3SG3A

Crystal structure of gcamp3-d380y
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
409
structure length
394
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 138
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg3A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg3A02
1KQVA 2WHTA 1G33A 4R1EA 1CLBA 1JC0A 1PSBA 2LVVA 3GJ2A 4DXQA 1TNWA 1Q4AA 2P6BB 2F8PA 2FL1A 2LCPA 3ZUJA 4ZF4A 5AXIA 4GGFC 1SNLA 2L51A 5DKRA 1RECA 1BMOA 2JQ6A 1GGZA 3EKJA 1NX0A 3SSHA 3SSTA 5BTTA 1Q4DA 1K94A 2QU1A 3RWTA 2NXQA 1IG5A 4ORCB 3I5IC 2HQZA 5TNCA 3SVOA 2EMNA 4OJ0A 3SJSA 1YVLA 1D1OA 4EDSA 3ST0A 4AOMA 4JEOA 2L4IA 2I18A 4W6GA 3P28A 2KAXA 3TZ1A 3UFZA 3BXKA 2K7CA 4MN0A 3DPWA 4Z4KA 5KTGA 3FWBA 2CTNA 2IB5A 3SVSA 2QLGB 4KAGA 1CLLA 4AR7A 4W6DA 1GJYA 2HCGA 4RTCA 4LJDA 2GGMA 4JF9A 2PVBA 2JPTA 1ZUXA 1BU3A 2M1KB 2VADA 1SW8A 4W74A 2YFPA 4L1IA 1CFPA 1SKTA 4FQOA 3KF9A 2LP3A 2G3DB 4EULA 3AKAA 1XK4A 5HBDA 3JVTB 1RROA 1AJ5A 1K90D 1M46A 4AQIA 1N2DA 3SG4A 1H4BA 4OGSA 5CSNA 4ZCUA 3CFHA 2H6VA 2IE2A 3TDZA 3U8PA 3M24A 1PK0D 2BL0C 1K95A 5CSJA 3IR8A 2QZ0A 1DJGA 2KBIA 4IK8A 5DPGA 4GBAA 2V53A 5HZTA 1MQ1A 2LVJA 2O29A 4W76A 1KK7Z 1RFJA 4H3NA 4YI9A 1G7KA 3SVEA 1BR1B 5KU1A 1EG3A 2BE6A 1KK7Y 1YHGA 1IWQA 2KFHA 1CB1A 1KP5A 2HFCA 4ORNA 3DQAA 3H1RA 4DUQA 2KYFA 1NCYA 1Q4CA 2QLGA 3DQ9A 1TCOB 2ZNEA 2KAYA 2H5QA 1C7WA 1UURA 1KK8C 2KSPA 3DQ8A 1PRWA 1K96A 2LMTA 1CFDA 3E3RA 1NP8A 4OKHA 1OXEA 1UHHA 2RGIA 3GJ1A 1Y6WA 2O2BA 2KI6C 2F33A 5JJGA 1ZMZA 2G5ZB 4KEXA 1QV1A 4HSZA 1WLZA 1DT7B 5I2QA 4JRBA 1SYMA 3KEVA 3MGFA 2KYCA 3AAKA 5BQLA 2H8QA 1BT6A 3PJBA 1YURA 1YRUB 1K8UA 4F0ZB 2QLHA 1W7SA 2PALA 1ZOTB 1ALWA 4PPLA 1KYSA 1MXEA 3E5WA 1BF5A 1C07A 2VAEA 1Y1AA 5DTLA 1J1EA 2DOQA 1DMOA 4H3LA 1OQPA 1OZOA 3LF3A 4YBHB 1F71A 4HVFA 4ZF5A 3ICBA 4HREE 1W7UA 5DQBA 4PE7A 1RWYA 2PXSA 3SVNA 4ZF3A 1S36A 1MF8B 2EMDA 2JT0A 2KHNA 2EHBA 1EMKA 3TMTA 1AHRA 3JTDB 4IK4A 3DQDA 4ZINA 1CM4A 3FWCA 2I7AA 3K21A 1K9KA 4HE4A 2M29A 2BCAA 1QJTA 4Q7UA 4PE1A 4N1GA 4XOWA 3SIAA 4QJ4B 5DKQA 3W1DA 2KGRA 1EG4A 1B4CA 1CNPA 1EMBA 2FZUA 3ST4A 1SRAA 1KWOC 1NSHA 1UHIA 3TDUA 4W6OA 2HJOA 2HQKA 2HRSA 5HLOA 3LA1A 2L0PA 1CTRA 4MZJA 4LJBA 1BFPA 4PHJA 3SSPA 5DTXA 1ZGQA 2F2PA 4USLA 5AERA 1J1DA 3RLZA 4W6LA 2Y1MA 5LTQA 1EJ3A 3JVTC 2YE1A 3CB9A 3DPXA 2C9IA 5D69A 1SR6C 4MRXA 5KSZA 2V4EB 2M7LA 1DF0B 3WLCA 2ZKMX 2AWJA 3DQFA 3EVPA 4I5LB 2QPTA 3M22A 2QACA 5GQQC 4EMQA 2CBLA 2OJKA 3DQCA 4Q7TA 5HLVA 1TN4A 2F3YA 1GGXA 3KCSA 3VRRA 5EXBA 1MUXA 2HGYA 3A8RA 1ZGPA 1XFUO 4JFGA 3PM8A 1FW4A 3SG5A 2JOJA 2LAPA 5EXUA 2GV5A 2VVIA 2BBMA 4W7XA 1MOUA 2KAVA 4XOVA 1L7ZA 1OMRA 1Y0VH 3DQUA 2ZNDA 2K2FA 1JWDA 2IS9A 5T3IA 3D0YB 4CFRA 4GPLB 4PHMA 3CLNA 4KW8A 1HQVA 2VRGA 2JULA 3FIAA 1S6IA 3CGLA 4LW5A 4YGDB 2LV7A 5HKWA 2C9JA 1SBJA 1U5IB 3BQ3A 1EMMA 2G16B 2A54B 4D1EA 3GK1A 1SY9A 3SG6A 2MJWB 1W7IB 3WXAA 5EXCI 3SVUA 5ER5A 1RMMA 2OGRA 4E68A 1KFXL 4ZB1A 3NXAA 1NWDA 2DUFA 2V4EA 3NSLA 3SG3A 1CDLA 1DF0A 1JBAA 3NT9A 2KI4C 4P76A 1TRFA 1CKKA 2HETA 1F8HA 1XAEA 1WDCB 2ZRSA 1UHJA 2ZRTA 2DUEA 1OXDA 1IH0A 2EC6B 2NZ0A 3WNXB 1JC2A 1KSMA 3G9AA 3TS5C 1N0YA 1NIWA 3U0MA 1Q73A 3NSKA 3NF0A 2H5PA 1ZFSA 1C4FA 4IK1A 1UUSA 3BXCA 2H5RA 4Q7RA 4W6KA 5F6TA 1S3PA 3VRPA 2A56B 4W6BA 2WURA 1OOJA 1KFXS 1CFFA 4Q04A 2O60A 1CLMA 2JU0A 1QX2A 4I2YA 2M49B 3DQEA 3D0YA 3DQ7A 4W7EA 1HT9A 1JBYA 5HZOA 1RMPA 5BT0A 4W75A 1XVJA 1OXFA 4ZIOA 2A46A 1EH2A 1B7TZ 1BG1A 5EB6A 2KNEA 2OKWA 1XFXO 3LK1A 1U5IA 5AFPA 5DTYA 2WCFA 2I94A 2WCEA 2ZFDA 3JTDC 4DXMA 4UPGA 3IQOA 2LC5A 2AAOA 1MHOA 3GL4A 1JSAA 1IJ5A 1XQMA 4I5NB 3AAJA 1UP5A 4JC2A 4EDOA 1KWOB 5DPIA 5FHVA 3A8SA 1JFJA 4LQUA 2GW4B 3E5TA 4HQ9A 1FI5A 2A52B 1S26D 1K93D 4H48A 1XFVO 1EMEA 1MOVA 3DQNA 5I2OA 4PHKA 2KQYA 4GNKB 3PJ5A 1SL8A 2WHUA 2WCBA 4W6CA 2IB6A 5AEQA 3BXBA 1Q4EA 1SL7A 4GFTA 1XSSA 3IP2A 4C0LA 3O2PA 4ANJA 5AQBB 2Y5IA 1SR6B 4DS7A 3WCKA 3VGOA 1ODBA 1DJXA 1J7RA 2K7DA 3SG7A 4DXNA 1TCFA 3HCMA 2FWQA 1XA5A 2WC8A 1V1GA 2V4EC 3ST3A 2FCEA 4W6JA 1NUBA 1GGWA 1DTLA 2MA2A 4NDBA 4B30B 1EMAA 3S05A 2G2SB 3EVVA 3VROA 3H1OA 2LLTA 1ALVA 4HQCA 2BECA 3BUNB 4YGEB 3DD4A 4M2QA 5I2LA 1L2OB 4PHNA 5J3XA 1JBZA 1QS7A 3SS0A 1QX5B 4J89A 4IL1A 1BLQA 1PALA 2PRUA 3BX9A 4J88A 1K2HA 2FCDA 4WQ3A 2LHIA 1CMFA 3LSAA 5HZUA 4JQ0D 1CDMA 1JFKA 2MLFC 4YGCB 1DJYA 2A48A 1J7OA 1UHKA 3DVEA 4ZFSA 1OZSA 3KPXA 4NQGA 3GOFA 2OTBA 3CBEA 2Z6XA 1BJFA 4DXPA 3AKOA 1IKUA 2H2KA 1YHHA 4YI8A 4W6RA 2M97A 2KI4B 3U8CA 1TTXA 4M2OA 4L13A 4W6UA 1WLMA 3TS5B 3OSQA 2LMUA 3SSLA 3DQIA 3HX4A 4IK9A 1CM1A 3OB2B 1LA3A 2LUCA 5FVGA 4Q9WA 3NT3A 3EVUA 1Y1UA 1WDCC 1QASA 3EK4A 2EC6C 4PE4A 4IK3A 4W77A 2TN4A 2F3ZA 2WSNA 2K7OA 3LCPC 3BUWB 1PULA 1ZACA 2B3PA 3OP0A 5DRFA 4XGYA 3BUMB 2Z1OA 3DVKA 2WHSA 2CXJA 3PFVA 4BY4A 3RM1A 5HYDA 3OSRA 3DQ2A 2M9GA 1F4OA 2G6YA 3BUOB 1Z1PA 2BKHB 1R2UA 3GEXA 3ZTFA 4OV2A 4MRYA 4HQ8A 1AJ4A 4M2PA 3GK4X 4R6BA 2ISDA 3EK8A 1KQMC 2KFFA 3ZULA 2OTEA 1QLKA 2H61A 1B8RA 2B3QA 2OS8C 3ZUFA 3AI4A 5DRGA 1RTP1 5EHUA 3U8AA 4GAOA 3DVJA 2HPWA 2JNXA 1TNQA 2FOTA 3ZWHA 4W6SA 1CDPA 1GL4A 1SCVA 2O5GA 1E8AA 2AWLA 1UWOA 1A75B 3DQ4A 2CCMA 4HRHA 1W7JB 2LANA 1LKJA 2Q57A 4PE0A 3M0WA 3SRYA 3LK0A 1QX7A 2KI6D 4W73A 3U0KA 3QRXA 4W7DA 1QIWA 4AQJA 3DQJA 2PMYA 1YFPA 1NX3A 2ICRA 2GGZA 4C0JA 1YHIA 1Y1XA 2M8UA 3SG2A 3BXAA 2QT2A 1K9PA 3H4SE 3CR4X 5EJUA 1A29A 1JF2A 3LL8B 2DD9A 2MRDA 4ORBB 2MBXA 1SCMC 4JGEA 1NX1A 1WRZA 2JXCA 4KPIA 2WIQA 1S5GZ 3E5VA 2BCXA 5JOLA 2K2AA 3KO0A 2HPSA 3EVRA 2KBMA 1DJIA 4MLWA 4YGBB 2L50A 1B9CA 5H89A 4MZLA 3A4UB 2WOSA 3RWAA 1IQ3A 3WHTB 1LXFC 1CDNA 1PVAA 4W7CA 4GESB 1B9AA 1S5GY 2D8NA 4TNCA 5IBWA 2A53B 3SSKA 2G9BA 4TZGA 4CFQA 4ZCVA 1BODA 2I2RE 1L2OC 2ZO6A 2AMIA 5AANA 1Q4BA 5F9GA 2H9WA 4KGEA 1AVSA 2LMVA 3SV5A 3PN7B 3CGAA 1A75A 2K8MB 2BE4A 1Q80A 4Z4MA 4OCIA 3DQ1A 1QY3A 1DVIA 3O4YA 3TUYB 4KGFA 4XL5A 4FTGA 5LTPA 1CFCA 1RMOA 5DPHA 3BYAA 3DF0B 1KYPA 4W6FA 4KA9A 3CR2A 2LP2A 2E30A 1N65A 3CZTX 3OGOA 4W69A 2H61C 4ORAB 1RJVA 4W7RA 2Y0GA 1CMGA 3V3DA 1HCJA 1QXTA 2PXWA 1KCYA 5H87A 4XYNA 4WQ2A 3UG0A 3SIBA 5CSFA 2POXA 1JF0A 3MSEB 4PALA 1G4YR 3DQ5A 2JZIA 4R6DA 1YUUA 1GFLA 2RH7A 1NX2A 1J55A 2NLNA 1OMDA 3IQQA 1F4QA 4DXIA 1QATA 2JADA 1IQ5A 4H3MA 4XVPA 3SSVA 3NSOA 5LK4A 3PIBA 4BDUA 1A2XA 3U0NA 3CD1A 2AWMA 1DJWA 4W6IA 3I5GB 4PPJA 1AK8A 1TNXA 1RRXA 1KQMB 1S6CA 4W6PA 2A4JA 1M45A 1JC1A 2DDCA 5LTRA 2BKIB 3SVDA 3VHTB 2AWKA 3NSIA 4ZBLA 2OS8B 3DVMA 3O6BA 2ZMWA 2PASA 4KF5C 2OPOA 2L98A 4DCKA 4MVFA 4EN1A 4TZAA 3DF0A 2K0JA 4A4BA 4OY4A 3OB1B 1B7TY 2GX2A 1DJHA 2Q91A 2LHLA 3DQKA 4DIRA 1YZWA 4I5KA 2GW3A 3ED8A 1EMCA 4MSPA 2WNDA 1H8BA 1A4PA 5HW9A 4RYSA 1C7VA 2HQWA 4JWQA 4N5XA 3IF7A 1EMGA 3VK1A 5K89A 1XFYO 2G2BA 1OMVA 1LA0A 4W6AA 2E6WA 3EKHA 1FPWA 3BOWB 4RYWA 5PALA 2EMOA 1F55A 3LVAA 1NPQA 3CTNA 2A47A 1MR8A 1S1EA 4W6TA 4C0KA 2OTGB 2B1UA 3SSYA 1TOPA 2G3OA 1SCMB 1XMZA 2KDHA 2CT9A 2M7NA 1J7PA 1QV0A 2WISA 4UTSA 5HZSA 4NDDA 5I8NA 4P2YB 1KFUL 4GF6B 4KW9A 2QLEA 3CWGA 3DPZA 2Y1NA 4ICBA 2M1UA 2DD7A 2MHHA 4XJKB 3WHUB 3PALA 2BBNA 3VHTA 1W7TA 2Z6YA 1YVHA 3GK2A 4Q9XA 3KHEA 2AH8A 3I5FB 4DKMA 5DQMA 1DGVA 5DTZA 1IRJA 1YJFA 4CPVA 3DQMA 2VZXA 4CIDA 3AKBA 1H6RA 4NWSA 2ZN9A 1F54A 4N3DA 1SL9A 3NEDA 3NEZA 1IGVA 4J8AA 3DQ6A 4PDZA 2K7BA 4U2VA 5HKZA 4B5YA 2LVIA 1KFUS 4W7AA 3ADFA 1NYAA 2YDZA 2Y4QA 1X02A 4PFEA 2JTTA 3CFFA 2WORA 1RK9A 3WLDA 2ZN8A 1HUYA 4L12A 1XYDA 3PN7C 4WRIA 2JC2A 5DKNA 2L5XB 3BOWA 2L4HA 3I5HC 2KGBC 1BR4B 3I19A 5DU0A 1M39A 1QYOA 4PCWA 1UISA 3TUYC 3O78A 3ZNIA 2COLB 4PPKA 2VVHA 1OE9B 1XFZO 1YX8A 2KFGA 4KF4A 3ST2A 1QYQA 1AUIB 2WSOA 4QJ5B 1MXLC 1F0BA 1ZGOA 1NCXA 3AI5A 2Q6PA 4OHSA 2OKYA 4LJCA 3PJ7A 2JT3A 2JXLA 3SVBA 2MAZA 2G6XA 4MZKA 4XJKA 1F70A 2DUGA 3PLFB 2IOVA 4B30A 3OX5A 5FYXA 4A4CA 1EL4A 2LNKA 1YX7A 4LJDC 1UHNA 3VRQA 2K61A 1SMGA 1B1GA 2JNFA 3FS7A 4P5OE 1YRTB 5ER4X 2M3WA 1KSOA 1XK4C 1RM9A 4OQWA 4CLNA 2Z6ZA 3C1VA 1QIVA 3I5GC 1JUOA 1B47A 2QRFA 3DQOA 2LLUA 2PSRA 3I5IB 2P4MA 1V1FA 3U0LA 3W1CA 3DQ3A 2HF5A 2JT8A 5EB7A 1FBVA 3PATA 5EBJA 2SCPA 3DQLA 2L2EA 1Z1QA 1MWNA 1BOCA 4BY5A 1XO5A 1EMFA 1NCZA 1M63B 3CS1A 4HRGA 2JWWA 3OHMB 2DUIA 2M0RA 4DRWA 1G8IA 3LF4B 2EGDA 1F09A 5G08A 1S6ZA 1WY9A 1B8CA 3EK7A 4GOBA 1SPYA 1A03A 1CV7A 4L9MA 4IZNA 2DDDA 2ZMUA 1AP4A 5KTYA 1KYRA 5DPJA 3CR5X 4W6MA 1TIZA 2QLIA 2BCBA 4MEWA 3GB3A 5B8IB 2A50B 4I5JA 1S6JA 5H88A 3SVCA 2JTZA 2LLSA 1K9UA 4N1FA 4H47A 3P8UA 4QJ3B 2AHAA 2ZO7A 5HGEA 3O77A 4GGFA 1QXPA 2O24A 5FVIA 4GGNA 2H5OA 2OTGC 1QYFA 4W6HA 2HQ8A 1LVCD 1OSAA 2BL0B 2DUHA 3DQHA 1QLSA 2R2IA 1EMLA 3D10A 4W6NA 1DJZA 5DY6A 4KF5A 2ARLA 1FF1A 4DKNA 5BPJA 1MYWA 3BUXB 3LLEA 4JPZB 2LM5A 4NDCA 2BTJA 2NCPA 4P1QA 3CFAA 1YJ2A 1ZUZA 1YUTA 1QVIZ 1H4UA 2KOTA 1IJ6A 1YTZC 4AS8A 3KCTA 2LE9B 2FJUB 3K1KA 3I5FC 4W7FA 3TMRA 1DGUA 1J7QA 4YRUA 1FI6A 1SK6D 1YR5A 4OR9B 1QVIY 2F2OA 3VICA 2Q4UA 4W72A 1B8LA 5FVFA 2HGDA 1LINA 3LS3A 2CNPA 1M31A 5BTTB 1KK8B 1WRLA 4IK5A 3SVRA 3I5HB 1PVBA 1TNPA 3OX6A 4ETOA 5D7FA 1YUSA 4GUKA 2NCOA 1QTXA 2KQ6A 5CSIA 1WRKA 5CPVA 2LVKA 3F45A 1XFWO 3PSRA 4KW4A 2SASA 5J2OA 3VRNA 2LUXA 2MLEC 3TDIA 2YE0A 1PSRA 2VVJA 1XA9A 4LQTA 1EXRA 4U8DA 3LVCA 2G6EA 3CD9A 4YGAA 1R6PA 2JRFA 2AUCA 5HKYA 1GQMA 4DXOA 4MBEA 2GX0A 3LVDA 1VRKA 4OVNF
chains in the Genus database with same CATH superfamily
1KQVA 2WHTA 1G33A 4R1EA 1CLBA 1JC0A 1PSBA 2LVVA 3GJ2A 4DXQA 1TNWA 1Q4AA 2P6BB 2F8PA 2FL1A 2LCPA 3ZUJA 4ZF4A 5AXIA 4GGFC 1SNLA 2L51A 5DKRA 1RECA 1BMOA 2JQ6A 1GGZA 3EKJA 1NX0A 3SSHA 3SSTA 5BTTA 2QEVA 1Q4DA 1K94A 3FE9A 2QU1A 3RWTA 2NXQA 1IG5A 4ORCB 3I5IC 2HQZA 5TNCA 3SVOA 2EMNA 4OJ0A 4PT1A 3SJSA 1YVLA 1D1OA 3S0DA 4EDSA 3ST0A 4AOMA 4JEOA 2L4IA 2I18A 4W6GA 1DC1A 3P28A 2KAXA 3TZ1A 3UFZA 3BXKA 2K7CA 4MN0A 3DPWA 4Z4KA 5KTGA 3FWBA 2CTNA 2IB5A 3SVSA 2QLGB 3RZSA 4KAGA 2FJYA 1CLLA 4AR7A 4W6DA 1GJYA 2HCGA 4RTCA 4LJDA 2GGMA 4JF9A 2PVBA 2JPTA 1ZUXA 1BU3A 1IIOA 2M1KB 2VADA 1SW8A 4W74A 2YFPA 4L1IA 1CFPA 1SKTA 4FQOA 3KF9A 2LP3A 2G3DB 4EULA 3AKAA 1XK4A 5HBDA 3JVTB 1C3YA 1RROA 1AJ5A 1K90D 1M46A 4AQIA 1N2DA 3SG4A 1H4BA 4OGSA 5CSNA 3BFAA 4ZCUA 3CFHA 2H6VA 2IE2A 3TDZA 3U8PA 3M24A 1PK0D 2BL0C 1K95A 5EL2A 5CSJA 3V2LA 3IR8A 2QZ0A 1DJGA 2KBIA 4IK8A 5DPGA 4GBAA 2V53A 5HZTA 2WCMA 5FI7A 1MQ1A 2LVJA 5FI2A 2O29A 4W76A 1KK7Z 1RFJA 4H3NA 4YI9A 1G7KA 4OZDA 3SVEA 3D75A 1BR1B 5KU1A 1EG3A 2BE6A 1KK7Y 1YHGA 1IWQA 2KFHA 1CB1A 1KP5A 2HFCA 1XFRA 4ORNA 3DQAA 3H1RA 4DUQA 2KYFA 1NCYA 1Q4CA 2QLGA 3DQ9A 1TCOB 3PJIA 2ZNEA 2KAYA 2QEHA 2H5QA 1C7WA 1UURA 1KK8C 2KSPA 3DQ8A 1PRWA 3SS5A 1K96A 2LMTA 1CFDA 3E3RA 1NP8A 4OKHA 1OXEA 1UHHA 2RGIA 3GJ1A 1Y6WA 1SSEB 2O2BA 2KI6C 2F33A 5JJGA 1ZMZA 2G5ZB 4KEXA 1QV1A 4HSZA 1WLZA 1DT7B 5I2QA 4JRBA 3IVTA 1SYMA 3KEVA 2KYCA 3MGFA 3AAKA 5BQLA 2H8QA 1BT6A 3PJBA 1OW4A 1YURA 1YRUB 1K8UA 4F0ZB 2QLHA 1W7SA 2PALA 5HL1A 1ZOTB 1ALWA 1C3ZA 4PPLA 1KYSA 1MXEA 3E5WA 1BF5A 1C07A 2VAEA 1Y1AA 5DTLA 1J1EA 2DOQA 2PQLA 1DMOA 4H3LA 1OQPA 1OZOA 3LF3A 4YBHB 1F71A 4HVFA 4ZF5A 3ICBA 4HREE 1W7UA 5DQBA 4PE7A 1RWYA 2PXSA 3SVNA 4ZF3A 1S36A 1MF8B 2EMDA 2JT0A 2KHNA 4FQTA 2EHBA 1EMKA 3TMTA 1AHRA 3JTDB 4IK4A 3DQDA 4ZINA 1CM4A 3FWCA 2I7AA 3K21A 1K9KA 4HE4A 2M29A 2BCAA 1QJTA 4Q7UA 4PE1A 4N1GA 4XOWA 3SIAA 4QJ4B 1OOFA 5DKQA 3W1DA 2KGRA 1EG4A 1B4CA 1CNPA 1EMBA 2FZUA 3ST4A 1SRAA 3B7AA 1KWOC 1NSHA 1UHIA 3NGVA 3TDUA 4W6OA 2HJOA 2HQKA 2HRSA 2L2CA 5HLOA 3LA1A 2L0PA 1CTRA 4MZJA 4LJBA 1BFPA 4PHJA 3SSPA 5DTXA 1ZGQA 2F2PA 4USLA 5AERA 1J1DA 3RLZA 4W6LA 2Y1MA 5LTQA 1EJ3A 3JVTC 2YE1A 1TWOA 3CB9A 3BJHA 3DPXA 2C9IA 5D69A 1SR6C 4F7FA 4MRXA 5KSZA 4IJ7A 2V4EB 2M7LA 1DF0B 3WLCA 2ZKMX 2AWJA 3DQFA 3EVPA 4I5LB 2QPTA 3M22A 2QACA 5GQQC 4EMQA 3DY9A 2CBLA 2WCKA 2OJKA 3DQCA 4Q7TA 5HLVA 1TN4A 2F3YA 1GGXA 3KCSA 3VRRA 5EXBA 1MUXA 2HGYA 3A8RA 1ZGPA 1XFUO 4JFGA 3PM8A 1FW4A 3SG5A 2JOJA 2LAPA 5EXUA 2GV5A 2VVIA 2BBMA 4W7XA 1MOUA 2KAVA 4XOVA 1L7ZA 1OMRA 1Y0VH 3DQUA 2ZNDA 3FE6A 2K2FA 1JWDA 2IS9A 5T3IA 3D0YB 4CFRA 4GPLB 3L4AA 3CLNA 4PHMA 4KW8A 1HQVA 2VRGA 2JULA 3FIAA 1S6IA 3CGLA 4LW5A 4YGDB 2LV7A 3FE8A 5HKWA 2C9JA 1SBJA 1U5IB 3BQ3A 1EMMA 2G16B 2A54B 4D1EA 3GK1A 1SY9A 3SG6A 2MJWB 1W7IB 3WXAA 5EXCI 3SVUA 5ER5A 3D76A 1RMMA 2OGRA 4E68A 1KFXL 4ZB1A 3NXAA 1NWDA 2DUFA 2V4EA 3NSLA 3SG3A 1CDLA 1DF0A 1JBAA 3NT9A 2KI4C 4P76A 1TRFA 1CKKA 2HETA 1F8HA 1XAEA 1WDCB 2ZRSA 1UHJA 2ZRTA 2DUEA 1OXDA 1IH0A 2EC6B 2NZ0A 3D77A 3WNXB 1JC2A 1KSMA 3G9AA 3TS5C 1N0YA 1NIWA 3U0MA 1Q73A 3NSKA 3NF0A 2H5PA 1ZFSA 1C4FA 4IK1A 1UUSA 3BXCA 2H5RA 4Q7RA 3OGNA 4W6KA 5F6TA 1S3PA 3VRPA 2A56B 4W6BA 2WURA 1OOJA 1KFXS 1CFFA 4Q04A 2O60A 1CLMA 2JU0A 2BNXA 1QX2A 4I2YA 2M49B 3DQEA 3D0YA 3DQ7A 4W7EA 1HT9A 1JBYA 4INXA 5HZOA 1RMPA 5BT0A 4W75A 1XVJA 1OXFA 4ZIOA 2A46A 1EH2A 1B7TZ 1BG1A 5EB6A 2KNEA 2OKWA 1XFXO 3L4LA 3LK1A 1U5IA 5AFPA 5DTYA 2WCFA 1LS8A 2I94A 2WCEA 2WC5A 2ZFDA 3JTDC 3SS3A 4DXMA 4UPGA 3IQOA 2LC5A 2AAOA 1MHOA 3GL4A 1JSAA 1IJ5A 1XQMA 4I5NB 3AAJA 1UP5A 4JC2A 4EDOA 1KWOB 5DPIA 5FHVA 3A8SA 1JFJA 4LQUA 3CDNA 2GW4B 3E5TA 4HQ9A 1FI5A 2A52B 1S26D 1K93D 1EMEA 1XFVO 1MOVA 4H48A 3DQNA 5I2OA 4PHKA 2KQYA 4GNKB 3PJ5A 1SL8A 2WHUA 2WCBA 4W6CA 2IB6A 5AEQA 3BXBA 1Q4EA 1SL7A 4GFTA 1XSSA 3IP2A 4C0LA 3O2PA 3QMEA 4ANJA 5AQBB 2Y5IA 1SR6B 3NHTA 4DS7A 3WCKA 3VGOA 1ODBA 3S0BA 1OOHA 2WC6A 1DJXA 1J7RA 2K7DA 3SG7A 4DXNA 1TCFA 3HCMA 2FWQA 1XA5A 2WC8A 1V1GA 2V4EC 3D74A 3ST3A 2FCEA 4W6JA 1NUBA 1GGWA 1DTLA 2YGUA 2MA2A 4NDBA 4B30B 1EMAA 2QEBA 3S05A 2G2SB 3EVVA 3VROA 3H1OA 2LLTA 1ALVA 4HQCA 2BECA 3O4XA 3BUNB 4YGEB 3DD4A 4M2QA 5I2LA 1L2OB 4PHNA 5J3XA 1JBZA 1QS7A 3SS0A 1QX5B 4J89A 4IL1A 1BLQA 1PALA 3S0GA 2PRUA 3BX9A 4J88A 1K2HA 3R1OA 1T14A 2FCDA 4WQ3A 2LHIA 1CMFA 3LSAA 5HZUA 4JQ0D 1CDMA 1JFKA 2MLFC 4YGCB 1DJYA 2A48A 1J7OA 3BFHA 2WCLA 1UHKA 3DVEA 2ERBA 4ZFSA 1OZSA 3KPXA 4NQGA 3GOFA 2OTBA 3CBEA 2Z6XA 1BJFA 4DXPA 3AKOA 1IKUA 2H2KA 1YHHA 4YI8A 4W6RA 2M97A 2KI4B 3U8CA 1TTXA 4M2OA 4L13A 4W6UA 1WLMA 3TS5B 3OSQA 2LMUA 3SSLA 3DQIA 2WCHA 3HX4A 4IK9A 1CM1A 3OB2B 1LA3A 2LUCA 5FVGA 4Q9WA 3EVUA 1Y1UA 1WDCC 3NT3A 1QASA 3EK4A 2EC6C 4PE4A 4IK3A 4W77A 2TN4A 2F3ZA 2WSNA 2K7OA 3LCPC 3BUWB 1PULA 1ZACA 2B3PA 3OP0A 5DRFA 4XGYA 3BUMB 2Z1OA 3DVKA 2WHSA 2CXJA 2L5YA 3PFVA 4BY4A 3RM1A 5HYDA 3OSRA 3DQ2A 2M9GA 1F4OA 2G6YA 3BUOB 1Z1PA 2BKHB 1R2UA 3GEXA 1Z4HA 3Q8IA 3ZTFA 4OV2A 4MRYA 4HQ8A 1AJ4A 3R1VA 4M2PA 3GK4X 4R6BA 2ISDA 3EK8A 1KQMC 3SS4A 2KFFA 3ZULA 2OTEA 1QLKA 2H61A 1B8RA 2B3QA 2OS8C 3ZUFA 3AI4A 5DRGA 1RTP1 5EHUA 3U8AA 4GAOA 3DVJA 2HPWA 2KLDA 2JNXA 1TNQA 2FOTA 1W9ZA 3ZWHA 4W6SA 1CDPA 1GL4A 1SCVA 2O5GA 1E8AA 2AWLA 1UWOA 1A75B 3DQ4A 2CCMA 4HRHA 1W7JB 3CYZA 2LANA 1LKJA 2Q57A 4PE0A 3M0WA 3SRYA 3LK0A 1QX7A 2KI6D 4W73A 3U0KA 3QRXA 4W7DA 1QIWA 4AQJA 3DQJA 2PMYA 1YFPA 1NX3A 2ICRA 2GGZA 4C0JA 1YHIA 1Y1XA 2M8UA 3SG2A 3BXAA 2QT2A 1K9PA 1TUZA 3H4SE 1QWVA 3CR4X 5EJUA 1A29A 1JF2A 3LL8B 2DD9A 2MRDA 4ORBB 3BFBA 2MBXA 1SCMC 1GM0A 4JGEA 1NX1A 1WRZA 2JXCA 4KPIA 2WIQA 2KLEA 1S5GZ 3E5VA 2BCXA 5JOLA 2K2AA 3KO0A 2HPSA 3EVRA 2KBMA 3S0FA 1DJIA 4MLWA 4YGBB 2L50A 1B9CA 5H89A 4MZLA 3A4UB 2WOSA 3CZ1A 3RWAA 1IQ3A 3WHTB 1LXFC 1CDNA 1PVAA 4W7CA 4GESB 1B9AA 1S5GY 3K1EA 2D8NA 4TNCA 5IBWA 2A53B 3SSKA 2G9BA 4TZGA 4CFQA 4ZCVA 1BODA 2I2RE 1L2OC 2ZO6A 2AMIA 5AANA 1Q4BA 5F9GA 1DEKA 2H9WA 4KGEA 2KPHA 1AVSA 2LMVA 3SV5A 2P70A 3PN7B 1OOGA 3CGAA 1A75A 2K8MB 2BE4A 1Q80A 4Z4MA 4OCIA 3DQ1A 1QY3A 1DVIA 3O4YA 2P71A 3TUYB 4KGFA 4XL5A 4FTGA 5LTPA 1CFCA 1RMOA 5DPHA 3BYAA 3DF0B 1KYPA 4W6FA 4KA9A 3CR2A 2LP2A 3S0EA 2E30A 1N65A 3CZTX 3OGOA 4JKTA 4W69A 2H61C 4ORAB 1RJVA 4W7RA 2Y0GA 1CMGA 3V3DA 1HCJA 1QXTA 2K60A 2PXWA 1KCYA 5H87A 4XYNA 1OOIX 4WQ2A 3UG0A 3SIBA 5CSFA 2POXA 1JF0A 3MSEB 4PALA 1G4YR 3DQ5A 2JZIA 4R6DA 1YUUA 1GFLA 2RH7A 1NX2A 1J55A 2NLNA 1OMDA 3PM2A 3IQQA 1F4QA 4DXIA 1QATA 2JADA 1IQ5A 3NHIA 4H3MA 4XVPA 3SSVA 3NSOA 5LK4A 3PIBA 4BDUA 1A2XA 3U0NA 3CD1A 2AWMA 1DJWA 4W6IA 3I5GB 4PPJA 3R1PA 1AK8A 1TNXA 1RRXA 1KQMB 1S6CA 4W6PA 2A4JA 1M45A 1JC1A 2DDCA 5LTRA 2BKIB 3SVDA 3VHTB 2AWKA 3NSIA 4ZBLA 2OS8B 3CZ2A 3DVMA 3O6BA 3CABA 2ZMWA 2PASA 4KF5C 2OPOA 2L98A 4DCKA 4MVFA 4EN1A 4TZAA 3DF0A 2K0JA 4A4BA 4OY4A 3OB1B 1B7TY 2GX2A 1DJHA 2Q91A 2LHLA 3DQKA 4DIRA 1YZWA 4I5KA 2GW3A 3ED8A 1EMCA 4MSPA 2WNDA 1H8BA 1A4PA 5HW9A 4RYSA 1C7VA 2HQWA 4JWQA 4N5XA 2QDIA 3IF7A 1EMGA 3VK1A 5K89A 1XFYO 2G2BA 1OMVA 1LA0A 4W6AA 2E6WA 3EKHA 3UNWA 1FPWA 3BOWB 4RYWA 5PALA 2EMOA 1F55A 3LVAA 2GTEA 1NPQA 3CTNA 2A47A 1MR8A 1S1EA 4W6TA 4C0KA 2OTGB 2B1UA 3SSYA 1TOPA 2G3OA 1SCMB 1XMZA 2JPOA 5D3OA 2KDHA 2CT9A 2M7NA 1J7PA 3R72A 1QV0A 2WISA 4UTSA 5HZSA 4NDDA 5I8NA 4P2YB 1KFUL 4GF6B 4KW9A 2QLEA 3CWGA 3DPZA 2Y1NA 4ICBA 2M1UA 2DD7A 2MHHA 4XJKB 3WHUB 3PALA 2BBNA 3VHTA 1W7TA 2Z6YA 1YVHA 3GK2A 4Q9XA 3DYEA 3KHEA 2AH8A 3I5FB 4DKMA 5DQMA 1DGVA 5DTZA 1IRJA 1YJFA 2WCJA 2PYQA 4CPVA 3DQMA 2VZXA 4CIDA 4JD9A 3AKBA 1H6RA 4NWSA 2ZN9A 1F54A 4N3DA 1SL9A 3NEDA 3NEZA 1IGVA 4J8AA 3DQ6A 4PDZA 2K7BA 4U2VA 5HKZA 3DZTA 4B5YA 2LVIA 1KFUS 4W7AA 3ADFA 1NYAA 2YDZA 2Y4QA 1X02A 4PFEA 2JTTA 3CFFA 2WORA 3DXLA 1RK9A 3WLDA 2ZN8A 1HUYA 4L12A 1XYDA 3PN7C 4WRIA 2JC2A 5DKNA 2L5XB 3BOWA 2L4HA 3I5HC 2KGBC 1BR4B 3I19A 2QEOA 1M39A 5DU0A 1QYOA 4PCWA 1UISA 3TUYC 3O78A 3ZNIA 5FI6A 2COLB 4PPKA 2VVHA 1OE9B 1XFZO 1YX8A 2KFGA 4KF4A 3ST2A 1QYQA 1AUIB 2WSOA 4QJ5B 1MXLC 1F0BA 1ZGOA 1NCXA 3AI5A 2Q6PA 4OHSA 2OKYA 5DICA 4LJCA 3PJ7A 2JT3A 2JXLA 3N7HA 2MAZA 2G6XA 3SVBA 4MZKA 4XJKA 1F70A 2DUGA 3PLFB 4KYNA 2IOVA 4B30A 3OX5A 3OBVA 1P28A 5FYXA 4A4CA 1EL4A 2LNKA 3L47A 1YX7A 4LJDC 1UHNA 3VRQA 2K61A 1SMGA 1B1GA 2JNFA 3FS7A 1DELA 4P5OE 1YRTB 5ER4X 2M3WA 1KSOA 1XK4C 1RM9A 4OQWA 4CLNA 2Z6ZA 3C1VA 1QIVA 3I5GC 1JUOA 1B47A 3EG5B 2QRFA 3DQOA 2LLUA 2PSRA 3I5IB 2P4MA 1V1FA 3U0LA 3W1CA 3DQ3A 2HF5A 2JT8A 5EB7A 1FBVA 3PATA 5EBJA 2SCPA 3B87A 3DQLA 2BAPA 2L2EA 1Z1QA 3VB1A 1MWNA 1BOCA 4BY5A 1XO5A 1EMFA 1NCZA 1M63B 3CS1A 4HRGA 2JWWA 3OHMB 2DUIA 3B88A 4INWA 2M0RA 4DRWA 1G8IA 3LF4B 2EGDA 1F09A 5G08A 1S6ZA 1WY9A 1B8CA 3EK7A 4GOBA 1SPYA 1A03A 1CV7A 4L9MA 4IZNA 2DDDA 2ZMUA 3UO9A 1AP4A 5KTYA 1KYRA 5DPJA 3CR5X 4W6MA 1TIZA 2QLIA 2BCBA 1DQEA 4MEWA 3GB3A 5B8IB 2A50B 4I5JA 1S6JA 5H88A 3SVCA 2JTZA 2LLSA 1K9UA 4N1FA 3P8UA 4H47A 4QJ3B 3S0AA 2AHAA 2ZO7A 5HGEA 3O77A 4GGFA 1QXPA 2O24A 5FVIA 4GGNA 2H5OA 2H8VA 2OTGC 1QYFA 4W6HA 2HQ8A 1LVCD 3B6XA 1OSAA 2BL0B 2DUHA 3DQHA 1QLSA 1ORGA 2R2IA 1EMLA 3D10A 4W6NA 1DJZA 5DY6A 4KF5A 2ARLA 1FF1A 4DKNA 5BPJA 1MYWA 3BUXB 3LLEA 4JPZB 2LM5A 4NDCA 2BTJA 2NCPA 4P1QA 3CFAA 1YJ2A 1ZUZA 1YUTA 1QVIZ 1H4UA 2KOTA 3B86A 1IJ6A 1YTZC 4AS8A 3KCTA 2LE9B 2FJUB 3K1KA 3I5FC 4W7FA 3TMRA 1DGUA 3D73A 1J7QA 4YRUA 1FI6A 1SK6D 1YR5A 1Z2CB 4OR9B 1QVIY 2F2OA 3VICA 2Q4UA 4W72A 1B8LA 5FVFA 2HGDA 1LINA 3LS3A 2CNPA 1M31A 5BTTB 1KK8B 1WRLA 4IK5A 3SVRA 3I5HB 1PVBA 1TNPA 3OX6A 4ETOA 5D7FA 1YUSA 4GUKA 2NCOA 1QTXA 2KQ6A 5CSIA 1WRKA 5CPVA 2LVKA 3F45A 1XFWO 3PSRA 4KW4A 2SASA 5J2OA 3VRNA 2LUXA 2MLEC 3TDIA 5I94A 2YE0A 1PSRA 2VVJA 1XA9A 4LQTA 3D78A 1EXRA 4U8DA 3LVCA 1TUJA 2G6EA 3CD9A 4YGAA 3CZ0A 1R6PA 2JRFA 2AUCA 5HKYA 1GQMA 4DXOA 4MBEA 2GX0A 3LVDA 1VRKA 4OVNF
chains in the Genus database with same CATH topology
1KQVA 2WHTA 1G33A 4R1EA 1CLBA 1JC0A 1PSBA 2LVVA 3GJ2A 4DXQA 1TNWA 1Q4AA 2P6BB 2F8PA 2FL1A 2LCPA 3ZUJA 4ZF4A 5AXIA 4GGFC 1SNLA 2L51A 5DKRA 1RECA 1BMOA 2JQ6A 1GGZA 3EKJA 1NX0A 3SSHA 3SSTA 5BTTA 1Q4DA 1K94A 2QU1A 3RWTA 2NXQA 1IG5A 4ORCB 3I5IC 2HQZA 5TNCA 3SVOA 2EMNA 4OJ0A 3SJSA 1YVLA 1D1OA 4EDSA 3ST0A 4AOMA 4JEOA 2L4IA 2I18A 4W6GA 3P28A 2KAXA 3TZ1A 3UFZA 3BXKA 2K7CA 4MN0A 3DPWA 4Z4KA 5KTGA 3FWBA 2CTNA 2IB5A 3SVSA 2QLGB 4KAGA 1CLLA 4AR7A 4W6DA 1GJYA 2HCGA 4RTCA 4LJDA 2GGMA 4JF9A 2PVBA 2JPTA 1ZUXA 1BU3A 2M1KB 2VADA 1SW8A 4W74A 2YFPA 4L1IA 1CFPA 1SKTA 4FQOA 3KF9A 2LP3A 2G3DB 4EULA 3AKAA 1XK4A 5HBDA 3JVTB 1RROA 1AJ5A 1K90D 1M46A 4AQIA 1N2DA 3SG4A 1H4BA 4OGSA 5CSNA 4ZCUA 3CFHA 2H6VA 2IE2A 3TDZA 3U8PA 3M24A 1PK0D 2BL0C 1K95A 5CSJA 3IR8A 2QZ0A 1DJGA 2KBIA 4IK8A 5DPGA 4GBAA 2V53A 5HZTA 1MQ1A 2LVJA 2O29A 4W76A 1KK7Z 1RFJA 4H3NA 4YI9A 1G7KA 3SVEA 1BR1B 5KU1A 1EG3A 2BE6A 1KK7Y 1YHGA 1IWQA 2KFHA 1CB1A 1KP5A 2HFCA 4ORNA 3DQAA 3H1RA 4DUQA 2KYFA 1NCYA 1Q4CA 2QLGA 3DQ9A 1TCOB 2ZNEA 2KAYA 2H5QA 1C7WA 1UURA 1KK8C 2KSPA 3DQ8A 1PRWA 1K96A 2LMTA 1CFDA 3E3RA 1NP8A 4OKHA 1OXEA 1UHHA 2RGIA 3GJ1A 1Y6WA 2O2BA 2KI6C 2F33A 5JJGA 1ZMZA 2G5ZB 4KEXA 1QV1A 4HSZA 1WLZA 1DT7B 5I2QA 4JRBA 1SYMA 3KEVA 3MGFA 2KYCA 3AAKA 5BQLA 2H8QA 1BT6A 3PJBA 1YURA 1YRUB 1K8UA 4F0ZB 2QLHA 1W7SA 2PALA 1ZOTB 1ALWA 4PPLA 1KYSA 1MXEA 3E5WA 1BF5A 1C07A 2VAEA 1Y1AA 5DTLA 1J1EA 2DOQA 1DMOA 4H3LA 1OQPA 1OZOA 3LF3A 4YBHB 1F71A 4HVFA 4ZF5A 3ICBA 4HREE 1W7UA 5DQBA 4PE7A 1RWYA 2PXSA 3SVNA 4ZF3A 1S36A 1MF8B 2EMDA 2JT0A 2KHNA 2EHBA 1EMKA 3TMTA 1AHRA 3JTDB 4IK4A 3DQDA 4ZINA 1CM4A 3FWCA 2I7AA 3K21A 1K9KA 4HE4A 2M29A 2BCAA 1QJTA 4Q7UA 4PE1A 4N1GA 4XOWA 3SIAA 4QJ4B 5DKQA 3W1DA 2KGRA 1EG4A 1B4CA 1CNPA 1EMBA 2FZUA 3ST4A 1SRAA 1KWOC 1NSHA 1UHIA 3TDUA 4W6OA 2HJOA 2HQKA 2HRSA 5HLOA 3LA1A 2L0PA 1CTRA 4MZJA 4LJBA 1BFPA 4PHJA 3SSPA 5DTXA 1ZGQA 2F2PA 4USLA 5AERA 1J1DA 3RLZA 4W6LA 2Y1MA 5LTQA 1EJ3A 3JVTC 2YE1A 3CB9A 3DPXA 2C9IA 5D69A 1SR6C 4MRXA 5KSZA 2V4EB 2M7LA 1DF0B 3WLCA 2ZKMX 2AWJA 3DQFA 3EVPA 4I5LB 2QPTA 3M22A 2QACA 5GQQC 4EMQA 2CBLA 2OJKA 3DQCA 4Q7TA 5HLVA 1TN4A 2F3YA 1GGXA 3KCSA 3VRRA 5EXBA 1MUXA 2HGYA 3A8RA 1ZGPA 1XFUO 4JFGA 3PM8A 1FW4A 3SG5A 2JOJA 2LAPA 5EXUA 2GV5A 2VVIA 2BBMA 4W7XA 1MOUA 2KAVA 4XOVA 1L7ZA 1OMRA 1Y0VH 3DQUA 2ZNDA 2K2FA 1JWDA 2IS9A 5T3IA 3D0YB 4CFRA 4GPLB 4PHMA 3CLNA 4KW8A 1HQVA 2VRGA 2JULA 3FIAA 1S6IA 3CGLA 4LW5A 4YGDB 2LV7A 5HKWA 2C9JA 1SBJA 1U5IB 3BQ3A 1EMMA 2G16B 2A54B 4D1EA 3GK1A 1SY9A 3SG6A 2MJWB 1W7IB 3WXAA 5EXCI 3SVUA 5ER5A 1RMMA 2OGRA 4E68A 1KFXL 4ZB1A 3NXAA 1NWDA 2DUFA 2V4EA 3NSLA 3SG3A 1CDLA 1DF0A 1JBAA 3NT9A 2KI4C 4P76A 1TRFA 1CKKA 2HETA 1F8HA 1XAEA 1WDCB 2ZRSA 1UHJA 2ZRTA 2DUEA 1OXDA 1IH0A 2EC6B 2NZ0A 3WNXB 1JC2A 1KSMA 3G9AA 3TS5C 1N0YA 1NIWA 3U0MA 1Q73A 3NSKA 3NF0A 2H5PA 1ZFSA 1C4FA 4IK1A 1UUSA 3BXCA 2H5RA 4Q7RA 4W6KA 5F6TA 1S3PA 3VRPA 2A56B 4W6BA 2WURA 1OOJA 1KFXS 1CFFA 4Q04A 2O60A 1CLMA 2JU0A 1QX2A 4I2YA 2M49B 3DQEA 3D0YA 3DQ7A 4W7EA 1HT9A 1JBYA 5HZOA 1RMPA 5BT0A 4W75A 1XVJA 1OXFA 4ZIOA 2A46A 1EH2A 1B7TZ 1BG1A 5EB6A 2KNEA 2OKWA 1XFXO 3LK1A 1U5IA 5AFPA 5DTYA 2WCFA 2I94A 2WCEA 2ZFDA 3JTDC 4DXMA 4UPGA 3IQOA 2LC5A 2AAOA 1MHOA 3GL4A 1JSAA 1IJ5A 1XQMA 4I5NB 3AAJA 1UP5A 4JC2A 4EDOA 1KWOB 5DPIA 5FHVA 3A8SA 1JFJA 4LQUA 2GW4B 3E5TA 4HQ9A 1FI5A 2A52B 1S26D 1K93D 4H48A 1XFVO 1EMEA 1MOVA 3DQNA 5I2OA 4PHKA 2KQYA 4GNKB 3PJ5A 1SL8A 2WHUA 2WCBA 4W6CA 2IB6A 5AEQA 3BXBA 1Q4EA 1SL7A 4GFTA 1XSSA 3IP2A 4C0LA 3O2PA 4ANJA 5AQBB 2Y5IA 1SR6B 4DS7A 3WCKA 3VGOA 1ODBA 1DJXA 1J7RA 2K7DA 3SG7A 4DXNA 1TCFA 3HCMA 2FWQA 1XA5A 2WC8A 1V1GA 2V4EC 3ST3A 2FCEA 4W6JA 1NUBA 1GGWA 1DTLA 2MA2A 4NDBA 4B30B 1EMAA 3S05A 2G2SB 3EVVA 3VROA 3H1OA 2LLTA 1ALVA 4HQCA 2BECA 3BUNB 4YGEB 3DD4A 4M2QA 5I2LA 1L2OB 4PHNA 5J3XA 1JBZA 1QS7A 3SS0A 1QX5B 4J89A 4IL1A 1BLQA 1PALA 2PRUA 3BX9A 4J88A 1K2HA 2FCDA 4WQ3A 2LHIA 1CMFA 3LSAA 5HZUA 4JQ0D 1CDMA 1JFKA 2MLFC 4YGCB 1DJYA 2A48A 1J7OA 1UHKA 3DVEA 4ZFSA 1OZSA 3KPXA 4NQGA 3GOFA 2OTBA 3CBEA 2Z6XA 1BJFA 4DXPA 3AKOA 1IKUA 2H2KA 1YHHA 4YI8A 4W6RA 2M97A 2KI4B 3U8CA 1TTXA 4M2OA 4L13A 4W6UA 1WLMA 3TS5B 3OSQA 2LMUA 3SSLA 3DQIA 3HX4A 4IK9A 1CM1A 3OB2B 1LA3A 2LUCA 5FVGA 4Q9WA 3NT3A 3EVUA 1Y1UA 1WDCC 1QASA 3EK4A 2EC6C 4PE4A 4IK3A 4W77A 2TN4A 2F3ZA 2WSNA 2K7OA 3LCPC 3BUWB 1PULA 1ZACA 2B3PA 3OP0A 5DRFA 4XGYA 3BUMB 2Z1OA 3DVKA 2WHSA 2CXJA 3PFVA 4BY4A 3RM1A 5HYDA 3OSRA 3DQ2A 2M9GA 1F4OA 2G6YA 3BUOB 1Z1PA 2BKHB 1R2UA 3GEXA 3ZTFA 4OV2A 4MRYA 4HQ8A 1AJ4A 4M2PA 3GK4X 4R6BA 2ISDA 3EK8A 1KQMC 2KFFA 3ZULA 2OTEA 1QLKA 2H61A 1B8RA 2B3QA 2OS8C 3ZUFA 3AI4A 5DRGA 1RTP1 5EHUA 3U8AA 4GAOA 3DVJA 2HPWA 2JNXA 1TNQA 2FOTA 3ZWHA 4W6SA 1CDPA 1GL4A 1SCVA 2O5GA 1E8AA 2AWLA 1UWOA 1A75B 3DQ4A 2CCMA 4HRHA 1W7JB 2LANA 1LKJA 2Q57A 4PE0A 3M0WA 3SRYA 3LK0A 1QX7A 2KI6D 4W73A 3U0KA 3QRXA 4W7DA 1QIWA 4AQJA 3DQJA 2PMYA 1YFPA 1NX3A 2ICRA 2GGZA 4C0JA 1YHIA 1Y1XA 2M8UA 3SG2A 3BXAA 2QT2A 1K9PA 3H4SE 3CR4X 5EJUA 1A29A 1JF2A 3LL8B 2DD9A 2MRDA 4ORBB 2MBXA 1SCMC 4JGEA 1NX1A 1WRZA 2JXCA 4KPIA 2WIQA 1S5GZ 3E5VA 2BCXA 5JOLA 2K2AA 3KO0A 2HPSA 3EVRA 2KBMA 1DJIA 4MLWA 4YGBB 2L50A 1B9CA 5H89A 4MZLA 3A4UB 2WOSA 3RWAA 1IQ3A 3WHTB 1LXFC 1CDNA 1PVAA 4W7CA 4GESB 1B9AA 1S5GY 2D8NA 4TNCA 5IBWA 2A53B 3SSKA 2G9BA 4TZGA 4CFQA 4ZCVA 1BODA 2I2RE 1L2OC 2ZO6A 2AMIA 5AANA 1Q4BA 5F9GA 2H9WA 4KGEA 1AVSA 2LMVA 3SV5A 3PN7B 3CGAA 1A75A 2K8MB 2BE4A 1Q80A 4Z4MA 4OCIA 3DQ1A 1QY3A 1DVIA 3O4YA 3TUYB 4KGFA 4XL5A 4FTGA 5LTPA 1CFCA 1RMOA 5DPHA 3BYAA 3DF0B 1KYPA 4W6FA 4KA9A 3CR2A 2LP2A 2E30A 1N65A 3CZTX 3OGOA 4W69A 2H61C 4ORAB 1RJVA 4W7RA 2Y0GA 1CMGA 3V3DA 1HCJA 1QXTA 2PXWA 1KCYA 5H87A 4XYNA 4WQ2A 3UG0A 3SIBA 5CSFA 2POXA 1JF0A 3MSEB 4PALA 1G4YR 3DQ5A 2JZIA 4R6DA 1YUUA 1GFLA 2RH7A 1NX2A 1J55A 2NLNA 1OMDA 3IQQA 1F4QA 4DXIA 1QATA 2JADA 1IQ5A 4H3MA 4XVPA 3SSVA 3NSOA 5LK4A 3PIBA 4BDUA 1A2XA 3U0NA 3CD1A 2AWMA 1DJWA 4W6IA 3I5GB 4PPJA 1AK8A 1TNXA 1RRXA 1KQMB 1S6CA 4W6PA 2A4JA 1M45A 1JC1A 2DDCA 5LTRA 2BKIB 3SVDA 3VHTB 2AWKA 3NSIA 4ZBLA 2OS8B 3DVMA 3O6BA 2ZMWA 2PASA 4KF5C 2OPOA 2L98A 4DCKA 4MVFA 4EN1A 4TZAA 3DF0A 2K0JA 4A4BA 4OY4A 3OB1B 1B7TY 2GX2A 1DJHA 2Q91A 2LHLA 3DQKA 4DIRA 1YZWA 4I5KA 2GW3A 3ED8A 1EMCA 4MSPA 2WNDA 1H8BA 1A4PA 5HW9A 4RYSA 1C7VA 2HQWA 4JWQA 4N5XA 3IF7A 1EMGA 3VK1A 5K89A 1XFYO 2G2BA 1OMVA 1LA0A 4W6AA 2E6WA 3EKHA 1FPWA 3BOWB 4RYWA 5PALA 2EMOA 1F55A 3LVAA 1NPQA 3CTNA 2A47A 1MR8A 1S1EA 4W6TA 4C0KA 2OTGB 2B1UA 3SSYA 1TOPA 2G3OA 1SCMB 1XMZA 2KDHA 2CT9A 2M7NA 1J7PA 1QV0A 2WISA 4UTSA 5HZSA 4NDDA 5I8NA 4P2YB 1KFUL 4GF6B 4KW9A 2QLEA 3CWGA 3DPZA 2Y1NA 4ICBA 2M1UA 2DD7A 2MHHA 4XJKB 3WHUB 3PALA 2BBNA 3VHTA 1W7TA 2Z6YA 1YVHA 3GK2A 4Q9XA 3KHEA 2AH8A 3I5FB 4DKMA 5DQMA 1DGVA 5DTZA 1IRJA 1YJFA 4CPVA 3DQMA 2VZXA 4CIDA 3AKBA 1H6RA 4NWSA 2ZN9A 1F54A 4N3DA 1SL9A 3NEDA 3NEZA 1IGVA 4J8AA 3DQ6A 4PDZA 2K7BA 4U2VA 5HKZA 4B5YA 2LVIA 1KFUS 4W7AA 3ADFA 1NYAA 2YDZA 2Y4QA 1X02A 4PFEA 2JTTA 3CFFA 2WORA 1RK9A 3WLDA 2ZN8A 1HUYA 4L12A 1XYDA 3PN7C 4WRIA 2JC2A 5DKNA 2L5XB 3BOWA 2L4HA 3I5HC 2KGBC 1BR4B 3I19A 5DU0A 1M39A 1QYOA 4PCWA 1UISA 3TUYC 3O78A 3ZNIA 2COLB 4PPKA 2VVHA 1OE9B 1XFZO 1YX8A 2KFGA 4KF4A 3ST2A 1QYQA 1AUIB 2WSOA 4QJ5B 1MXLC 1F0BA 1ZGOA 1NCXA 3AI5A 2Q6PA 4OHSA 2OKYA 4LJCA 3PJ7A 2JT3A 2JXLA 3SVBA 2MAZA 2G6XA 4MZKA 4XJKA 1F70A 2DUGA 3PLFB 2IOVA 4B30A 3OX5A 5FYXA 4A4CA 1EL4A 2LNKA 1YX7A 4LJDC 1UHNA 3VRQA 2K61A 1SMGA 1B1GA 2JNFA 3FS7A 4P5OE 1YRTB 5ER4X 2M3WA 1KSOA 1XK4C 1RM9A 4OQWA 4CLNA 2Z6ZA 3C1VA 1QIVA 3I5GC 1JUOA 1B47A 2QRFA 3DQOA 2LLUA 2PSRA 3I5IB 2P4MA 1V1FA 3U0LA 3W1CA 3DQ3A 2HF5A 2JT8A 5EB7A 1FBVA 3PATA 5EBJA 2SCPA 3DQLA 2L2EA 1Z1QA 1MWNA 1BOCA 4BY5A 1XO5A 1EMFA 1NCZA 1M63B 3CS1A 4HRGA 2JWWA 3OHMB 2DUIA 2M0RA 4DRWA 1G8IA 3LF4B 2EGDA 1F09A 5G08A 1S6ZA 1WY9A 1B8CA 3EK7A 4GOBA 1SPYA 1A03A 1CV7A 4L9MA 4IZNA 2DDDA 2ZMUA 1AP4A 5KTYA 1KYRA 5DPJA 3CR5X 4W6MA 1TIZA 2QLIA 2BCBA 4MEWA 3GB3A 5B8IB 2A50B 4I5JA 1S6JA 5H88A 3SVCA 2JTZA 2LLSA 1K9UA 4N1FA 4H47A 3P8UA 4QJ3B 2AHAA 2ZO7A 5HGEA 3O77A 4GGFA 1QXPA 2O24A 5FVIA 4GGNA 2H5OA 2OTGC 1QYFA 4W6HA 2HQ8A 1LVCD 1OSAA 2BL0B 2DUHA 3DQHA 1QLSA 2R2IA 1EMLA 3D10A 4W6NA 1DJZA 5DY6A 4KF5A 2ARLA 1FF1A 4DKNA 5BPJA 1MYWA 3BUXB 3LLEA 4JPZB 2LM5A 4NDCA 2BTJA 2NCPA 4P1QA 3CFAA 1YJ2A 1ZUZA 1YUTA 1QVIZ 1H4UA 2KOTA 1IJ6A 1YTZC 4AS8A 3KCTA 2LE9B 2FJUB 3K1KA 3I5FC 4W7FA 3TMRA 1DGUA 1J7QA 4YRUA 1FI6A 1SK6D 1YR5A 4OR9B 1QVIY 2F2OA 3VICA 2Q4UA 4W72A 1B8LA 5FVFA 2HGDA 1LINA 3LS3A 2CNPA 1M31A 5BTTB 1KK8B 1WRLA 4IK5A 3SVRA 3I5HB 1PVBA 1TNPA 3OX6A 4ETOA 5D7FA 1YUSA 4GUKA 2NCOA 1QTXA 2KQ6A 5CSIA 1WRKA 5CPVA 2LVKA 3F45A 1XFWO 3PSRA 4KW4A 2SASA 5J2OA 3VRNA 2LUXA 2MLEC 3TDIA 2YE0A 1PSRA 2VVJA 1XA9A 4LQTA 1EXRA 4U8DA 3LVCA 2G6EA 3CD9A 4YGAA 1R6PA 2JRFA 2AUCA 5HKYA 1GQMA 4DXOA 4MBEA 2GX0A 3LVDA 1VRKA 4OVNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQV A;  2WHT A;  1G33 A;  4R1E A;  1CLB A;  1JC0 A;  1PSB A;  2LVV A;  3GJ2 A;  4DXQ A;  1TNW A;  1Q4A A;  2P6B B;  2F8P A;  2FL1 A;  2LCP A;  3ZUJ A;  4ZF4 A;  5AXI A;  4GGF C;  1SNL A;  2L51 A;  5DKR A;  1REC A;  1BMO A;  2JQ6 A;  1GGZ A;  3EKJ A;  1NX0 A;  3SSH A;  3SST A;  5BTT A;  1Q4D A;  1K94 A;  2QU1 A;  3RWT A;  2NXQ A;  1IG5 A;  4ORC B;  3I5I C;  2HQZ A;  5TNC A;  3SVO A;  2EMN A;  4OJ0 A;  3SJS A;  1YVL A;  1D1O A;  4EDS A;  3ST0 A;  4AOM A;  4JEO A;  2L4I A;  2I18 A;  4W6G A;  3P28 A;  2KAX A;  3TZ1 A;  3UFZ A;  3BXK A;  2K7C A;  4MN0 A;  3DPW A;  4Z4K A;  5KTG A;  3FWB A;  2CTN A;  2IB5 A;  3SVS A;  2QLG B;  4KAG A;  1CLL A;  4AR7 A;  4W6D A;  1GJY A;  2HCG A;  4RTC A;  4LJD A;  2GGM A;  4JF9 A;  2PVB A;  2JPT A;  1ZUX A;  1BU3 A;  2M1K B;  2VAD A;  1SW8 A;  4W74 A;  2YFP A;  4L1I A;  1CFP A;  1SKT A;  4FQO A;  3KF9 A;  2LP3 A;  2G3D B;  4EUL A;  3AKA A;  1XK4 A;  5HBD A;  3JVT B;  1RRO A;  1AJ5 A;  1K90 D;  1M46 A;  4AQI A;  1N2D A;  3SG4 A;  1H4B A;  4OGS A;  5CSN A;  4ZCU A;  3CFH A;  2H6V A;  2IE2 A;  3TDZ A;  3U8P A;  3M24 A;  1PK0 D;  2BL0 C;  1K95 A;  5CSJ A;  3IR8 A;  2QZ0 A;  1DJG A;  2KBI A;  4IK8 A;  5DPG A;  4GBA A;  2V53 A;  5HZT A;  1MQ1 A;  2LVJ A;  2O29 A;  4W76 A;  1KK7 Z;  1RFJ A;  4H3N A;  4YI9 A;  1G7K A;  3SVE A;  1BR1 B;  5KU1 A;  1EG3 A;  2BE6 A;  1KK7 Y;  1YHG A;  1IWQ A;  2KFH A;  1CB1 A;  1KP5 A;  2HFC A;  4ORN A;  3DQA A;  3H1R A;  4DUQ A;  2KYF A;  1NCY A;  1Q4C A;  2QLG A;  3DQ9 A;  1TCO B;  2ZNE A;  2KAY A;  2H5Q A;  1C7W A;  1UUR A;  1KK8 C;  2KSP A;  3DQ8 A;  1PRW A;  1K96 A;  2LMT A;  1CFD A;  3E3R A;  1NP8 A;  4OKH A;  1OXE A;  1UHH A;  2RGI A;  3GJ1 A;  1Y6W A;  2O2B A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  2G5Z B;  4KEX A;  1QV1 A;  4HSZ A;  1WLZ A;  1DT7 B;  5I2Q A;  4JRB A;  1SYM A;  3KEV A;  3MGF A;  2KYC A;  3AAK A;  5BQL A;  2H8Q A;  1BT6 A;  3PJB A;  1YUR A;  1YRU B;  1K8U A;  4F0Z B;  2QLH A;  1W7S A;  2PAL A;  1ZOT B;  1ALW A;  4PPL A;  1KYS A;  1MXE A;  3E5W A;  1BF5 A;  1C07 A;  2VAE A;  1Y1A A;  5DTL A;  1J1E A;  2DOQ A;  1DMO A;  4H3L A;  1OQP A;  1OZO A;  3LF3 A;  4YBH B;  1F71 A;  4HVF A;  4ZF5 A;  3ICB A;  4HRE E;  1W7U A;  5DQB A;  4PE7 A;  1RWY A;  2PXS A;  3SVN A;  4ZF3 A;  1S36 A;  1MF8 B;  2EMD A;  2JT0 A;  2KHN A;  2EHB A;  1EMK A;  3TMT A;  1AHR A;  3JTD B;  4IK4 A;  3DQD A;  4ZIN A;  1CM4 A;  3FWC A;  2I7A A;  3K21 A;  1K9K A;  4HE4 A;  2M29 A;  2BCA A;  1QJT A;  4Q7U A;  4PE1 A;  4N1G A;  4XOW A;  3SIA A;  4QJ4 B;  5DKQ A;  3W1D A;  2KGR A;  1EG4 A;  1B4C A;  1CNP A;  1EMB A;  2FZU A;  3ST4 A;  1SRA A;  1KWO C;  1NSH A;  1UHI A;  3TDU A;  4W6O A;  2HJO A;  2HQK A;  2HRS A;  5HLO A;  3LA1 A;  2L0P A;  1CTR A;  4MZJ A;  4LJB A;  1BFP A;  4PHJ A;  3SSP A;  5DTX A;  1ZGQ A;  2F2P A;  4USL A;  5AER A;  1J1D A;  3RLZ A;  4W6L A;  2Y1M A;  5LTQ A;  1EJ3 A;  3JVT C;  2YE1 A;  3CB9 A;  3DPX A;  2C9I A;  5D69 A;  1SR6 C;  4MRX A;  5KSZ A;  2V4E B;  2M7L A;  1DF0 B;  3WLC A;  2ZKM X;  2AWJ A;  3DQF A;  3EVP A;  4I5L B;  2QPT A;  3M22 A;  2QAC A;  5GQQ C;  4EMQ A;  2CBL A;  2OJK A;  3DQC A;  4Q7T A;  5HLV A;  1TN4 A;  2F3Y A;  1GGX A;  3KCS A;  3VRR A;  5EXB A;  1MUX A;  2HGY A;  3A8R A;  1ZGP A;  1XFU O;  4JFG A;  3PM8 A;  1FW4 A;  3SG5 A;  2JOJ A;  2LAP A;  5EXU A;  2GV5 A;  2VVI A;  2BBM A;  4W7X A;  1MOU A;  2KAV A;  4XOV A;  1L7Z A;  1OMR A;  1Y0V H;  3DQU A;  2ZND A;  2K2F A;  1JWD A;  2IS9 A;  5T3I A;  3D0Y B;  4CFR A;  4GPL B;  4PHM A;  3CLN A;  4KW8 A;  1HQV A;  2VRG A;  2JUL A;  3FIA A;  1S6I A;  3CGL A;  4LW5 A;  4YGD B;  2LV7 A;  5HKW A;  2C9J A;  1SBJ A;  1U5I B;  3BQ3 A;  1EMM A;  2G16 B;  2A54 B;  4D1E A;  3GK1 A;  1SY9 A;  3SG6 A;  2MJW B;  1W7I B;  3WXA A;  5EXC I;  3SVU A;  5ER5 A;  1RMM A;  2OGR A;  4E68 A;  1KFX L;  4ZB1 A;  3NXA A;  1NWD A;  2DUF A;  2V4E A;  3NSL A;  3SG3 A;  1CDL A;  1DF0 A;  1JBA A;  3NT9 A;  2KI4 C;  4P76 A;  1TRF A;  1CKK A;  2HET A;  1F8H A;  1XAE A;  1WDC B;  2ZRS A;  1UHJ A;  2ZRT A;  2DUE A;  1OXD A;  1IH0 A;  2EC6 B;  2NZ0 A;  3WNX B;  1JC2 A;  1KSM A;  3G9A A;  3TS5 C;  1N0Y A;  1NIW A;  3U0M A;  1Q73 A;  3NSK A;  3NF0 A;  2H5P A;  1ZFS A;  1C4F A;  4IK1 A;  1UUS A;  3BXC A;  2H5R A;  4Q7R A;  4W6K A;  5F6T A;  1S3P A;  3VRP A;  2A56 B;  4W6B A;  2WUR A;  1OOJ A;  1KFX S;  1CFF A;  4Q04 A;  2O60 A;  1CLM A;  2JU0 A;  1QX2 A;  4I2Y A;  2M49 B;  3DQE A;  3D0Y A;  3DQ7 A;  4W7E A;  1HT9 A;  1JBY A;  5HZO A;  1RMP A;  5BT0 A;  4W75 A;  1XVJ A;  1OXF A;  4ZIO A;  2A46 A;  1EH2 A;  1B7T Z;  1BG1 A;  5EB6 A;  2KNE A;  2OKW A;  1XFX O;  3LK1 A;  1U5I A;  5AFP A;  5DTY A;  2WCF A;  2I94 A;  2WCE A;  2ZFD A;  3JTD C;  4DXM A;  4UPG A;  3IQO A;  2LC5 A;  2AAO A;  1MHO A;  3GL4 A;  1JSA A;  1IJ5 A;  1XQM A;  4I5N B;  3AAJ A;  1UP5 A;  4JC2 A;  4EDO A;  1KWO B;  5DPI A;  5FHV A;  3A8S A;  1JFJ A;  4LQU A;  2GW4 B;  3E5T A;  4HQ9 A;  1FI5 A;  2A52 B;  1S26 D;  1K93 D;  4H48 A;  1XFV O;  1EME A;  1MOV A;  3DQN A;  5I2O A;  4PHK A;  2KQY A;  4GNK B;  3PJ5 A;  1SL8 A;  2WHU A;  2WCB A;  4W6C A;  2IB6 A;  5AEQ A;  3BXB A;  1Q4E A;  1SL7 A;  4GFT A;  1XSS A;  3IP2 A;  4C0L A;  3O2P A;  4ANJ A;  5AQB B;  2Y5I A;  1SR6 B;  4DS7 A;  3WCK A;  3VGO A;  1ODB A;  1DJX A;  1J7R A;  2K7D A;  3SG7 A;  4DXN A;  1TCF A;  3HCM A;  2FWQ A;  1XA5 A;  2WC8 A;  1V1G A;  2V4E C;  3ST3 A;  2FCE A;  4W6J A;  1NUB A;  1GGW A;  1DTL A;  2MA2 A;  4NDB A;  4B30 B;  1EMA A;  3S05 A;  2G2S B;  3EVV A;  3VRO A;  3H1O A;  2LLT A;  1ALV A;  4HQC A;  2BEC A;  3BUN B;  4YGE B;  3DD4 A;  4M2Q A;  5I2L A;  1L2O B;  4PHN A;  5J3X A;  1JBZ A;  1QS7 A;  3SS0 A;  1QX5 B;  4J89 A;  4IL1 A;  1BLQ A;  1PAL A;  2PRU A;  3BX9 A;  4J88 A;  1K2H A;  2FCD A;  4WQ3 A;  2LHI A;  1CMF A;  3LSA A;  5HZU A;  4JQ0 D;  1CDM A;  1JFK A;  2MLF C;  4YGC B;  1DJY A;  2A48 A;  1J7O A;  1UHK A;  3DVE A;  4ZFS A;  1OZS A;  3KPX A;  4NQG A;  3GOF A;  2OTB A;  3CBE A;  2Z6X A;  1BJF A;  4DXP A;  3AKO A;  1IKU A;  2H2K A;  1YHH A;  4YI8 A;  4W6R A;  2M97 A;  2KI4 B;  3U8C A;  1TTX A;  4M2O A;  4L13 A;  4W6U A;  1WLM A;  3TS5 B;  3OSQ A;  2LMU A;  3SSL A;  3DQI A;  3HX4 A;  4IK9 A;  1CM1 A;  3OB2 B;  1LA3 A;  2LUC A;  5FVG A;  4Q9W A;  3NT3 A;  3EVU A;  1Y1U A;  1WDC C;  1QAS A;  3EK4 A;  2EC6 C;  4PE4 A;  4IK3 A;  4W77 A;  2TN4 A;  2F3Z A;  2WSN A;  2K7O A;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  2B3P A;  3OP0 A;  5DRF A;  4XGY A;  3BUM B;  2Z1O A;  3DVK A;  2WHS A;  2CXJ A;  3PFV A;  4BY4 A;  3RM1 A;  5HYD A;  3OSR A;  3DQ2 A;  2M9G A;  1F4O A;  2G6Y A;  3BUO B;  1Z1P A;  2BKH B;  1R2U A;  3GEX A;  3ZTF A;  4OV2 A;  4MRY A;  4HQ8 A;  1AJ4 A;  4M2P A;  3GK4 X;  4R6B A;  2ISD A;  3EK8 A;  1KQM C;  2KFF A;  3ZUL A;  2OTE A;  1QLK A;  2H61 A;  1B8R A;  2B3Q A;  2OS8 C;  3ZUF A;  3AI4 A;  5DRG A;  1RTP 1;  5EHU A;  3U8A A;  4GAO A;  3DVJ A;  2HPW A;  2JNX A;  1TNQ A;  2FOT A;  3ZWH A;  4W6S A;  1CDP A;  1GL4 A;  1SCV A;  2O5G A;  1E8A A;  2AWL A;  1UWO A;  1A75 B;  3DQ4 A;  2CCM A;  4HRH A;  1W7J B;  2LAN A;  1LKJ A;  2Q57 A;  4PE0 A;  3M0W A;  3SRY A;  3LK0 A;  1QX7 A;  2KI6 D;  4W73 A;  3U0K A;  3QRX A;  4W7D A;  1QIW A;  4AQJ A;  3DQJ A;  2PMY A;  1YFP A;  1NX3 A;  2ICR A;  2GGZ A;  4C0J A;  1YHI A;  1Y1X A;  2M8U A;  3SG2 A;  3BXA A;  2QT2 A;  1K9P A;  3H4S E;  3CR4 X;  5EJU A;  1A29 A;  1JF2 A;  3LL8 B;  2DD9 A;  2MRD A;  4ORB B;  2MBX A;  1SCM C;  4JGE A;  1NX1 A;  1WRZ A;  2JXC A;  4KPI A;  2WIQ A;  1S5G Z;  3E5V A;  2BCX A;  5JOL A;  2K2A A;  3KO0 A;  2HPS A;  3EVR A;  2KBM A;  1DJI A;  4MLW A;  4YGB B;  2L50 A;  1B9C A;  5H89 A;  4MZL A;  3A4U B;  2WOS A;  3RWA A;  1IQ3 A;  3WHT B;  1LXF C;  1CDN A;  1PVA A;  4W7C A;  4GES B;  1B9A A;  1S5G Y;  2D8N A;  4TNC A;  5IBW A;  2A53 B;  3SSK A;  2G9B A;  4TZG A;  4CFQ A;  4ZCV A;  1BOD A;  2I2R E;  1L2O C;  2ZO6 A;  2AMI A;  5AAN A;  1Q4B A;  5F9G A;  2H9W A;  4KGE A;  1AVS A;  2LMV A;  3SV5 A;  3PN7 B;  3CGA A;  1A75 A;  2K8M B;  2BE4 A;  1Q80 A;  4Z4M A;  4OCI A;  3DQ1 A;  1QY3 A;  1DVI A;  3O4Y A;  3TUY B;  4KGF A;  4XL5 A;  4FTG A;  5LTP A;  1CFC A;  1RMO A;  5DPH A;  3BYA A;  3DF0 B;  1KYP A;  4W6F A;  4KA9 A;  3CR2 A;  2LP2 A;  2E30 A;  1N65 A;  3CZT X;  3OGO A;  4W69 A;  2H61 C;  4ORA B;  1RJV A;  4W7R A;  2Y0G A;  1CMG A;  3V3D A;  1HCJ A;  1QXT A;  2PXW A;  1KCY A;  5H87 A;  4XYN A;  4WQ2 A;  3UG0 A;  3SIB A;  5CSF A;  2POX A;  1JF0 A;  3MSE B;  4PAL A;  1G4Y R;  3DQ5 A;  2JZI A;  4R6D A;  1YUU A;  1GFL A;  2RH7 A;  1NX2 A;  1J55 A;  2NLN A;  1OMD A;  3IQQ A;  1F4Q A;  4DXI A;  1QAT A;  2JAD A;  1IQ5 A;  4H3M A;  4XVP A;  3SSV A;  3NSO A;  5LK4 A;  3PIB A;  4BDU A;  1A2X A;  3U0N A;  3CD1 A;  2AWM A;  1DJW A;  4W6I A;  3I5G B;  4PPJ A;  1AK8 A;  1TNX A;  1RRX A;  1KQM B;  1S6C A;  4W6P A;  2A4J A;  1M45 A;  1JC1 A;  2DDC A;  5LTR A;  2BKI B;  3SVD A;  3VHT B;  2AWK A;  3NSI A;  4ZBL A;  2OS8 B;  3DVM A;  3O6B A;  2ZMW A;  2PAS A;  4KF5 C;  2OPO A;  2L98 A;  4DCK A;  4MVF A;  4EN1 A;  4TZA A;  3DF0 A;  2K0J A;  4A4B A;  4OY4 A;  3OB1 B;  1B7T Y;  2GX2 A;  1DJH A;  2Q91 A;  2LHL A;  3DQK A;  4DIR A;  1YZW A;  4I5K A;  2GW3 A;  3ED8 A;  1EMC A;  4MSP A;  2WND A;  1H8B A;  1A4P A;  5HW9 A;  4RYS A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  3IF7 A;  1EMG A;  3VK1 A;  5K89 A;  1XFY O;  2G2B A;  1OMV A;  1LA0 A;  4W6A A;  2E6W A;  3EKH A;  1FPW A;  3BOW B;  4RYW A;  5PAL A;  2EMO A;  1F55 A;  3LVA A;  1NPQ A;  3CTN A;  2A47 A;  1MR8 A;  1S1E A;  4W6T A;  4C0K A;  2OTG B;  2B1U A;  3SSY A;  1TOP A;  2G3O A;  1SCM B;  1XMZ A;  2KDH A;  2CT9 A;  2M7N A;  1J7P A;  1QV0 A;  2WIS A;  4UTS A;  5HZS A;  4NDD A;  5I8N A;  4P2Y B;  1KFU L;  4GF6 B;  4KW9 A;  2QLE A;  3CWG A;  3DPZ A;  2Y1N A;  4ICB A;  2M1U A;  2DD7 A;  2MHH A;  4XJK B;  3WHU B;  3PAL A;  2BBN A;  3VHT A;  1W7T A;  2Z6Y A;  1YVH A;  3GK2 A;  4Q9X A;  3KHE A;  2AH8 A;  3I5F B;  4DKM A;  5DQM A;  1DGV A;  5DTZ A;  1IRJ A;  1YJF A;  4CPV A;  3DQM A;  2VZX A;  4CID A;  3AKB A;  1H6R A;  4NWS A;  2ZN9 A;  1F54 A;  4N3D A;  1SL9 A;  3NED A;  3NEZ A;  1IGV A;  4J8A A;  3DQ6 A;  4PDZ A;  2K7B A;  4U2V A;  5HKZ A;  4B5Y A;  2LVI A;  1KFU S;  4W7A A;  3ADF A;  1NYA A;  2YDZ A;  2Y4Q A;  1X02 A;  4PFE A;  2JTT A;  3CFF A;  2WOR A;  1RK9 A;  3WLD A;  2ZN8 A;  1HUY A;  4L12 A;  1XYD A;  3PN7 C;  4WRI A;  2JC2 A;  5DKN A;  2L5X B;  3BOW A;  2L4H A;  3I5H C;  2KGB C;  1BR4 B;  3I19 A;  5DU0 A;  1M39 A;  1QYO A;  4PCW A;  1UIS A;  3TUY C;  3O78 A;  3ZNI A;  2COL B;  4PPK A;  2VVH A;  1OE9 B;  1XFZ O;  1YX8 A;  2KFG A;  4KF4 A;  3ST2 A;  1QYQ A;  1AUI B;  2WSO A;  4QJ5 B;  1MXL C;  1F0B A;  1ZGO A;  1NCX A;  3AI5 A;  2Q6P A;  4OHS A;  2OKY A;  4LJC A;  3PJ7 A;  2JT3 A;  2JXL A;  3SVB A;  2MAZ A;  2G6X A;  4MZK A;  4XJK A;  1F70 A;  2DUG A;  3PLF B;  2IOV A;  4B30 A;  3OX5 A;  5FYX A;  4A4C A;  1EL4 A;  2LNK A;  1YX7 A;  4LJD C;  1UHN A;  3VRQ A;  2K61 A;  1SMG A;  1B1G A;  2JNF A;  3FS7 A;  4P5O E;  1YRT B;  5ER4 X;  2M3W A;  1KSO A;  1XK4 C;  1RM9 A;  4OQW A;  4CLN A;  2Z6Z A;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  1B47 A;  2QRF A;  3DQO A;  2LLU A;  2PSR A;  3I5I B;  2P4M A;  1V1F A;  3U0L A;  3W1C A;  3DQ3 A;  2HF5 A;  2JT8 A;  5EB7 A;  1FBV A;  3PAT A;  5EBJ A;  2SCP A;  3DQL A;  2L2E A;  1Z1Q A;  1MWN A;  1BOC A;  4BY5 A;  1XO5 A;  1EMF A;  1NCZ A;  1M63 B;  3CS1 A;  4HRG A;  2JWW A;  3OHM B;  2DUI A;  2M0R A;  4DRW A;  1G8I A;  3LF4 B;  2EGD A;  1F09 A;  5G08 A;  1S6Z A;  1WY9 A;  1B8C A;  3EK7 A;  4GOB A;  1SPY A;  1A03 A;  1CV7 A;  4L9M A;  4IZN A;  2DDD A;  2ZMU A;  1AP4 A;  5KTY A;  1KYR A;  5DPJ A;  3CR5 X;  4W6M A;  1TIZ A;  2QLI A;  2BCB A;  4MEW A;  3GB3 A;  5B8I B;  2A50 B;  4I5J A;  1S6J A;  5H88 A;  3SVC A;  2JTZ A;  2LLS A;  1K9U A;  4N1F A;  4H47 A;  3P8U A;  4QJ3 B;  2AHA A;  2ZO7 A;  5HGE A;  3O77 A;  4GGF A;  1QXP A;  2O24 A;  5FVI A;  4GGN A;  2H5O A;  2OTG C;  1QYF A;  4W6H A;  2HQ8 A;  1LVC D;  1OSA A;  2BL0 B;  2DUH A;  3DQH A;  1QLS A;  2R2I A;  1EML A;  3D10 A;  4W6N A;  1DJZ A;  5DY6 A;  4KF5 A;  2ARL A;  1FF1 A;  4DKN A;  5BPJ A;  1MYW A;  3BUX B;  3LLE A;  4JPZ B;  2LM5 A;  4NDC A;  2BTJ A;  2NCP A;  4P1Q A;  3CFA A;  1YJ2 A;  1ZUZ A;  1YUT A;  1QVI Z;  1H4U A;  2KOT A;  1IJ6 A;  1YTZ C;  4AS8 A;  3KCT A;  2LE9 B;  2FJU B;  3K1K A;  3I5F C;  4W7F A;  3TMR A;  1DGU A;  1J7Q A;  4YRU A;  1FI6 A;  1SK6 D;  1YR5 A;  4OR9 B;  1QVI Y;  2F2O A;  3VIC A;  2Q4U A;  4W72 A;  1B8L A;  5FVF A;  2HGD A;  1LIN A;  3LS3 A;  2CNP A;  1M31 A;  5BTT B;  1KK8 B;  1WRL A;  4IK5 A;  3SVR A;  3I5H B;  1PVB A;  1TNP A;  3OX6 A;  4ETO A;  5D7F A;  1YUS A;  4GUK A;  2NCO A;  1QTX A;  2KQ6 A;  5CSI A;  1WRK A;  5CPV A;  2LVK A;  3F45 A;  1XFW O;  3PSR A;  4KW4 A;  2SAS A;  5J2O A;  3VRN A;  2LUX A;  2MLE C;  3TDI A;  2YE0 A;  1PSR A;  2VVJ A;  1XA9 A;  4LQT A;  1EXR A;  4U8D A;  3LVC A;  2G6E A;  3CD9 A;  4YGA A;  1R6P A;  2JRF A;  2AUC A;  5HKY A;  1GQM A;  4DXO A;  4MBE A;  2GX0 A;  3LVD A;  1VRK A;  4OVN F; 
#chains in the Genus database with same CATH topology
 1KQV A;  2WHT A;  1G33 A;  4R1E A;  1CLB A;  1JC0 A;  1PSB A;  2LVV A;  3GJ2 A;  4DXQ A;  1TNW A;  1Q4A A;  2P6B B;  2F8P A;  2FL1 A;  2LCP A;  3ZUJ A;  4ZF4 A;  5AXI A;  4GGF C;  1SNL A;  2L51 A;  5DKR A;  1REC A;  1BMO A;  2JQ6 A;  1GGZ A;  3EKJ A;  1NX0 A;  3SSH A;  3SST A;  5BTT A;  2QEV A;  1Q4D A;  1K94 A;  3FE9 A;  2QU1 A;  3RWT A;  2NXQ A;  1IG5 A;  4ORC B;  3I5I C;  2HQZ A;  5TNC A;  3SVO A;  2EMN A;  4OJ0 A;  4PT1 A;  3SJS A;  1YVL A;  1D1O A;  3S0D A;  4EDS A;  3ST0 A;  4AOM A;  4JEO A;  2L4I A;  2I18 A;  4W6G A;  1DC1 A;  3P28 A;  2KAX A;  3TZ1 A;  3UFZ A;  3BXK A;  2K7C A;  4MN0 A;  3DPW A;  4Z4K A;  5KTG A;  3FWB A;  2CTN A;  2IB5 A;  3SVS A;  2QLG B;  3RZS A;  4KAG A;  2FJY A;  1CLL A;  4AR7 A;  4W6D A;  1GJY A;  2HCG A;  4RTC A;  4LJD A;  2GGM A;  4JF9 A;  2PVB A;  2JPT A;  1ZUX A;  1BU3 A;  1IIO A;  2M1K B;  2VAD A;  1SW8 A;  4W74 A;  2YFP A;  4L1I A;  1CFP A;  1SKT A;  4FQO A;  3KF9 A;  2LP3 A;  2G3D B;  4EUL A;  3AKA A;  1XK4 A;  5HBD A;  3JVT B;  1C3Y A;  1RRO A;  1AJ5 A;  1K90 D;  1M46 A;  4AQI A;  1N2D A;  3SG4 A;  1H4B A;  4OGS A;  5CSN A;  3BFA A;  4ZCU A;  3CFH A;  2H6V A;  2IE2 A;  3TDZ A;  3U8P A;  3M24 A;  1PK0 D;  2BL0 C;  1K95 A;  5EL2 A;  5CSJ A;  3V2L A;  3IR8 A;  2QZ0 A;  1DJG A;  2KBI A;  4IK8 A;  5DPG A;  4GBA A;  2V53 A;  5HZT A;  2WCM A;  5FI7 A;  1MQ1 A;  2LVJ A;  5FI2 A;  2O29 A;  4W76 A;  1KK7 Z;  1RFJ A;  4H3N A;  4YI9 A;  1G7K A;  4OZD A;  3SVE A;  3D75 A;  1BR1 B;  5KU1 A;  1EG3 A;  2BE6 A;  1KK7 Y;  1YHG A;  1IWQ A;  2KFH A;  1CB1 A;  1KP5 A;  2HFC A;  1XFR A;  4ORN A;  3DQA A;  3H1R A;  4DUQ A;  2KYF A;  1NCY A;  1Q4C A;  2QLG A;  3DQ9 A;  1TCO B;  3PJI A;  2ZNE A;  2KAY A;  2QEH A;  2H5Q A;  1C7W A;  1UUR A;  1KK8 C;  2KSP A;  3DQ8 A;  1PRW A;  3SS5 A;  1K96 A;  2LMT A;  1CFD A;  3E3R A;  1NP8 A;  4OKH A;  1OXE A;  1UHH A;  2RGI A;  3GJ1 A;  1Y6W A;  1SSE B;  2O2B A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  2G5Z B;  4KEX A;  1QV1 A;  4HSZ A;  1WLZ A;  1DT7 B;  5I2Q A;  4JRB A;  3IVT A;  1SYM A;  3KEV A;  2KYC A;  3MGF A;  3AAK A;  5BQL A;  2H8Q A;  1BT6 A;  3PJB A;  1OW4 A;  1YUR A;  1YRU B;  1K8U A;  4F0Z B;  2QLH A;  1W7S A;  2PAL A;  5HL1 A;  1ZOT B;  1ALW A;  1C3Z A;  4PPL A;  1KYS A;  1MXE A;  3E5W A;  1BF5 A;  1C07 A;  2VAE A;  1Y1A A;  5DTL A;  1J1E A;  2DOQ A;  2PQL A;  1DMO A;  4H3L A;  1OQP A;  1OZO A;  3LF3 A;  4YBH B;  1F71 A;  4HVF A;  4ZF5 A;  3ICB A;  4HRE E;  1W7U A;  5DQB A;  4PE7 A;  1RWY A;  2PXS A;  3SVN A;  4ZF3 A;  1S36 A;  1MF8 B;  2EMD A;  2JT0 A;  2KHN A;  4FQT A;  2EHB A;  1EMK A;  3TMT A;  1AHR A;  3JTD B;  4IK4 A;  3DQD A;  4ZIN A;  1CM4 A;  3FWC A;  2I7A A;  3K21 A;  1K9K A;  4HE4 A;  2M29 A;  2BCA A;  1QJT A;  4Q7U A;  4PE1 A;  4N1G A;  4XOW A;  3SIA A;  4QJ4 B;  1OOF A;  5DKQ A;  3W1D A;  2KGR A;  1EG4 A;  1B4C A;  1CNP A;  1EMB A;  2FZU A;  3ST4 A;  1SRA A;  3B7A A;  1KWO C;  1NSH A;  1UHI A;  3NGV A;  3TDU A;  4W6O A;  2HJO A;  2HQK A;  2HRS A;  2L2C A;  5HLO A;  3LA1 A;  2L0P A;  1CTR A;  4MZJ A;  4LJB A;  1BFP A;  4PHJ A;  3SSP A;  5DTX A;  1ZGQ A;  2F2P A;  4USL A;  5AER A;  1J1D A;  3RLZ A;  4W6L A;  2Y1M A;  5LTQ A;  1EJ3 A;  3JVT C;  2YE1 A;  1TWO A;  3CB9 A;  3BJH A;  3DPX A;  2C9I A;  5D69 A;  1SR6 C;  4F7F A;  4MRX A;  5KSZ A;  4IJ7 A;  2V4E B;  2M7L A;  1DF0 B;  3WLC A;  2ZKM X;  2AWJ A;  3DQF A;  3EVP A;  4I5L B;  2QPT A;  3M22 A;  2QAC A;  5GQQ C;  4EMQ A;  3DY9 A;  2CBL A;  2WCK A;  2OJK A;  3DQC A;  4Q7T A;  5HLV A;  1TN4 A;  2F3Y A;  1GGX A;  3KCS A;  3VRR A;  5EXB A;  1MUX A;  2HGY A;  3A8R A;  1ZGP A;  1XFU O;  4JFG A;  3PM8 A;  1FW4 A;  3SG5 A;  2JOJ A;  2LAP A;  5EXU A;  2GV5 A;  2VVI A;  2BBM A;  4W7X A;  1MOU A;  2KAV A;  4XOV A;  1L7Z A;  1OMR A;  1Y0V H;  3DQU A;  2ZND A;  3FE6 A;  2K2F A;  1JWD A;  2IS9 A;  5T3I A;  3D0Y B;  4CFR A;  4GPL B;  3L4A A;  3CLN A;  4PHM A;  4KW8 A;  1HQV A;  2VRG A;  2JUL A;  3FIA A;  1S6I A;  3CGL A;  4LW5 A;  4YGD B;  2LV7 A;  3FE8 A;  5HKW A;  2C9J A;  1SBJ A;  1U5I B;  3BQ3 A;  1EMM A;  2G16 B;  2A54 B;  4D1E A;  3GK1 A;  1SY9 A;  3SG6 A;  2MJW B;  1W7I B;  3WXA A;  5EXC I;  3SVU A;  5ER5 A;  3D76 A;  1RMM A;  2OGR A;  4E68 A;  1KFX L;  4ZB1 A;  3NXA A;  1NWD A;  2DUF A;  2V4E A;  3NSL A;  3SG3 A;  1CDL A;  1DF0 A;  1JBA A;  3NT9 A;  2KI4 C;  4P76 A;  1TRF A;  1CKK A;  2HET A;  1F8H A;  1XAE A;  1WDC B;  2ZRS A;  1UHJ A;  2ZRT A;  2DUE A;  1OXD A;  1IH0 A;  2EC6 B;  2NZ0 A;  3D77 A;  3WNX B;  1JC2 A;  1KSM A;  3G9A A;  3TS5 C;  1N0Y A;  1NIW A;  3U0M A;  1Q73 A;  3NSK A;  3NF0 A;  2H5P A;  1ZFS A;  1C4F A;  4IK1 A;  1UUS A;  3BXC A;  2H5R A;  4Q7R A;  3OGN A;  4W6K A;  5F6T A;  1S3P A;  3VRP A;  2A56 B;  4W6B A;  2WUR A;  1OOJ A;  1KFX S;  1CFF A;  4Q04 A;  2O60 A;  1CLM A;  2JU0 A;  2BNX A;  1QX2 A;  4I2Y A;  2M49 B;  3DQE A;  3D0Y A;  3DQ7 A;  4W7E A;  1HT9 A;  1JBY A;  4INX A;  5HZO A;  1RMP A;  5BT0 A;  4W75 A;  1XVJ A;  1OXF A;  4ZIO A;  2A46 A;  1EH2 A;  1B7T Z;  1BG1 A;  5EB6 A;  2KNE A;  2OKW A;  1XFX O;  3L4L A;  3LK1 A;  1U5I A;  5AFP A;  5DTY A;  2WCF A;  1LS8 A;  2I94 A;  2WCE A;  2WC5 A;  2ZFD A;  3JTD C;  3SS3 A;  4DXM A;  4UPG A;  3IQO A;  2LC5 A;  2AAO A;  1MHO A;  3GL4 A;  1JSA A;  1IJ5 A;  1XQM A;  4I5N B;  3AAJ A;  1UP5 A;  4JC2 A;  4EDO A;  1KWO B;  5DPI A;  5FHV A;  3A8S A;  1JFJ A;  4LQU A;  3CDN A;  2GW4 B;  3E5T A;  4HQ9 A;  1FI5 A;  2A52 B;  1S26 D;  1K93 D;  1EME A;  1XFV O;  1MOV A;  4H48 A;  3DQN A;  5I2O A;  4PHK A;  2KQY A;  4GNK B;  3PJ5 A;  1SL8 A;  2WHU A;  2WCB A;  4W6C A;  2IB6 A;  5AEQ A;  3BXB A;  1Q4E A;  1SL7 A;  4GFT A;  1XSS A;  3IP2 A;  4C0L A;  3O2P A;  3QME A;  4ANJ A;  5AQB B;  2Y5I A;  1SR6 B;  3NHT A;  4DS7 A;  3WCK A;  3VGO A;  1ODB A;  3S0B A;  1OOH A;  2WC6 A;  1DJX A;  1J7R A;  2K7D A;  3SG7 A;  4DXN A;  1TCF A;  3HCM A;  2FWQ A;  1XA5 A;  2WC8 A;  1V1G A;  2V4E C;  3D74 A;  3ST3 A;  2FCE A;  4W6J A;  1NUB A;  1GGW A;  1DTL A;  2YGU A;  2MA2 A;  4NDB A;  4B30 B;  1EMA A;  2QEB A;  3S05 A;  2G2S B;  3EVV A;  3VRO A;  3H1O A;  2LLT A;  1ALV A;  4HQC A;  2BEC A;  3O4X A;  3BUN B;  4YGE B;  3DD4 A;  4M2Q A;  5I2L A;  1L2O B;  4PHN A;  5J3X A;  1JBZ A;  1QS7 A;  3SS0 A;  1QX5 B;  4J89 A;  4IL1 A;  1BLQ A;  1PAL A;  3S0G A;  2PRU A;  3BX9 A;  4J88 A;  1K2H A;  3R1O A;  1T14 A;  2FCD A;  4WQ3 A;  2LHI A;  1CMF A;  3LSA A;  5HZU A;  4JQ0 D;  1CDM A;  1JFK A;  2MLF C;  4YGC B;  1DJY A;  2A48 A;  1J7O A;  3BFH A;  2WCL A;  1UHK A;  3DVE A;  2ERB A;  4ZFS A;  1OZS A;  3KPX A;  4NQG A;  3GOF A;  2OTB A;  3CBE A;  2Z6X A;  1BJF A;  4DXP A;  3AKO A;  1IKU A;  2H2K A;  1YHH A;  4YI8 A;  4W6R A;  2M97 A;  2KI4 B;  3U8C A;  1TTX A;  4M2O A;  4L13 A;  4W6U A;  1WLM A;  3TS5 B;  3OSQ A;  2LMU A;  3SSL A;  3DQI A;  2WCH A;  3HX4 A;  4IK9 A;  1CM1 A;  3OB2 B;  1LA3 A;  2LUC A;  5FVG A;  4Q9W A;  3EVU A;  1Y1U A;  1WDC C;  3NT3 A;  1QAS A;  3EK4 A;  2EC6 C;  4PE4 A;  4IK3 A;  4W77 A;  2TN4 A;  2F3Z A;  2WSN A;  2K7O A;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  2B3P A;  3OP0 A;  5DRF A;  4XGY A;  3BUM B;  2Z1O A;  3DVK A;  2WHS A;  2CXJ A;  2L5Y A;  3PFV A;  4BY4 A;  3RM1 A;  5HYD A;  3OSR A;  3DQ2 A;  2M9G A;  1F4O A;  2G6Y A;  3BUO B;  1Z1P A;  2BKH B;  1R2U A;  3GEX A;  1Z4H A;  3Q8I A;  3ZTF A;  4OV2 A;  4MRY A;  4HQ8 A;  1AJ4 A;  3R1V A;  4M2P A;  3GK4 X;  4R6B A;  2ISD A;  3EK8 A;  1KQM C;  3SS4 A;  2KFF A;  3ZUL A;  2OTE A;  1QLK A;  2H61 A;  1B8R A;  2B3Q A;  2OS8 C;  3ZUF A;  3AI4 A;  5DRG A;  1RTP 1;  5EHU A;  3U8A A;  4GAO A;  3DVJ A;  2HPW A;  2KLD A;  2JNX A;  1TNQ A;  2FOT A;  1W9Z A;  3ZWH A;  4W6S A;  1CDP A;  1GL4 A;  1SCV A;  2O5G A;  1E8A A;  2AWL A;  1UWO A;  1A75 B;  3DQ4 A;  2CCM A;  4HRH A;  1W7J B;  3CYZ A;  2LAN A;  1LKJ A;  2Q57 A;  4PE0 A;  3M0W A;  3SRY A;  3LK0 A;  1QX7 A;  2KI6 D;  4W73 A;  3U0K A;  3QRX A;  4W7D A;  1QIW A;  4AQJ A;  3DQJ A;  2PMY A;  1YFP A;  1NX3 A;  2ICR A;  2GGZ A;  4C0J A;  1YHI A;  1Y1X A;  2M8U A;  3SG2 A;  3BXA A;  2QT2 A;  1K9P A;  1TUZ A;  3H4S E;  1QWV A;  3CR4 X;  5EJU A;  1A29 A;  1JF2 A;  3LL8 B;  2DD9 A;  2MRD A;  4ORB B;  3BFB A;  2MBX A;  1SCM C;  1GM0 A;  4JGE A;  1NX1 A;  1WRZ A;  2JXC A;  4KPI A;  2WIQ A;  2KLE A;  1S5G Z;  3E5V A;  2BCX A;  5JOL A;  2K2A A;  3KO0 A;  2HPS A;  3EVR A;  2KBM A;  3S0F A;  1DJI A;  4MLW A;  4YGB B;  2L50 A;  1B9C A;  5H89 A;  4MZL A;  3A4U B;  2WOS A;  3CZ1 A;  3RWA A;  1IQ3 A;  3WHT B;  1LXF C;  1CDN A;  1PVA A;  4W7C A;  4GES B;  1B9A A;  1S5G Y;  3K1E A;  2D8N A;  4TNC A;  5IBW A;  2A53 B;  3SSK A;  2G9B A;  4TZG A;  4CFQ A;  4ZCV A;  1BOD A;  2I2R E;  1L2O C;  2ZO6 A;  2AMI A;  5AAN A;  1Q4B A;  5F9G A;  1DEK A;  2H9W A;  4KGE A;  2KPH A;  1AVS A;  2LMV A;  3SV5 A;  2P70 A;  3PN7 B;  1OOG A;  3CGA A;  1A75 A;  2K8M B;  2BE4 A;  1Q80 A;  4Z4M A;  4OCI A;  3DQ1 A;  1QY3 A;  1DVI A;  3O4Y A;  2P71 A;  3TUY B;  4KGF A;  4XL5 A;  4FTG A;  5LTP A;  1CFC A;  1RMO A;  5DPH A;  3BYA A;  3DF0 B;  1KYP A;  4W6F A;  4KA9 A;  3CR2 A;  2LP2 A;  3S0E A;  2E30 A;  1N65 A;  3CZT X;  3OGO A;  4JKT A;  4W69 A;  2H61 C;  4ORA B;  1RJV A;  4W7R A;  2Y0G A;  1CMG A;  3V3D A;  1HCJ A;  1QXT A;  2K60 A;  2PXW A;  1KCY A;  5H87 A;  4XYN A;  1OOI X;  4WQ2 A;  3UG0 A;  3SIB A;  5CSF A;  2POX A;  1JF0 A;  3MSE B;  4PAL A;  1G4Y R;  3DQ5 A;  2JZI A;  4R6D A;  1YUU A;  1GFL A;  2RH7 A;  1NX2 A;  1J55 A;  2NLN A;  1OMD A;  3PM2 A;  3IQQ A;  1F4Q A;  4DXI A;  1QAT A;  2JAD A;  1IQ5 A;  3NHI A;  4H3M A;  4XVP A;  3SSV A;  3NSO A;  5LK4 A;  3PIB A;  4BDU A;  1A2X A;  3U0N A;  3CD1 A;  2AWM A;  1DJW A;  4W6I A;  3I5G B;  4PPJ A;  3R1P A;  1AK8 A;  1TNX A;  1RRX A;  1KQM B;  1S6C A;  4W6P A;  2A4J A;  1M45 A;  1JC1 A;  2DDC A;  5LTR A;  2BKI B;  3SVD A;  3VHT B;  2AWK A;  3NSI A;  4ZBL A;  2OS8 B;  3CZ2 A;  3DVM A;  3O6B A;  3CAB A;  2ZMW A;  2PAS A;  4KF5 C;  2OPO A;  2L98 A;  4DCK A;  4MVF A;  4EN1 A;  4TZA A;  3DF0 A;  2K0J A;  4A4B A;  4OY4 A;  3OB1 B;  1B7T Y;  2GX2 A;  1DJH A;  2Q91 A;  2LHL A;  3DQK A;  4DIR A;  1YZW A;  4I5K A;  2GW3 A;  3ED8 A;  1EMC A;  4MSP A;  2WND A;  1H8B A;  1A4P A;  5HW9 A;  4RYS A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  2QDI A;  3IF7 A;  1EMG A;  3VK1 A;  5K89 A;  1XFY O;  2G2B A;  1OMV A;  1LA0 A;  4W6A A;  2E6W A;  3EKH A;  3UNW A;  1FPW A;  3BOW B;  4RYW A;  5PAL A;  2EMO A;  1F55 A;  3LVA A;  2GTE A;  1NPQ A;  3CTN A;  2A47 A;  1MR8 A;  1S1E A;  4W6T A;  4C0K A;  2OTG B;  2B1U A;  3SSY A;  1TOP A;  2G3O A;  1SCM B;  1XMZ A;  2JPO A;  5D3O A;  2KDH A;  2CT9 A;  2M7N A;  1J7P A;  3R72 A;  1QV0 A;  2WIS A;  4UTS A;  5HZS A;  4NDD A;  5I8N A;  4P2Y B;  1KFU L;  4GF6 B;  4KW9 A;  2QLE A;  3CWG A;  3DPZ A;  2Y1N A;  4ICB A;  2M1U A;  2DD7 A;  2MHH A;  4XJK B;  3WHU B;  3PAL A;  2BBN A;  3VHT A;  1W7T A;  2Z6Y A;  1YVH A;  3GK2 A;  4Q9X A;  3DYE A;  3KHE A;  2AH8 A;  3I5F B;  4DKM A;  5DQM A;  1DGV A;  5DTZ A;  1IRJ A;  1YJF A;  2WCJ A;  2PYQ A;  4CPV A;  3DQM A;  2VZX A;  4CID A;  4JD9 A;  3AKB A;  1H6R A;  4NWS A;  2ZN9 A;  1F54 A;  4N3D A;  1SL9 A;  3NED A;  3NEZ A;  1IGV A;  4J8A A;  3DQ6 A;  4PDZ A;  2K7B A;  4U2V A;  5HKZ A;  3DZT A;  4B5Y A;  2LVI A;  1KFU S;  4W7A A;  3ADF A;  1NYA A;  2YDZ A;  2Y4Q A;  1X02 A;  4PFE A;  2JTT A;  3CFF A;  2WOR A;  3DXL A;  1RK9 A;  3WLD A;  2ZN8 A;  1HUY A;  4L12 A;  1XYD A;  3PN7 C;  4WRI A;  2JC2 A;  5DKN A;  2L5X B;  3BOW A;  2L4H A;  3I5H C;  2KGB C;  1BR4 B;  3I19 A;  2QEO A;  1M39 A;  5DU0 A;  1QYO A;  4PCW A;  1UIS A;  3TUY C;  3O78 A;  3ZNI A;  5FI6 A;  2COL B;  4PPK A;  2VVH A;  1OE9 B;  1XFZ O;  1YX8 A;  2KFG A;  4KF4 A;  3ST2 A;  1QYQ A;  1AUI B;  2WSO A;  4QJ5 B;  1MXL C;  1F0B A;  1ZGO A;  1NCX A;  3AI5 A;  2Q6P A;  4OHS A;  2OKY A;  5DIC A;  4LJC A;  3PJ7 A;  2JT3 A;  2JXL A;  3N7H A;  2MAZ A;  2G6X A;  3SVB A;  4MZK A;  4XJK A;  1F70 A;  2DUG A;  3PLF B;  4KYN A;  2IOV A;  4B30 A;  3OX5 A;  3OBV A;  1P28 A;  5FYX A;  4A4C A;  1EL4 A;  2LNK A;  3L47 A;  1YX7 A;  4LJD C;  1UHN A;  3VRQ A;  2K61 A;  1SMG A;  1B1G A;  2JNF A;  3FS7 A;  1DEL A;  4P5O E;  1YRT B;  5ER4 X;  2M3W A;  1KSO A;  1XK4 C;  1RM9 A;  4OQW A;  4CLN A;  2Z6Z A;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  1B47 A;  3EG5 B;  2QRF A;  3DQO A;  2LLU A;  2PSR A;  3I5I B;  2P4M A;  1V1F A;  3U0L A;  3W1C A;  3DQ3 A;  2HF5 A;  2JT8 A;  5EB7 A;  1FBV A;  3PAT A;  5EBJ A;  2SCP A;  3B87 A;  3DQL A;  2BAP A;  2L2E A;  1Z1Q A;  3VB1 A;  1MWN A;  1BOC A;  4BY5 A;  1XO5 A;  1EMF A;  1NCZ A;  1M63 B;  3CS1 A;  4HRG A;  2JWW A;  3OHM B;  2DUI A;  3B88 A;  4INW A;  2M0R A;  4DRW A;  1G8I A;  3LF4 B;  2EGD A;  1F09 A;  5G08 A;  1S6Z A;  1WY9 A;  1B8C A;  3EK7 A;  4GOB A;  1SPY A;  1A03 A;  1CV7 A;  4L9M A;  4IZN A;  2DDD A;  2ZMU A;  3UO9 A;  1AP4 A;  5KTY A;  1KYR A;  5DPJ A;  3CR5 X;  4W6M A;  1TIZ A;  2QLI A;  2BCB A;  1DQE A;  4MEW A;  3GB3 A;  5B8I B;  2A50 B;  4I5J A;  1S6J A;  5H88 A;  3SVC A;  2JTZ A;  2LLS A;  1K9U A;  4N1F A;  3P8U A;  4H47 A;  4QJ3 B;  3S0A A;  2AHA A;  2ZO7 A;  5HGE A;  3O77 A;  4GGF A;  1QXP A;  2O24 A;  5FVI A;  4GGN A;  2H5O A;  2H8V A;  2OTG C;  1QYF A;  4W6H A;  2HQ8 A;  1LVC D;  3B6X A;  1OSA A;  2BL0 B;  2DUH A;  3DQH A;  1QLS A;  1ORG A;  2R2I A;  1EML A;  3D10 A;  4W6N A;  1DJZ A;  5DY6 A;  4KF5 A;  2ARL A;  1FF1 A;  4DKN A;  5BPJ A;  1MYW A;  3BUX B;  3LLE A;  4JPZ B;  2LM5 A;  4NDC A;  2BTJ A;  2NCP A;  4P1Q A;  3CFA A;  1YJ2 A;  1ZUZ A;  1YUT A;  1QVI Z;  1H4U A;  2KOT A;  3B86 A;  1IJ6 A;  1YTZ C;  4AS8 A;  3KCT A;  2LE9 B;  2FJU B;  3K1K A;  3I5F C;  4W7F A;  3TMR A;  1DGU A;  3D73 A;  1J7Q A;  4YRU A;  1FI6 A;  1SK6 D;  1YR5 A;  1Z2C B;  4OR9 B;  1QVI Y;  2F2O A;  3VIC A;  2Q4U A;  4W72 A;  1B8L A;  5FVF A;  2HGD A;  1LIN A;  3LS3 A;  2CNP A;  1M31 A;  5BTT B;  1KK8 B;  1WRL A;  4IK5 A;  3SVR A;  3I5H B;  1PVB A;  1TNP A;  3OX6 A;  4ETO A;  5D7F A;  1YUS A;  4GUK A;  2NCO A;  1QTX A;  2KQ6 A;  5CSI A;  1WRK A;  5CPV A;  2LVK A;  3F45 A;  1XFW O;  3PSR A;  4KW4 A;  2SAS A;  5J2O A;  3VRN A;  2LUX A;  2MLE C;  3TDI A;  5I94 A;  2YE0 A;  1PSR A;  2VVJ A;  1XA9 A;  4LQT A;  3D78 A;  1EXR A;  4U8D A;  3LVC A;  1TUJ A;  2G6E A;  3CD9 A;  4YGA A;  3CZ0 A;  1R6P A;  2JRF A;  2AUC A;  5HKY A;  1GQM A;  4DXO A;  4MBE A;  2GX0 A;  3LVD A;  1VRK A;  4OVN F; 
#chains in the Genus database with same CATH homology
 1KQV A;  2WHT A;  1G33 A;  4R1E A;  1CLB A;  1JC0 A;  1PSB A;  2LVV A;  3GJ2 A;  4DXQ A;  1TNW A;  1Q4A A;  2P6B B;  2F8P A;  2FL1 A;  2LCP A;  3ZUJ A;  4ZF4 A;  5AXI A;  4GGF C;  1SNL A;  2L51 A;  5DKR A;  1REC A;  1BMO A;  2JQ6 A;  1GGZ A;  3EKJ A;  1NX0 A;  3SSH A;  3SST A;  5BTT A;  1Q4D A;  1K94 A;  2QU1 A;  3RWT A;  2NXQ A;  1IG5 A;  4ORC B;  3I5I C;  2HQZ A;  5TNC A;  3SVO A;  2EMN A;  4OJ0 A;  3SJS A;  1YVL A;  1D1O A;  4EDS A;  3ST0 A;  4AOM A;  4JEO A;  2L4I A;  2I18 A;  4W6G A;  3P28 A;  2KAX A;  3TZ1 A;  3UFZ A;  3BXK A;  2K7C A;  4MN0 A;  3DPW A;  4Z4K A;  5KTG A;  3FWB A;  2CTN A;  2IB5 A;  3SVS A;  2QLG B;  4KAG A;  1CLL A;  4AR7 A;  4W6D A;  1GJY A;  2HCG A;  4RTC A;  4LJD A;  2GGM A;  4JF9 A;  2PVB A;  2JPT A;  1ZUX A;  1BU3 A;  2M1K B;  2VAD A;  1SW8 A;  4W74 A;  2YFP A;  4L1I A;  1CFP A;  1SKT A;  4FQO A;  3KF9 A;  2LP3 A;  2G3D B;  4EUL A;  3AKA A;  1XK4 A;  5HBD A;  3JVT B;  1RRO A;  1AJ5 A;  1K90 D;  1M46 A;  4AQI A;  1N2D A;  3SG4 A;  1H4B A;  4OGS A;  5CSN A;  4ZCU A;  3CFH A;  2H6V A;  2IE2 A;  3TDZ A;  3U8P A;  3M24 A;  1PK0 D;  2BL0 C;  1K95 A;  5CSJ A;  3IR8 A;  2QZ0 A;  1DJG A;  2KBI A;  4IK8 A;  5DPG A;  4GBA A;  2V53 A;  5HZT A;  1MQ1 A;  2LVJ A;  2O29 A;  4W76 A;  1KK7 Z;  1RFJ A;  4H3N A;  4YI9 A;  1G7K A;  3SVE A;  1BR1 B;  5KU1 A;  1EG3 A;  2BE6 A;  1KK7 Y;  1YHG A;  1IWQ A;  2KFH A;  1CB1 A;  1KP5 A;  2HFC A;  4ORN A;  3DQA A;  3H1R A;  4DUQ A;  2KYF A;  1NCY A;  1Q4C A;  2QLG A;  3DQ9 A;  1TCO B;  2ZNE A;  2KAY A;  2H5Q A;  1C7W A;  1UUR A;  1KK8 C;  2KSP A;  3DQ8 A;  1PRW A;  1K96 A;  2LMT A;  1CFD A;  3E3R A;  1NP8 A;  4OKH A;  1OXE A;  1UHH A;  2RGI A;  3GJ1 A;  1Y6W A;  2O2B A;  2KI6 C;  2F33 A;  5JJG A;  1ZMZ A;  2G5Z B;  4KEX A;  1QV1 A;  4HSZ A;  1WLZ A;  1DT7 B;  5I2Q A;  4JRB A;  1SYM A;  3KEV A;  3MGF A;  2KYC A;  3AAK A;  5BQL A;  2H8Q A;  1BT6 A;  3PJB A;  1YUR A;  1YRU B;  1K8U A;  4F0Z B;  2QLH A;  1W7S A;  2PAL A;  1ZOT B;  1ALW A;  4PPL A;  1KYS A;  1MXE A;  3E5W A;  1BF5 A;  1C07 A;  2VAE A;  1Y1A A;  5DTL A;  1J1E A;  2DOQ A;  1DMO A;  4H3L A;  1OQP A;  1OZO A;  3LF3 A;  4YBH B;  1F71 A;  4HVF A;  4ZF5 A;  3ICB A;  4HRE E;  1W7U A;  5DQB A;  4PE7 A;  1RWY A;  2PXS A;  3SVN A;  4ZF3 A;  1S36 A;  1MF8 B;  2EMD A;  2JT0 A;  2KHN A;  2EHB A;  1EMK A;  3TMT A;  1AHR A;  3JTD B;  4IK4 A;  3DQD A;  4ZIN A;  1CM4 A;  3FWC A;  2I7A A;  3K21 A;  1K9K A;  4HE4 A;  2M29 A;  2BCA A;  1QJT A;  4Q7U A;  4PE1 A;  4N1G A;  4XOW A;  3SIA A;  4QJ4 B;  5DKQ A;  3W1D A;  2KGR A;  1EG4 A;  1B4C A;  1CNP A;  1EMB A;  2FZU A;  3ST4 A;  1SRA A;  1KWO C;  1NSH A;  1UHI A;  3TDU A;  4W6O A;  2HJO A;  2HQK A;  2HRS A;  5HLO A;  3LA1 A;  2L0P A;  1CTR A;  4MZJ A;  4LJB A;  1BFP A;  4PHJ A;  3SSP A;  5DTX A;  1ZGQ A;  2F2P A;  4USL A;  5AER A;  1J1D A;  3RLZ A;  4W6L A;  2Y1M A;  5LTQ A;  1EJ3 A;  3JVT C;  2YE1 A;  3CB9 A;  3DPX A;  2C9I A;  5D69 A;  1SR6 C;  4MRX A;  5KSZ A;  2V4E B;  2M7L A;  1DF0 B;  3WLC A;  2ZKM X;  2AWJ A;  3DQF A;  3EVP A;  4I5L B;  2QPT A;  3M22 A;  2QAC A;  5GQQ C;  4EMQ A;  2CBL A;  2OJK A;  3DQC A;  4Q7T A;  5HLV A;  1TN4 A;  2F3Y A;  1GGX A;  3KCS A;  3VRR A;  5EXB A;  1MUX A;  2HGY A;  3A8R A;  1ZGP A;  1XFU O;  4JFG A;  3PM8 A;  1FW4 A;  3SG5 A;  2JOJ A;  2LAP A;  5EXU A;  2GV5 A;  2VVI A;  2BBM A;  4W7X A;  1MOU A;  2KAV A;  4XOV A;  1L7Z A;  1OMR A;  1Y0V H;  3DQU A;  2ZND A;  2K2F A;  1JWD A;  2IS9 A;  5T3I A;  3D0Y B;  4CFR A;  4GPL B;  4PHM A;  3CLN A;  4KW8 A;  1HQV A;  2VRG A;  2JUL A;  3FIA A;  1S6I A;  3CGL A;  4LW5 A;  4YGD B;  2LV7 A;  5HKW A;  2C9J A;  1SBJ A;  1U5I B;  3BQ3 A;  1EMM A;  2G16 B;  2A54 B;  4D1E A;  3GK1 A;  1SY9 A;  3SG6 A;  2MJW B;  1W7I B;  3WXA A;  5EXC I;  3SVU A;  5ER5 A;  1RMM A;  2OGR A;  4E68 A;  1KFX L;  4ZB1 A;  3NXA A;  1NWD A;  2DUF A;  2V4E A;  3NSL A;  3SG3 A;  1CDL A;  1DF0 A;  1JBA A;  3NT9 A;  2KI4 C;  4P76 A;  1TRF A;  1CKK A;  2HET A;  1F8H A;  1XAE A;  1WDC B;  2ZRS A;  1UHJ A;  2ZRT A;  2DUE A;  1OXD A;  1IH0 A;  2EC6 B;  2NZ0 A;  3WNX B;  1JC2 A;  1KSM A;  3G9A A;  3TS5 C;  1N0Y A;  1NIW A;  3U0M A;  1Q73 A;  3NSK A;  3NF0 A;  2H5P A;  1ZFS A;  1C4F A;  4IK1 A;  1UUS A;  3BXC A;  2H5R A;  4Q7R A;  4W6K A;  5F6T A;  1S3P A;  3VRP A;  2A56 B;  4W6B A;  2WUR A;  1OOJ A;  1KFX S;  1CFF A;  4Q04 A;  2O60 A;  1CLM A;  2JU0 A;  1QX2 A;  4I2Y A;  2M49 B;  3DQE A;  3D0Y A;  3DQ7 A;  4W7E A;  1HT9 A;  1JBY A;  5HZO A;  1RMP A;  5BT0 A;  4W75 A;  1XVJ A;  1OXF A;  4ZIO A;  2A46 A;  1EH2 A;  1B7T Z;  1BG1 A;  5EB6 A;  2KNE A;  2OKW A;  1XFX O;  3LK1 A;  1U5I A;  5AFP A;  5DTY A;  2WCF A;  2I94 A;  2WCE A;  2ZFD A;  3JTD C;  4DXM A;  4UPG A;  3IQO A;  2LC5 A;  2AAO A;  1MHO A;  3GL4 A;  1JSA A;  1IJ5 A;  1XQM A;  4I5N B;  3AAJ A;  1UP5 A;  4JC2 A;  4EDO A;  1KWO B;  5DPI A;  5FHV A;  3A8S A;  1JFJ A;  4LQU A;  2GW4 B;  3E5T A;  4HQ9 A;  1FI5 A;  2A52 B;  1S26 D;  1K93 D;  4H48 A;  1XFV O;  1EME A;  1MOV A;  3DQN A;  5I2O A;  4PHK A;  2KQY A;  4GNK B;  3PJ5 A;  1SL8 A;  2WHU A;  2WCB A;  4W6C A;  2IB6 A;  5AEQ A;  3BXB A;  1Q4E A;  1SL7 A;  4GFT A;  1XSS A;  3IP2 A;  4C0L A;  3O2P A;  4ANJ A;  5AQB B;  2Y5I A;  1SR6 B;  4DS7 A;  3WCK A;  3VGO A;  1ODB A;  1DJX A;  1J7R A;  2K7D A;  3SG7 A;  4DXN A;  1TCF A;  3HCM A;  2FWQ A;  1XA5 A;  2WC8 A;  1V1G A;  2V4E C;  3ST3 A;  2FCE A;  4W6J A;  1NUB A;  1GGW A;  1DTL A;  2MA2 A;  4NDB A;  4B30 B;  1EMA A;  3S05 A;  2G2S B;  3EVV A;  3VRO A;  3H1O A;  2LLT A;  1ALV A;  4HQC A;  2BEC A;  3BUN B;  4YGE B;  3DD4 A;  4M2Q A;  5I2L A;  1L2O B;  4PHN A;  5J3X A;  1JBZ A;  1QS7 A;  3SS0 A;  1QX5 B;  4J89 A;  4IL1 A;  1BLQ A;  1PAL A;  2PRU A;  3BX9 A;  4J88 A;  1K2H A;  2FCD A;  4WQ3 A;  2LHI A;  1CMF A;  3LSA A;  5HZU A;  4JQ0 D;  1CDM A;  1JFK A;  2MLF C;  4YGC B;  1DJY A;  2A48 A;  1J7O A;  1UHK A;  3DVE A;  4ZFS A;  1OZS A;  3KPX A;  4NQG A;  3GOF A;  2OTB A;  3CBE A;  2Z6X A;  1BJF A;  4DXP A;  3AKO A;  1IKU A;  2H2K A;  1YHH A;  4YI8 A;  4W6R A;  2M97 A;  2KI4 B;  3U8C A;  1TTX A;  4M2O A;  4L13 A;  4W6U A;  1WLM A;  3TS5 B;  3OSQ A;  2LMU A;  3SSL A;  3DQI A;  3HX4 A;  4IK9 A;  1CM1 A;  3OB2 B;  1LA3 A;  2LUC A;  5FVG A;  4Q9W A;  3NT3 A;  3EVU A;  1Y1U A;  1WDC C;  1QAS A;  3EK4 A;  2EC6 C;  4PE4 A;  4IK3 A;  4W77 A;  2TN4 A;  2F3Z A;  2WSN A;  2K7O A;  3LCP C;  3BUW B;  1PUL A;  1ZAC A;  2B3P A;  3OP0 A;  5DRF A;  4XGY A;  3BUM B;  2Z1O A;  3DVK A;  2WHS A;  2CXJ A;  3PFV A;  4BY4 A;  3RM1 A;  5HYD A;  3OSR A;  3DQ2 A;  2M9G A;  1F4O A;  2G6Y A;  3BUO B;  1Z1P A;  2BKH B;  1R2U A;  3GEX A;  3ZTF A;  4OV2 A;  4MRY A;  4HQ8 A;  1AJ4 A;  4M2P A;  3GK4 X;  4R6B A;  2ISD A;  3EK8 A;  1KQM C;  2KFF A;  3ZUL A;  2OTE A;  1QLK A;  2H61 A;  1B8R A;  2B3Q A;  2OS8 C;  3ZUF A;  3AI4 A;  5DRG A;  1RTP 1;  5EHU A;  3U8A A;  4GAO A;  3DVJ A;  2HPW A;  2JNX A;  1TNQ A;  2FOT A;  3ZWH A;  4W6S A;  1CDP A;  1GL4 A;  1SCV A;  2O5G A;  1E8A A;  2AWL A;  1UWO A;  1A75 B;  3DQ4 A;  2CCM A;  4HRH A;  1W7J B;  2LAN A;  1LKJ A;  2Q57 A;  4PE0 A;  3M0W A;  3SRY A;  3LK0 A;  1QX7 A;  2KI6 D;  4W73 A;  3U0K A;  3QRX A;  4W7D A;  1QIW A;  4AQJ A;  3DQJ A;  2PMY A;  1YFP A;  1NX3 A;  2ICR A;  2GGZ A;  4C0J A;  1YHI A;  1Y1X A;  2M8U A;  3SG2 A;  3BXA A;  2QT2 A;  1K9P A;  3H4S E;  3CR4 X;  5EJU A;  1A29 A;  1JF2 A;  3LL8 B;  2DD9 A;  2MRD A;  4ORB B;  2MBX A;  1SCM C;  4JGE A;  1NX1 A;  1WRZ A;  2JXC A;  4KPI A;  2WIQ A;  1S5G Z;  3E5V A;  2BCX A;  5JOL A;  2K2A A;  3KO0 A;  2HPS A;  3EVR A;  2KBM A;  1DJI A;  4MLW A;  4YGB B;  2L50 A;  1B9C A;  5H89 A;  4MZL A;  3A4U B;  2WOS A;  3RWA A;  1IQ3 A;  3WHT B;  1LXF C;  1CDN A;  1PVA A;  4W7C A;  4GES B;  1B9A A;  1S5G Y;  2D8N A;  4TNC A;  5IBW A;  2A53 B;  3SSK A;  2G9B A;  4TZG A;  4CFQ A;  4ZCV A;  1BOD A;  2I2R E;  1L2O C;  2ZO6 A;  2AMI A;  5AAN A;  1Q4B A;  5F9G A;  2H9W A;  4KGE A;  1AVS A;  2LMV A;  3SV5 A;  3PN7 B;  3CGA A;  1A75 A;  2K8M B;  2BE4 A;  1Q80 A;  4Z4M A;  4OCI A;  3DQ1 A;  1QY3 A;  1DVI A;  3O4Y A;  3TUY B;  4KGF A;  4XL5 A;  4FTG A;  5LTP A;  1CFC A;  1RMO A;  5DPH A;  3BYA A;  3DF0 B;  1KYP A;  4W6F A;  4KA9 A;  3CR2 A;  2LP2 A;  2E30 A;  1N65 A;  3CZT X;  3OGO A;  4W69 A;  2H61 C;  4ORA B;  1RJV A;  4W7R A;  2Y0G A;  1CMG A;  3V3D A;  1HCJ A;  1QXT A;  2PXW A;  1KCY A;  5H87 A;  4XYN A;  4WQ2 A;  3UG0 A;  3SIB A;  5CSF A;  2POX A;  1JF0 A;  3MSE B;  4PAL A;  1G4Y R;  3DQ5 A;  2JZI A;  4R6D A;  1YUU A;  1GFL A;  2RH7 A;  1NX2 A;  1J55 A;  2NLN A;  1OMD A;  3IQQ A;  1F4Q A;  4DXI A;  1QAT A;  2JAD A;  1IQ5 A;  4H3M A;  4XVP A;  3SSV A;  3NSO A;  5LK4 A;  3PIB A;  4BDU A;  1A2X A;  3U0N A;  3CD1 A;  2AWM A;  1DJW A;  4W6I A;  3I5G B;  4PPJ A;  1AK8 A;  1TNX A;  1RRX A;  1KQM B;  1S6C A;  4W6P A;  2A4J A;  1M45 A;  1JC1 A;  2DDC A;  5LTR A;  2BKI B;  3SVD A;  3VHT B;  2AWK A;  3NSI A;  4ZBL A;  2OS8 B;  3DVM A;  3O6B A;  2ZMW A;  2PAS A;  4KF5 C;  2OPO A;  2L98 A;  4DCK A;  4MVF A;  4EN1 A;  4TZA A;  3DF0 A;  2K0J A;  4A4B A;  4OY4 A;  3OB1 B;  1B7T Y;  2GX2 A;  1DJH A;  2Q91 A;  2LHL A;  3DQK A;  4DIR A;  1YZW A;  4I5K A;  2GW3 A;  3ED8 A;  1EMC A;  4MSP A;  2WND A;  1H8B A;  1A4P A;  5HW9 A;  4RYS A;  1C7V A;  2HQW A;  4JWQ A;  4N5X A;  3IF7 A;  1EMG A;  3VK1 A;  5K89 A;  1XFY O;  2G2B A;  1OMV A;  1LA0 A;  4W6A A;  2E6W A;  3EKH A;  1FPW A;  3BOW B;  4RYW A;  5PAL A;  2EMO A;  1F55 A;  3LVA A;  1NPQ A;  3CTN A;  2A47 A;  1MR8 A;  1S1E A;  4W6T A;  4C0K A;  2OTG B;  2B1U A;  3SSY A;  1TOP A;  2G3O A;  1SCM B;  1XMZ A;  2KDH A;  2CT9 A;  2M7N A;  1J7P A;  1QV0 A;  2WIS A;  4UTS A;  5HZS A;  4NDD A;  5I8N A;  4P2Y B;  1KFU L;  4GF6 B;  4KW9 A;  2QLE A;  3CWG A;  3DPZ A;  2Y1N A;  4ICB A;  2M1U A;  2DD7 A;  2MHH A;  4XJK B;  3WHU B;  3PAL A;  2BBN A;  3VHT A;  1W7T A;  2Z6Y A;  1YVH A;  3GK2 A;  4Q9X A;  3KHE A;  2AH8 A;  3I5F B;  4DKM A;  5DQM A;  1DGV A;  5DTZ A;  1IRJ A;  1YJF A;  4CPV A;  3DQM A;  2VZX A;  4CID A;  3AKB A;  1H6R A;  4NWS A;  2ZN9 A;  1F54 A;  4N3D A;  1SL9 A;  3NED A;  3NEZ A;  1IGV A;  4J8A A;  3DQ6 A;  4PDZ A;  2K7B A;  4U2V A;  5HKZ A;  4B5Y A;  2LVI A;  1KFU S;  4W7A A;  3ADF A;  1NYA A;  2YDZ A;  2Y4Q A;  1X02 A;  4PFE A;  2JTT A;  3CFF A;  2WOR A;  1RK9 A;  3WLD A;  2ZN8 A;  1HUY A;  4L12 A;  1XYD A;  3PN7 C;  4WRI A;  2JC2 A;  5DKN A;  2L5X B;  3BOW A;  2L4H A;  3I5H C;  2KGB C;  1BR4 B;  3I19 A;  5DU0 A;  1M39 A;  1QYO A;  4PCW A;  1UIS A;  3TUY C;  3O78 A;  3ZNI A;  2COL B;  4PPK A;  2VVH A;  1OE9 B;  1XFZ O;  1YX8 A;  2KFG A;  4KF4 A;  3ST2 A;  1QYQ A;  1AUI B;  2WSO A;  4QJ5 B;  1MXL C;  1F0B A;  1ZGO A;  1NCX A;  3AI5 A;  2Q6P A;  4OHS A;  2OKY A;  4LJC A;  3PJ7 A;  2JT3 A;  2JXL A;  3SVB A;  2MAZ A;  2G6X A;  4MZK A;  4XJK A;  1F70 A;  2DUG A;  3PLF B;  2IOV A;  4B30 A;  3OX5 A;  5FYX A;  4A4C A;  1EL4 A;  2LNK A;  1YX7 A;  4LJD C;  1UHN A;  3VRQ A;  2K61 A;  1SMG A;  1B1G A;  2JNF A;  3FS7 A;  4P5O E;  1YRT B;  5ER4 X;  2M3W A;  1KSO A;  1XK4 C;  1RM9 A;  4OQW A;  4CLN A;  2Z6Z A;  3C1V A;  1QIV A;  3I5G C;  1JUO A;  1B47 A;  2QRF A;  3DQO A;  2LLU A;  2PSR A;  3I5I B;  2P4M A;  1V1F A;  3U0L A;  3W1C A;  3DQ3 A;  2HF5 A;  2JT8 A;  5EB7 A;  1FBV A;  3PAT A;  5EBJ A;  2SCP A;  3DQL A;  2L2E A;  1Z1Q A;  1MWN A;  1BOC A;  4BY5 A;  1XO5 A;  1EMF A;  1NCZ A;  1M63 B;  3CS1 A;  4HRG A;  2JWW A;  3OHM B;  2DUI A;  2M0R A;  4DRW A;  1G8I A;  3LF4 B;  2EGD A;  1F09 A;  5G08 A;  1S6Z A;  1WY9 A;  1B8C A;  3EK7 A;  4GOB A;  1SPY A;  1A03 A;  1CV7 A;  4L9M A;  4IZN A;  2DDD A;  2ZMU A;  1AP4 A;  5KTY A;  1KYR A;  5DPJ A;  3CR5 X;  4W6M A;  1TIZ A;  2QLI A;  2BCB A;  4MEW A;  3GB3 A;  5B8I B;  2A50 B;  4I5J A;  1S6J A;  5H88 A;  3SVC A;  2JTZ A;  2LLS A;  1K9U A;  4N1F A;  4H47 A;  3P8U A;  4QJ3 B;  2AHA A;  2ZO7 A;  5HGE A;  3O77 A;  4GGF A;  1QXP A;  2O24 A;  5FVI A;  4GGN A;  2H5O A;  2OTG C;  1QYF A;  4W6H A;  2HQ8 A;  1LVC D;  1OSA A;  2BL0 B;  2DUH A;  3DQH A;  1QLS A;  2R2I A;  1EML A;  3D10 A;  4W6N A;  1DJZ A;  5DY6 A;  4KF5 A;  2ARL A;  1FF1 A;  4DKN A;  5BPJ A;  1MYW A;  3BUX B;  3LLE A;  4JPZ B;  2LM5 A;  4NDC A;  2BTJ A;  2NCP A;  4P1Q A;  3CFA A;  1YJ2 A;  1ZUZ A;  1YUT A;  1QVI Z;  1H4U A;  2KOT A;  1IJ6 A;  1YTZ C;  4AS8 A;  3KCT A;  2LE9 B;  2FJU B;  3K1K A;  3I5F C;  4W7F A;  3TMR A;  1DGU A;  1J7Q A;  4YRU A;  1FI6 A;  1SK6 D;  1YR5 A;  4OR9 B;  1QVI Y;  2F2O A;  3VIC A;  2Q4U A;  4W72 A;  1B8L A;  5FVF A;  2HGD A;  1LIN A;  3LS3 A;  2CNP A;  1M31 A;  5BTT B;  1KK8 B;  1WRL A;  4IK5 A;  3SVR A;  3I5H B;  1PVB A;  1TNP A;  3OX6 A;  4ETO A;  5D7F A;  1YUS A;  4GUK A;  2NCO A;  1QTX A;  2KQ6 A;  5CSI A;  1WRK A;  5CPV A;  2LVK A;  3F45 A;  1XFW O;  3PSR A;  4KW4 A;  2SAS A;  5J2O A;  3VRN A;  2LUX A;  2MLE C;  3TDI A;  2YE0 A;  1PSR A;  2VVJ A;  1XA9 A;  4LQT A;  1EXR A;  4U8D A;  3LVC A;  2G6E A;  3CD9 A;  4YGA A;  1R6P A;  2JRF A;  2AUC A;  5HKY A;  1GQM A;  4DXO A;  4MBE A;  2GX0 A;  3LVD A;  1VRK A;  4OVN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...