3SG3A

Crystal structure of gcamp3-d380y
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
total genus 138
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg3A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg3A02
1D1OA 1OE9B 3I5HC 3KCTA 4MEWA 1ZUZA 2MJWB 5H88A 4Q9WA 1TNPA 4M2PA 1S5GZ 2M1UA 3DQUA 3KO0A 2G2BA 2LM5A 1QYFA 2JOJA 2L98A 3BUWB 3FWCA 3H1RA 1W7JB 3DF0B 3NEDA 4GPLB 1Y1XA 4CFRA 4I2YA 1JBZA 1CM4A 3SSVA 2LVJA 4DUQA 1SY9A 2BKIB 4W6LA 1KWOC 2GW3A 2Y0GA 2F8PA 2Q91A 3PSRA 3W1CA 3EK7A 1Q4EA 3CGLA 1UISA 4ORAB 3PJ5A 1ZFSA 3VRRA 5B8IB 3SSKA 5FVGA 4MLWA 1ALWA 2L51A 3TS5C 4CIDA 1QYQA 1EMMA 1IH0A 4W6OA 3ADFA 1GGXA 2HGYA 2L50A 2POXA 3LF3A 1U5IB 2KGRA 1QTXA 1JC1A 2JULA 3EVPA 2CT9A 2V53A 2LP3A 3EK4A 2FOTA 3CBEA 2WHUA 1TTXA 5FVFA 1K9UA 4GF6B 3CWGA 3SVBA 2DOQA 2OGRA 2QACA 3EVUA 2JTTA 2OS8C 3UG0A 2Y5IA 2LV7A 4AS8A 3QRXA 4W6JA 3SVRA 4BDUA 2BL0B 1R2UA 1MF8B 2M0RA 1YURA 5AERA 5CPVA 2Z1OA 1TRFA 4TZGA 2WHSA 2DUFA 4TZAA 1CTRA 1JWDA 2F33A 1SNLA 2LMTA 4PHNA 4GOBA 1Z1PA 3DQ4A 3CR4X 1M39A 2FJUB 4EDOA 1XFVO 4DXMA 4W7RA 1UHJA 3OP0A 1M45A 3GB3A 1N65A 1NWDA 1YRTB 2AWJA 4KEXA 5LTPA 4ZF3A 5EBJA 2OTBA 4N5XA 2F3ZA 3IQOA 2WIQA 3DQ5A 1NX3A 3FIAA 3WNXB 1F54A 2VRGA 1PSRA 4ZCVA 1FF1A 3SSLA 2AWMA 2WURA 1Y1UA 3A4UB 3ST4A 1TN4A 5DQBA 1TNWA 1S1EA 3PN7C 1FI6A 2YDZA 1OSAA 3E3RA 4IK8A 1YJ2A 4BY5A 1IJ6A 1Y0VH 4L13A 1QVIZ 1L7ZA 2M3WA 3SSPA 1WLZA 3DQAA 3NSOA 1S6CA 5CSIA 5AXIA 1K96A 2JC2A 1QJTA 4HRGA 3WXAA 3NSIA 1BMOA 1EMAA 1CFFA 3PJBA 4OJ0A 1IKUA 1SL9A 3JVTB 1AP4A 2DUHA 3WHTB 4PDZA 2ZMUA 4W72A 1Q4AA 2HQWA 3TMRA 3U8PA 2LLSA 2B3QA 3SG6A 3TUYB 2H8QA 2VVIA 1QIVA 1KSMA 4B5YA 4ZFSA 1JF0A 1KQMB 3F45A 1ZUXA 4N1FA 4XYNA 2CBLA 1J1DA 1QYOA 1A75A 3I5GC 4J89A 1ZACA 5DQMA 1C4FA 1DVIA 2M29A 5LTRA 1ODBA 4ZBLA 1BOCA 1M31A 3DQ1A 5I8NA 1YR5A 2NCOA 3M0WA 1K2HA 3SG2A 1IQ3A 1CLLA 1QLSA 1JBAA 4LJCA 1BU3A 4QJ4B 4JQ0D 4HE4A 3BUOB 1J7RA 3W1DA 2G9BA 1KFUS 4R6BA 3NSLA 2FWQA 2IB5A 4PHKA 1KFXS 2H61C 2H5PA 3C1VA 4OR9B 2MLEC 1QASA 2EMNA 4PPJA 2Q4UA 1KK8C 2F2PA 4XJKA 1QS7A 2IOVA 1YJFA 4IK4A 1YVLA 1UWOA 1CDLA 4R1EA 3EVVA 1YUSA 2L5XB 5DTYA 4EDSA 5DRGA 4W6GA 3P8UA 4IL1A 3BYAA 3E5TA 5DU0A 5DPGA 4Q7UA 1ZOTB 2K2AA 4WQ2A 1WDCC 2B3PA 2ZKMX 2JTZA 4I5LB 1SCMB 1IGVA 3FWBA 1B8CA 5JOLA 1SBJA 3NSKA 2G6XA 3ZUFA 3AKBA 1QXPA 2HFCA 4IK3A 2O24A 3DVJA 3LCPC 4JWQA 4MRXA 3OSRA 3IF7A 4Z4KA 4PHMA 1QLKA 1RECA 1UHIA 2LAPA 1CB1A 3SG5A 5HZOA 2LNKA 1XFUO 1A75B 2A46A 2PASA 3NT3A 4NWSA 1RROA 1OXDA 2CNPA 3U0LA 1F55A 2KI4C 2LMVA 2K61A 4GAOA 2BCBA 4JRBA 2ZNEA 2P4MA 2LCPA 1K95A 2HJOA 1A29A 1R6PA 3K1KA 3DQKA 2ZRTA 3PFVA 2HRSA 4W7CA 1S6ZA 4MSPA 4EULA 2YFPA 2HPSA 3CR5X 5HYDA 2KDHA 2M7NA 3SSHA 3WLDA 1SPYA 1VRKA 3SSTA 1LA3A 4LJDC 3CZTX 2DUIA 1DJGA 3KHEA 4DIRA 1BFPA 1H4BA 1B8RA 1KWOB 1QY3A 1BG1A 2K7BA 3ZULA 2GW4B 1MYWA 1JC2A 1YVHA 2NLNA 3O6BA 1B47A 4KF5C 1JSAA 1GFLA 3PIBA 1H6RA 4ETOA 3AKOA 3ED8A 4L1IA 1PVAA 4Q7RA 1NCYA 1NPQA 4DXNA 3TS5B 1H8BA 4JGEA 2G6EA 4EMQA 3OGOA 1RFJA 5D69A 3SVOA 2LANA 1KQVA 2NXQA 2L4IA 4LQTA 2KAXA 4P5OE 2BE6A 1DJXA 3ICBA 4JPZB 2JXCA 1DJYA 1B9AA 2KFFA 3AAKA 1DJZA 3SG7A 3DQEA 3U0MA 2M8UA 4AR7A 1NP8A 5K89A 4F0ZB 2HPWA 4KPIA 5EB6A 1IWQA 4W7EA 2OS8B 2AUCA 4JC2A 4H3MA 4W6KA 4GGFA 4PE4A 4PFEA 2DD7A 5FYXA 4A4BA 3SVCA 4UTSA 1W7IB 4DRWA 3DVMA 4ORBB 4MVFA 4P76A 5LTQA 3U0KA 1S6IA 1NIWA 1RRXA 1YTZC 3ST2A 4QJ5B 1EJ3A 2KI6C 2F3YA 1EMBA 3AI4A 1MXEA 4W76A 1YHIA 4PE7A 4L9MA 5CSFA 4WQ3A 1RMOA 3NF0A 1LXFC 2FCEA 3SVDA 3PM8A 2EGDA 1Q4DA 4USLA 4IK1A 4KGFA 4Z4MA 1RWYA 1K94A 5AANA 3EVRA 3D0YA 1EL4A 3SVSA 4YGEB 2QZ0A 2H5QA 1SCVA 3CFAA 4IK5A 1BR4B 1AUIB 5KTYA 3SVNA 2GV5A 2K7CA 3TDIA 3I19A 4W6SA 4W75A 2EHBA 1DJWA 2KBIA 3CB9A 3PN7B 1OMDA 1DT7B 5BQLA 1WRZA 1XFYO 5HZUA 1V1GA 4RYWA 4CFQA 2QPTA 3DQFA 1CFDA 1QX5B 2DDCA 1XO5A 1IG5A 2H9WA 2AWKA 3OX5A 1BR1B 4YI9A 4N1GA 1JFJA 1HT9A 2A50B 1XYDA 1S6JA 1UHKA 1MUXA 2KSPA 5DKRA 5JJGA 5HLOA 1GGWA 1G33A 5ER4X 2K7DA 3DQLA 2RH7A 4MZJA 2KFHA 1A2XA 3LVAA 1RMPA 3I5GB 1EMGA 5CSJA 4U2VA 1X02A 5KU1A 4W6TA 4R6DA 3NXAA 4MBEA 4I5NB 3I5FC 4L12A 4OHSA 1NYAA 1Z1QA 3HX4A 3SIAA 3SVEA 2FL1A 1KSOA 1L2OC 2SASA 4W74A 4C0LA 3SVUA 4ZCUA 2LC5A 2E30A 4ORNA 4CLNA 2KAVA 4J88A 4XGYA 3D0YB 1EMKA 3CFHA 3RWTA 2JWWA 1KYSA 2JRFA 3MSEB 4U8DA 3ZWHA 5TNCA 3LVCA 1KK8B 2KOTA 4OGSA 1A03A 3DQOA 1HUYA 1G8IA 1J55A 4OY4A 1ZGQA 3E5VA 3ZUJA 2Q6PA 4N3DA 1F71A 5GQQC 3CR2A 3CTNA 5EB7A 1EH2A 4H3NA 1QV0A 4OV2A 2R2IA 5EXBA 1RM9A 2JT8A 2PALA 2OTEA 4W6UA 2O29A 3SRYA 4GESB 1PRWA 1C7WA 2G6YA 5DTLA 2JU0A 4MZLA 1KYRA 2MHHA 3BX9A 3U8AA 5AEQA 2DDDA 1SYMA 4RTCA 1WRKA 3OHMB 4YI8A 4PALA 2H5OA 1AJ5A 3BUXB 2JNFA 4W6BA 3E5WA 2GGZA 2M9GA 3EK8A 3O4YA 2WCEA 2RGIA 3VRNA 2I94A 1XFXO 3OB1B 2DUEA 5EHUA 5I2QA 2PXWA 4XVPA 5AFPA 3LK0A 1XA5A 2F2OA 4H3LA 3RM1A 2DD9A 3RLZA 2KI4B 1SRAA 3VRPA 1UURA 3TDUA 1W7TA 1OQPA 5I2LA 3LSAA 2L0PA 1TCFA 5DRFA 1KP5A 1N0YA 4W73A 3RWAA 2M97A 2LP2A 2YE1A 1YX8A 2MRDA 2A48A 4M2OA 2WISA 3GJ1A 3G9AA 2MAZA 2H5RA 4HRHA 4HREE 3M24A 1G4YR 1KYPA 3SG3A 3GEXA 2K8MB 5DPJA 4A4CA 2FZUA 2ZFDA 1HCJA 4HVFA 3ZNIA 1F4QA 3VHTB 3DD4A 1EXRA 2BE4A 1GJYA 2LLTA 3SV5A 2KNEA 2BECA 5I2OA 4AQJA 3U0NA 1OZOA 2TN4A 4HQ8A 5HGEA 1IRJA 5D7FA 4ICBA 2EC6C 1BF5A 4W6HA 4OVNF 4ZB1A 4W6CA 5J3XA 1CKKA 3SJSA 2WCFA 4BY4A 2JNXA 3LS3A 2LUCA 5BT0A 2KYFA 3A8RA 1XMZA 5BPJA 1MR8A 1CDNA 1DMOA 1JFKA 1NCZA 2Z6YA 4W7DA 1QXTA 2QLEA 2Z6XA 4W69A 4AOMA 4GFTA 4CPVA 4ZF4A 1QIWA 5HKYA 2M1KB 2Y1MA 1RJVA 1K9PA 2L4HA 2OTGC 2WORA 3KEVA 3I5HB 5CSNA 2ICRA 2PVBA 1NX2A 3BUNB 3GJ2A 1YZWA 3BOWA 5EXUA 1XVJA 3VK1A 4XOVA 2NCPA 2CXJA 2PMYA 2OJKA 2LVKA 3PATA 1QV1A 2BKHB 2LLUA 3OB2B 4XL5A 5H87A 1K90D 3TDZA 3LK1A 2VADA 3P28A 1ZGPA 4E68A 5F9GA 4PPKA 3KCSA 1BODA 4Q04A 2A56B 4C0KA 2I18A 4ORCB 4H47A 1SR6C 2ZO7A 1W7SA 3DQMA 2QLIA 1LINA 1MOUA 5HLVA 1J7OA 1LVCD 1SCMC 3DQ2A 2PRUA 4LQUA 2AMIA 1WY9A 3MGFA 2A52B 1YRUB 2OPOA 4KA9A 4JFGA 2LUXA 1MHOA 3DQJA 3DQHA 2G16B 3O77A 1PULA 5KTGA 1JBYA 1TNQA 2COLB 4YGAA 4W7FA 2VAEA 2WCBA 1F8HA 2KAYA 4XOWA 2GX2A 1JF2A 3OSQA 4MZKA 5DPIA 2LVIA 3VICA 1ZMZA 2LVVA 3EKJA 1Q4BA 2PSRA 1J7QA 3CLNA 4TNCA 3BQ3A 3GOFA 4KGEA 4IK9A 3BOWB 3DQ9A 4Q7TA 3I5IC 2WSNA 5FVIA 4YBHB 2JT0A 1RTP1 4P1QA 4JF9A 2HQ8A 1GL4A 1KK7Y 3GL4A 1RMMA 4DXOA 1OXFA 2M49B 1EG3A 2D8NA 1XAEA 1WRLA 1AK8A 2CTNA 2BTJA 3AKAA 3I5FB 2WNDA 4DXPA 4NDBA 1XFZO 2M7LA 2HETA 1L2OB 3H4SE 2H61A 1QATA 3SG4A 3LF4B 2KI6D 1EMFA 3DQ8A 1XSSA 4LW5A 2ZMWA 3WHUB 3A8SA 1B7TY 5G08A 2AH8A 3TMTA 5EXCI 4OQWA 1OMVA 4C0JA 2V4EC 4YGCB 2E6WA 1EG4A 4W6IA 1EMLA 3DPXA 5DTXA 4HQCA 1SKTA 2HQKA 1TOPA 2KYCA 2O5GA 1NUBA 1CMGA 1CDMA 3JTDC 3SSYA 5HZTA 4DXIA 1W7UA 1YHGA 3LL8B 2K2FA 2O60A 2KBMA 1FPWA 1PSBA 2JPTA 2G3DB 4OKHA 1QX2A 4P2YB 1PALA 2QRFA 2MA2A 1LKJA 1SL8A 1F09A 1YUUA 2O2BA 3DQCA 2LMUA 4LJBA 3HCMA 4RYSA 1J1EA 2Z6ZA 5T3IA 1S36A 1NCXA 1OMRA 1DF0A 3PALA 4KF4A 1YX7A 1DGUA 1S26D 5HW9A 4KW9A 4W6NA 1B4CA 2JT3A 1ALVA 2H6VA 2BCAA 2QLHA 2IE2A 5DTZA 1K9KA 1B9CA 1ZGOA 3CD9A 2EMDA 1F70A 2A53B 1FW4A 2NZ0A 4DXQA 1B8LA 3GK1A 1NX1A 4M2QA 1DJIA 2MLFC 3PJ7A 3EKHA 1N2DA 5HBDA 3DVKA 4LJDA 3O2PA 4IZNA 4OCIA 2HGDA 3SIBA 2WC8A 3VHTA 3KPXA 2JQ6A 5ER5A 1PK0D 3K21A 4YRUA 3DQ3A 1HQVA 1XK4C 4W7XA 2ZRSA 4KF5A 4PCWA 5AQBB 2VZXA 3BXKA 3VGOA 3LA1A 2IS9A 3BXCA 4PPLA 2OKWA 2KGBC 2A4JA 1WDCB 3CS1A 1C07A 2GX0A 1QX7A 3ST0A 2AHAA 4GGFC 2BL0C 4H48A 1S5GY 2A47A 4GBAA 3ZTFA 2EC6B 3FS7A 5DKQA 1CM1A 1OOJA 1KCYA 3DQ6A 4AQIA 3SS0A 2PXSA 4I5KA 1YHHA 1JUOA 1SW8A 5DPHA 4EN1A 3CFFA 2WHTA 4GUKA 1RK9A 1TCOB 2C9JA 1DF0B 5DY6A 1IQ5A 1MOVA 2KQYA 2YE0A 4MRYA 2Y4QA 2AAOA 4DKNA 4KAGA 3BXBA 5J2OA 2K7OA 1SL7A 1MXLC 4KW4A 4NDDA 2WSOA 4PE1A 4W6PA 2OTGB 2A54B 3IP2A 4I5JA 2Y1NA 4Q9XA 1V1FA 5BTTA 3VROA 3V3DA 1Y1AA 1BT6A 1IJ5A 3IR8A 2H2KA 2GGMA 2QLGA 4MN0A 2ISDA 3ST3A 1OXEA 1CLBA 4QJ3B 2MBXA 4PE0A 3DQNA 5LK4A 1AJ4A 1Q80A 2OKYA 2L2EA 2B1UA 4YGBB 2EMOA 1TNXA 4KW8A 4DS7A 1JC0A 3O78A 2K0JA 1GGZA 1BJFA 3KF9A 2CCMA 4WRIA 1XQMA 1KK7Z 1K8UA 2G5ZB 4NQGA 5PALA 1CV7A 1DTLA 5IBWA 1S3PA 1YUTA 3JVTC 1F0BA 1SR6B 3NEZA 1SK6D 1GQMA 3DPZA 4UPGA 5FHVA 1XA9A 1XFWO 2ZO6A 1DJHA 3TUYC 3CD1A 3LVDA 1C7VA 3AAJA 1Q4CA 2V4EA 2JZIA 2ZNDA 1KQMC 1B7TZ 1PVBA 4B30A 1TIZA 1H4UA 4DKMA 1SMGA 2FCDA 1CLMA 3M22A 4W77A 3AI5A 4JEOA 1MQ1A 4W6FA 3NT9A 4ANJA 1A4PA 5HKWA 1BLQA 3UFZA 1B1GA 4DCKA 4W6RA 5F6TA 2LE9B 1CNPA 1FI5A 2P6BB 2WOSA 5EJUA 3BUMB 3WCKA 2ARLA 5HZSA 2DUGA 3IQQA 4ZIOA 4HQ9A 2I2RE 4J8AA 1KFUL 4GNKB 5BTTB 3H1OA 2BCXA 4HSZA 2G3OA 3CGAA 1UHHA 1KFXL 3DQ7A 3DF0A 2QLGB 1Y6WA 3DQDA 3D10A 4PHJA 5HKZA 4W7AA 1CDPA 1G7KA 3VRQA 1YFPA 3I5IB 2HCGA 1QVIY 1LA0A 1CFPA 2HF5A 4GGNA 4W6MA 2ZN8A 4XJKB 1J7PA 5DKNA 2AWLA 4FTGA 2SCPA 3BXAA 2IB6A 1UP5A 1K93D 2VVJA 1M46A 3TZ1A 1NX0A 2Q57A 1NSHA 2JADA 1AVSA 4FQOA 1OZSA 4W6DA 5H89A 2ZN9A 2HQZA 1DGVA 1WLMA 3LLEA 3GK4X 1FBVA 1UUSA 4D1EA 3U8CA 1U5IA 2QU1A 2VVHA 2BBNA 1UHNA 2BBMA 1MWNA 1F4OA 4ZF5A 4ZINA 3OX6A 2QT2A 2KHNA 1AHRA 3DVEA 5KSZA 2V4EB 1CFCA 1E8AA 4B30B 4YGDB 2I7AA 1CMFA 2C9IA 1XK4A 4NDCA 2LHIA 1EMCA 2KFGA 2G2SB 2KQ6A 1EMEA 1Q73A 2LHLA 3PLFB 3WLCA 3DQIA 3S05A 2JXLA 1M63B 3DPWA 3JTDB 4W6AA 3GK2A
chains in the Genus database with same CATH superfamily
1D1OA 1OE9B 3I5HC 3KCTA 4MEWA 1ZUZA 2MJWB 5H88A 4Q9WA 1TNPA 4M2PA 1S5GZ 1DELA 2M1UA 3DQUA 3KO0A 2G2BA 2LM5A 1QYFA 2JOJA 2L98A 3BUWB 3FWCA 3H1RA 1W7JB 3DF0B 3NEDA 4GPLB 1Y1XA 4CFRA 3D77A 1JBZA 1CM4A 4I2YA 3SSVA 2LVJA 4DUQA 1SY9A 2BKIB 4W6LA 1KWOC 3K1EA 2GW3A 2Y0GA 2F8PA 2WCLA 4PT1A 2Q91A 3PSRA 1OOGA 3R1OA 1DC1A 3W1CA 3EK7A 1Q4EA 3CGLA 1UISA 4ORAB 3PJ5A 1ZFSA 3VRRA 5B8IB 3SSKA 5FVGA 4MLWA 1ALWA 3R72A 2L51A 3TS5C 4CIDA 1QYQA 3S0FA 1TUZA 1EMMA 1IH0A 4W6OA 3ADFA 1GGXA 2HGYA 2L50A 2POXA 3LF3A 1U5IB 2KGRA 1QTXA 1JC1A 2JULA 3EVPA 2CT9A 2V53A 2LP3A 3EK4A 2FOTA 3CBEA 2WHUA 1TTXA 2GTEA 5FVFA 1K9UA 4GF6B 3CWGA 3SVBA 2DOQA 2OGRA 3DZTA 2QACA 3EVUA 2JTTA 2OS8C 3UG0A 2Y5IA 2LV7A 4AS8A 3OBVA 3NGVA 3QRXA 4W6JA 3SVRA 3D75A 3CDNA 4BDUA 2BL0B 1R2UA 1MF8B 2M0RA 1YURA 5AERA 5CPVA 2Z1OA 1TRFA 4TZGA 5FI6A 2WHSA 2DUFA 4TZAA 1CTRA 4FQTA 1JWDA 2F33A 1SNLA 2P70A 2LMTA 2KLEA 4PHNA 4GOBA 1Z1PA 3DQ4A 3CR4X 1M39A 2FJUB 4EDOA 1XFVO 4DXMA 4W7RA 1UHJA 3OP0A 1M45A 3PM2A 3GB3A 1N65A 1NWDA 1YRTB 2AWJA 4KEXA 3IVTA 5LTPA 4ZF3A 5EBJA 2OTBA 1DEKA 4N5XA 2F3ZA 3IQOA 2WIQA 3DQ5A 1NX3A 3FIAA 3WNXB 1F54A 2VRGA 1PSRA 4ZCVA 1FF1A 3SSLA 2AWMA 2WURA 1Y1UA 3L47A 3A4UB 3ST4A 1TN4A 5DQBA 1TNWA 1S1EA 3PN7C 1FI6A 2YDZA 1OSAA 3E3RA 4IK8A 1YJ2A 4BY5A 1IJ6A 1Y0VH 4L13A 1QVIZ 1L7ZA 2M3WA 3SSPA 1WLZA 3DQAA 3NSOA 1QWVA 1S6CA 5CSIA 1W9ZA 5AXIA 1K96A 2JC2A 1QJTA 4HRGA 3WXAA 3NSIA 1BMOA 3CYZA 1EMAA 1CFFA 3PJBA 4OJ0A 1IKUA 1SL9A 3JVTB 1AP4A 2DUHA 3WHTB 4PDZA 2ZMUA 4W72A 1Q4AA 2HQWA 3TMRA 3U8PA 2LLSA 2B3QA 3SG6A 3TUYB 2H8QA 2VVIA 1QIVA 1KSMA 4B5YA 4ZFSA 1JF0A 1KQMB 3F45A 1ZUXA 5EL2A 4N1FA 4XYNA 2CBLA 1J1DA 1QYOA 1A75A 3I5GC 4J89A 1ZACA 5DQMA 1C4FA 1DVIA 2M29A 5LTRA 1ODBA 4ZBLA 1BOCA 1M31A 3D74A 3DQ1A 5I8NA 1YR5A 2NCOA 3M0WA 1K2HA 3SG2A 1IQ3A 1CLLA 1QLSA 1JBAA 4LJCA 1BU3A 4QJ4B 4JQ0D 4HE4A 3BUOB 1J7RA 3W1DA 2G9BA 3SS5A 1KFUS 1TUJA 3EG5B 4R6BA 3BFAA 3NSLA 2FWQA 2IB5A 4PHKA 1KFXS 2H61C 2QEVA 2H5PA 3C1VA 4OR9B 2MLEC 1QASA 2EMNA 4PPJA 2Q4UA 1KK8C 3S0AA 3UNWA 2F2PA 4XJKA 1QS7A 2IOVA 3L4LA 1YJFA 4IK4A 1YVLA 1UWOA 1CDLA 4IJ7A 4R1EA 3EVVA 1Z2CB 1YUSA 3FE9A 2L5XB 5DTYA 4OZDA 4EDSA 5DRGA 4W6GA 3P8UA 4IL1A 3BYAA 3E5TA 5DU0A 5DPGA 4Q7UA 1ZOTB 2K2AA 4WQ2A 1WDCC 2B3PA 5FI7A 2ZKMX 2JTZA 4I5LB 1SCMB 1IGVA 3FWBA 1B8CA 5JOLA 1OOFA 1SBJA 3NSKA 2G6XA 3ZUFA 3AKBA 1QXPA 2HFCA 4IK3A 2O24A 3DVJA 2KLDA 3LCPC 4JWQA 4MRXA 3OSRA 3IF7A 4Z4KA 4PHMA 1QLKA 1RECA 1UHIA 2LAPA 1CB1A 3SG5A 5HZOA 2LNKA 1XFUO 1A75B 2A46A 2PASA 3NT3A 3BFHA 3UO9A 4NWSA 1RROA 1OXDA 2CNPA 3D76A 3U0LA 1F55A 2KI4C 2LMVA 2K61A 4GAOA 2BCBA 4JRBA 2ZNEA 2P4MA 2LCPA 1K95A 2HJOA 1A29A 1R6PA 3K1KA 3DQKA 2ZRTA 3PFVA 2HRSA 4W7CA 1S6ZA 4MSPA 4EULA 2YFPA 2HPSA 3CR5X 5HYDA 2KDHA 2M7NA 3SSHA 3WLDA 1SPYA 1VRKA 3SSTA 1LA3A 4LJDC 3CZTX 2DUIA 1DJGA 3KHEA 4DIRA 1BFPA 1H4BA 1B8RA 1KWOB 1QY3A 1BG1A 2K7BA 3ZULA 2GW4B 1MYWA 1JC2A 1YVHA 2NLNA 3O6BA 1B47A 4KF5C 1JSAA 1GFLA 3PIBA 1H6RA 4ETOA 3AKOA 3ED8A 4L1IA 1PVAA 4Q7RA 1NCYA 1NPQA 4DXNA 3TS5B 1H8BA 4JGEA 2G6EA 4EMQA 3OGOA 4INXA 1RFJA 5D69A 3SVOA 2LANA 1KQVA 2NXQA 2L4IA 4LQTA 2KAXA 3CABA 4P5OE 2BE6A 1DJXA 3ICBA 4JPZB 2JXCA 1DJYA 1B9AA 2KFFA 3VB1A 3AAKA 1DJZA 3SG7A 3DQEA 3U0MA 2M8UA 4AR7A 3D78A 1NP8A 5K89A 4F0ZB 2HPWA 4KPIA 5EB6A 1IWQA 4W7EA 2OS8B 2AUCA 3R1VA 4JC2A 4H3MA 3N7HA 3CZ0A 4W6KA 4GGFA 4PE4A 2PYQA 4PFEA 2DD7A 5FYXA 4A4BA 3SVCA 4UTSA 3S0GA 1W7IB 4DRWA 3DVMA 4ORBB 4MVFA 4P76A 5LTQA 3U0KA 1S6IA 1NIWA 1RRXA 1YTZC 3ST2A 4QJ5B 1EJ3A 2KI6C 2F3YA 1EMBA 3AI4A 1MXEA 4W76A 1YHIA 4PE7A 4L9MA 2BAPA 5CSFA 4WQ3A 1RMOA 1SSEB 3NF0A 1LXFC 2FCEA 3SVDA 3PM8A 3OGNA 2EGDA 1Q4DA 4USLA 4IK1A 4KGFA 4Z4MA 2FJYA 1RWYA 1K94A 5AANA 3EVRA 3D0YA 1EL4A 3SVSA 4YGEB 2QZ0A 2H5QA 1SCVA 3CFAA 4IK5A 1BR4B 1AUIB 5KTYA 3SVNA 2GV5A 2K7CA 3TDIA 3I19A 4W6SA 4W75A 2EHBA 1DJWA 2KBIA 3CB9A 3PN7B 1OMDA 1DT7B 5BQLA 1WRZA 1XFYO 5HZUA 1V1GA 4RYWA 4CFQA 2QPTA 3DQFA 1CFDA 1QX5B 4F7FA 2DDCA 1XO5A 3D73A 1IG5A 2H9WA 2AWKA 3OX5A 1BR1B 4YI9A 4N1GA 1JFJA 1HT9A 2A50B 1XYDA 3DXLA 1S6JA 1UHKA 1MUXA 2KSPA 1GM0A 5DKRA 5JJGA 5HLOA 1GGWA 1G33A 5ER4X 2K7DA 3B7AA 3DQLA 2RH7A 4MZJA 2KFHA 1A2XA 3LVAA 1RMPA 3I5GB 1EMGA 5CSJA 4U2VA 1X02A 5KU1A 4W6TA 4R6DA 3NXAA 4MBEA 4I5NB 3I5FC 4L12A 4OHSA 1NYAA 1Z1QA 3HX4A 3SIAA 3SVEA 2FL1A 1KSOA 1L2OC 2QEOA 2SASA 4W74A 4C0LA 3SVUA 4ZCUA 2LC5A 2E30A 4ORNA 4CLNA 2KAVA 4J88A 4XGYA 3D0YB 2WCHA 1EMKA 3CFHA 3RWTA 2P71A 2JWWA 1KYSA 2JRFA 3MSEB 4U8DA 3ZWHA 5TNCA 3LVCA 1KK8B 2KOTA 2WCKA 4OGSA 1A03A 3DQOA 1HUYA 1G8IA 1J55A 4OY4A 1ZGQA 3E5VA 3ZUJA 2Q6PA 4N3DA 1F71A 5GQQC 3CR2A 3CTNA 5EB7A 1EH2A 4H3NA 1QV0A 4OV2A 2R2IA 5EXBA 1RM9A 2JT8A 2PALA 2OTEA 4W6UA 2O29A 3SRYA 4GESB 1PRWA 1C7WA 2G6YA 5DTLA 2JU0A 4MZLA 1KYRA 2MHHA 3BX9A 3U8AA 5AEQA 2DDDA 1SYMA 4RTCA 1WRKA 3OHMB 4YI8A 3SS4A 4PALA 2H5OA 1AJ5A 3BUXB 2JNFA 4W6BA 3E5WA 2GGZA 2M9GA 3EK8A 3O4YA 2WCEA 2RGIA 3VRNA 2I94A 1XFXO 3OB1B 2DUEA 5EHUA 5I2QA 2PXWA 4XVPA 5AFPA 3LK0A 1XA5A 2F2OA 4H3LA 3RM1A 2DD9A 3RLZA 2KI4B 1SRAA 3VRPA 1UURA 3TDUA 1W7TA 1OQPA 5I2LA 3LSAA 2L0PA 1TCFA 5DRFA 1KP5A 1N0YA 4W73A 2ERBA 3RWAA 2M97A 2LP2A 2YE1A 1YX8A 2MRDA 2A48A 4M2OA 2WISA 3GJ1A 3G9AA 2MAZA 2H5RA 4HRHA 4HREE 3M24A 1G4YR 1KYPA 3SG3A 3GEXA 2K8MB 5DPJA 4A4CA 2FZUA 2ZFDA 1HCJA 4HVFA 3ZNIA 1TWOA 1F4QA 3VHTB 3DD4A 1EXRA 2BE4A 1GJYA 2LLTA 3SV5A 2KNEA 2WC6A 2BECA 5I2OA 4AQJA 3U0NA 1OZOA 2TN4A 4HQ8A 3B6XA 5HGEA 1IRJA 5D7FA 4ICBA 2EC6C 1BF5A 4W6HA 4OVNF 4ZB1A 4W6CA 5J3XA 1CKKA 3SJSA 2WCFA 4BY4A 2JNXA 3LS3A 2LUCA 5BT0A 2KYFA 3A8RA 1XMZA 5BPJA 1MR8A 1CDNA 1DMOA 1JFKA 1NCZA 2Z6YA 4W7DA 1QXTA 2QLEA 2Z6XA 4W69A 4AOMA 4GFTA 4CPVA 4ZF4A 1QIWA 5HKYA 2M1KB 1C3YA 2Y1MA 1RJVA 2QEHA 1K9PA 2L4HA 2OTGC 2WORA 3S0EA 3KEVA 3I5HB 5CSNA 2ICRA 2PVBA 1NX2A 3BUNB 3GJ2A 1YZWA 3BOWA 5EXUA 1XVJA 3VK1A 4XOVA 3SS3A 2NCPA 2CXJA 2PMYA 2OJKA 2LVKA 3PATA 1QV1A 3CZ2A 2BKHB 2LLUA 3OB2B 4XL5A 5H87A 1K90D 3TDZA 3NHTA 3LK1A 2QDIA 2VADA 3P28A 1ZGPA 4E68A 5F9GA 4PPKA 3KCSA 1BODA 4Q04A 2A56B 4C0KA 2I18A 4ORCB 4H47A 1SR6C 2ZO7A 1W7SA 3DQMA 2QLIA 1LINA 1MOUA 5HLVA 1J7OA 1LVCD 3CZ1A 1SCMC 3DQ2A 2PRUA 4LQUA 2AMIA 1WY9A 3MGFA 2A52B 2L5YA 1YRUB 1IIOA 2OPOA 4KA9A 4JFGA 2LUXA 1MHOA 3DQJA 3DQHA 2G16B 3O77A 1PULA 5KTGA 1JBYA 1TNQA 2COLB 4YGAA 4W7FA 2VAEA 2WCBA 1F8HA 2KAYA 1LS8A 4XOWA 2GX2A 1JF2A 3OSQA 4MZKA 1Z4HA 5DPIA 2LVIA 3VICA 1ZMZA 2LVVA 3EKJA 1Q4BA 2PSRA 1J7QA 3CLNA 4TNCA 3BQ3A 3GOFA 4KGEA 4IK9A 3BOWB 3DQ9A 4Q7TA 3I5IC 2WSNA 5FVIA 4YBHB 2JT0A 1RTP1 4P1QA 4JF9A 2HQ8A 1GL4A 1KK7Y 3GL4A 5HL1A 1RMMA 4DXOA 1OXFA 2M49B 1EG3A 2D8NA 1XAEA 2JPOA 1WRLA 1AK8A 2CTNA 3V2LA 2BTJA 3AKAA 3I5FB 2WNDA 4DXPA 4NDBA 1XFZO 2M7LA 2HETA 1L2OB 3H4SE 2H61A 1QATA 3SG4A 3LF4B 2KI6D 1EMFA 3DQ8A 1XSSA 4LW5A 2ZMWA 3WHUB 3A8SA 3L4AA 1B7TY 5G08A 2AH8A 3TMTA 5EXCI 4OQWA 1OMVA 4C0JA 2V4EC 3BFBA 3B87A 2PQLA 4YGCB 2E6WA 3RZSA 1EG4A 3B86A 4W6IA 3S0DA 1EMLA 3DPXA 5DTXA 4HQCA 1SKTA 2HQKA 3FE6A 1TOPA 2KYCA 2O5GA 1NUBA 1CMGA 2BNXA 1CDMA 3JTDC 3SSYA 5HZTA 4DXIA 1W7UA 1YHGA 3LL8B 2K2FA 2O60A 2KBMA 1FPWA 1C3ZA 4JD9A 1PSBA 2JPTA 2G3DB 4OKHA 1QX2A 4P2YB 1PALA 2KPHA 2QRFA 2MA2A 1LKJA 1SL8A 1F09A 1YUUA 2O2BA 3DQCA 2LMUA 2K60A 4LJBA 3HCMA 4RYSA 1J1EA 2Z6ZA 5T3IA 1S36A 1NCXA 1OMRA 1DF0A 2QEBA 3PALA 4KF4A 1YX7A 1DGUA 1S26D 5HW9A 4KW9A 4W6NA 1B4CA 2JT3A 5FI2A 1ALVA 2H6VA 2BCAA 2QLHA 2IE2A 5DTZA 1K9KA 1B9CA 1ZGOA 3CD9A 2EMDA 1F70A 2A53B 1FW4A 2NZ0A 2WCJA 1OOHA 4DXQA 1B8LA 3GK1A 1NX1A 4M2QA 1DJIA 2MLFC 3PJ7A 3EKHA 1N2DA 5HBDA 3DVKA 4LJDA 3O2PA 4IZNA 3PJIA 4OCIA 2HGDA 2H8VA 3SIBA 2WC8A 3VHTA 3KPXA 2JQ6A 5ER5A 1PK0D 2L2CA 3K21A 4YRUA 3DQ3A 1HQVA 1XK4C 4W7XA 2ZRSA 4KF5A 4PCWA 5AQBB 2VZXA 3BXKA 3VGOA 3LA1A 2IS9A 3BXCA 4PPLA 2OKWA 2KGBC 5DICA 2A4JA 1WDCB 3CS1A 1C07A 2GX0A 1QX7A 3ST0A 2AHAA 4GGFC 2BL0C 4H48A 1S5GY 2A47A 4GBAA 3ZTFA 2EC6B 3FS7A 5DKQA 1CM1A 1OOJA 1KCYA 3DQ6A 3B88A 4AQIA 3SS0A 2PXSA 4I5KA 1YHHA 1JUOA 1SW8A 5DPHA 4EN1A 2YGUA 3CFFA 1XFRA 2WHTA 4GUKA 1RK9A 1TCOB 2C9JA 1DF0B 5DY6A 1IQ5A 1MOVA 4INWA 2KQYA 2YE0A 4MRYA 2Y4QA 2AAOA 4DKNA 4KAGA 3BXBA 5J2OA 2K7OA 1SL7A 5I94A 1MXLC 4KW4A 4NDDA 2WSOA 4PE1A 4W6PA 2OTGB 2A54B 3IP2A 4I5JA 1DQEA 2Y1NA 4Q9XA 1V1FA 5BTTA 3VROA 3V3DA 1Y1AA 1P28A 1BT6A 1IJ5A 3IR8A 2H2KA 2GGMA 2QLGA 4MN0A 2ISDA 3ST3A 1OXEA 1CLBA 4QJ3B 2MBXA 3NHIA 4PE0A 3DQNA 3Q8IA 5LK4A 1AJ4A 1Q80A 2OKYA 1OW4A 2L2EA 2B1UA 4YGBB 2EMOA 1TNXA 4KW8A 4DS7A 1JC0A 3O78A 2K0JA 3FE8A 1GGZA 1BJFA 3KF9A 2CCMA 4WRIA 1XQMA 1KK7Z 1K8UA 2G5ZB 4NQGA 5PALA 1CV7A 3BJHA 1DTLA 5IBWA 1S3PA 3S0BA 1YUTA 3JVTC 1F0BA 1SR6B 3NEZA 1SK6D 1GQMA 3DPZA 4UPGA 5FHVA 1XA9A 1XFWO 2ZO6A 1DJHA 3TUYC 3CD1A 3LVDA 3DYEA 1C7VA 3AAJA 1Q4CA 2V4EA 2JZIA 2ZNDA 1KQMC 1B7TZ 1PVBA 1T14A 4B30A 1TIZA 1H4UA 4DKMA 1SMGA 2FCDA 1CLMA 3M22A 4W77A 3AI5A 4JEOA 1MQ1A 4W6FA 3O4XA 3NT9A 4ANJA 1A4PA 5HKWA 1BLQA 3UFZA 1B1GA 4DCKA 4W6RA 5F6TA 2LE9B 1CNPA 1OOIX 1FI5A 2P6BB 2WOSA 5EJUA 3BUMB 3WCKA 2ARLA 5HZSA 2DUGA 3IQQA 4ZIOA 4HQ9A 4JKTA 2I2RE 4J8AA 1KFUL 4GNKB 5BTTB 3H1OA 2BCXA 4HSZA 2WC5A 2G3OA 3CGAA 1UHHA 1KFXL 3DQ7A 3DF0A 2QLGB 1Y6WA 3DQDA 3D10A 4PHJA 5D3OA 5HKZA 4W7AA 1CDPA 2WCMA 1G7KA 3VRQA 1YFPA 3I5IB 2HCGA 1QVIY 1LA0A 1CFPA 2HF5A 4GGNA 4W6MA 2ZN8A 4XJKB 1J7PA 5DKNA 2AWLA 4FTGA 2SCPA 3BXAA 2IB6A 1UP5A 1K93D 2VVJA 1M46A 3TZ1A 1ORGA 1NX0A 2Q57A 1NSHA 2JADA 1AVSA 4FQOA 1OZSA 4W6DA 5H89A 2ZN9A 2HQZA 3DY9A 1DGVA 1WLMA 3LLEA 3GK4X 1FBVA 1UUSA 4D1EA 3U8CA 1U5IA 2QU1A 2VVHA 2BBNA 1UHNA 2BBMA 1MWNA 3R1PA 1F4OA 4ZF5A 4ZINA 3OX6A 2QT2A 2KHNA 1AHRA 3DVEA 5KSZA 2V4EB 1CFCA 1E8AA 4B30B 4YGDB 2I7AA 1CMFA 2C9IA 1XK4A 4NDCA 3QMEA 2LHIA 1EMCA 2KFGA 4KYNA 2G2SB 2KQ6A 1EMEA 1Q73A 2LHLA 3PLFB 3WLCA 3DQIA 3S05A 2JXLA 1M63B 3DPWA 3JTDB 4W6AA 3GK2A
chains in the Genus database with same CATH topology
1D1OA 1OE9B 3I5HC 3KCTA 4MEWA 1ZUZA 2MJWB 5H88A 4Q9WA 1TNPA 4M2PA 1S5GZ 2M1UA 3DQUA 3KO0A 2G2BA 2LM5A 1QYFA 2JOJA 2L98A 3BUWB 3FWCA 3H1RA 1W7JB 3DF0B 3NEDA 4GPLB 1Y1XA 4CFRA 4I2YA 1JBZA 1CM4A 3SSVA 2LVJA 4DUQA 1SY9A 2BKIB 4W6LA 1KWOC 2GW3A 2Y0GA 2F8PA 2Q91A 3PSRA 3W1CA 3EK7A 1Q4EA 3CGLA 1UISA 4ORAB 3PJ5A 1ZFSA 3VRRA 5B8IB 3SSKA 5FVGA 4MLWA 1ALWA 2L51A 3TS5C 4CIDA 1QYQA 1EMMA 1IH0A 4W6OA 3ADFA 1GGXA 2HGYA 2L50A 2POXA 3LF3A 1U5IB 2KGRA 1QTXA 1JC1A 2JULA 3EVPA 2CT9A 2V53A 2LP3A 3EK4A 2FOTA 3CBEA 2WHUA 1TTXA 5FVFA 1K9UA 4GF6B 3CWGA 3SVBA 2DOQA 2OGRA 2QACA 3EVUA 2JTTA 2OS8C 3UG0A 2Y5IA 2LV7A 4AS8A 3QRXA 4W6JA 3SVRA 4BDUA 2BL0B 1R2UA 1MF8B 2M0RA 1YURA 5AERA 5CPVA 2Z1OA 1TRFA 4TZGA 2WHSA 2DUFA 4TZAA 1CTRA 1JWDA 2F33A 1SNLA 2LMTA 4PHNA 4GOBA 1Z1PA 3DQ4A 3CR4X 1M39A 2FJUB 4EDOA 1XFVO 4DXMA 4W7RA 1UHJA 3OP0A 1M45A 3GB3A 1N65A 1NWDA 1YRTB 2AWJA 4KEXA 5LTPA 4ZF3A 5EBJA 2OTBA 4N5XA 2F3ZA 3IQOA 2WIQA 3DQ5A 1NX3A 3FIAA 3WNXB 1F54A 2VRGA 1PSRA 4ZCVA 1FF1A 3SSLA 2AWMA 2WURA 1Y1UA 3A4UB 3ST4A 1TN4A 5DQBA 1TNWA 1S1EA 3PN7C 1FI6A 2YDZA 1OSAA 3E3RA 4IK8A 1YJ2A 4BY5A 1IJ6A 1Y0VH 4L13A 1QVIZ 1L7ZA 2M3WA 3SSPA 1WLZA 3DQAA 3NSOA 1S6CA 5CSIA 5AXIA 1K96A 2JC2A 1QJTA 4HRGA 3WXAA 3NSIA 1BMOA 1EMAA 1CFFA 3PJBA 4OJ0A 1IKUA 1SL9A 3JVTB 1AP4A 2DUHA 3WHTB 4PDZA 2ZMUA 4W72A 1Q4AA 2HQWA 3TMRA 3U8PA 2LLSA 2B3QA 3SG6A 3TUYB 2H8QA 2VVIA 1QIVA 1KSMA 4B5YA 4ZFSA 1JF0A 1KQMB 3F45A 1ZUXA 4N1FA 4XYNA 2CBLA 1J1DA 1QYOA 1A75A 3I5GC 4J89A 1ZACA 5DQMA 1C4FA 1DVIA 2M29A 5LTRA 1ODBA 4ZBLA 1BOCA 1M31A 3DQ1A 5I8NA 1YR5A 2NCOA 3M0WA 1K2HA 3SG2A 1IQ3A 1CLLA 1QLSA 1JBAA 4LJCA 1BU3A 4QJ4B 4JQ0D 4HE4A 3BUOB 1J7RA 3W1DA 2G9BA 1KFUS 4R6BA 3NSLA 2FWQA 2IB5A 4PHKA 1KFXS 2H61C 2H5PA 3C1VA 4OR9B 2MLEC 1QASA 2EMNA 4PPJA 2Q4UA 1KK8C 2F2PA 4XJKA 1QS7A 2IOVA 1YJFA 4IK4A 1YVLA 1UWOA 1CDLA 4R1EA 3EVVA 1YUSA 2L5XB 5DTYA 4EDSA 5DRGA 4W6GA 3P8UA 4IL1A 3BYAA 3E5TA 5DU0A 5DPGA 4Q7UA 1ZOTB 2K2AA 4WQ2A 1WDCC 2B3PA 2ZKMX 2JTZA 4I5LB 1SCMB 1IGVA 3FWBA 1B8CA 5JOLA 1SBJA 3NSKA 2G6XA 3ZUFA 3AKBA 1QXPA 2HFCA 4IK3A 2O24A 3DVJA 3LCPC 4JWQA 4MRXA 3OSRA 3IF7A 4Z4KA 4PHMA 1QLKA 1RECA 1UHIA 2LAPA 1CB1A 3SG5A 5HZOA 2LNKA 1XFUO 1A75B 2A46A 2PASA 3NT3A 4NWSA 1RROA 1OXDA 2CNPA 3U0LA 1F55A 2KI4C 2LMVA 2K61A 4GAOA 2BCBA 4JRBA 2ZNEA 2P4MA 2LCPA 1K95A 2HJOA 1A29A 1R6PA 3K1KA 3DQKA 2ZRTA 3PFVA 2HRSA 4W7CA 1S6ZA 4MSPA 4EULA 2YFPA 2HPSA 3CR5X 5HYDA 2KDHA 2M7NA 3SSHA 3WLDA 1SPYA 1VRKA 3SSTA 1LA3A 4LJDC 3CZTX 2DUIA 1DJGA 3KHEA 4DIRA 1BFPA 1H4BA 1B8RA 1KWOB 1QY3A 1BG1A 2K7BA 3ZULA 2GW4B 1MYWA 1JC2A 1YVHA 2NLNA 3O6BA 1B47A 4KF5C 1JSAA 1GFLA 3PIBA 1H6RA 4ETOA 3AKOA 3ED8A 4L1IA 1PVAA 4Q7RA 1NCYA 1NPQA 4DXNA 3TS5B 1H8BA 4JGEA 2G6EA 4EMQA 3OGOA 1RFJA 5D69A 3SVOA 2LANA 1KQVA 2NXQA 2L4IA 4LQTA 2KAXA 4P5OE 2BE6A 1DJXA 3ICBA 4JPZB 2JXCA 1DJYA 1B9AA 2KFFA 3AAKA 1DJZA 3SG7A 3DQEA 3U0MA 2M8UA 4AR7A 1NP8A 5K89A 4F0ZB 2HPWA 4KPIA 5EB6A 1IWQA 4W7EA 2OS8B 2AUCA 4JC2A 4H3MA 4W6KA 4GGFA 4PE4A 4PFEA 2DD7A 5FYXA 4A4BA 3SVCA 4UTSA 1W7IB 4DRWA 3DVMA 4ORBB 4MVFA 4P76A 5LTQA 3U0KA 1S6IA 1NIWA 1RRXA 1YTZC 3ST2A 4QJ5B 1EJ3A 2KI6C 2F3YA 1EMBA 3AI4A 1MXEA 4W76A 1YHIA 4PE7A 4L9MA 5CSFA 4WQ3A 1RMOA 3NF0A 1LXFC 2FCEA 3SVDA 3PM8A 2EGDA 1Q4DA 4USLA 4IK1A 4KGFA 4Z4MA 1RWYA 1K94A 5AANA 3EVRA 3D0YA 1EL4A 3SVSA 4YGEB 2QZ0A 2H5QA 1SCVA 3CFAA 4IK5A 1BR4B 1AUIB 5KTYA 3SVNA 2GV5A 2K7CA 3TDIA 3I19A 4W6SA 4W75A 2EHBA 1DJWA 2KBIA 3CB9A 3PN7B 1OMDA 1DT7B 5BQLA 1WRZA 1XFYO 5HZUA 1V1GA 4RYWA 4CFQA 2QPTA 3DQFA 1CFDA 1QX5B 2DDCA 1XO5A 1IG5A 2H9WA 2AWKA 3OX5A 1BR1B 4YI9A 4N1GA 1JFJA 1HT9A 2A50B 1XYDA 1S6JA 1UHKA 1MUXA 2KSPA 5DKRA 5JJGA 5HLOA 1GGWA 1G33A 5ER4X 2K7DA 3DQLA 2RH7A 4MZJA 2KFHA 1A2XA 3LVAA 1RMPA 3I5GB 1EMGA 5CSJA 4U2VA 1X02A 5KU1A 4W6TA 4R6DA 3NXAA 4MBEA 4I5NB 3I5FC 4L12A 4OHSA 1NYAA 1Z1QA 3HX4A 3SIAA 3SVEA 2FL1A 1KSOA 1L2OC 2SASA 4W74A 4C0LA 3SVUA 4ZCUA 2LC5A 2E30A 4ORNA 4CLNA 2KAVA 4J88A 4XGYA 3D0YB 1EMKA 3CFHA 3RWTA 2JWWA 1KYSA 2JRFA 3MSEB 4U8DA 3ZWHA 5TNCA 3LVCA 1KK8B 2KOTA 4OGSA 1A03A 3DQOA 1HUYA 1G8IA 1J55A 4OY4A 1ZGQA 3E5VA 3ZUJA 2Q6PA 4N3DA 1F71A 5GQQC 3CR2A 3CTNA 5EB7A 1EH2A 4H3NA 1QV0A 4OV2A 2R2IA 5EXBA 1RM9A 2JT8A 2PALA 2OTEA 4W6UA 2O29A 3SRYA 4GESB 1PRWA 1C7WA 2G6YA 5DTLA 2JU0A 4MZLA 1KYRA 2MHHA 3BX9A 3U8AA 5AEQA 2DDDA 1SYMA 4RTCA 1WRKA 3OHMB 4YI8A 4PALA 2H5OA 1AJ5A 3BUXB 2JNFA 4W6BA 3E5WA 2GGZA 2M9GA 3EK8A 3O4YA 2WCEA 2RGIA 3VRNA 2I94A 1XFXO 3OB1B 2DUEA 5EHUA 5I2QA 2PXWA 4XVPA 5AFPA 3LK0A 1XA5A 2F2OA 4H3LA 3RM1A 2DD9A 3RLZA 2KI4B 1SRAA 3VRPA 1UURA 3TDUA 1W7TA 1OQPA 5I2LA 3LSAA 2L0PA 1TCFA 5DRFA 1KP5A 1N0YA 4W73A 3RWAA 2M97A 2LP2A 2YE1A 1YX8A 2MRDA 2A48A 4M2OA 2WISA 3GJ1A 3G9AA 2MAZA 2H5RA 4HRHA 4HREE 3M24A 1G4YR 1KYPA 3SG3A 3GEXA 2K8MB 5DPJA 4A4CA 2FZUA 2ZFDA 1HCJA 4HVFA 3ZNIA 1F4QA 3VHTB 3DD4A 1EXRA 2BE4A 1GJYA 2LLTA 3SV5A 2KNEA 2BECA 5I2OA 4AQJA 3U0NA 1OZOA 2TN4A 4HQ8A 5HGEA 1IRJA 5D7FA 4ICBA 2EC6C 1BF5A 4W6HA 4OVNF 4ZB1A 4W6CA 5J3XA 1CKKA 3SJSA 2WCFA 4BY4A 2JNXA 3LS3A 2LUCA 5BT0A 2KYFA 3A8RA 1XMZA 5BPJA 1MR8A 1CDNA 1DMOA 1JFKA 1NCZA 2Z6YA 4W7DA 1QXTA 2QLEA 2Z6XA 4W69A 4AOMA 4GFTA 4CPVA 4ZF4A 1QIWA 5HKYA 2M1KB 2Y1MA 1RJVA 1K9PA 2L4HA 2OTGC 2WORA 3KEVA 3I5HB 5CSNA 2ICRA 2PVBA 1NX2A 3BUNB 3GJ2A 1YZWA 3BOWA 5EXUA 1XVJA 3VK1A 4XOVA 2NCPA 2CXJA 2PMYA 2OJKA 2LVKA 3PATA 1QV1A 2BKHB 2LLUA 3OB2B 4XL5A 5H87A 1K90D 3TDZA 3LK1A 2VADA 3P28A 1ZGPA 4E68A 5F9GA 4PPKA 3KCSA 1BODA 4Q04A 2A56B 4C0KA 2I18A 4ORCB 4H47A 1SR6C 2ZO7A 1W7SA 3DQMA 2QLIA 1LINA 1MOUA 5HLVA 1J7OA 1LVCD 1SCMC 3DQ2A 2PRUA 4LQUA 2AMIA 1WY9A 3MGFA 2A52B 1YRUB 2OPOA 4KA9A 4JFGA 2LUXA 1MHOA 3DQJA 3DQHA 2G16B 3O77A 1PULA 5KTGA 1JBYA 1TNQA 2COLB 4YGAA 4W7FA 2VAEA 2WCBA 1F8HA 2KAYA 4XOWA 2GX2A 1JF2A 3OSQA 4MZKA 5DPIA 2LVIA 3VICA 1ZMZA 2LVVA 3EKJA 1Q4BA 2PSRA 1J7QA 3CLNA 4TNCA 3BQ3A 3GOFA 4KGEA 4IK9A 3BOWB 3DQ9A 4Q7TA 3I5IC 2WSNA 5FVIA 4YBHB 2JT0A 1RTP1 4P1QA 4JF9A 2HQ8A 1GL4A 1KK7Y 3GL4A 1RMMA 4DXOA 1OXFA 2M49B 1EG3A 2D8NA 1XAEA 1WRLA 1AK8A 2CTNA 2BTJA 3AKAA 3I5FB 2WNDA 4DXPA 4NDBA 1XFZO 2M7LA 2HETA 1L2OB 3H4SE 2H61A 1QATA 3SG4A 3LF4B 2KI6D 1EMFA 3DQ8A 1XSSA 4LW5A 2ZMWA 3WHUB 3A8SA 1B7TY 5G08A 2AH8A 3TMTA 5EXCI 4OQWA 1OMVA 4C0JA 2V4EC 4YGCB 2E6WA 1EG4A 4W6IA 1EMLA 3DPXA 5DTXA 4HQCA 1SKTA 2HQKA 1TOPA 2KYCA 2O5GA 1NUBA 1CMGA 1CDMA 3JTDC 3SSYA 5HZTA 4DXIA 1W7UA 1YHGA 3LL8B 2K2FA 2O60A 2KBMA 1FPWA 1PSBA 2JPTA 2G3DB 4OKHA 1QX2A 4P2YB 1PALA 2QRFA 2MA2A 1LKJA 1SL8A 1F09A 1YUUA 2O2BA 3DQCA 2LMUA 4LJBA 3HCMA 4RYSA 1J1EA 2Z6ZA 5T3IA 1S36A 1NCXA 1OMRA 1DF0A 3PALA 4KF4A 1YX7A 1DGUA 1S26D 5HW9A 4KW9A 4W6NA 1B4CA 2JT3A 1ALVA 2H6VA 2BCAA 2QLHA 2IE2A 5DTZA 1K9KA 1B9CA 1ZGOA 3CD9A 2EMDA 1F70A 2A53B 1FW4A 2NZ0A 4DXQA 1B8LA 3GK1A 1NX1A 4M2QA 1DJIA 2MLFC 3PJ7A 3EKHA 1N2DA 5HBDA 3DVKA 4LJDA 3O2PA 4IZNA 4OCIA 2HGDA 3SIBA 2WC8A 3VHTA 3KPXA 2JQ6A 5ER5A 1PK0D 3K21A 4YRUA 3DQ3A 1HQVA 1XK4C 4W7XA 2ZRSA 4KF5A 4PCWA 5AQBB 2VZXA 3BXKA 3VGOA 3LA1A 2IS9A 3BXCA 4PPLA 2OKWA 2KGBC 2A4JA 1WDCB 3CS1A 1C07A 2GX0A 1QX7A 3ST0A 2AHAA 4GGFC 2BL0C 4H48A 1S5GY 2A47A 4GBAA 3ZTFA 2EC6B 3FS7A 5DKQA 1CM1A 1OOJA 1KCYA 3DQ6A 4AQIA 3SS0A 2PXSA 4I5KA 1YHHA 1JUOA 1SW8A 5DPHA 4EN1A 3CFFA 2WHTA 4GUKA 1RK9A 1TCOB 2C9JA 1DF0B 5DY6A 1IQ5A 1MOVA 2KQYA 2YE0A 4MRYA 2Y4QA 2AAOA 4DKNA 4KAGA 3BXBA 5J2OA 2K7OA 1SL7A 1MXLC 4KW4A 4NDDA 2WSOA 4PE1A 4W6PA 2OTGB 2A54B 3IP2A 4I5JA 2Y1NA 4Q9XA 1V1FA 5BTTA 3VROA 3V3DA 1Y1AA 1BT6A 1IJ5A 3IR8A 2H2KA 2GGMA 2QLGA 4MN0A 2ISDA 3ST3A 1OXEA 1CLBA 4QJ3B 2MBXA 4PE0A 3DQNA 5LK4A 1AJ4A 1Q80A 2OKYA 2L2EA 2B1UA 4YGBB 2EMOA 1TNXA 4KW8A 4DS7A 1JC0A 3O78A 2K0JA 1GGZA 1BJFA 3KF9A 2CCMA 4WRIA 1XQMA 1KK7Z 1K8UA 2G5ZB 4NQGA 5PALA 1CV7A 1DTLA 5IBWA 1S3PA 1YUTA 3JVTC 1F0BA 1SR6B 3NEZA 1SK6D 1GQMA 3DPZA 4UPGA 5FHVA 1XA9A 1XFWO 2ZO6A 1DJHA 3TUYC 3CD1A 3LVDA 1C7VA 3AAJA 1Q4CA 2V4EA 2JZIA 2ZNDA 1KQMC 1B7TZ 1PVBA 4B30A 1TIZA 1H4UA 4DKMA 1SMGA 2FCDA 1CLMA 3M22A 4W77A 3AI5A 4JEOA 1MQ1A 4W6FA 3NT9A 4ANJA 1A4PA 5HKWA 1BLQA 3UFZA 1B1GA 4DCKA 4W6RA 5F6TA 2LE9B 1CNPA 1FI5A 2P6BB 2WOSA 5EJUA 3BUMB 3WCKA 2ARLA 5HZSA 2DUGA 3IQQA 4ZIOA 4HQ9A 2I2RE 4J8AA 1KFUL 4GNKB 5BTTB 3H1OA 2BCXA 4HSZA 2G3OA 3CGAA 1UHHA 1KFXL 3DQ7A 3DF0A 2QLGB 1Y6WA 3DQDA 3D10A 4PHJA 5HKZA 4W7AA 1CDPA 1G7KA 3VRQA 1YFPA 3I5IB 2HCGA 1QVIY 1LA0A 1CFPA 2HF5A 4GGNA 4W6MA 2ZN8A 4XJKB 1J7PA 5DKNA 2AWLA 4FTGA 2SCPA 3BXAA 2IB6A 1UP5A 1K93D 2VVJA 1M46A 3TZ1A 1NX0A 2Q57A 1NSHA 2JADA 1AVSA 4FQOA 1OZSA 4W6DA 5H89A 2ZN9A 2HQZA 1DGVA 1WLMA 3LLEA 3GK4X 1FBVA 1UUSA 4D1EA 3U8CA 1U5IA 2QU1A 2VVHA 2BBNA 1UHNA 2BBMA 1MWNA 1F4OA 4ZF5A 4ZINA 3OX6A 2QT2A 2KHNA 1AHRA 3DVEA 5KSZA 2V4EB 1CFCA 1E8AA 4B30B 4YGDB 2I7AA 1CMFA 2C9IA 1XK4A 4NDCA 2LHIA 1EMCA 2KFGA 2G2SB 2KQ6A 1EMEA 1Q73A 2LHLA 3PLFB 3WLCA 3DQIA 3S05A 2JXLA 1M63B 3DPWA 3JTDB 4W6AA 3GK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1O A;  1OE9 B;  3I5H C;  3KCT A;  4MEW A;  1ZUZ A;  2MJW B;  5H88 A;  4Q9W A;  1TNP A;  4M2P A;  1S5G Z;  2M1U A;  3DQU A;  3KO0 A;  2G2B A;  2LM5 A;  1QYF A;  2JOJ A;  2L98 A;  3BUW B;  3FWC A;  3H1R A;  1W7J B;  3DF0 B;  3NED A;  4GPL B;  1Y1X A;  4CFR A;  4I2Y A;  1JBZ A;  1CM4 A;  3SSV A;  2LVJ A;  4DUQ A;  1SY9 A;  2BKI B;  4W6L A;  1KWO C;  2GW3 A;  2Y0G A;  2F8P A;  2Q91 A;  3PSR A;  3W1C A;  3EK7 A;  1Q4E A;  3CGL A;  1UIS A;  4ORA B;  3PJ5 A;  1ZFS A;  3VRR A;  5B8I B;  3SSK A;  5FVG A;  4MLW A;  1ALW A;  2L51 A;  3TS5 C;  4CID A;  1QYQ A;  1EMM A;  1IH0 A;  4W6O A;  3ADF A;  1GGX A;  2HGY A;  2L50 A;  2POX A;  3LF3 A;  1U5I B;  2KGR A;  1QTX A;  1JC1 A;  2JUL A;  3EVP A;  2CT9 A;  2V53 A;  2LP3 A;  3EK4 A;  2FOT A;  3CBE A;  2WHU A;  1TTX A;  5FVF A;  1K9U A;  4GF6 B;  3CWG A;  3SVB A;  2DOQ A;  2OGR A;  2QAC A;  3EVU A;  2JTT A;  2OS8 C;  3UG0 A;  2Y5I A;  2LV7 A;  4AS8 A;  3QRX A;  4W6J A;  3SVR A;  4BDU A;  2BL0 B;  1R2U A;  1MF8 B;  2M0R A;  1YUR A;  5AER A;  5CPV A;  2Z1O A;  1TRF A;  4TZG A;  2WHS A;  2DUF A;  4TZA A;  1CTR A;  1JWD A;  2F33 A;  1SNL A;  2LMT A;  4PHN A;  4GOB A;  1Z1P A;  3DQ4 A;  3CR4 X;  1M39 A;  2FJU B;  4EDO A;  1XFV O;  4DXM A;  4W7R A;  1UHJ A;  3OP0 A;  1M45 A;  3GB3 A;  1N65 A;  1NWD A;  1YRT B;  2AWJ A;  4KEX A;  5LTP A;  4ZF3 A;  5EBJ A;  2OTB A;  4N5X A;  2F3Z A;  3IQO A;  2WIQ A;  3DQ5 A;  1NX3 A;  3FIA A;  3WNX B;  1F54 A;  2VRG A;  1PSR A;  4ZCV A;  1FF1 A;  3SSL A;  2AWM A;  2WUR A;  1Y1U A;  3A4U B;  3ST4 A;  1TN4 A;  5DQB A;  1TNW A;  1S1E A;  3PN7 C;  1FI6 A;  2YDZ A;  1OSA A;  3E3R A;  4IK8 A;  1YJ2 A;  4BY5 A;  1IJ6 A;  1Y0V H;  4L13 A;  1QVI Z;  1L7Z A;  2M3W A;  3SSP A;  1WLZ A;  3DQA A;  3NSO A;  1S6C A;  5CSI A;  5AXI A;  1K96 A;  2JC2 A;  1QJT A;  4HRG A;  3WXA A;  3NSI A;  1BMO A;  1EMA A;  1CFF A;  3PJB A;  4OJ0 A;  1IKU A;  1SL9 A;  3JVT B;  1AP4 A;  2DUH A;  3WHT B;  4PDZ A;  2ZMU A;  4W72 A;  1Q4A A;  2HQW A;  3TMR A;  3U8P A;  2LLS A;  2B3Q A;  3SG6 A;  3TUY B;  2H8Q A;  2VVI A;  1QIV A;  1KSM A;  4B5Y A;  4ZFS A;  1JF0 A;  1KQM B;  3F45 A;  1ZUX A;  4N1F A;  4XYN A;  2CBL A;  1J1D A;  1QYO A;  1A75 A;  3I5G C;  4J89 A;  1ZAC A;  5DQM A;  1C4F A;  1DVI A;  2M29 A;  5LTR A;  1ODB A;  4ZBL A;  1BOC A;  1M31 A;  3DQ1 A;  5I8N A;  1YR5 A;  2NCO A;  3M0W A;  1K2H A;  3SG2 A;  1IQ3 A;  1CLL A;  1QLS A;  1JBA A;  4LJC A;  1BU3 A;  4QJ4 B;  4JQ0 D;  4HE4 A;  3BUO B;  1J7R A;  3W1D A;  2G9B A;  1KFU S;  4R6B A;  3NSL A;  2FWQ A;  2IB5 A;  4PHK A;  1KFX S;  2H61 C;  2H5P A;  3C1V A;  4OR9 B;  2MLE C;  1QAS A;  2EMN A;  4PPJ A;  2Q4U A;  1KK8 C;  2F2P A;  4XJK A;  1QS7 A;  2IOV A;  1YJF A;  4IK4 A;  1YVL A;  1UWO A;  1CDL A;  4R1E A;  3EVV A;  1YUS A;  2L5X B;  5DTY A;  4EDS A;  5DRG A;  4W6G A;  3P8U A;  4IL1 A;  3BYA A;  3E5T A;  5DU0 A;  5DPG A;  4Q7U A;  1ZOT B;  2K2A A;  4WQ2 A;  1WDC C;  2B3P A;  2ZKM X;  2JTZ A;  4I5L B;  1SCM B;  1IGV A;  3FWB A;  1B8C A;  5JOL A;  1SBJ A;  3NSK A;  2G6X A;  3ZUF A;  3AKB A;  1QXP A;  2HFC A;  4IK3 A;  2O24 A;  3DVJ A;  3LCP C;  4JWQ A;  4MRX A;  3OSR A;  3IF7 A;  4Z4K A;  4PHM A;  1QLK A;  1REC A;  1UHI A;  2LAP A;  1CB1 A;  3SG5 A;  5HZO A;  2LNK A;  1XFU O;  1A75 B;  2A46 A;  2PAS A;  3NT3 A;  4NWS A;  1RRO A;  1OXD A;  2CNP A;  3U0L A;  1F55 A;  2KI4 C;  2LMV A;  2K61 A;  4GAO A;  2BCB A;  4JRB A;  2ZNE A;  2P4M A;  2LCP A;  1K95 A;  2HJO A;  1A29 A;  1R6P A;  3K1K A;  3DQK A;  2ZRT A;  3PFV A;  2HRS A;  4W7C A;  1S6Z A;  4MSP A;  4EUL A;  2YFP A;  2HPS A;  3CR5 X;  5HYD A;  2KDH A;  2M7N A;  3SSH A;  3WLD A;  1SPY A;  1VRK A;  3SST A;  1LA3 A;  4LJD C;  3CZT X;  2DUI A;  1DJG A;  3KHE A;  4DIR A;  1BFP A;  1H4B A;  1B8R A;  1KWO B;  1QY3 A;  1BG1 A;  2K7B A;  3ZUL A;  2GW4 B;  1MYW A;  1JC2 A;  1YVH A;  2NLN A;  3O6B A;  1B47 A;  4KF5 C;  1JSA A;  1GFL A;  3PIB A;  1H6R A;  4ETO A;  3AKO A;  3ED8 A;  4L1I A;  1PVA A;  4Q7R A;  1NCY A;  1NPQ A;  4DXN A;  3TS5 B;  1H8B A;  4JGE A;  2G6E A;  4EMQ A;  3OGO A;  1RFJ A;  5D69 A;  3SVO A;  2LAN A;  1KQV A;  2NXQ A;  2L4I A;  4LQT A;  2KAX A;  4P5O E;  2BE6 A;  1DJX A;  3ICB A;  4JPZ B;  2JXC A;  1DJY A;  1B9A A;  2KFF A;  3AAK A;  1DJZ A;  3SG7 A;  3DQE A;  3U0M A;  2M8U A;  4AR7 A;  1NP8 A;  5K89 A;  4F0Z B;  2HPW A;  4KPI A;  5EB6 A;  1IWQ A;  4W7E A;  2OS8 B;  2AUC A;  4JC2 A;  4H3M A;  4W6K A;  4GGF A;  4PE4 A;  4PFE A;  2DD7 A;  5FYX A;  4A4B A;  3SVC A;  4UTS A;  1W7I B;  4DRW A;  3DVM A;  4ORB B;  4MVF A;  4P76 A;  5LTQ A;  3U0K A;  1S6I A;  1NIW A;  1RRX A;  1YTZ C;  3ST2 A;  4QJ5 B;  1EJ3 A;  2KI6 C;  2F3Y A;  1EMB A;  3AI4 A;  1MXE A;  4W76 A;  1YHI A;  4PE7 A;  4L9M A;  5CSF A;  4WQ3 A;  1RMO A;  3NF0 A;  1LXF C;  2FCE A;  3SVD A;  3PM8 A;  2EGD A;  1Q4D A;  4USL A;  4IK1 A;  4KGF A;  4Z4M A;  1RWY A;  1K94 A;  5AAN A;  3EVR A;  3D0Y A;  1EL4 A;  3SVS A;  4YGE B;  2QZ0 A;  2H5Q A;  1SCV A;  3CFA A;  4IK5 A;  1BR4 B;  1AUI B;  5KTY A;  3SVN A;  2GV5 A;  2K7C A;  3TDI A;  3I19 A;  4W6S A;  4W75 A;  2EHB A;  1DJW A;  2KBI A;  3CB9 A;  3PN7 B;  1OMD A;  1DT7 B;  5BQL A;  1WRZ A;  1XFY O;  5HZU A;  1V1G A;  4RYW A;  4CFQ A;  2QPT A;  3DQF A;  1CFD A;  1QX5 B;  2DDC A;  1XO5 A;  1IG5 A;  2H9W A;  2AWK A;  3OX5 A;  1BR1 B;  4YI9 A;  4N1G A;  1JFJ A;  1HT9 A;  2A50 B;  1XYD A;  1S6J A;  1UHK A;  1MUX A;  2KSP A;  5DKR A;  5JJG A;  5HLO A;  1GGW A;  1G33 A;  5ER4 X;  2K7D A;  3DQL A;  2RH7 A;  4MZJ A;  2KFH A;  1A2X A;  3LVA A;  1RMP A;  3I5G B;  1EMG A;  5CSJ A;  4U2V A;  1X02 A;  5KU1 A;  4W6T A;  4R6D A;  3NXA A;  4MBE A;  4I5N B;  3I5F C;  4L12 A;  4OHS A;  1NYA A;  1Z1Q A;  3HX4 A;  3SIA A;  3SVE A;  2FL1 A;  1KSO A;  1L2O C;  2SAS A;  4W74 A;  4C0L A;  3SVU A;  4ZCU A;  2LC5 A;  2E30 A;  4ORN A;  4CLN A;  2KAV A;  4J88 A;  4XGY A;  3D0Y B;  1EMK A;  3CFH A;  3RWT A;  2JWW A;  1KYS A;  2JRF A;  3MSE B;  4U8D A;  3ZWH A;  5TNC A;  3LVC A;  1KK8 B;  2KOT A;  4OGS A;  1A03 A;  3DQO A;  1HUY A;  1G8I A;  1J55 A;  4OY4 A;  1ZGQ A;  3E5V A;  3ZUJ A;  2Q6P A;  4N3D A;  1F71 A;  5GQQ C;  3CR2 A;  3CTN A;  5EB7 A;  1EH2 A;  4H3N A;  1QV0 A;  4OV2 A;  2R2I A;  5EXB A;  1RM9 A;  2JT8 A;  2PAL A;  2OTE A;  4W6U A;  2O29 A;  3SRY A;  4GES B;  1PRW A;  1C7W A;  2G6Y A;  5DTL A;  2JU0 A;  4MZL A;  1KYR A;  2MHH A;  3BX9 A;  3U8A A;  5AEQ A;  2DDD A;  1SYM A;  4RTC A;  1WRK A;  3OHM B;  4YI8 A;  4PAL A;  2H5O A;  1AJ5 A;  3BUX B;  2JNF A;  4W6B A;  3E5W A;  2GGZ A;  2M9G A;  3EK8 A;  3O4Y A;  2WCE A;  2RGI A;  3VRN A;  2I94 A;  1XFX O;  3OB1 B;  2DUE A;  5EHU A;  5I2Q A;  2PXW A;  4XVP A;  5AFP A;  3LK0 A;  1XA5 A;  2F2O A;  4H3L A;  3RM1 A;  2DD9 A;  3RLZ A;  2KI4 B;  1SRA A;  3VRP A;  1UUR A;  3TDU A;  1W7T A;  1OQP A;  5I2L A;  3LSA A;  2L0P A;  1TCF A;  5DRF A;  1KP5 A;  1N0Y A;  4W73 A;  3RWA A;  2M97 A;  2LP2 A;  2YE1 A;  1YX8 A;  2MRD A;  2A48 A;  4M2O A;  2WIS A;  3GJ1 A;  3G9A A;  2MAZ A;  2H5R A;  4HRH A;  4HRE E;  3M24 A;  1G4Y R;  1KYP A;  3SG3 A;  3GEX A;  2K8M B;  5DPJ A;  4A4C A;  2FZU A;  2ZFD A;  1HCJ A;  4HVF A;  3ZNI A;  1F4Q A;  3VHT B;  3DD4 A;  1EXR A;  2BE4 A;  1GJY A;  2LLT A;  3SV5 A;  2KNE A;  2BEC A;  5I2O A;  4AQJ A;  3U0N A;  1OZO A;  2TN4 A;  4HQ8 A;  5HGE A;  1IRJ A;  5D7F A;  4ICB A;  2EC6 C;  1BF5 A;  4W6H A;  4OVN F;  4ZB1 A;  4W6C A;  5J3X A;  1CKK A;  3SJS A;  2WCF A;  4BY4 A;  2JNX A;  3LS3 A;  2LUC A;  5BT0 A;  2KYF A;  3A8R A;  1XMZ A;  5BPJ A;  1MR8 A;  1CDN A;  1DMO A;  1JFK A;  1NCZ A;  2Z6Y A;  4W7D A;  1QXT A;  2QLE A;  2Z6X A;  4W69 A;  4AOM A;  4GFT A;  4CPV A;  4ZF4 A;  1QIW A;  5HKY A;  2M1K B;  2Y1M A;  1RJV A;  1K9P A;  2L4H A;  2OTG C;  2WOR A;  3KEV A;  3I5H B;  5CSN A;  2ICR A;  2PVB A;  1NX2 A;  3BUN B;  3GJ2 A;  1YZW A;  3BOW A;  5EXU A;  1XVJ A;  3VK1 A;  4XOV A;  2NCP A;  2CXJ A;  2PMY A;  2OJK A;  2LVK A;  3PAT A;  1QV1 A;  2BKH B;  2LLU A;  3OB2 B;  4XL5 A;  5H87 A;  1K90 D;  3TDZ A;  3LK1 A;  2VAD A;  3P28 A;  1ZGP A;  4E68 A;  5F9G A;  4PPK A;  3KCS A;  1BOD A;  4Q04 A;  2A56 B;  4C0K A;  2I18 A;  4ORC B;  4H47 A;  1SR6 C;  2ZO7 A;  1W7S A;  3DQM A;  2QLI A;  1LIN A;  1MOU A;  5HLV A;  1J7O A;  1LVC D;  1SCM C;  3DQ2 A;  2PRU A;  4LQU A;  2AMI A;  1WY9 A;  3MGF A;  2A52 B;  1YRU B;  2OPO A;  4KA9 A;  4JFG A;  2LUX A;  1MHO A;  3DQJ A;  3DQH A;  2G16 B;  3O77 A;  1PUL A;  5KTG A;  1JBY A;  1TNQ A;  2COL B;  4YGA A;  4W7F A;  2VAE A;  2WCB A;  1F8H A;  2KAY A;  4XOW A;  2GX2 A;  1JF2 A;  3OSQ A;  4MZK A;  5DPI A;  2LVI A;  3VIC A;  1ZMZ A;  2LVV A;  3EKJ A;  1Q4B A;  2PSR A;  1J7Q A;  3CLN A;  4TNC A;  3BQ3 A;  3GOF A;  4KGE A;  4IK9 A;  3BOW B;  3DQ9 A;  4Q7T A;  3I5I C;  2WSN A;  5FVI A;  4YBH B;  2JT0 A;  1RTP 1;  4P1Q A;  4JF9 A;  2HQ8 A;  1GL4 A;  1KK7 Y;  3GL4 A;  1RMM A;  4DXO A;  1OXF A;  2M49 B;  1EG3 A;  2D8N A;  1XAE A;  1WRL A;  1AK8 A;  2CTN A;  2BTJ A;  3AKA A;  3I5F B;  2WND A;  4DXP A;  4NDB A;  1XFZ O;  2M7L A;  2HET A;  1L2O B;  3H4S E;  2H61 A;  1QAT A;  3SG4 A;  3LF4 B;  2KI6 D;  1EMF A;  3DQ8 A;  1XSS A;  4LW5 A;  2ZMW A;  3WHU B;  3A8S A;  1B7T Y;  5G08 A;  2AH8 A;  3TMT A;  5EXC I;  4OQW A;  1OMV A;  4C0J A;  2V4E C;  4YGC B;  2E6W A;  1EG4 A;  4W6I A;  1EML A;  3DPX A;  5DTX A;  4HQC A;  1SKT A;  2HQK A;  1TOP A;  2KYC A;  2O5G A;  1NUB A;  1CMG A;  1CDM A;  3JTD C;  3SSY A;  5HZT A;  4DXI A;  1W7U A;  1YHG A;  3LL8 B;  2K2F A;  2O60 A;  2KBM A;  1FPW A;  1PSB A;  2JPT A;  2G3D B;  4OKH A;  1QX2 A;  4P2Y B;  1PAL A;  2QRF A;  2MA2 A;  1LKJ A;  1SL8 A;  1F09 A;  1YUU A;  2O2B A;  3DQC A;  2LMU A;  4LJB A;  3HCM A;  4RYS A;  1J1E A;  2Z6Z A;  5T3I A;  1S36 A;  1NCX A;  1OMR A;  1DF0 A;  3PAL A;  4KF4 A;  1YX7 A;  1DGU A;  1S26 D;  5HW9 A;  4KW9 A;  4W6N A;  1B4C A;  2JT3 A;  1ALV A;  2H6V A;  2BCA A;  2QLH A;  2IE2 A;  5DTZ A;  1K9K A;  1B9C A;  1ZGO A;  3CD9 A;  2EMD A;  1F70 A;  2A53 B;  1FW4 A;  2NZ0 A;  4DXQ A;  1B8L A;  3GK1 A;  1NX1 A;  4M2Q A;  1DJI A;  2MLF C;  3PJ7 A;  3EKH A;  1N2D A;  5HBD A;  3DVK A;  4LJD A;  3O2P A;  4IZN A;  4OCI A;  2HGD A;  3SIB A;  2WC8 A;  3VHT A;  3KPX A;  2JQ6 A;  5ER5 A;  1PK0 D;  3K21 A;  4YRU A;  3DQ3 A;  1HQV A;  1XK4 C;  4W7X A;  2ZRS A;  4KF5 A;  4PCW A;  5AQB B;  2VZX A;  3BXK A;  3VGO A;  3LA1 A;  2IS9 A;  3BXC A;  4PPL A;  2OKW A;  2KGB C;  2A4J A;  1WDC B;  3CS1 A;  1C07 A;  2GX0 A;  1QX7 A;  3ST0 A;  2AHA A;  4GGF C;  2BL0 C;  4H48 A;  1S5G Y;  2A47 A;  4GBA A;  3ZTF A;  2EC6 B;  3FS7 A;  5DKQ A;  1CM1 A;  1OOJ A;  1KCY A;  3DQ6 A;  4AQI A;  3SS0 A;  2PXS A;  4I5K A;  1YHH A;  1JUO A;  1SW8 A;  5DPH A;  4EN1 A;  3CFF A;  2WHT A;  4GUK A;  1RK9 A;  1TCO B;  2C9J A;  1DF0 B;  5DY6 A;  1IQ5 A;  1MOV A;  2KQY A;  2YE0 A;  4MRY A;  2Y4Q A;  2AAO A;  4DKN A;  4KAG A;  3BXB A;  5J2O A;  2K7O A;  1SL7 A;  1MXL C;  4KW4 A;  4NDD A;  2WSO A;  4PE1 A;  4W6P A;  2OTG B;  2A54 B;  3IP2 A;  4I5J A;  2Y1N A;  4Q9X A;  1V1F A;  5BTT A;  3VRO A;  3V3D A;  1Y1A A;  1BT6 A;  1IJ5 A;  3IR8 A;  2H2K A;  2GGM A;  2QLG A;  4MN0 A;  2ISD A;  3ST3 A;  1OXE A;  1CLB A;  4QJ3 B;  2MBX A;  4PE0 A;  3DQN A;  5LK4 A;  1AJ4 A;  1Q80 A;  2OKY A;  2L2E A;  2B1U A;  4YGB B;  2EMO A;  1TNX A;  4KW8 A;  4DS7 A;  1JC0 A;  3O78 A;  2K0J A;  1GGZ A;  1BJF A;  3KF9 A;  2CCM A;  4WRI A;  1XQM A;  1KK7 Z;  1K8U A;  2G5Z B;  4NQG A;  5PAL A;  1CV7 A;  1DTL A;  5IBW A;  1S3P A;  1YUT A;  3JVT C;  1F0B A;  1SR6 B;  3NEZ A;  1SK6 D;  1GQM A;  3DPZ A;  4UPG A;  5FHV A;  1XA9 A;  1XFW O;  2ZO6 A;  1DJH A;  3TUY C;  3CD1 A;  3LVD A;  1C7V A;  3AAJ A;  1Q4C A;  2V4E A;  2JZI A;  2ZND A;  1KQM C;  1B7T Z;  1PVB A;  4B30 A;  1TIZ A;  1H4U A;  4DKM A;  1SMG A;  2FCD A;  1CLM A;  3M22 A;  4W77 A;  3AI5 A;  4JEO A;  1MQ1 A;  4W6F A;  3NT9 A;  4ANJ A;  1A4P A;  5HKW A;  1BLQ A;  3UFZ A;  1B1G A;  4DCK A;  4W6R A;  5F6T A;  2LE9 B;  1CNP A;  1FI5 A;  2P6B B;  2WOS A;  5EJU A;  3BUM B;  3WCK A;  2ARL A;  5HZS A;  2DUG A;  3IQQ A;  4ZIO A;  4HQ9 A;  2I2R E;  4J8A A;  1KFU L;  4GNK B;  5BTT B;  3H1O A;  2BCX A;  4HSZ A;  2G3O A;  3CGA A;  1UHH A;  1KFX L;  3DQ7 A;  3DF0 A;  2QLG B;  1Y6W A;  3DQD A;  3D10 A;  4PHJ A;  5HKZ A;  4W7A A;  1CDP A;  1G7K A;  3VRQ A;  1YFP A;  3I5I B;  2HCG A;  1QVI Y;  1LA0 A;  1CFP A;  2HF5 A;  4GGN A;  4W6M A;  2ZN8 A;  4XJK B;  1J7P A;  5DKN A;  2AWL A;  4FTG A;  2SCP A;  3BXA A;  2IB6 A;  1UP5 A;  1K93 D;  2VVJ A;  1M46 A;  3TZ1 A;  1NX0 A;  2Q57 A;  1NSH A;  2JAD A;  1AVS A;  4FQO A;  1OZS A;  4W6D A;  5H89 A;  2ZN9 A;  2HQZ A;  1DGV A;  1WLM A;  3LLE A;  3GK4 X;  1FBV A;  1UUS A;  4D1E A;  3U8C A;  1U5I A;  2QU1 A;  2VVH A;  2BBN A;  1UHN A;  2BBM A;  1MWN A;  1F4O A;  4ZF5 A;  4ZIN A;  3OX6 A;  2QT2 A;  2KHN A;  1AHR A;  3DVE A;  5KSZ A;  2V4E B;  1CFC A;  1E8A A;  4B30 B;  4YGD B;  2I7A A;  1CMF A;  2C9I A;  1XK4 A;  4NDC A;  2LHI A;  1EMC A;  2KFG A;  2G2S B;  2KQ6 A;  1EME A;  1Q73 A;  2LHL A;  3PLF B;  3WLC A;  3DQI A;  3S05 A;  2JXL A;  1M63 B;  3DPW A;  3JTD B;  4W6A A;  3GK2 A; 
#chains in the Genus database with same CATH topology
 1D1O A;  1OE9 B;  3I5H C;  3KCT A;  4MEW A;  1ZUZ A;  2MJW B;  5H88 A;  4Q9W A;  1TNP A;  4M2P A;  1S5G Z;  1DEL A;  2M1U A;  3DQU A;  3KO0 A;  2G2B A;  2LM5 A;  1QYF A;  2JOJ A;  2L98 A;  3BUW B;  3FWC A;  3H1R A;  1W7J B;  3DF0 B;  3NED A;  4GPL B;  1Y1X A;  4CFR A;  3D77 A;  1JBZ A;  1CM4 A;  4I2Y A;  3SSV A;  2LVJ A;  4DUQ A;  1SY9 A;  2BKI B;  4W6L A;  1KWO C;  3K1E A;  2GW3 A;  2Y0G A;  2F8P A;  2WCL A;  4PT1 A;  2Q91 A;  3PSR A;  1OOG A;  3R1O A;  1DC1 A;  3W1C A;  3EK7 A;  1Q4E A;  3CGL A;  1UIS A;  4ORA B;  3PJ5 A;  1ZFS A;  3VRR A;  5B8I B;  3SSK A;  5FVG A;  4MLW A;  1ALW A;  3R72 A;  2L51 A;  3TS5 C;  4CID A;  1QYQ A;  3S0F A;  1TUZ A;  1EMM A;  1IH0 A;  4W6O A;  3ADF A;  1GGX A;  2HGY A;  2L50 A;  2POX A;  3LF3 A;  1U5I B;  2KGR A;  1QTX A;  1JC1 A;  2JUL A;  3EVP A;  2CT9 A;  2V53 A;  2LP3 A;  3EK4 A;  2FOT A;  3CBE A;  2WHU A;  1TTX A;  2GTE A;  5FVF A;  1K9U A;  4GF6 B;  3CWG A;  3SVB A;  2DOQ A;  2OGR A;  3DZT A;  2QAC A;  3EVU A;  2JTT A;  2OS8 C;  3UG0 A;  2Y5I A;  2LV7 A;  4AS8 A;  3OBV A;  3NGV A;  3QRX A;  4W6J A;  3SVR A;  3D75 A;  3CDN A;  4BDU A;  2BL0 B;  1R2U A;  1MF8 B;  2M0R A;  1YUR A;  5AER A;  5CPV A;  2Z1O A;  1TRF A;  4TZG A;  5FI6 A;  2WHS A;  2DUF A;  4TZA A;  1CTR A;  4FQT A;  1JWD A;  2F33 A;  1SNL A;  2P70 A;  2LMT A;  2KLE A;  4PHN A;  4GOB A;  1Z1P A;  3DQ4 A;  3CR4 X;  1M39 A;  2FJU B;  4EDO A;  1XFV O;  4DXM A;  4W7R A;  1UHJ A;  3OP0 A;  1M45 A;  3PM2 A;  3GB3 A;  1N65 A;  1NWD A;  1YRT B;  2AWJ A;  4KEX A;  3IVT A;  5LTP A;  4ZF3 A;  5EBJ A;  2OTB A;  1DEK A;  4N5X A;  2F3Z A;  3IQO A;  2WIQ A;  3DQ5 A;  1NX3 A;  3FIA A;  3WNX B;  1F54 A;  2VRG A;  1PSR A;  4ZCV A;  1FF1 A;  3SSL A;  2AWM A;  2WUR A;  1Y1U A;  3L47 A;  3A4U B;  3ST4 A;  1TN4 A;  5DQB A;  1TNW A;  1S1E A;  3PN7 C;  1FI6 A;  2YDZ A;  1OSA A;  3E3R A;  4IK8 A;  1YJ2 A;  4BY5 A;  1IJ6 A;  1Y0V H;  4L13 A;  1QVI Z;  1L7Z A;  2M3W A;  3SSP A;  1WLZ A;  3DQA A;  3NSO A;  1QWV A;  1S6C A;  5CSI A;  1W9Z A;  5AXI A;  1K96 A;  2JC2 A;  1QJT A;  4HRG A;  3WXA A;  3NSI A;  1BMO A;  3CYZ A;  1EMA A;  1CFF A;  3PJB A;  4OJ0 A;  1IKU A;  1SL9 A;  3JVT B;  1AP4 A;  2DUH A;  3WHT B;  4PDZ A;  2ZMU A;  4W72 A;  1Q4A A;  2HQW A;  3TMR A;  3U8P A;  2LLS A;  2B3Q A;  3SG6 A;  3TUY B;  2H8Q A;  2VVI A;  1QIV A;  1KSM A;  4B5Y A;  4ZFS A;  1JF0 A;  1KQM B;  3F45 A;  1ZUX A;  5EL2 A;  4N1F A;  4XYN A;  2CBL A;  1J1D A;  1QYO A;  1A75 A;  3I5G C;  4J89 A;  1ZAC A;  5DQM A;  1C4F A;  1DVI A;  2M29 A;  5LTR A;  1ODB A;  4ZBL A;  1BOC A;  1M31 A;  3D74 A;  3DQ1 A;  5I8N A;  1YR5 A;  2NCO A;  3M0W A;  1K2H A;  3SG2 A;  1IQ3 A;  1CLL A;  1QLS A;  1JBA A;  4LJC A;  1BU3 A;  4QJ4 B;  4JQ0 D;  4HE4 A;  3BUO B;  1J7R A;  3W1D A;  2G9B A;  3SS5 A;  1KFU S;  1TUJ A;  3EG5 B;  4R6B A;  3BFA A;  3NSL A;  2FWQ A;  2IB5 A;  4PHK A;  1KFX S;  2H61 C;  2QEV A;  2H5P A;  3C1V A;  4OR9 B;  2MLE C;  1QAS A;  2EMN A;  4PPJ A;  2Q4U A;  1KK8 C;  3S0A A;  3UNW A;  2F2P A;  4XJK A;  1QS7 A;  2IOV A;  3L4L A;  1YJF A;  4IK4 A;  1YVL A;  1UWO A;  1CDL A;  4IJ7 A;  4R1E A;  3EVV A;  1Z2C B;  1YUS A;  3FE9 A;  2L5X B;  5DTY A;  4OZD A;  4EDS A;  5DRG A;  4W6G A;  3P8U A;  4IL1 A;  3BYA A;  3E5T A;  5DU0 A;  5DPG A;  4Q7U A;  1ZOT B;  2K2A A;  4WQ2 A;  1WDC C;  2B3P A;  5FI7 A;  2ZKM X;  2JTZ A;  4I5L B;  1SCM B;  1IGV A;  3FWB A;  1B8C A;  5JOL A;  1OOF A;  1SBJ A;  3NSK A;  2G6X A;  3ZUF A;  3AKB A;  1QXP A;  2HFC A;  4IK3 A;  2O24 A;  3DVJ A;  2KLD A;  3LCP C;  4JWQ A;  4MRX A;  3OSR A;  3IF7 A;  4Z4K A;  4PHM A;  1QLK A;  1REC A;  1UHI A;  2LAP A;  1CB1 A;  3SG5 A;  5HZO A;  2LNK A;  1XFU O;  1A75 B;  2A46 A;  2PAS A;  3NT3 A;  3BFH A;  3UO9 A;  4NWS A;  1RRO A;  1OXD A;  2CNP A;  3D76 A;  3U0L A;  1F55 A;  2KI4 C;  2LMV A;  2K61 A;  4GAO A;  2BCB A;  4JRB A;  2ZNE A;  2P4M A;  2LCP A;  1K95 A;  2HJO A;  1A29 A;  1R6P A;  3K1K A;  3DQK A;  2ZRT A;  3PFV A;  2HRS A;  4W7C A;  1S6Z A;  4MSP A;  4EUL A;  2YFP A;  2HPS A;  3CR5 X;  5HYD A;  2KDH A;  2M7N A;  3SSH A;  3WLD A;  1SPY A;  1VRK A;  3SST A;  1LA3 A;  4LJD C;  3CZT X;  2DUI A;  1DJG A;  3KHE A;  4DIR A;  1BFP A;  1H4B A;  1B8R A;  1KWO B;  1QY3 A;  1BG1 A;  2K7B A;  3ZUL A;  2GW4 B;  1MYW A;  1JC2 A;  1YVH A;  2NLN A;  3O6B A;  1B47 A;  4KF5 C;  1JSA A;  1GFL A;  3PIB A;  1H6R A;  4ETO A;  3AKO A;  3ED8 A;  4L1I A;  1PVA A;  4Q7R A;  1NCY A;  1NPQ A;  4DXN A;  3TS5 B;  1H8B A;  4JGE A;  2G6E A;  4EMQ A;  3OGO A;  4INX A;  1RFJ A;  5D69 A;  3SVO A;  2LAN A;  1KQV A;  2NXQ A;  2L4I A;  4LQT A;  2KAX A;  3CAB A;  4P5O E;  2BE6 A;  1DJX A;  3ICB A;  4JPZ B;  2JXC A;  1DJY A;  1B9A A;  2KFF A;  3VB1 A;  3AAK A;  1DJZ A;  3SG7 A;  3DQE A;  3U0M A;  2M8U A;  4AR7 A;  3D78 A;  1NP8 A;  5K89 A;  4F0Z B;  2HPW A;  4KPI A;  5EB6 A;  1IWQ A;  4W7E A;  2OS8 B;  2AUC A;  3R1V A;  4JC2 A;  4H3M A;  3N7H A;  3CZ0 A;  4W6K A;  4GGF A;  4PE4 A;  2PYQ A;  4PFE A;  2DD7 A;  5FYX A;  4A4B A;  3SVC A;  4UTS A;  3S0G A;  1W7I B;  4DRW A;  3DVM A;  4ORB B;  4MVF A;  4P76 A;  5LTQ A;  3U0K A;  1S6I A;  1NIW A;  1RRX A;  1YTZ C;  3ST2 A;  4QJ5 B;  1EJ3 A;  2KI6 C;  2F3Y A;  1EMB A;  3AI4 A;  1MXE A;  4W76 A;  1YHI A;  4PE7 A;  4L9M A;  2BAP A;  5CSF A;  4WQ3 A;  1RMO A;  1SSE B;  3NF0 A;  1LXF C;  2FCE A;  3SVD A;  3PM8 A;  3OGN A;  2EGD A;  1Q4D A;  4USL A;  4IK1 A;  4KGF A;  4Z4M A;  2FJY A;  1RWY A;  1K94 A;  5AAN A;  3EVR A;  3D0Y A;  1EL4 A;  3SVS A;  4YGE B;  2QZ0 A;  2H5Q A;  1SCV A;  3CFA A;  4IK5 A;  1BR4 B;  1AUI B;  5KTY A;  3SVN A;  2GV5 A;  2K7C A;  3TDI A;  3I19 A;  4W6S A;  4W75 A;  2EHB A;  1DJW A;  2KBI A;  3CB9 A;  3PN7 B;  1OMD A;  1DT7 B;  5BQL A;  1WRZ A;  1XFY O;  5HZU A;  1V1G A;  4RYW A;  4CFQ A;  2QPT A;  3DQF A;  1CFD A;  1QX5 B;  4F7F A;  2DDC A;  1XO5 A;  3D73 A;  1IG5 A;  2H9W A;  2AWK A;  3OX5 A;  1BR1 B;  4YI9 A;  4N1G A;  1JFJ A;  1HT9 A;  2A50 B;  1XYD A;  3DXL A;  1S6J A;  1UHK A;  1MUX A;  2KSP A;  1GM0 A;  5DKR A;  5JJG A;  5HLO A;  1GGW A;  1G33 A;  5ER4 X;  2K7D A;  3B7A A;  3DQL A;  2RH7 A;  4MZJ A;  2KFH A;  1A2X A;  3LVA A;  1RMP A;  3I5G B;  1EMG A;  5CSJ A;  4U2V A;  1X02 A;  5KU1 A;  4W6T A;  4R6D A;  3NXA A;  4MBE A;  4I5N B;  3I5F C;  4L12 A;  4OHS A;  1NYA A;  1Z1Q A;  3HX4 A;  3SIA A;  3SVE A;  2FL1 A;  1KSO A;  1L2O C;  2QEO A;  2SAS A;  4W74 A;  4C0L A;  3SVU A;  4ZCU A;  2LC5 A;  2E30 A;  4ORN A;  4CLN A;  2KAV A;  4J88 A;  4XGY A;  3D0Y B;  2WCH A;  1EMK A;  3CFH A;  3RWT A;  2P71 A;  2JWW A;  1KYS A;  2JRF A;  3MSE B;  4U8D A;  3ZWH A;  5TNC A;  3LVC A;  1KK8 B;  2KOT A;  2WCK A;  4OGS A;  1A03 A;  3DQO A;  1HUY A;  1G8I A;  1J55 A;  4OY4 A;  1ZGQ A;  3E5V A;  3ZUJ A;  2Q6P A;  4N3D A;  1F71 A;  5GQQ C;  3CR2 A;  3CTN A;  5EB7 A;  1EH2 A;  4H3N A;  1QV0 A;  4OV2 A;  2R2I A;  5EXB A;  1RM9 A;  2JT8 A;  2PAL A;  2OTE A;  4W6U A;  2O29 A;  3SRY A;  4GES B;  1PRW A;  1C7W A;  2G6Y A;  5DTL A;  2JU0 A;  4MZL A;  1KYR A;  2MHH A;  3BX9 A;  3U8A A;  5AEQ A;  2DDD A;  1SYM A;  4RTC A;  1WRK A;  3OHM B;  4YI8 A;  3SS4 A;  4PAL A;  2H5O A;  1AJ5 A;  3BUX B;  2JNF A;  4W6B A;  3E5W A;  2GGZ A;  2M9G A;  3EK8 A;  3O4Y A;  2WCE A;  2RGI A;  3VRN A;  2I94 A;  1XFX O;  3OB1 B;  2DUE A;  5EHU A;  5I2Q A;  2PXW A;  4XVP A;  5AFP A;  3LK0 A;  1XA5 A;  2F2O A;  4H3L A;  3RM1 A;  2DD9 A;  3RLZ A;  2KI4 B;  1SRA A;  3VRP A;  1UUR A;  3TDU A;  1W7T A;  1OQP A;  5I2L A;  3LSA A;  2L0P A;  1TCF A;  5DRF A;  1KP5 A;  1N0Y A;  4W73 A;  2ERB A;  3RWA A;  2M97 A;  2LP2 A;  2YE1 A;  1YX8 A;  2MRD A;  2A48 A;  4M2O A;  2WIS A;  3GJ1 A;  3G9A A;  2MAZ A;  2H5R A;  4HRH A;  4HRE E;  3M24 A;  1G4Y R;  1KYP A;  3SG3 A;  3GEX A;  2K8M B;  5DPJ A;  4A4C A;  2FZU A;  2ZFD A;  1HCJ A;  4HVF A;  3ZNI A;  1TWO A;  1F4Q A;  3VHT B;  3DD4 A;  1EXR A;  2BE4 A;  1GJY A;  2LLT A;  3SV5 A;  2KNE A;  2WC6 A;  2BEC A;  5I2O A;  4AQJ A;  3U0N A;  1OZO A;  2TN4 A;  4HQ8 A;  3B6X A;  5HGE A;  1IRJ A;  5D7F A;  4ICB A;  2EC6 C;  1BF5 A;  4W6H A;  4OVN F;  4ZB1 A;  4W6C A;  5J3X A;  1CKK A;  3SJS A;  2WCF A;  4BY4 A;  2JNX A;  3LS3 A;  2LUC A;  5BT0 A;  2KYF A;  3A8R A;  1XMZ A;  5BPJ A;  1MR8 A;  1CDN A;  1DMO A;  1JFK A;  1NCZ A;  2Z6Y A;  4W7D A;  1QXT A;  2QLE A;  2Z6X A;  4W69 A;  4AOM A;  4GFT A;  4CPV A;  4ZF4 A;  1QIW A;  5HKY A;  2M1K B;  1C3Y A;  2Y1M A;  1RJV A;  2QEH A;  1K9P A;  2L4H A;  2OTG C;  2WOR A;  3S0E A;  3KEV A;  3I5H B;  5CSN A;  2ICR A;  2PVB A;  1NX2 A;  3BUN B;  3GJ2 A;  1YZW A;  3BOW A;  5EXU A;  1XVJ A;  3VK1 A;  4XOV A;  3SS3 A;  2NCP A;  2CXJ A;  2PMY A;  2OJK A;  2LVK A;  3PAT A;  1QV1 A;  3CZ2 A;  2BKH B;  2LLU A;  3OB2 B;  4XL5 A;  5H87 A;  1K90 D;  3TDZ A;  3NHT A;  3LK1 A;  2QDI A;  2VAD A;  3P28 A;  1ZGP A;  4E68 A;  5F9G A;  4PPK A;  3KCS A;  1BOD A;  4Q04 A;  2A56 B;  4C0K A;  2I18 A;  4ORC B;  4H47 A;  1SR6 C;  2ZO7 A;  1W7S A;  3DQM A;  2QLI A;  1LIN A;  1MOU A;  5HLV A;  1J7O A;  1LVC D;  3CZ1 A;  1SCM C;  3DQ2 A;  2PRU A;  4LQU A;  2AMI A;  1WY9 A;  3MGF A;  2A52 B;  2L5Y A;  1YRU B;  1IIO A;  2OPO A;  4KA9 A;  4JFG A;  2LUX A;  1MHO A;  3DQJ A;  3DQH A;  2G16 B;  3O77 A;  1PUL A;  5KTG A;  1JBY A;  1TNQ A;  2COL B;  4YGA A;  4W7F A;  2VAE A;  2WCB A;  1F8H A;  2KAY A;  1LS8 A;  4XOW A;  2GX2 A;  1JF2 A;  3OSQ A;  4MZK A;  1Z4H A;  5DPI A;  2LVI A;  3VIC A;  1ZMZ A;  2LVV A;  3EKJ A;  1Q4B A;  2PSR A;  1J7Q A;  3CLN A;  4TNC A;  3BQ3 A;  3GOF A;  4KGE A;  4IK9 A;  3BOW B;  3DQ9 A;  4Q7T A;  3I5I C;  2WSN A;  5FVI A;  4YBH B;  2JT0 A;  1RTP 1;  4P1Q A;  4JF9 A;  2HQ8 A;  1GL4 A;  1KK7 Y;  3GL4 A;  5HL1 A;  1RMM A;  4DXO A;  1OXF A;  2M49 B;  1EG3 A;  2D8N A;  1XAE A;  2JPO A;  1WRL A;  1AK8 A;  2CTN A;  3V2L A;  2BTJ A;  3AKA A;  3I5F B;  2WND A;  4DXP A;  4NDB A;  1XFZ O;  2M7L A;  2HET A;  1L2O B;  3H4S E;  2H61 A;  1QAT A;  3SG4 A;  3LF4 B;  2KI6 D;  1EMF A;  3DQ8 A;  1XSS A;  4LW5 A;  2ZMW A;  3WHU B;  3A8S A;  3L4A A;  1B7T Y;  5G08 A;  2AH8 A;  3TMT A;  5EXC I;  4OQW A;  1OMV A;  4C0J A;  2V4E C;  3BFB A;  3B87 A;  2PQL A;  4YGC B;  2E6W A;  3RZS A;  1EG4 A;  3B86 A;  4W6I A;  3S0D A;  1EML A;  3DPX A;  5DTX A;  4HQC A;  1SKT A;  2HQK A;  3FE6 A;  1TOP A;  2KYC A;  2O5G A;  1NUB A;  1CMG A;  2BNX A;  1CDM A;  3JTD C;  3SSY A;  5HZT A;  4DXI A;  1W7U A;  1YHG A;  3LL8 B;  2K2F A;  2O60 A;  2KBM A;  1FPW A;  1C3Z A;  4JD9 A;  1PSB A;  2JPT A;  2G3D B;  4OKH A;  1QX2 A;  4P2Y B;  1PAL A;  2KPH A;  2QRF A;  2MA2 A;  1LKJ A;  1SL8 A;  1F09 A;  1YUU A;  2O2B A;  3DQC A;  2LMU A;  2K60 A;  4LJB A;  3HCM A;  4RYS A;  1J1E A;  2Z6Z A;  5T3I A;  1S36 A;  1NCX A;  1OMR A;  1DF0 A;  2QEB A;  3PAL A;  4KF4 A;  1YX7 A;  1DGU A;  1S26 D;  5HW9 A;  4KW9 A;  4W6N A;  1B4C A;  2JT3 A;  5FI2 A;  1ALV A;  2H6V A;  2BCA A;  2QLH A;  2IE2 A;  5DTZ A;  1K9K A;  1B9C A;  1ZGO A;  3CD9 A;  2EMD A;  1F70 A;  2A53 B;  1FW4 A;  2NZ0 A;  2WCJ A;  1OOH A;  4DXQ A;  1B8L A;  3GK1 A;  1NX1 A;  4M2Q A;  1DJI A;  2MLF C;  3PJ7 A;  3EKH A;  1N2D A;  5HBD A;  3DVK A;  4LJD A;  3O2P A;  4IZN A;  3PJI A;  4OCI A;  2HGD A;  2H8V A;  3SIB A;  2WC8 A;  3VHT A;  3KPX A;  2JQ6 A;  5ER5 A;  1PK0 D;  2L2C A;  3K21 A;  4YRU A;  3DQ3 A;  1HQV A;  1XK4 C;  4W7X A;  2ZRS A;  4KF5 A;  4PCW A;  5AQB B;  2VZX A;  3BXK A;  3VGO A;  3LA1 A;  2IS9 A;  3BXC A;  4PPL A;  2OKW A;  2KGB C;  5DIC A;  2A4J A;  1WDC B;  3CS1 A;  1C07 A;  2GX0 A;  1QX7 A;  3ST0 A;  2AHA A;  4GGF C;  2BL0 C;  4H48 A;  1S5G Y;  2A47 A;  4GBA A;  3ZTF A;  2EC6 B;  3FS7 A;  5DKQ A;  1CM1 A;  1OOJ A;  1KCY A;  3DQ6 A;  3B88 A;  4AQI A;  3SS0 A;  2PXS A;  4I5K A;  1YHH A;  1JUO A;  1SW8 A;  5DPH A;  4EN1 A;  2YGU A;  3CFF A;  1XFR A;  2WHT A;  4GUK A;  1RK9 A;  1TCO B;  2C9J A;  1DF0 B;  5DY6 A;  1IQ5 A;  1MOV A;  4INW A;  2KQY A;  2YE0 A;  4MRY A;  2Y4Q A;  2AAO A;  4DKN A;  4KAG A;  3BXB A;  5J2O A;  2K7O A;  1SL7 A;  5I94 A;  1MXL C;  4KW4 A;  4NDD A;  2WSO A;  4PE1 A;  4W6P A;  2OTG B;  2A54 B;  3IP2 A;  4I5J A;  1DQE A;  2Y1N A;  4Q9X A;  1V1F A;  5BTT A;  3VRO A;  3V3D A;  1Y1A A;  1P28 A;  1BT6 A;  1IJ5 A;  3IR8 A;  2H2K A;  2GGM A;  2QLG A;  4MN0 A;  2ISD A;  3ST3 A;  1OXE A;  1CLB A;  4QJ3 B;  2MBX A;  3NHI A;  4PE0 A;  3DQN A;  3Q8I A;  5LK4 A;  1AJ4 A;  1Q80 A;  2OKY A;  1OW4 A;  2L2E A;  2B1U A;  4YGB B;  2EMO A;  1TNX A;  4KW8 A;  4DS7 A;  1JC0 A;  3O78 A;  2K0J A;  3FE8 A;  1GGZ A;  1BJF A;  3KF9 A;  2CCM A;  4WRI A;  1XQM A;  1KK7 Z;  1K8U A;  2G5Z B;  4NQG A;  5PAL A;  1CV7 A;  3BJH A;  1DTL A;  5IBW A;  1S3P A;  3S0B A;  1YUT A;  3JVT C;  1F0B A;  1SR6 B;  3NEZ A;  1SK6 D;  1GQM A;  3DPZ A;  4UPG A;  5FHV A;  1XA9 A;  1XFW O;  2ZO6 A;  1DJH A;  3TUY C;  3CD1 A;  3LVD A;  3DYE A;  1C7V A;  3AAJ A;  1Q4C A;  2V4E A;  2JZI A;  2ZND A;  1KQM C;  1B7T Z;  1PVB A;  1T14 A;  4B30 A;  1TIZ A;  1H4U A;  4DKM A;  1SMG A;  2FCD A;  1CLM A;  3M22 A;  4W77 A;  3AI5 A;  4JEO A;  1MQ1 A;  4W6F A;  3O4X A;  3NT9 A;  4ANJ A;  1A4P A;  5HKW A;  1BLQ A;  3UFZ A;  1B1G A;  4DCK A;  4W6R A;  5F6T A;  2LE9 B;  1CNP A;  1OOI X;  1FI5 A;  2P6B B;  2WOS A;  5EJU A;  3BUM B;  3WCK A;  2ARL A;  5HZS A;  2DUG A;  3IQQ A;  4ZIO A;  4HQ9 A;  4JKT A;  2I2R E;  4J8A A;  1KFU L;  4GNK B;  5BTT B;  3H1O A;  2BCX A;  4HSZ A;  2WC5 A;  2G3O A;  3CGA A;  1UHH A;  1KFX L;  3DQ7 A;  3DF0 A;  2QLG B;  1Y6W A;  3DQD A;  3D10 A;  4PHJ A;  5D3O A;  5HKZ A;  4W7A A;  1CDP A;  2WCM A;  1G7K A;  3VRQ A;  1YFP A;  3I5I B;  2HCG A;  1QVI Y;  1LA0 A;  1CFP A;  2HF5 A;  4GGN A;  4W6M A;  2ZN8 A;  4XJK B;  1J7P A;  5DKN A;  2AWL A;  4FTG A;  2SCP A;  3BXA A;  2IB6 A;  1UP5 A;  1K93 D;  2VVJ A;  1M46 A;  3TZ1 A;  1ORG A;  1NX0 A;  2Q57 A;  1NSH A;  2JAD A;  1AVS A;  4FQO A;  1OZS A;  4W6D A;  5H89 A;  2ZN9 A;  2HQZ A;  3DY9 A;  1DGV A;  1WLM A;  3LLE A;  3GK4 X;  1FBV A;  1UUS A;  4D1E A;  3U8C A;  1U5I A;  2QU1 A;  2VVH A;  2BBN A;  1UHN A;  2BBM A;  1MWN A;  3R1P A;  1F4O A;  4ZF5 A;  4ZIN A;  3OX6 A;  2QT2 A;  2KHN A;  1AHR A;  3DVE A;  5KSZ A;  2V4E B;  1CFC A;  1E8A A;  4B30 B;  4YGD B;  2I7A A;  1CMF A;  2C9I A;  1XK4 A;  4NDC A;  3QME A;  2LHI A;  1EMC A;  2KFG A;  4KYN A;  2G2S B;  2KQ6 A;  1EME A;  1Q73 A;  2LHL A;  3PLF B;  3WLC A;  3DQI A;  3S05 A;  2JXL A;  1M63 B;  3DPW A;  3JTD B;  4W6A A;  3GK2 A; 
#chains in the Genus database with same CATH homology
 1D1O A;  1OE9 B;  3I5H C;  3KCT A;  4MEW A;  1ZUZ A;  2MJW B;  5H88 A;  4Q9W A;  1TNP A;  4M2P A;  1S5G Z;  2M1U A;  3DQU A;  3KO0 A;  2G2B A;  2LM5 A;  1QYF A;  2JOJ A;  2L98 A;  3BUW B;  3FWC A;  3H1R A;  1W7J B;  3DF0 B;  3NED A;  4GPL B;  1Y1X A;  4CFR A;  4I2Y A;  1JBZ A;  1CM4 A;  3SSV A;  2LVJ A;  4DUQ A;  1SY9 A;  2BKI B;  4W6L A;  1KWO C;  2GW3 A;  2Y0G A;  2F8P A;  2Q91 A;  3PSR A;  3W1C A;  3EK7 A;  1Q4E A;  3CGL A;  1UIS A;  4ORA B;  3PJ5 A;  1ZFS A;  3VRR A;  5B8I B;  3SSK A;  5FVG A;  4MLW A;  1ALW A;  2L51 A;  3TS5 C;  4CID A;  1QYQ A;  1EMM A;  1IH0 A;  4W6O A;  3ADF A;  1GGX A;  2HGY A;  2L50 A;  2POX A;  3LF3 A;  1U5I B;  2KGR A;  1QTX A;  1JC1 A;  2JUL A;  3EVP A;  2CT9 A;  2V53 A;  2LP3 A;  3EK4 A;  2FOT A;  3CBE A;  2WHU A;  1TTX A;  5FVF A;  1K9U A;  4GF6 B;  3CWG A;  3SVB A;  2DOQ A;  2OGR A;  2QAC A;  3EVU A;  2JTT A;  2OS8 C;  3UG0 A;  2Y5I A;  2LV7 A;  4AS8 A;  3QRX A;  4W6J A;  3SVR A;  4BDU A;  2BL0 B;  1R2U A;  1MF8 B;  2M0R A;  1YUR A;  5AER A;  5CPV A;  2Z1O A;  1TRF A;  4TZG A;  2WHS A;  2DUF A;  4TZA A;  1CTR A;  1JWD A;  2F33 A;  1SNL A;  2LMT A;  4PHN A;  4GOB A;  1Z1P A;  3DQ4 A;  3CR4 X;  1M39 A;  2FJU B;  4EDO A;  1XFV O;  4DXM A;  4W7R A;  1UHJ A;  3OP0 A;  1M45 A;  3GB3 A;  1N65 A;  1NWD A;  1YRT B;  2AWJ A;  4KEX A;  5LTP A;  4ZF3 A;  5EBJ A;  2OTB A;  4N5X A;  2F3Z A;  3IQO A;  2WIQ A;  3DQ5 A;  1NX3 A;  3FIA A;  3WNX B;  1F54 A;  2VRG A;  1PSR A;  4ZCV A;  1FF1 A;  3SSL A;  2AWM A;  2WUR A;  1Y1U A;  3A4U B;  3ST4 A;  1TN4 A;  5DQB A;  1TNW A;  1S1E A;  3PN7 C;  1FI6 A;  2YDZ A;  1OSA A;  3E3R A;  4IK8 A;  1YJ2 A;  4BY5 A;  1IJ6 A;  1Y0V H;  4L13 A;  1QVI Z;  1L7Z A;  2M3W A;  3SSP A;  1WLZ A;  3DQA A;  3NSO A;  1S6C A;  5CSI A;  5AXI A;  1K96 A;  2JC2 A;  1QJT A;  4HRG A;  3WXA A;  3NSI A;  1BMO A;  1EMA A;  1CFF A;  3PJB A;  4OJ0 A;  1IKU A;  1SL9 A;  3JVT B;  1AP4 A;  2DUH A;  3WHT B;  4PDZ A;  2ZMU A;  4W72 A;  1Q4A A;  2HQW A;  3TMR A;  3U8P A;  2LLS A;  2B3Q A;  3SG6 A;  3TUY B;  2H8Q A;  2VVI A;  1QIV A;  1KSM A;  4B5Y A;  4ZFS A;  1JF0 A;  1KQM B;  3F45 A;  1ZUX A;  4N1F A;  4XYN A;  2CBL A;  1J1D A;  1QYO A;  1A75 A;  3I5G C;  4J89 A;  1ZAC A;  5DQM A;  1C4F A;  1DVI A;  2M29 A;  5LTR A;  1ODB A;  4ZBL A;  1BOC A;  1M31 A;  3DQ1 A;  5I8N A;  1YR5 A;  2NCO A;  3M0W A;  1K2H A;  3SG2 A;  1IQ3 A;  1CLL A;  1QLS A;  1JBA A;  4LJC A;  1BU3 A;  4QJ4 B;  4JQ0 D;  4HE4 A;  3BUO B;  1J7R A;  3W1D A;  2G9B A;  1KFU S;  4R6B A;  3NSL A;  2FWQ A;  2IB5 A;  4PHK A;  1KFX S;  2H61 C;  2H5P A;  3C1V A;  4OR9 B;  2MLE C;  1QAS A;  2EMN A;  4PPJ A;  2Q4U A;  1KK8 C;  2F2P A;  4XJK A;  1QS7 A;  2IOV A;  1YJF A;  4IK4 A;  1YVL A;  1UWO A;  1CDL A;  4R1E A;  3EVV A;  1YUS A;  2L5X B;  5DTY A;  4EDS A;  5DRG A;  4W6G A;  3P8U A;  4IL1 A;  3BYA A;  3E5T A;  5DU0 A;  5DPG A;  4Q7U A;  1ZOT B;  2K2A A;  4WQ2 A;  1WDC C;  2B3P A;  2ZKM X;  2JTZ A;  4I5L B;  1SCM B;  1IGV A;  3FWB A;  1B8C A;  5JOL A;  1SBJ A;  3NSK A;  2G6X A;  3ZUF A;  3AKB A;  1QXP A;  2HFC A;  4IK3 A;  2O24 A;  3DVJ A;  3LCP C;  4JWQ A;  4MRX A;  3OSR A;  3IF7 A;  4Z4K A;  4PHM A;  1QLK A;  1REC A;  1UHI A;  2LAP A;  1CB1 A;  3SG5 A;  5HZO A;  2LNK A;  1XFU O;  1A75 B;  2A46 A;  2PAS A;  3NT3 A;  4NWS A;  1RRO A;  1OXD A;  2CNP A;  3U0L A;  1F55 A;  2KI4 C;  2LMV A;  2K61 A;  4GAO A;  2BCB A;  4JRB A;  2ZNE A;  2P4M A;  2LCP A;  1K95 A;  2HJO A;  1A29 A;  1R6P A;  3K1K A;  3DQK A;  2ZRT A;  3PFV A;  2HRS A;  4W7C A;  1S6Z A;  4MSP A;  4EUL A;  2YFP A;  2HPS A;  3CR5 X;  5HYD A;  2KDH A;  2M7N A;  3SSH A;  3WLD A;  1SPY A;  1VRK A;  3SST A;  1LA3 A;  4LJD C;  3CZT X;  2DUI A;  1DJG A;  3KHE A;  4DIR A;  1BFP A;  1H4B A;  1B8R A;  1KWO B;  1QY3 A;  1BG1 A;  2K7B A;  3ZUL A;  2GW4 B;  1MYW A;  1JC2 A;  1YVH A;  2NLN A;  3O6B A;  1B47 A;  4KF5 C;  1JSA A;  1GFL A;  3PIB A;  1H6R A;  4ETO A;  3AKO A;  3ED8 A;  4L1I A;  1PVA A;  4Q7R A;  1NCY A;  1NPQ A;  4DXN A;  3TS5 B;  1H8B A;  4JGE A;  2G6E A;  4EMQ A;  3OGO A;  1RFJ A;  5D69 A;  3SVO A;  2LAN A;  1KQV A;  2NXQ A;  2L4I A;  4LQT A;  2KAX A;  4P5O E;  2BE6 A;  1DJX A;  3ICB A;  4JPZ B;  2JXC A;  1DJY A;  1B9A A;  2KFF A;  3AAK A;  1DJZ A;  3SG7 A;  3DQE A;  3U0M A;  2M8U A;  4AR7 A;  1NP8 A;  5K89 A;  4F0Z B;  2HPW A;  4KPI A;  5EB6 A;  1IWQ A;  4W7E A;  2OS8 B;  2AUC A;  4JC2 A;  4H3M A;  4W6K A;  4GGF A;  4PE4 A;  4PFE A;  2DD7 A;  5FYX A;  4A4B A;  3SVC A;  4UTS A;  1W7I B;  4DRW A;  3DVM A;  4ORB B;  4MVF A;  4P76 A;  5LTQ A;  3U0K A;  1S6I A;  1NIW A;  1RRX A;  1YTZ C;  3ST2 A;  4QJ5 B;  1EJ3 A;  2KI6 C;  2F3Y A;  1EMB A;  3AI4 A;  1MXE A;  4W76 A;  1YHI A;  4PE7 A;  4L9M A;  5CSF A;  4WQ3 A;  1RMO A;  3NF0 A;  1LXF C;  2FCE A;  3SVD A;  3PM8 A;  2EGD A;  1Q4D A;  4USL A;  4IK1 A;  4KGF A;  4Z4M A;  1RWY A;  1K94 A;  5AAN A;  3EVR A;  3D0Y A;  1EL4 A;  3SVS A;  4YGE B;  2QZ0 A;  2H5Q A;  1SCV A;  3CFA A;  4IK5 A;  1BR4 B;  1AUI B;  5KTY A;  3SVN A;  2GV5 A;  2K7C A;  3TDI A;  3I19 A;  4W6S A;  4W75 A;  2EHB A;  1DJW A;  2KBI A;  3CB9 A;  3PN7 B;  1OMD A;  1DT7 B;  5BQL A;  1WRZ A;  1XFY O;  5HZU A;  1V1G A;  4RYW A;  4CFQ A;  2QPT A;  3DQF A;  1CFD A;  1QX5 B;  2DDC A;  1XO5 A;  1IG5 A;  2H9W A;  2AWK A;  3OX5 A;  1BR1 B;  4YI9 A;  4N1G A;  1JFJ A;  1HT9 A;  2A50 B;  1XYD A;  1S6J A;  1UHK A;  1MUX A;  2KSP A;  5DKR A;  5JJG A;  5HLO A;  1GGW A;  1G33 A;  5ER4 X;  2K7D A;  3DQL A;  2RH7 A;  4MZJ A;  2KFH A;  1A2X A;  3LVA A;  1RMP A;  3I5G B;  1EMG A;  5CSJ A;  4U2V A;  1X02 A;  5KU1 A;  4W6T A;  4R6D A;  3NXA A;  4MBE A;  4I5N B;  3I5F C;  4L12 A;  4OHS A;  1NYA A;  1Z1Q A;  3HX4 A;  3SIA A;  3SVE A;  2FL1 A;  1KSO A;  1L2O C;  2SAS A;  4W74 A;  4C0L A;  3SVU A;  4ZCU A;  2LC5 A;  2E30 A;  4ORN A;  4CLN A;  2KAV A;  4J88 A;  4XGY A;  3D0Y B;  1EMK A;  3CFH A;  3RWT A;  2JWW A;  1KYS A;  2JRF A;  3MSE B;  4U8D A;  3ZWH A;  5TNC A;  3LVC A;  1KK8 B;  2KOT A;  4OGS A;  1A03 A;  3DQO A;  1HUY A;  1G8I A;  1J55 A;  4OY4 A;  1ZGQ A;  3E5V A;  3ZUJ A;  2Q6P A;  4N3D A;  1F71 A;  5GQQ C;  3CR2 A;  3CTN A;  5EB7 A;  1EH2 A;  4H3N A;  1QV0 A;  4OV2 A;  2R2I A;  5EXB A;  1RM9 A;  2JT8 A;  2PAL A;  2OTE A;  4W6U A;  2O29 A;  3SRY A;  4GES B;  1PRW A;  1C7W A;  2G6Y A;  5DTL A;  2JU0 A;  4MZL A;  1KYR A;  2MHH A;  3BX9 A;  3U8A A;  5AEQ A;  2DDD A;  1SYM A;  4RTC A;  1WRK A;  3OHM B;  4YI8 A;  4PAL A;  2H5O A;  1AJ5 A;  3BUX B;  2JNF A;  4W6B A;  3E5W A;  2GGZ A;  2M9G A;  3EK8 A;  3O4Y A;  2WCE A;  2RGI A;  3VRN A;  2I94 A;  1XFX O;  3OB1 B;  2DUE A;  5EHU A;  5I2Q A;  2PXW A;  4XVP A;  5AFP A;  3LK0 A;  1XA5 A;  2F2O A;  4H3L A;  3RM1 A;  2DD9 A;  3RLZ A;  2KI4 B;  1SRA A;  3VRP A;  1UUR A;  3TDU A;  1W7T A;  1OQP A;  5I2L A;  3LSA A;  2L0P A;  1TCF A;  5DRF A;  1KP5 A;  1N0Y A;  4W73 A;  3RWA A;  2M97 A;  2LP2 A;  2YE1 A;  1YX8 A;  2MRD A;  2A48 A;  4M2O A;  2WIS A;  3GJ1 A;  3G9A A;  2MAZ A;  2H5R A;  4HRH A;  4HRE E;  3M24 A;  1G4Y R;  1KYP A;  3SG3 A;  3GEX A;  2K8M B;  5DPJ A;  4A4C A;  2FZU A;  2ZFD A;  1HCJ A;  4HVF A;  3ZNI A;  1F4Q A;  3VHT B;  3DD4 A;  1EXR A;  2BE4 A;  1GJY A;  2LLT A;  3SV5 A;  2KNE A;  2BEC A;  5I2O A;  4AQJ A;  3U0N A;  1OZO A;  2TN4 A;  4HQ8 A;  5HGE A;  1IRJ A;  5D7F A;  4ICB A;  2EC6 C;  1BF5 A;  4W6H A;  4OVN F;  4ZB1 A;  4W6C A;  5J3X A;  1CKK A;  3SJS A;  2WCF A;  4BY4 A;  2JNX A;  3LS3 A;  2LUC A;  5BT0 A;  2KYF A;  3A8R A;  1XMZ A;  5BPJ A;  1MR8 A;  1CDN A;  1DMO A;  1JFK A;  1NCZ A;  2Z6Y A;  4W7D A;  1QXT A;  2QLE A;  2Z6X A;  4W69 A;  4AOM A;  4GFT A;  4CPV A;  4ZF4 A;  1QIW A;  5HKY A;  2M1K B;  2Y1M A;  1RJV A;  1K9P A;  2L4H A;  2OTG C;  2WOR A;  3KEV A;  3I5H B;  5CSN A;  2ICR A;  2PVB A;  1NX2 A;  3BUN B;  3GJ2 A;  1YZW A;  3BOW A;  5EXU A;  1XVJ A;  3VK1 A;  4XOV A;  2NCP A;  2CXJ A;  2PMY A;  2OJK A;  2LVK A;  3PAT A;  1QV1 A;  2BKH B;  2LLU A;  3OB2 B;  4XL5 A;  5H87 A;  1K90 D;  3TDZ A;  3LK1 A;  2VAD A;  3P28 A;  1ZGP A;  4E68 A;  5F9G A;  4PPK A;  3KCS A;  1BOD A;  4Q04 A;  2A56 B;  4C0K A;  2I18 A;  4ORC B;  4H47 A;  1SR6 C;  2ZO7 A;  1W7S A;  3DQM A;  2QLI A;  1LIN A;  1MOU A;  5HLV A;  1J7O A;  1LVC D;  1SCM C;  3DQ2 A;  2PRU A;  4LQU A;  2AMI A;  1WY9 A;  3MGF A;  2A52 B;  1YRU B;  2OPO A;  4KA9 A;  4JFG A;  2LUX A;  1MHO A;  3DQJ A;  3DQH A;  2G16 B;  3O77 A;  1PUL A;  5KTG A;  1JBY A;  1TNQ A;  2COL B;  4YGA A;  4W7F A;  2VAE A;  2WCB A;  1F8H A;  2KAY A;  4XOW A;  2GX2 A;  1JF2 A;  3OSQ A;  4MZK A;  5DPI A;  2LVI A;  3VIC A;  1ZMZ A;  2LVV A;  3EKJ A;  1Q4B A;  2PSR A;  1J7Q A;  3CLN A;  4TNC A;  3BQ3 A;  3GOF A;  4KGE A;  4IK9 A;  3BOW B;  3DQ9 A;  4Q7T A;  3I5I C;  2WSN A;  5FVI A;  4YBH B;  2JT0 A;  1RTP 1;  4P1Q A;  4JF9 A;  2HQ8 A;  1GL4 A;  1KK7 Y;  3GL4 A;  1RMM A;  4DXO A;  1OXF A;  2M49 B;  1EG3 A;  2D8N A;  1XAE A;  1WRL A;  1AK8 A;  2CTN A;  2BTJ A;  3AKA A;  3I5F B;  2WND A;  4DXP A;  4NDB A;  1XFZ O;  2M7L A;  2HET A;  1L2O B;  3H4S E;  2H61 A;  1QAT A;  3SG4 A;  3LF4 B;  2KI6 D;  1EMF A;  3DQ8 A;  1XSS A;  4LW5 A;  2ZMW A;  3WHU B;  3A8S A;  1B7T Y;  5G08 A;  2AH8 A;  3TMT A;  5EXC I;  4OQW A;  1OMV A;  4C0J A;  2V4E C;  4YGC B;  2E6W A;  1EG4 A;  4W6I A;  1EML A;  3DPX A;  5DTX A;  4HQC A;  1SKT A;  2HQK A;  1TOP A;  2KYC A;  2O5G A;  1NUB A;  1CMG A;  1CDM A;  3JTD C;  3SSY A;  5HZT A;  4DXI A;  1W7U A;  1YHG A;  3LL8 B;  2K2F A;  2O60 A;  2KBM A;  1FPW A;  1PSB A;  2JPT A;  2G3D B;  4OKH A;  1QX2 A;  4P2Y B;  1PAL A;  2QRF A;  2MA2 A;  1LKJ A;  1SL8 A;  1F09 A;  1YUU A;  2O2B A;  3DQC A;  2LMU A;  4LJB A;  3HCM A;  4RYS A;  1J1E A;  2Z6Z A;  5T3I A;  1S36 A;  1NCX A;  1OMR A;  1DF0 A;  3PAL A;  4KF4 A;  1YX7 A;  1DGU A;  1S26 D;  5HW9 A;  4KW9 A;  4W6N A;  1B4C A;  2JT3 A;  1ALV A;  2H6V A;  2BCA A;  2QLH A;  2IE2 A;  5DTZ A;  1K9K A;  1B9C A;  1ZGO A;  3CD9 A;  2EMD A;  1F70 A;  2A53 B;  1FW4 A;  2NZ0 A;  4DXQ A;  1B8L A;  3GK1 A;  1NX1 A;  4M2Q A;  1DJI A;  2MLF C;  3PJ7 A;  3EKH A;  1N2D A;  5HBD A;  3DVK A;  4LJD A;  3O2P A;  4IZN A;  4OCI A;  2HGD A;  3SIB A;  2WC8 A;  3VHT A;  3KPX A;  2JQ6 A;  5ER5 A;  1PK0 D;  3K21 A;  4YRU A;  3DQ3 A;  1HQV A;  1XK4 C;  4W7X A;  2ZRS A;  4KF5 A;  4PCW A;  5AQB B;  2VZX A;  3BXK A;  3VGO A;  3LA1 A;  2IS9 A;  3BXC A;  4PPL A;  2OKW A;  2KGB C;  2A4J A;  1WDC B;  3CS1 A;  1C07 A;  2GX0 A;  1QX7 A;  3ST0 A;  2AHA A;  4GGF C;  2BL0 C;  4H48 A;  1S5G Y;  2A47 A;  4GBA A;  3ZTF A;  2EC6 B;  3FS7 A;  5DKQ A;  1CM1 A;  1OOJ A;  1KCY A;  3DQ6 A;  4AQI A;  3SS0 A;  2PXS A;  4I5K A;  1YHH A;  1JUO A;  1SW8 A;  5DPH A;  4EN1 A;  3CFF A;  2WHT A;  4GUK A;  1RK9 A;  1TCO B;  2C9J A;  1DF0 B;  5DY6 A;  1IQ5 A;  1MOV A;  2KQY A;  2YE0 A;  4MRY A;  2Y4Q A;  2AAO A;  4DKN A;  4KAG A;  3BXB A;  5J2O A;  2K7O A;  1SL7 A;  1MXL C;  4KW4 A;  4NDD A;  2WSO A;  4PE1 A;  4W6P A;  2OTG B;  2A54 B;  3IP2 A;  4I5J A;  2Y1N A;  4Q9X A;  1V1F A;  5BTT A;  3VRO A;  3V3D A;  1Y1A A;  1BT6 A;  1IJ5 A;  3IR8 A;  2H2K A;  2GGM A;  2QLG A;  4MN0 A;  2ISD A;  3ST3 A;  1OXE A;  1CLB A;  4QJ3 B;  2MBX A;  4PE0 A;  3DQN A;  5LK4 A;  1AJ4 A;  1Q80 A;  2OKY A;  2L2E A;  2B1U A;  4YGB B;  2EMO A;  1TNX A;  4KW8 A;  4DS7 A;  1JC0 A;  3O78 A;  2K0J A;  1GGZ A;  1BJF A;  3KF9 A;  2CCM A;  4WRI A;  1XQM A;  1KK7 Z;  1K8U A;  2G5Z B;  4NQG A;  5PAL A;  1CV7 A;  1DTL A;  5IBW A;  1S3P A;  1YUT A;  3JVT C;  1F0B A;  1SR6 B;  3NEZ A;  1SK6 D;  1GQM A;  3DPZ A;  4UPG A;  5FHV A;  1XA9 A;  1XFW O;  2ZO6 A;  1DJH A;  3TUY C;  3CD1 A;  3LVD A;  1C7V A;  3AAJ A;  1Q4C A;  2V4E A;  2JZI A;  2ZND A;  1KQM C;  1B7T Z;  1PVB A;  4B30 A;  1TIZ A;  1H4U A;  4DKM A;  1SMG A;  2FCD A;  1CLM A;  3M22 A;  4W77 A;  3AI5 A;  4JEO A;  1MQ1 A;  4W6F A;  3NT9 A;  4ANJ A;  1A4P A;  5HKW A;  1BLQ A;  3UFZ A;  1B1G A;  4DCK A;  4W6R A;  5F6T A;  2LE9 B;  1CNP A;  1FI5 A;  2P6B B;  2WOS A;  5EJU A;  3BUM B;  3WCK A;  2ARL A;  5HZS A;  2DUG A;  3IQQ A;  4ZIO A;  4HQ9 A;  2I2R E;  4J8A A;  1KFU L;  4GNK B;  5BTT B;  3H1O A;  2BCX A;  4HSZ A;  2G3O A;  3CGA A;  1UHH A;  1KFX L;  3DQ7 A;  3DF0 A;  2QLG B;  1Y6W A;  3DQD A;  3D10 A;  4PHJ A;  5HKZ A;  4W7A A;  1CDP A;  1G7K A;  3VRQ A;  1YFP A;  3I5I B;  2HCG A;  1QVI Y;  1LA0 A;  1CFP A;  2HF5 A;  4GGN A;  4W6M A;  2ZN8 A;  4XJK B;  1J7P A;  5DKN A;  2AWL A;  4FTG A;  2SCP A;  3BXA A;  2IB6 A;  1UP5 A;  1K93 D;  2VVJ A;  1M46 A;  3TZ1 A;  1NX0 A;  2Q57 A;  1NSH A;  2JAD A;  1AVS A;  4FQO A;  1OZS A;  4W6D A;  5H89 A;  2ZN9 A;  2HQZ A;  1DGV A;  1WLM A;  3LLE A;  3GK4 X;  1FBV A;  1UUS A;  4D1E A;  3U8C A;  1U5I A;  2QU1 A;  2VVH A;  2BBN A;  1UHN A;  2BBM A;  1MWN A;  1F4O A;  4ZF5 A;  4ZIN A;  3OX6 A;  2QT2 A;  2KHN A;  1AHR A;  3DVE A;  5KSZ A;  2V4E B;  1CFC A;  1E8A A;  4B30 B;  4YGD B;  2I7A A;  1CMF A;  2C9I A;  1XK4 A;  4NDC A;  2LHI A;  1EMC A;  2KFG A;  2G2S B;  2KQ6 A;  1EME A;  1Q73 A;  2LHL A;  3PLF B;  3WLC A;  3DQI A;  3S05 A;  2JXL A;  1M63 B;  3DPW A;  3JTD B;  4W6A A;  3GK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...