DXI A;  3U8P A;  3BXC A;  1Z1Q A;  3RWT A;  2G6E A;  3DQD A;  3EK7 A;  4KW4 A;  4DXP A;  4W77 A;  3ST4 A;  3SSK A;  4J8A A;  4LJC A;  2G16 B;  5HW9 A;  2VVI A;  4W76 A;  2A53 B;  2ZO7 A;  4LW5 A;  4ZF5 A;  4KPI A;  2OTB A;  1YHI A;  4IK1 A;  2QLE A;  4JRB A;  5DQB A;  3SG6 A;  3S05 A;  4XOV A;  2EMN A;  4DKN A;  3CB9 A;  3U0K A;  5EJU A;  3E5V A;  1CV7 A;  4IZN A;  1H4U A;  3LVD A;  4ORN A;  3U0N A;  2A48 A;  2HQZ A;  4J89 A;  3DQC A;  3VHT B;  3SVN A;  3EK4 A;  3SVC A;  4B5Y A;  4OY4 A;  3GJ2 A;  4GF6 B;  4ANJ A;  2O2B A;  1XMZ A;  4IK8 A;  3O78 A;  2JAD A;  2P4M A;  1ZGQ A;  3NT3 A;  4KW9 A;  1RMO A;  3AKO A;  1Q4E A;  1GGX A;  3EKH A;  4RTC A;  2VVJ A;  4W7R A;  4W69 A;  5HZU A;  3ZUJ A;  4HQ8 A;  4ZFS A;  2Q57 A;  3NED A;  5DU0 A;  3DQ3 A;  3SSY A;  4RYS A;  4OQW A;  3EVV A;  3NEZ A;  4KEX A;  4Q9X A;  1KYR A;  3DQN A;  3DQ9 A;  3EKJ A;  3SG7 A;  3ZUL A;  1EML A;  4JGE A;  4UTS A;  3VK1 A;  5BTT A;  2Q6P A;  1MOU A;  3MGF A;  3CFH A;  2HJO A;  3SG5 A;  4W6O A;  4OHS A;  1JBZ A;  4KW8 A;  4R6B A;  4P76 A;  3PIB A;  2WIQ A;  2FWQ A;  1JC0 A;  4PFE A;  1XQM A;  4W6I A;  4H48 A;  4ZF4 A;  2WSO A;  3DQ2 A;  5FVI A;  2WHU A;  2BTJ A;  2VAD A;  5EB7 A;  4IK4 A;  1Q4B A;  4IK5 A;  5EXB A;  3BXB A;  1ZGO A;  4Q9W A;  3GEX A;  4H3N A;  2PXW A;  5LK4 A;  2ZMU A;  4W6N A;  1F09 A;  1F0B A;  1Q73 A;  1EMK A;  1OXD A;  2DUF A;  4W6U A;  5FVF A;  1QXT A;  4B30 A;  2DD9 A;  4KGF A;  3ST0 A;  3U0M A;  3VHT A;  3H1O A;  3DQ1 A;  5HZT A;  3V3D A;  3I19 A;  4ZF3 A;  2AH8 A;  5HZO A;  4AS8 A;  5DRG A;  3SV5 A;  4KA9 A;  1KYS A;  4HQ9 A;  4W6R A;  4W6D A;  4DXQ A;  3PJB A;  3VIC A;  2A46 A;  4W6M A;  4H47 A;  3LVA A;  4KAG A;  2B3P A;  4W7C A;  3DQ5 A;  1UIS A;  4W72 A;  1RRX A;  4W73 A;  2POX A;  1EMA A;  3O77 A;  3BXA A;  4PPJ A;  4B30 B;  2IB5 A;  5DTY A;  5H87 A;  2DUG A;  2V4E C;  3CFF A;  4PPK A;  2VVH A;  3ZUF A;  2YE0 A;  3SSH A;  2AWM A;  3LVC A;  3DQU A;  2A54 B;  2EMO A;  4KGE A;  5EHU A;  5EBJ A;  4TZG A;  3BX9 A;  4W6B A;  1C4F A;  4XL5 A;  5DRF A;  4IK3 A;  1QYQ A;  4DXO A;  1OXF A;  4H3M A;  3CFA A;  4EDO A;  5DPI A;  4W7F A;  5EXC I;  2GX2 A;  5EXU A;  1RMP A;  1QYO A;  2VZX A;  5T3I A;  5HBD A;  3SVS A;  2B3Q A;  5DPG A;  5HGE A;  3SG2 A;  1YJF A;  2AHA A;  2V4E B;  2DUI A;  3OSQ A;  3DQL A;  2YE1 A;  4W6P A;  5LTR A;  2QLG A;  4L12 A;  3DPW A;  3AI4 A;  1ZUX A;  2H8Q A;  1H6R A;  1EMM A;  4P1Q A;  3SVU A;  3SVD A;  1W7S A;  1BFP A;  2Z6Y A;  3DQO A;  2H5Q A;  4KF4 A;  4W6T A;  2DUH A;  1XSS A; 
#chains in the Genus database with same CATH homology
 1S6Z A;  2EMD A;  2AWJ A;  3GB3 A;  3U8A A;  4JEO A;  1Z1P A;  2G5Z B;  4EUL A;  4Q7R A;  3PJ7 A;  5KTG A;  5LTP A;  4OJ0 A;  3GJ1 A;  1W7U A;  2H5R A;  3WCK A;  3M22 A;  4W6J A;  1KP5 A;  1MOV A;  2FZU A;  2HFC A;  3NT9 A;  5LTQ A;  4Q7U A;  3DQ4 A;  2G6X A;  4W7A A;  1Q4A A;  3P8U A;  3ADF A;  2Z6Z A;  3U0L A;  1RMM A;  3AI5 A;  2A56 B;  5EB6 A;  4EDS A;  2ZO6 A;  1Q4C A;  4HE4 A;  2C9J A;  1Q4D A;  4U2V A;  3GL4 A;  4TZA A;  2QLG B;  5FHV A;  2GW3 A;  2QRF A;  1OXE A;  3DQE A;  1QY3 A;  2HRS A;  3OSR A;  2A47 A;  3LF4 B;  2WUR A;  1EMC A;  4PPL A;  3KCS A;  1GFL A;  1RM9 A;  3SG4 A;  5DTX A;  4W75 A;  5BT0 A;  3CD1 A;  4AR7 A;  2OKY A;  3SG3 A;  2QLH A;  3DQK A;  4JF9 A;  3G9A A;  2AWK A;  3U8C A;  4JC2 A;  1G7K A;  1EMF A;  4HVF A;  4L13 A;  3ST2 A;  2G6Y A;  3CBE A;  5DTL A;  4LQT A;  2ARL A;  1HCJ A;  5BQL A;  2IB6 A;  4W6A A;  2H5P A;  1YFP A;  2ICR A;  2V4E A;  3WLD A;  3RWA A;  1B9C A;  3CD9 A;  4H3L A;  4LJD A;  3DQA A;  3NF0 A;  3E5T A;  4ZB1 A;  3ZTF A;  2DDD A;  2QLI A;  3DPZ A;  3CGL A;  4XVP A;  4GOB A;  3PJ5 A;  4XOW A;  4Z4M A;  3E5W A;  4ZIO A;  4LQU A;  3UG0 A;  2OKW A;  4W6H A;  3SVB A;  4JFG A;  1GL4 A;  2IOV A;  3DQM A;  2H9W A;  1YHG A;  4LJD C;  4XGY A;  2QT2 A;  3SS0 A;  4Z4K A;  4R6D A;  2HGY A;  3ST3 A;  3DPX A;  1JC1 A;  2OGR A;  2HPW A;  4I2Y A;  3DQH A;  3OGO A;  3IP2 A;  2PXS A;  3DQF A;  5H89 A;  4LJB A;  2WIS A;  4Q7T A;  4W6K A;  4EN1 A;  2WHT A;  1EMB A;  1W7T A;  5DY6 A;  5J2O A;  2WSN A;  4GES B;  3LA1 A;  1HUY A;  3H1R A;  2WHS A;  1EMG A;  4W7D A;  4ZBL A;  1YJ2 A;  1YZW A;  4W6C A;  2A50 B;  2HGD A;  3EVU A;  4N3D A;  5DTZ A;  3DQI A;  3LS3 A;  2DUE A;  3SSV A;  2A52 B;  2YFP A;  3SSP A;  4W7E A;  3SVO A;  4OGS A;  4ZIN A;  1JBY A;  4EMQ A;  3EVR A;  5FVG A;  3W1C A;  2QZ0 A;  5F9G A;  3TMT A;  4HQC A;  3SST A;  3K1K A;  2HCG A;  1KYP A;  4IK9 A;  4L1I A;  2DD7 A;  3DQ8 A;  2DDC A;  3LF3 A;  1XAE A;  2GW4 B;  3DQ6 A;  2FL1 A;  2IE2 A;  4W6S A;  2OTE A;  2C9I A;  3SVR A;  4W6G A;  1MYW A;  3SRY A;  3IR8 A;  4KF5 A;  3TMR A;  2Y0G A;  4J88 A;  2Z1O A;  2G3O A;  4W7X A;  5AQB B;  2O29 A;  2G3D B;  2GX0 A;  3EK8 A;  5DPJ A;  2OJK A;  2ZMW A;  4W6L A;  4NWS A;  3P28 A;  3SVE A;  2HQK A;  2AWL A;  2YDZ A;  1EME A;  5H88 A;  4DKM A;  4KF5 C;  3KCT A;  4DXN A;  3DQJ A;  3UFZ A;  4W6F A;  2H6V A;  4RYW A;  3DQ7 A;  3WLC A;  1ZGP A;  3SSL A;  3LSA A;  3EVP A;  2Z6X A;  2VAE A;  4DXM A;  2QU1 A;  2RH7 A;  4W74 A;  1YHH A;  5DPH A;  3A8S A;  3ED8 A;  2G2S B;  3W1D A;  5HZS A;  2H5O A;  1QYF A;  1XA9 A;  5DQM A;  5BTT B;  4BDU A;  2O24 A;  3M24 A;  4DXI A;  3U8P A;  3BXC A;  1Z1Q A;  3RWT A;  2G6E A;  3DQD A;  3EK7 A;  4KW4 A;  4DXP A;  4W77 A;  3ST4 A;  3SSK A;  4J8A A;  4LJC A;  2G16 B;  5HW9 A;  2VVI A;  4W76 A;  2A53 B;  2ZO7 A;  4LW5 A;  4ZF5 A;  4KPI A;  2OTB A;  1YHI A;  4IK1 A;  2QLE A;  4JRB A;  5DQB A;  3SG6 A;  3S05 A;  4XOV A;  2EMN A;  4DKN A;  3CB9 A;  3U0K A;  5EJU A;  3E5V A;  1CV7 A;  4IZN A;  1H4U A;  3LVD A;  4ORN A;  3U0N A;  2A48 A;  2HQZ A;  4J89 A;  3DQC A;  3VHT B;  3SVN A;  3EK4 A;  3SVC A;  4B5Y A;  4OY4 A;  3GJ2 A;  4GF6 B;  4ANJ A;  2O2B A;  1XMZ A;  4IK8 A;  3O78 A;  2JAD A;  2P4M A;  1ZGQ A;  3NT3 A;  4KW9 A;  1RMO A;  3AKO A;  1Q4E A;  1GGX A;  3EKH A;  4RTC A;  2VVJ A;  4W7R A;  4W69 A;  5HZU A;  3ZUJ A;  4HQ8 A;  4ZFS A;  2Q57 A;  3NED A;  5DU0 A;  3DQ3 A;  3SSY A;  4RYS A;  4OQW A;  3EVV A;  3NEZ A;  4KEX A;  4Q9X A;  1KYR A;  3DQN A;  3DQ9 A;  3EKJ A;  3SG7 A;  3ZUL A;  1EML A;  4JGE A;  4UTS A;  3VK1 A;  5BTT A;  2Q6P A;  1MOU A;  3MGF A;  3CFH A;  2HJO A;  3SG5 A;  4W6O A;  4OHS A;  1JBZ A;  4KW8 A;  4R6B A;  4P76 A;  3PIB A;  2WIQ A;  2FWQ A;  1JC0 A;  4PFE A;  1XQM A;  4W6I A;  4H48 A;  4ZF4 A;  2WSO A;  3DQ2 A;  5FVI A;  2WHU A;  2BTJ A;  2VAD A;  5EB7 A;  4IK4 A;  1Q4B A;  4IK5 A;  5EXB A;  3BXB A;  1ZGO A;  4Q9W A;  3GEX A;  4H3N A;  2PXW A;  5LK4 A;  2ZMU A;  4W6N A;  1F09 A;  1F0B A;  1Q73 A;  1EMK A;  1OXD A;  2DUF A;  4W6U A;  5FVF A;  1QXT A;  4B30 A;  2DD9 A;  4KGF A;  3ST0 A;  3U0M A;  3VHT A;  3H1O A;  3DQ1 A;  5HZT A;  3V3D A;  3I19 A;  4ZF3 A;  2AH8 A;  5HZO A;  4AS8 A;  5DRG A;  3SV5 A;  4KA9 A;  1KYS A;  4HQ9 A;  4W6R A;  4W6D A;  4DXQ A;  3PJB A;  3VIC A;  2A46 A;  4W6M A;  4H47 A;  3LVA A;  4KAG A;  2B3P A;  4W7C A;  3DQ5 A;  1UIS A;  4W72 A;  1RRX A;  4W73 A;  2POX A;  1EMA A;  3O77 A;  3BXA A;  4PPJ A;  4B30 B;  2IB5 A;  5DTY A;  5H87 A;  2DUG A;  2V4E C;  3CFF A;  4PPK A;  2VVH A;  3ZUF A;  2YE0 A;  3SSH A;  2AWM A;  3LVC A;  3DQU A;  2A54 B;  2EMO A;  4KGE A;  5EHU A;  5EBJ A;  4TZG A;  3BX9 A;  4W6B A;  1C4F A;  4XL5 A;  5DRF A;  4IK3 A;  1QYQ A;  4DXO A;  1OXF A;  4H3M A;  3CFA A;  4EDO A;  5DPI A;  4W7F A;  5EXC I;  2GX2 A;  5EXU A;  1RMP A;  1QYO A;  2VZX A;  5T3I A;  5HBD A;  3SVS A;  2B3Q A;  5DPG A;  5HGE A;  3SG2 A;  1YJF A;  2AHA A;  2V4E B;  2DUI A;  3OSQ A;  3DQL A;  2YE1 A;  4W6P A;  5LTR A;  2QLG A;  4L12 A;  3DPW A;  3AI4 A;  1ZUX A;  2H8Q A;  1H6R A;  1EMM A;  4P1Q A;  3SVU A;  3SVD A;  1W7S A;  1BFP A;  2Z6Y A;  3DQO A;  2H5Q A;  4KF4 A;  4W6T A;  2DUH A;  1XSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...