3SG3A

Crystal structure of gcamp3-d380y
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
409
structure length
394
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 138
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg3A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg3A02
4PFEA 1XFVO 1S3PA 5DU0A 4OGSA 2K7BA 3DVJA 4R6DA 1OOJA 2FOTA 4KPIA 3ZUFA 1UHHA 2K2AA 3I19A 4P1QA 1B47A 2PVBA 4YGCB 4M2PA 2H5OA 4W73A 1CLMA 2ICRA 4W74A 2LVIA 1XVJA 5FHVA 5AANA 5H88A 4N1GA 2K8MB 3CR4X 5BTTA 1S6JA 2Z6XA 3SSHA 4NDDA 4ZIOA 3JVTB 4DXNA 5HYDA 4OV2A 2FCDA 4HQCA 3CR5X 3TMTA 2KBIA 2DOQA 4PHMA 1JC1A 3G9AA 4H3MA 1YHIA 2QLIA 4BDUA 2QU1A 2Q57A 4XVPA 3DQ9A 4MRYA 1S6IA 2H5QA 5LTPA 2V4EA 4AOMA 3KCTA 3DVEA 2Y1NA 1K9UA 2L50A 1J7RA 3SG5A 3SG2A 5AQBB 1S6ZA 2IB6A 3BUXB 4W6SA 1NX3A 3BX9A 4H47A 5DKRA 2GGZA 5HZUA 3BUNB 2OTBA 3WLCA 1KFUS 4IK3A 3MSEB 2SASA 1YVHA 2KI4B 1SCVA 4DS7A 3GJ2A 4ZCUA 2AH8A 1TNWA 3DQKA 2ZNDA 1R6PA 2LV7A 4QJ4B 1EJ3A 3LL8B 4DXPA 4ORAB 2OKYA 1N65A 1Y6WA 1B1GA 3EKHA 2PASA 2BKHB 1U5IB 2KAVA 1MR8A 1MHOA 1NX0A 3NSOA 1IGVA 5IBWA 1MUXA 3KEVA 5EHUA 4IZNA 1JSAA 1KQMB 2RH7A 1IWQA 1D1OA 1RWYA 1EMEA 1ALWA 4KW8A 3BOWA 4IK4A 3W1DA 3DQEA 2LUCA 4CFRA 2F3ZA 1KCYA 5TNCA 1JFKA 2JQ6A 2JT3A 3ZUJA 5PALA 3PM8A 1DJXA 1JWDA 1S36A 3DF0A 4IK9A 2NLNA 3CBEA 3TUYB 2I7AA 3LK1A 2AWKA 3SRYA 1XA9A 1CFDA 5I8NA 1SNLA 1NUBA 4XOWA 4Q04A 4Q9WA 1SYMA 4HVFA 2OTGC 4TNCA 4ZCVA 3IP2A 2YE0A 3WCKA 3WHTB 3NT3A 4EULA 3CGLA 3A8SA 3CB9A 3SVNA 4YGEB 5FVIA 2A4JA 2B1UA 3RWTA 2JOJA 1TOPA 2EMOA 1Q4DA 1QVIY 4GAOA 2A53B 3I5IB 4ZINA 3ZTFA 1UURA 4DXOA 1L2OB 3SS0A 3DQFA 3CTNA 1ZGOA 2B3PA 2KI4C 4OR9B 2VRGA 2BTJA 1Y1XA 2G3OA 2LVJA 4QJ5B 1OXEA 4NDCA 3EVPA 1SCMB 1CMGA 3M24A 1A75A 1PVAA 3DQ3A 5HW9A 2H8QA 4C0LA 4ZF3A 2KI6D 3LF3A 4LJCA 2LCPA 1JF2A 1RECA 4RYWA 1AJ4A 3DQMA 2QACA 1KQVA 1W7SA 5KTGA 5K89A 5LTRA 1YUSA 1C07A 3WNXB 5BTTB 2PSRA 1EMFA 1MOUA 5HLOA 2B3QA 4KA9A 3TS5C 2WHUA 1ZOTB 4R6BA 1R2UA 4DXIA 1QJTA 4JRBA 2VVJA 4W75A 2LHIA 2GX2A 1ALVA 4L1IA 4CIDA 2L4HA 2H6VA 3ST0A 3I5FB 1PRWA 3BXCA 2V4EB 4HQ8A 1K94A 5HBDA 2ZN8A 1GFLA 2Y0GA 1ZGQA 4ZFSA 1M45A 1EMMA 2O60A 3CWGA 4LW5A 1G4YR 4EN1A 4CPVA 1K96A 1QXTA 4GOBA 2Q4UA 1YRTB 3SVBA 5HLVA 1XFYO 3IQQA 3D0YA 3DQ4A 3DQCA 1SY9A 3PJ7A 2GX0A 2A52B 2G16B 2E30A 1WY9A 1LVCD 3ICBA 2K2FA 2PRUA 4JFGA 4W6HA 3OSRA 2WSOA 1OXFA 3CD1A 3PN7C 1CLLA 1GJYA 2PXWA 4W6TA 1G33A 2GV5A 2DUGA 1G8IA 3GB3A 4W6FA 5DPIA 2IB5A 4MEWA 3NT9A 1OE9B 1JF0A 5GQQC 3DQ2A 1B9AA 5EXUA 1GGXA 1Q4AA 1QVIZ 3GK4X 2KGBC 3U0LA 4OHSA 2HPWA 2BCBA 5HZOA 1CFCA 2QLEA 2AHAA 1RK9A 4W76A 4AQIA 3NSKA 4ORCB 3EVVA 4MN0A 1U5IA 3O2PA 4I5LB 2LANA 1AUIB 1BJFA 2F3YA 4W6KA 3PJBA 2DUFA 2LMUA 3DQIA 3SSPA 2WC8A 5FVGA 2L51A 5ER4X 2AMIA 4W6AA 3VRPA 5AERA 4ICBA 3D10A 4P76A 1CV7A 1F55A 3H1OA 2L4IA 2A47A 4FQOA 1NPQA 1EMAA 3DQ6A 4LJBA 4CLNA 2QPTA 1ODBA 4OCIA 3AI4A 4DRWA 1GL4A 3BUWB 1LKJA 1F71A 1XQMA 1QLKA 1CFPA 1XYDA 3JTDC 2ARLA 3ST3A 2RGIA 3VGOA 4XYNA 2DUHA 2JNXA 5CPVA 1G7KA 1S5GY 2VZXA 1BLQA 1RRXA 1A75B 3AKBA 3VK1A 2G6EA 1YUUA 3PLFB 1DJGA 4W69A 2BE6A 5DPGA 1RM9A 4USLA 4YI9A 1YJFA 1IJ6A 2P4MA 5HGEA 3GEXA 4DXMA 1SKTA 4YRUA 1Q4CA 3DQUA 1NP8A 3BUOB 2Z6ZA 2LVVA 3GL4A 1YHHA 1RMMA 1QYQA 2WURA 4WQ2A 1OQPA 3PSRA 1NCZA 1RROA 4L9MA 1YR5A 3SIBA 3TDZA 2LNKA 3SSTA 1N2DA 2JXLA 2ZRTA 2OJKA 1IQ5A 2JT8A 3C1VA 3DPZA 4W6CA 2MJWB 3SVDA 3NEZA 2M3WA 1SRAA 4F0ZB 1SL7A 1TCOB 1B4CA 2KAXA 3WLDA 3K1KA 2HCGA 4I5NB 5KU1A 3SVEA 4DKNA 1PULA 4GF6B 2LM5A 3D0YB 1JC0A 1OSAA 1SL9A 2O24A 3OSQA 2WIQA 1QLSA 3DD4A 4KW9A 1B9CA 2OTGB 4W6MA 5D7FA 4HRGA 1M46A 4W7EA 4GNKB 1TN4A 2M49B 4HSZA 5EXBA 3ST2A 1EXRA 4NWSA 1W7UA 1BFPA 2WOSA 2QLHA 3LF4B 2HGDA 1MQ1A 2LP3A 3GK1A 5EB7A 2E6WA 1BU3A 5CSFA 3DQ8A 3U0KA 2NCOA 4W77A 1K8UA 3U8CA 4YGBB 2KHNA 3NSIA 1FI5A 3U0NA 3VICA 5I2LA 3EVRA 1B7TY 4PHJA 5DPJA 2A54B 1A4PA 1C7VA 2FZUA 1YURA 1NCXA 1S5GZ 3W1CA 1YVLA 4PCWA 4QJ3B 4B30B 3HX4A 4P5OE 3ZNIA 4W6PA 3ST4A 1FBVA 2KFFA 1CTRA 3P8UA 1H6RA 3M22A 4RYSA 3DVMA 3AAKA 2VVHA 3VRNA 3OP0A 2M9GA 2OPOA 2HQZA 1V1FA 3CS1A 1JFJA 4C0JA 2K0JA 2F33A 1B8RA 3SSKA 3TS5B 1WRLA 1PSRA 2HQKA 3DQ7A 3LK0A 3CFFA 2JXCA 2HRSA 2LLSA 1HUYA 3I5GB 1YX7A 2DDDA 3LA1A 1XA5A 1JBAA 3KPXA 3KO0A 3ED8A 2CNPA 4W7FA 3DQOA 1QX2A 1WRKA 4XGYA 5DRGA 3VROA 1PK0D 2ZMWA 4EDSA 3NEDA 1AJ5A 1YJ2A 1LA3A 1JC2A 4MLWA 2V53A 1F0BA 2G6XA 1DGVA 4J89A 2OS8B 4I5KA 1J7QA 1KYPA 1DF0A 3BXKA 4OJ0A 1BMOA 1QXPA 1NCYA 1A29A 3PN7B 1MXLC 3LLEA 1H8BA 3EKJA 2Z6YA 2EMNA 1K9PA 1UWOA 4ZB1A 4PE0A 2LMVA 2EC6C 2LVKA 4UTSA 3CR2A 1PSBA 4OVNF 5HKWA 1A2XA 2CXJA 4I2YA 3P28A 1YZWA 1Q80A 4PPKA 2BBNA 1CDPA 1PALA 4M2QA 2IOVA 1SPYA 3E3RA 1HQVA 3O78A 3SVOA 1HCJA 1J1EA 1S26D 3ZWHA 1KP5A 1ZMZA 1ZGPA 1EG3A 4WRIA 3SVSA 2Y4QA 2MLFC 4KGEA 5DKNA 4N1FA 2CTNA 1XFWO 2WCEA 1B7TZ 2M29A 4A4BA 2HETA 1CLBA 5EXCI 1BOCA 4PE1A 1QX7A 3BXAA 3ZULA 3I5GC 4HREE 1DGUA 2JTZA 3CGAA 1F70A 4DXQA 2A50B 1K9KA 5HKZA 4NDBA 3FWCA 3FS7A 1M39A 1CM1A 2KGRA 1KSOA 2H61C 1CB1A 3CD9A 2DD7A 4M2OA 1UUSA 1QTXA 1EMBA 1QV1A 1XAEA 1TNXA 4MRXA 2OS8C 4W7RA 1OXDA 2KYFA 3PJ5A 3JTDB 2JPTA 3WXAA 1SR6C 2YFPA 4MVFA 2F2PA 1JUOA 3ADFA 1J7PA 1BF5A 1OZSA 4W6BA 1NSHA 1VRKA 2BCAA 3H1RA 2A46A 3RLZA 4XJKA 2DD9A 3RM1A 1QIWA 3EK7A 1M31A 4W7XA 1GGWA 1KYRA 1BR1B 4W6RA 1EMLA 4AS8A 1MF8B 1QV0A 5I2QA 2QLGA 4P2YB 4IK1A 5CSJA 1K93D 1XFUO 4W6GA 1UHKA 2I94A 3KCSA 2WHTA 1CKKA 2KQYA 3SG4A 4WQ3A 1AHRA 1CMFA 1M63B 4OY4A 3DQJA 3VHTA 4IL1A 2JNFA 3I5HC 2BL0C 4B30A 4W6NA 2MLEC 2HJOA 3BUMB 2JRFA 2WNDA 2P6BB 2DDCA 3O77A 3F45A 2LUXA 4ORBB 3FIAA 2M97A 3DQDA 2SCPA 2BCXA 1WDCC 3KF9A 2G2SB 3S05A 1UHJA 2ZFDA 2VADA 4ETOA 2OKWA 2JTTA 1DF0B 2C9IA 4PPLA 4C0KA 2Y5IA 4W7CA 1K2HA 5DPHA 1EG4A 2JWWA 5AEQA 2NZ0A 4HQ9A 1QATA 2BE4A 2LHLA 4MSPA 2H61A 2CBLA 4B5YA 1XSSA 1EH2A 2KDHA 1NYAA 2M1UA 1FF1A 2LMTA 2F2OA 5KSZA 2OGRA 4IK5A 2ZNEA 1E8AA 3FWBA 2G9BA 4JPZB 3WHUB 2BBMA 1QY3A 1Q4EA 2M7LA 1K95A 2VVIA 2ZRSA 3LVDA 1CNPA 1KK7Y 2I18A 1W7TA 2L2EA 3SVCA 4A4CA 2LE9B 5KTYA 2LC5A 3U0MA 1X02A 1V1GA 3SJSA 1CDLA 3O6BA 4IK8A 1CDNA 2QT2A 2KAYA 4PDZA 2KOTA 4OQWA 4KF5C 3QRXA 2TN4A 2GGMA 1SMGA 1KFXL 2Q91A 2PXSA 3DQLA 4KEXA 3SIAA 1KSMA 4PE4A 5HZSA 2QZ0A 4MZKA 1CDMA 1RTP1 3E5VA 4YGDB 4GGFC 2POXA 2CT9A 3PALA 5F9GA 1WLZA 1XO5A 4GPLB 4EMQA 2IS9A 5HZTA 1J7OA 1Y0VH 3AKAA 3LVCA 3BQ3A 1LXFC 1CFFA 2MBXA 4YI8A 1Z1PA 4W6OA 1QASA 2ZKMX 1J55A 1DMOA 3GJ1A 4U8DA 1IJ5A 1IKUA 1TIZA 3CLNA 4L12A 3GOFA 3NF0A 1BT6A 4J8AA 4Z4MA 4W6DA 4GGNA 4FTGA 3DPWA 1J1DA 3LSAA 1ZUZA 1JBZA 4GESB 2NXQA 1IQ3A 2KBMA 3DQ5A 3DPXA 3VRQA 3EK8A 4XJKB 3SSLA 4TZAA 4J88A 5DY6A 5CSIA 2WSNA 1KK8C 3K21A 2QLGB 5JOLA 1JBYA 1C4FA 3NSLA 2LP2A 5DTXA 3LS3A 2EC6B 4DUQA 1WRZA 4GUKA 1OZOA 4W6UA 2KI6C 4D1EA 4W6LA 1DT7B 5B8IB 2L0PA 2G3DB 1XFXO 2I2RE 3VHTB 1TNQA 3SVUA 1CM4A 5DTLA 4W7AA 4HRHA 2K7CA 1DJYA 1XFZO 4MZJA 2WCBA 1KWOC 5BQLA 1AVSA 5DRFA 5EB6A 3V3DA 1ZFSA 4L13A 2LLUA 2EMDA 2EHBA 1Q73A 1YFPA 2Y1MA 1DJHA 3SVRA 1RJVA 1KK7Z 2MAZA 4KW4A 1L7ZA 1QYOA 1TTXA 3GK2A 3DQAA 2AWJA 4JQ0D 3BYAA 4N3DA 4BY4A 4KF5A 2O29A 2CCMA 4MZLA 1EL4A 3E5TA 1BR4B 1TCFA 1DJIA 4TZGA 3AAJA 1W7IB 4KGFA 5I2OA 2L98A 4GGFA 1N0YA 3PATA 2FWQA 1OMRA 1YTZC 3IF7A 3LCPC 1MOVA 2PALA 3JVTC 2H5RA 5J2OA 4PHKA 4YGAA 1QIVA 4U2VA 2KYCA 4KAGA 2MA2A 1KFXS 2AWMA 1S6CA 2HF5A 2JT0A 4AR7A 4W72A 1QYFA 2AWLA 2BKIB 2JU0A 2FJUB 4LQUA 1SR6B 1IG5A 1YX8A 4PE7A 3A4UB 2G6YA 1UHNA 2KNEA 2M8UA 5HKYA 2GW3A 5ER5A 1BODA 1Q4BA 2M7NA 1XK4C 1DVIA 1AP4A 4AQJA 2F8PA 2ZMUA 1QX5B 3OX6A 4XL5A 1ZACA 3HCMA 2K7DA 4DIRA 4Z4KA 3CZTX 1DJZA 4GFTA 5G08A 1EMKA 1FI6A 2HQ8A 1SW8A 1F8HA 2O2BA 5DTZA 4PALA 4XOVA 3AKOA 1KQMC 3O4YA 4DKMA 1IRJA 3CFHA 2WHSA 3I5HB 2BL0B 4JWQA 3U8AA 3IQOA 3M0WA 5T3IA 4ZBLA 4ZF5A 5BT0A 1SL8A 1ZUXA 1LINA 5FVFA 3RWAA 4H48A 2HGYA 4LJDC 4Q7RA 1WLMA 1GGZA 5D69A 3SG7A 3PFVA 1WDCB 2L5XB 2M1KB 4KF4A 2H5PA 3DQNA 3TUYC 1W7JB 4R1EA 3OGOA 1IH0A 1UISA 2FCEA 2A56B 5FYXA 4UPGA 4DCKA 3SSYA 2VAEA 2MHHA 1FPWA 3OB2B 2ZO7A 2YE1A 1F4OA 1LA0A 2K7OA 5CSNA 1AK8A 4EDOA 3UFZA 1NX2A 2AUCA 1C7WA 4GBAA 2HPSA 4N5XA 2JZIA 1H4BA 5DKQA 2JADA 3DVKA 3H4SE 1GQMA 2JC2A 3EK4A 5J3XA 3TMRA 4JF9A 3I5IC 5F6TA 1L2OC 2NCPA 3SG3A 5AFPA 1MWNA 1RMPA 3SSVA 1SBJA 5EBJA 5LK4A 1HT9A 1Z1QA 4HE4A 3UG0A 5LTQA 1Y1UA 1OMVA 1SCMC 2OTEA 2WISA 1B8LA 4Q7UA 1YHGA 2YDZA 4LQTA 2JULA 3BXBA 1TRFA 2R2IA 2IE2A 2KSPA 1EMGA 1NIWA 5BPJA 4W6JA 4H3NA 2EGDA 2PMYA 2DUEA 3BOWB 5AXIA 1KYSA 1K90D 1XK4A 1S1EA 3IR8A 3OB1B 2KFGA 1NWDA 1F4QA 2M0RA 2FL1A 1UHIA 2O5GA 3LVAA 4RTCA 1MYWA 4ANJA 1MXEA 3MGFA 2D8NA 3DF0B 1YRUB 3TDUA 4I5JA 3TZ1A 4E68A 3OHMB 3TDIA 2DUIA 2WCFA 1UP5A 1Y1AA 5H89A 4JC2A 2HQWA 2Z1OA 2ISDA 1KFUL 1F09A 1DTLA 3DQ1A 1BG1A 1EMCA 3I5FC 1QS7A 2V4EC 4PHNA 2HFCA 5DQMA 5DQBA 3NXAA 4ORNA 1TNPA 4Q9XA 2ZN9A 2LLTA 5JJGA 3E5WA 1F54A 1NX1A 4LJDA 1H4UA 3SG6A 1A03A 2LAPA 1SK6D 4JEOA 2AAOA 2QRFA 4CFQA 5DTYA 4NQGA 5H87A 4ZF4A 3OX5A 2Q6PA 4YBHB 2KFHA 2KQ6A 4BY5A 2A48A 2COLB 1KK8B 3CFAA 2H2KA 5EJUA 3U8PA 3KHEA 1OMDA 2G2BA 4W7DA 3SV5A 1PVBA 2G5ZB 1RFJA 2WORA 3DQHA 2K61A 2H9WA 3EVUA 4PPJA 1XMZA 2GW4B 1RMOA 4H3LA 4JGEA 1B8CA 4W6IA 4MBEA 3PIBA 2ZO6A 2C9JA 1FW4A 1KWOB 4OKHA 1YUTA 3VRRA 1DJWA 4Q7TA 3A8RA 2BECA 3AI5A 2MRDA
chains in the Genus database with same CATH superfamily
4PFEA 1XFVO 1S3PA 5DU0A 4OGSA 2K7BA 3DVJA 4R6DA 1OOJA 2FOTA 4KPIA 3ZUFA 1UHHA 2K2AA 3I19A 4P1QA 1B47A 2PVBA 1OOIX 4YGCB 4M2PA 2H5OA 1Z2CB 4W73A 1CLMA 2ICRA 4W74A 2LVIA 1XVJA 5FHVA 5AANA 5H88A 4N1GA 2K8MB 3CR4X 5BTTA 1S6JA 2Z6XA 3SSHA 4NDDA 3PM2A 4ZIOA 3JVTB 4DXNA 5HYDA 4OV2A 2FCDA 4HQCA 3CR5X 3TMTA 2KBIA 2DOQA 1C3YA 4PHMA 1JC1A 3G9AA 4H3MA 1YHIA 2QLIA 4BDUA 2QU1A 2Q57A 4XVPA 3L4LA 3DQ9A 4MRYA 1W9ZA 1S6IA 2H5QA 5LTPA 2V4EA 4AOMA 3KCTA 3DVEA 2Y1NA 3D75A 1K9UA 2L50A 1J7RA 3SG5A 3SG2A 3D76A 5AQBB 1S6ZA 2IB6A 3BUXB 4W6SA 3BFAA 1NX3A 3BX9A 4H47A 5DKRA 2GGZA 5HZUA 3BUNB 2OTBA 3WLCA 1KFUS 4IK3A 3MSEB 2SASA 1YVHA 2KI4B 1SCVA 5FI7A 4DS7A 3GJ2A 4ZCUA 2AH8A 1TNWA 3DQKA 2ZNDA 1R6PA 2LV7A 4QJ4B 1EJ3A 2L2CA 3LL8B 4DXPA 2K60A 4ORAB 2OKYA 1N65A 1Y6WA 2KLEA 1B1GA 3EKHA 2PASA 2BKHB 1U5IB 2KAVA 1MR8A 1MHOA 1NX0A 3NSOA 1IGVA 5IBWA 1MUXA 3KEVA 5EHUA 4IZNA 1JSAA 1KQMB 2RH7A 1IWQA 1D1OA 1RWYA 1EMEA 1ALWA 4KW8A 3BOWA 4IK4A 3W1DA 3DQEA 2LUCA 4CFRA 3L4AA 2F3ZA 1KCYA 5TNCA 1JFKA 2JQ6A 2JT3A 3ZUJA 5PALA 3PM8A 1DJXA 1JWDA 1S36A 3DF0A 4IK9A 2NLNA 3CBEA 3TUYB 2I7AA 3LK1A 2AWKA 3SRYA 1XA9A 1CFDA 5I8NA 1SNLA 1NUBA 4XOWA 4Q04A 4Q9WA 1SYMA 4HVFA 2OTGC 4TNCA 4ZCVA 3IP2A 2YE0A 3WCKA 3WHTB 3NT3A 4EULA 3CGLA 3A8SA 3CB9A 3SVNA 4YGEB 5FVIA 2A4JA 2B1UA 3RWTA 2JOJA 1TOPA 2EMOA 1Q4DA 1QVIY 4GAOA 2A53B 3I5IB 4ZINA 3ZTFA 1UURA 4DXOA 1L2OB 3SS0A 3DQFA 3CTNA 1ZGOA 2B3PA 2KI4C 2P71A 2VRGA 4OR9B 2BTJA 1Y1XA 2G3OA 2LVJA 4QJ5B 1OXEA 4NDCA 2QEHA 3EVPA 1SCMB 3NGVA 1CMGA 3M24A 1A75A 1PVAA 3DQ3A 5HW9A 2H8QA 4C0LA 4ZF3A 2KI6D 3LF3A 4LJCA 2LCPA 1JF2A 1RECA 4RYWA 1AJ4A 3DQMA 2QACA 1KQVA 1W7SA 5KTGA 5K89A 5LTRA 1YUSA 1C07A 3WNXB 5BTTB 2PSRA 1EMFA 1MOUA 5HLOA 2B3QA 4KA9A 3TS5C 2WHUA 2WCHA 1ZOTB 4R6BA 1R2UA 4DXIA 1QJTA 4JRBA 2VVJA 4W75A 2LHIA 2GX2A 1ALVA 4L1IA 4CIDA 2L4HA 2H6VA 3ST0A 3I5FB 1PRWA 3BXCA 2V4EB 4HQ8A 1K94A 5HBDA 2ZN8A 1GFLA 2Y0GA 1ZGQA 4ZFSA 1SSEB 2GTEA 1M45A 1EMMA 2O60A 3CWGA 4LW5A 1G4YR 4EN1A 4CPVA 1K96A 1QXTA 4GOBA 2Q4UA 1YRTB 3SVBA 5HLVA 1XFYO 3IQQA 3D0YA 3DQ4A 3DQCA 1SY9A 3PJ7A 2GX0A 2A52B 2G16B 2E30A 1WY9A 1LVCD 3ICBA 2K2FA 1OOGA 2PRUA 4JFGA 4W6HA 3OSRA 2WSOA 1OXFA 3CD1A 3PN7C 1CLLA 1DQEA 1GJYA 2PXWA 1XFRA 1G33A 4W6TA 2GV5A 2DUGA 1G8IA 3GB3A 4W6FA 5DPIA 2IB5A 4MEWA 3NT9A 1OE9B 1JF0A 5GQQC 3DQ2A 1B9AA 5EXUA 1GGXA 1Q4AA 1QVIZ 3CABA 3GK4X 2KGBC 3U0LA 4OHSA 2HPWA 2BCBA 5HZOA 1CFCA 2QLEA 2AHAA 1RK9A 4W76A 4AQIA 3S0GA 1TWOA 3NSKA 4ORCB 3EVVA 4MN0A 1U5IA 3O2PA 4I5LB 2LANA 1AUIB 4JKTA 1BJFA 2F3YA 4W6KA 3PJBA 2DUFA 2LMUA 3DQIA 3SSPA 2WC8A 3QMEA 5FVGA 2L51A 5ER4X 2AMIA 4W6AA 3VRPA 5AERA 4ICBA 3NHIA 3D10A 4P76A 1CV7A 1F55A 3H1OA 2L4IA 2A47A 4FQOA 1NPQA 1EMAA 3DQ6A 4LJBA 4CLNA 2QPTA 1ODBA 4OCIA 3AI4A 3SS5A 4DRWA 3DZTA 1GL4A 3BUWB 1LKJA 1F71A 1XQMA 1QLKA 1CFPA 2WCJA 1XYDA 3JTDC 2ARLA 3ST3A 2RGIA 3VGOA 4XYNA 2DUHA 2JNXA 5CPVA 1G7KA 1S5GY 2VZXA 1BLQA 1RRXA 4INXA 1A75B 3AKBA 4IJ7A 3VK1A 2G6EA 1YUUA 3PLFB 1DJGA 2WCMA 4W69A 2BE6A 2QDIA 3FE8A 5DPGA 1RM9A 4USLA 4YI9A 1YJFA 1IJ6A 2P4MA 5HGEA 3GEXA 4DXMA 1SKTA 4YRUA 1Q4CA 3DQUA 1NP8A 1TUZA 3BUOB 2Z6ZA 2LVVA 3GL4A 1YHHA 1RMMA 1QYQA 2WURA 3R72A 4WQ2A 1OQPA 3PSRA 5FI2A 4FQTA 3TDZA 1NCZA 1RROA 1YR5A 2KPHA 4L9MA 3SIBA 2LNKA 3SSTA 1N2DA 2JXLA 2ZRTA 2OJKA 1IQ5A 2L5YA 2JT8A 3C1VA 3DPZA 4W6CA 2MJWB 3SVDA 3NEZA 4PT1A 2M3WA 4KYNA 1SRAA 4F0ZB 1SL7A 1TCOB 1B4CA 2KAXA 3WLDA 3K1KA 2HCGA 4I5NB 5KU1A 3SVEA 4DKNA 1PULA 4GF6B 2LM5A 3D0YB 1JC0A 1OSAA 1SL9A 2O24A 3OSQA 2WIQA 1QLSA 3DD4A 4KW9A 1B9CA 2OTGB 3CDNA 3IVTA 3Q8IA 4W6MA 5D7FA 4HRGA 1M46A 4W7EA 1DELA 4GNKB 1TN4A 2M49B 4HSZA 5EXBA 3ST2A 1EXRA 4NWSA 1W7UA 1BFPA 2WOSA 2QLHA 3LF4B 2HGDA 1MQ1A 2LP3A 3GK1A 5EB7A 3O4XA 2E6WA 1BU3A 5CSFA 3DQ8A 3U0KA 2NCOA 3B7AA 4W77A 1K8UA 3U8CA 4YGBB 2KHNA 3NSIA 3R1PA 1FI5A 3U0NA 3VICA 5I2LA 3EVRA 1B7TY 4PHJA 5DPJA 2A54B 1A4PA 1C7VA 2FZUA 1YURA 1NCXA 3DY9A 1S5GZ 3W1CA 1YVLA 4PCWA 4QJ3B 4B30B 3HX4A 4P5OE 3ZNIA 4W6PA 3ST4A 1FBVA 2KFFA 1CTRA 3P8UA 1H6RA 3M22A 4RYSA 3DVMA 3AAKA 2VVHA 3VRNA 3OP0A 2M9GA 2OPOA 2HQZA 1V1FA 3CS1A 5DICA 1JFJA 2QEVA 4C0JA 4INWA 2K0JA 2F33A 1B8RA 3SSKA 3TS5B 1WRLA 3DXLA 1PSRA 2WCKA 2HQKA 3DQ7A 3LK0A 3CFFA 2JXCA 2HRSA 2LLSA 1HUYA 3I5GB 1YX7A 2DDDA 3LA1A 1XA5A 1JBAA 3KPXA 3KO0A 3ED8A 2CNPA 4W7FA 3DQOA 2JPOA 1QX2A 1WRKA 4XGYA 5DRGA 3VROA 1PK0D 3BJHA 2ZMWA 4EDSA 3NEDA 1AJ5A 1YJ2A 1LA3A 1JC2A 3CYZA 4MLWA 2V53A 3RZSA 1F0BA 3D78A 2G6XA 1DGVA 4J89A 2OS8B 4I5KA 1J7QA 3VB1A 1KYPA 1DF0A 3BXKA 4OJ0A 1BMOA 1QXPA 1NCYA 1A29A 3PN7B 1MXLC 3LLEA 1H8BA 3EKJA 2Z6YA 2EMNA 1K9PA 1UWOA 3K1EA 4ZB1A 2BAPA 4PE0A 2LMVA 2EC6C 2LVKA 4UTSA 3CR2A 1PSBA 4OVNF 5HKWA 3S0DA 1A2XA 2CXJA 4I2YA 3P28A 3CZ2A 1YZWA 1Q80A 4PPKA 2H8VA 3D77A 2BBNA 1CDPA 1PALA 4M2QA 2IOVA 1SPYA 3E3RA 1HQVA 3O78A 3SVOA 1HCJA 1J1EA 2WC5A 1S26D 3OGNA 3ZWHA 1KP5A 1ZMZA 1ZGPA 1EG3A 4WRIA 3SVSA 2Y4QA 2MLFC 4KGEA 5DKNA 4N1FA 2CTNA 1XFWO 2WCEA 1B7TZ 2M29A 4A4BA 2HETA 1CLBA 5EXCI 2PQLA 5FI6A 1BOCA 4PE1A 1QX7A 3BXAA 3ZULA 3I5GC 4HREE 1DGUA 2JTZA 3CGAA 1F70A 3CZ0A 4DXQA 1ORGA 2A50B 1K9KA 5HKZA 4NDBA 3FWCA 3FS7A 2QEBA 1M39A 1CM1A 2KGRA 1KSOA 2H61C 1CB1A 3CD9A 2DD7A 4M2OA 1UUSA 1QTXA 1EMBA 1QV1A 1XAEA 1TNXA 3DYEA 4MRXA 2OS8C 4W7RA 1OXDA 2KYFA 3PJ5A 2KLDA 3JTDB 2JPTA 3WXAA 1SR6C 2YFPA 4MVFA 2F2PA 3V2LA 1JUOA 3ADFA 1J7PA 1BF5A 1OZSA 4W6BA 1NSHA 1VRKA 3R1VA 2BCAA 3H1RA 1OOFA 2A46A 3RLZA 4XJKA 2DD9A 3RM1A 1QIWA 3EK7A 1M31A 4W7XA 1GGWA 1KYRA 1BR1B 4W6RA 1EMLA 4AS8A 1MF8B 1QV0A 5I2QA 2QLGA 4P2YB 4IK1A 5CSJA 1K93D 1XFUO 4W6GA 1UHKA 2I94A 3KCSA 1Z4HA 2WHTA 1CKKA 2KQYA 3SG4A 4WQ3A 5I94A 2FJYA 1AHRA 1CMFA 1M63B 4OY4A 3DQJA 3VHTA 4IL1A 2JNFA 3I5HC 2BL0C 4B30A 1OOHA 4W6NA 2MLEC 3BFHA 2HJOA 3BUMB 2JRFA 3S0FA 2WNDA 2P6BB 2DDCA 3O77A 3F45A 2LUXA 4ORBB 3FIAA 2M97A 3DQDA 2SCPA 2BCXA 1WDCC 3KF9A 2G2SB 3S05A 1UHJA 2ZFDA 2VADA 4ETOA 2OKWA 2JTTA 1DF0B 2C9IA 3EG5B 4PPLA 4C0KA 2Y5IA 4W7CA 1K2HA 5DPHA 3S0BA 1EG4A 2JWWA 5AEQA 2NZ0A 4HQ9A 3CZ1A 1QATA 2BE4A 1DC1A 2LHLA 4MSPA 2H61A 2CBLA 4B5YA 1XSSA 1EH2A 2KDHA 1NYAA 2M1UA 1FF1A 2LMTA 1QWVA 2F2OA 5KSZA 2OGRA 4IK5A 2ZNEA 1E8AA 3FWBA 2G9BA 4JPZB 1LS8A 3WHUB 2BBMA 1QY3A 1Q4EA 2M7LA 1K95A 2VVIA 2ZRSA 3LVDA 1CNPA 1KK7Y 2I18A 1W7TA 2L2EA 3SVCA 4A4CA 2LE9B 5KTYA 2LC5A 3U0MA 1X02A 1V1GA 3SJSA 1CDLA 3O6BA 4IK8A 1CDNA 3OBVA 2KAYA 2QT2A 4JD9A 4PDZA 2KOTA 4OQWA 4KF5C 3QRXA 2TN4A 2GGMA 1SMGA 1KFXL 2Q91A 2PXSA 3DQLA 4KEXA 3SIAA 1KSMA 4PE4A 5HZSA 2QZ0A 4MZKA 1CDMA 1RTP1 3E5VA 4YGDB 4GGFC 2POXA 2CT9A 3PALA 5F9GA 1WLZA 1XO5A 4GPLB 4EMQA 2IS9A 5HZTA 1J7OA 1Y0VH 3AKAA 3LVCA 3BQ3A 1LXFC 1CFFA 2MBXA 4YI8A 1Z1PA 4W6OA 1QASA 2ZKMX 1J55A 1DMOA 3GJ1A 4U8DA 1IJ5A 1IKUA 1TIZA 3CLNA 4L12A 3GOFA 3NF0A 1BT6A 4J8AA 4Z4MA 4W6DA 4GGNA 4FTGA 3DPWA 1J1DA 3LSAA 1ZUZA 1OW4A 1JBZA 2NXQA 1IQ3A 4GESB 2KBMA 3DQ5A 3DPXA 3VRQA 3EK8A 4XJKB 3SSLA 4TZAA 4J88A 5DY6A 5CSIA 2WSNA 1KK8C 3K21A 2QLGB 5JOLA 1JBYA 1C4FA 3NSLA 2LP2A 3D74A 5DTXA 3LS3A 2EC6B 4DUQA 1WRZA 4GUKA 1OZOA 4W6UA 2KI6C 4D1EA 4W6LA 1DT7B 5B8IB 2L0PA 3R1OA 2G3DB 1XFXO 2I2RE 3BFBA 3VHTB 1TNQA 3SVUA 1CM4A 5DTLA 4W7AA 4HRHA 2K7CA 2YGUA 1DJYA 3S0AA 1XFZO 4MZJA 2WCBA 1KWOC 5BQLA 1AVSA 5DRFA 5EB6A 3V3DA 1ZFSA 4L13A 2LLUA 2EMDA 2EHBA 1Q73A 1YFPA 2Y1MA 1DJHA 3SVRA 1RJVA 1KK7Z 2MAZA 4KW4A 1L7ZA 1QYOA 1TTXA 3GK2A 5HL1A 3DQAA 2AWJA 4JQ0D 3BYAA 4N3DA 4BY4A 4KF5A 2O29A 2CCMA 4MZLA 2P70A 1EL4A 3E5TA 1BR4B 1TCFA 1DJIA 4TZGA 3AAJA 1W7IB 4KGFA 3NHTA 5I2OA 2WCLA 2L98A 4GGFA 4F7FA 1N0YA 3PATA 2FWQA 1OMRA 1YTZC 3IF7A 3LCPC 1MOVA 2PALA 3JVTC 2H5RA 5J2OA 4PHKA 3SS3A 4YGAA 1QIVA 4U2VA 2KYCA 4KAGA 2MA2A 2QEOA 1KFXS 2AWMA 1S6CA 2HF5A 5EL2A 2JT0A 4AR7A 4W72A 1QYFA 2AWLA 2BKIB 2JU0A 2FJUB 3S0EA 4LQUA 1SR6B 3B86A 1IG5A 1YX8A 4PE7A 3A4UB 2G6YA 1UHNA 2KNEA 3SS4A 2M8UA 5HKYA 2GW3A 5ER5A 1BODA 1Q4BA 2M7NA 1AP4A 1XK4C 1DVIA 4AQJA 2F8PA 2ZMUA 1QX5B 3OX6A 4XL5A 1ZACA 3HCMA 2K7DA 1P28A 4DIRA 4Z4KA 3CZTX 1DJZA 4GFTA 1TUJA 5G08A 1EMKA 1FI6A 2HQ8A 1SW8A 1DEKA 1F8HA 2O2BA 5DTZA 4PALA 4XOVA 3AKOA 1KQMC 3O4YA 4DKMA 1IRJA 3CFHA 2WHSA 3I5HB 2BL0B 4JWQA 3U8AA 3IQOA 3M0WA 5T3IA 4ZBLA 4ZF5A 3L47A 5BT0A 1SL8A 1ZUXA 1LINA 5FVFA 3RWAA 4H48A 2HGYA 4LJDC 4Q7RA 1WLMA 1GGZA 3N7HA 5D69A 3SG7A 3PFVA 1WDCB 2L5XB 2M1KB 4KF4A 2H5PA 3DQNA 3TUYC 1W7JB 4R1EA 3OGOA 1IH0A 1UISA 2FCEA 5D3OA 2A56B 5FYXA 4UPGA 4DCKA 3SSYA 2WC6A 2VAEA 2MHHA 1FPWA 3OB2B 2ZO7A 3B6XA 1GM0A 1T14A 2YE1A 1F4OA 1LA0A 2K7OA 3D73A 5CSNA 1AK8A 4EDOA 3UFZA 1NX2A 2AUCA 1C7WA 4GBAA 2HPSA 4N5XA 2JZIA 1H4BA 5DKQA 2JADA 3DVKA 3H4SE 1GQMA 2JC2A 3EK4A 5J3XA 3TMRA 4JF9A 3I5IC 5F6TA 1L2OC 2NCPA 3SG3A 5AFPA 3FE6A 1RMPA 1MWNA 3SSVA 1SBJA 5EBJA 5LK4A 1HT9A 1Z1QA 4HE4A 3UG0A 1C3ZA 5LTQA 1Y1UA 1OMVA 1SCMC 2OTEA 2WISA 3PJIA 1B8LA 4Q7UA 1YHGA 2YDZA 4LQTA 2JULA 3BXBA 1TRFA 2R2IA 2IE2A 2KSPA 1EMGA 1NIWA 5BPJA 4W6JA 4H3NA 1IIOA 2EGDA 2PMYA 2DUEA 3BOWB 5AXIA 1KYSA 1K90D 1XK4A 1S1EA 3IR8A 3OB1B 2KFGA 1NWDA 1F4QA 2M0RA 2FL1A 4OZDA 1UHIA 2O5GA 3LVAA 3B87A 4RTCA 1MYWA 4ANJA 1MXEA 3MGFA 2D8NA 3DF0B 1YRUB 3TDUA 4I5JA 3TZ1A 3UNWA 4E68A 3OHMB 3TDIA 2DUIA 2WCFA 1UP5A 1Y1AA 5H89A 4JC2A 2HQWA 2Z1OA 2ISDA 1KFUL 1F09A 1DTLA 3DQ1A 1BG1A 1EMCA 3I5FC 1QS7A 2V4EC 4PHNA 2HFCA 5DQMA 5DQBA 3NXAA 4ORNA 1TNPA 4Q9XA 2ZN9A 2LLTA 5JJGA 3E5WA 1F54A 1NX1A 4LJDA 1H4UA 3SG6A 1A03A 2LAPA 1SK6D 4JEOA 2AAOA 2ERBA 2QRFA 4CFQA 5DTYA 4NQGA 5H87A 4ZF4A 3OX5A 2Q6PA 3FE9A 4YBHB 2KFHA 2KQ6A 4BY5A 2A48A 2PYQA 2COLB 1KK8B 3CFAA 2H2KA 5EJUA 3U8PA 3KHEA 2BNXA 1OMDA 2G2BA 3UO9A 4W7DA 3SV5A 1PVBA 2G5ZB 1RFJA 2WORA 3DQHA 2K61A 2H9WA 3EVUA 4PPJA 1XMZA 2GW4B 1RMOA 4H3LA 4JGEA 1B8CA 4W6IA 4MBEA 3PIBA 2ZO6A 2C9JA 1FW4A 3B88A 1KWOB 4OKHA 1YUTA 3VRRA 1DJWA 4Q7TA 3A8RA 2BECA 3AI5A 2MRDA
chains in the Genus database with same CATH topology
4PFEA 1XFVO 1S3PA 5DU0A 4OGSA 2K7BA 3DVJA 4R6DA 1OOJA 2FOTA 4KPIA 3ZUFA 1UHHA 2K2AA 3I19A 4P1QA 1B47A 2PVBA 4YGCB 4M2PA 2H5OA 4W73A 1CLMA 2ICRA 4W74A 2LVIA 1XVJA 5FHVA 5AANA 5H88A 4N1GA 2K8MB 3CR4X 5BTTA 1S6JA 2Z6XA 3SSHA 4NDDA 4ZIOA 3JVTB 4DXNA 5HYDA 4OV2A 2FCDA 4HQCA 3CR5X 3TMTA 2KBIA 2DOQA 4PHMA 1JC1A 3G9AA 4H3MA 1YHIA 2QLIA 4BDUA 2QU1A 2Q57A 4XVPA 3DQ9A 4MRYA 1S6IA 2H5QA 5LTPA 2V4EA 4AOMA 3KCTA 3DVEA 2Y1NA 1K9UA 2L50A 1J7RA 3SG5A 3SG2A 5AQBB 1S6ZA 2IB6A 3BUXB 4W6SA 1NX3A 3BX9A 4H47A 5DKRA 2GGZA 5HZUA 3BUNB 2OTBA 3WLCA 1KFUS 4IK3A 3MSEB 2SASA 1YVHA 2KI4B 1SCVA 4DS7A 3GJ2A 4ZCUA 2AH8A 1TNWA 3DQKA 2ZNDA 1R6PA 2LV7A 4QJ4B 1EJ3A 3LL8B 4DXPA 4ORAB 2OKYA 1N65A 1Y6WA 1B1GA 3EKHA 2PASA 2BKHB 1U5IB 2KAVA 1MR8A 1MHOA 1NX0A 3NSOA 1IGVA 5IBWA 1MUXA 3KEVA 5EHUA 4IZNA 1JSAA 1KQMB 2RH7A 1IWQA 1D1OA 1RWYA 1EMEA 1ALWA 4KW8A 3BOWA 4IK4A 3W1DA 3DQEA 2LUCA 4CFRA 2F3ZA 1KCYA 5TNCA 1JFKA 2JQ6A 2JT3A 3ZUJA 5PALA 3PM8A 1DJXA 1JWDA 1S36A 3DF0A 4IK9A 2NLNA 3CBEA 3TUYB 2I7AA 3LK1A 2AWKA 3SRYA 1XA9A 1CFDA 5I8NA 1SNLA 1NUBA 4XOWA 4Q04A 4Q9WA 1SYMA 4HVFA 2OTGC 4TNCA 4ZCVA 3IP2A 2YE0A 3WCKA 3WHTB 3NT3A 4EULA 3CGLA 3A8SA 3CB9A 3SVNA 4YGEB 5FVIA 2A4JA 2B1UA 3RWTA 2JOJA 1TOPA 2EMOA 1Q4DA 1QVIY 4GAOA 2A53B 3I5IB 4ZINA 3ZTFA 1UURA 4DXOA 1L2OB 3SS0A 3DQFA 3CTNA 1ZGOA 2B3PA 2KI4C 4OR9B 2VRGA 2BTJA 1Y1XA 2G3OA 2LVJA 4QJ5B 1OXEA 4NDCA 3EVPA 1SCMB 1CMGA 3M24A 1A75A 1PVAA 3DQ3A 5HW9A 2H8QA 4C0LA 4ZF3A 2KI6D 3LF3A 4LJCA 2LCPA 1JF2A 1RECA 4RYWA 1AJ4A 3DQMA 2QACA 1KQVA 1W7SA 5KTGA 5K89A 5LTRA 1YUSA 1C07A 3WNXB 5BTTB 2PSRA 1EMFA 1MOUA 5HLOA 2B3QA 4KA9A 3TS5C 2WHUA 1ZOTB 4R6BA 1R2UA 4DXIA 1QJTA 4JRBA 2VVJA 4W75A 2LHIA 2GX2A 1ALVA 4L1IA 4CIDA 2L4HA 2H6VA 3ST0A 3I5FB 1PRWA 3BXCA 2V4EB 4HQ8A 1K94A 5HBDA 2ZN8A 1GFLA 2Y0GA 1ZGQA 4ZFSA 1M45A 1EMMA 2O60A 3CWGA 4LW5A 1G4YR 4EN1A 4CPVA 1K96A 1QXTA 4GOBA 2Q4UA 1YRTB 3SVBA 5HLVA 1XFYO 3IQQA 3D0YA 3DQ4A 3DQCA 1SY9A 3PJ7A 2GX0A 2A52B 2G16B 2E30A 1WY9A 1LVCD 3ICBA 2K2FA 2PRUA 4JFGA 4W6HA 3OSRA 2WSOA 1OXFA 3CD1A 3PN7C 1CLLA 1GJYA 2PXWA 4W6TA 1G33A 2GV5A 2DUGA 1G8IA 3GB3A 4W6FA 5DPIA 2IB5A 4MEWA 3NT9A 1OE9B 1JF0A 5GQQC 3DQ2A 1B9AA 5EXUA 1GGXA 1Q4AA 1QVIZ 3GK4X 2KGBC 3U0LA 4OHSA 2HPWA 2BCBA 5HZOA 1CFCA 2QLEA 2AHAA 1RK9A 4W76A 4AQIA 3NSKA 4ORCB 3EVVA 4MN0A 1U5IA 3O2PA 4I5LB 2LANA 1AUIB 1BJFA 2F3YA 4W6KA 3PJBA 2DUFA 2LMUA 3DQIA 3SSPA 2WC8A 5FVGA 2L51A 5ER4X 2AMIA 4W6AA 3VRPA 5AERA 4ICBA 3D10A 4P76A 1CV7A 1F55A 3H1OA 2L4IA 2A47A 4FQOA 1NPQA 1EMAA 3DQ6A 4LJBA 4CLNA 2QPTA 1ODBA 4OCIA 3AI4A 4DRWA 1GL4A 3BUWB 1LKJA 1F71A 1XQMA 1QLKA 1CFPA 1XYDA 3JTDC 2ARLA 3ST3A 2RGIA 3VGOA 4XYNA 2DUHA 2JNXA 5CPVA 1G7KA 1S5GY 2VZXA 1BLQA 1RRXA 1A75B 3AKBA 3VK1A 2G6EA 1YUUA 3PLFB 1DJGA 4W69A 2BE6A 5DPGA 1RM9A 4USLA 4YI9A 1YJFA 1IJ6A 2P4MA 5HGEA 3GEXA 4DXMA 1SKTA 4YRUA 1Q4CA 3DQUA 1NP8A 3BUOB 2Z6ZA 2LVVA 3GL4A 1YHHA 1RMMA 1QYQA 2WURA 4WQ2A 1OQPA 3PSRA 1NCZA 1RROA 4L9MA 1YR5A 3SIBA 3TDZA 2LNKA 3SSTA 1N2DA 2JXLA 2ZRTA 2OJKA 1IQ5A 2JT8A 3C1VA 3DPZA 4W6CA 2MJWB 3SVDA 3NEZA 2M3WA 1SRAA 4F0ZB 1SL7A 1TCOB 1B4CA 2KAXA 3WLDA 3K1KA 2HCGA 4I5NB 5KU1A 3SVEA 4DKNA 1PULA 4GF6B 2LM5A 3D0YB 1JC0A 1OSAA 1SL9A 2O24A 3OSQA 2WIQA 1QLSA 3DD4A 4KW9A 1B9CA 2OTGB 4W6MA 5D7FA 4HRGA 1M46A 4W7EA 4GNKB 1TN4A 2M49B 4HSZA 5EXBA 3ST2A 1EXRA 4NWSA 1W7UA 1BFPA 2WOSA 2QLHA 3LF4B 2HGDA 1MQ1A 2LP3A 3GK1A 5EB7A 2E6WA 1BU3A 5CSFA 3DQ8A 3U0KA 2NCOA 4W77A 1K8UA 3U8CA 4YGBB 2KHNA 3NSIA 1FI5A 3U0NA 3VICA 5I2LA 3EVRA 1B7TY 4PHJA 5DPJA 2A54B 1A4PA 1C7VA 2FZUA 1YURA 1NCXA 1S5GZ 3W1CA 1YVLA 4PCWA 4QJ3B 4B30B 3HX4A 4P5OE 3ZNIA 4W6PA 3ST4A 1FBVA 2KFFA 1CTRA 3P8UA 1H6RA 3M22A 4RYSA 3DVMA 3AAKA 2VVHA 3VRNA 3OP0A 2M9GA 2OPOA 2HQZA 1V1FA 3CS1A 1JFJA 4C0JA 2K0JA 2F33A 1B8RA 3SSKA 3TS5B 1WRLA 1PSRA 2HQKA 3DQ7A 3LK0A 3CFFA 2JXCA 2HRSA 2LLSA 1HUYA 3I5GB 1YX7A 2DDDA 3LA1A 1XA5A 1JBAA 3KPXA 3KO0A 3ED8A 2CNPA 4W7FA 3DQOA 1QX2A 1WRKA 4XGYA 5DRGA 3VROA 1PK0D 2ZMWA 4EDSA 3NEDA 1AJ5A 1YJ2A 1LA3A 1JC2A 4MLWA 2V53A 1F0BA 2G6XA 1DGVA 4J89A 2OS8B 4I5KA 1J7QA 1KYPA 1DF0A 3BXKA 4OJ0A 1BMOA 1QXPA 1NCYA 1A29A 3PN7B 1MXLC 3LLEA 1H8BA 3EKJA 2Z6YA 2EMNA 1K9PA 1UWOA 4ZB1A 4PE0A 2LMVA 2EC6C 2LVKA 4UTSA 3CR2A 1PSBA 4OVNF 5HKWA 1A2XA 2CXJA 4I2YA 3P28A 1YZWA 1Q80A 4PPKA 2BBNA 1CDPA 1PALA 4M2QA 2IOVA 1SPYA 3E3RA 1HQVA 3O78A 3SVOA 1HCJA 1J1EA 1S26D 3ZWHA 1KP5A 1ZMZA 1ZGPA 1EG3A 4WRIA 3SVSA 2Y4QA 2MLFC 4KGEA 5DKNA 4N1FA 2CTNA 1XFWO 2WCEA 1B7TZ 2M29A 4A4BA 2HETA 1CLBA 5EXCI 1BOCA 4PE1A 1QX7A 3BXAA 3ZULA 3I5GC 4HREE 1DGUA 2JTZA 3CGAA 1F70A 4DXQA 2A50B 1K9KA 5HKZA 4NDBA 3FWCA 3FS7A 1M39A 1CM1A 2KGRA 1KSOA 2H61C 1CB1A 3CD9A 2DD7A 4M2OA 1UUSA 1QTXA 1EMBA 1QV1A 1XAEA 1TNXA 4MRXA 2OS8C 4W7RA 1OXDA 2KYFA 3PJ5A 3JTDB 2JPTA 3WXAA 1SR6C 2YFPA 4MVFA 2F2PA 1JUOA 3ADFA 1J7PA 1BF5A 1OZSA 4W6BA 1NSHA 1VRKA 2BCAA 3H1RA 2A46A 3RLZA 4XJKA 2DD9A 3RM1A 1QIWA 3EK7A 1M31A 4W7XA 1GGWA 1KYRA 1BR1B 4W6RA 1EMLA 4AS8A 1MF8B 1QV0A 5I2QA 2QLGA 4P2YB 4IK1A 5CSJA 1K93D 1XFUO 4W6GA 1UHKA 2I94A 3KCSA 2WHTA 1CKKA 2KQYA 3SG4A 4WQ3A 1AHRA 1CMFA 1M63B 4OY4A 3DQJA 3VHTA 4IL1A 2JNFA 3I5HC 2BL0C 4B30A 4W6NA 2MLEC 2HJOA 3BUMB 2JRFA 2WNDA 2P6BB 2DDCA 3O77A 3F45A 2LUXA 4ORBB 3FIAA 2M97A 3DQDA 2SCPA 2BCXA 1WDCC 3KF9A 2G2SB 3S05A 1UHJA 2ZFDA 2VADA 4ETOA 2OKWA 2JTTA 1DF0B 2C9IA 4PPLA 4C0KA 2Y5IA 4W7CA 1K2HA 5DPHA 1EG4A 2JWWA 5AEQA 2NZ0A 4HQ9A 1QATA 2BE4A 2LHLA 4MSPA 2H61A 2CBLA 4B5YA 1XSSA 1EH2A 2KDHA 1NYAA 2M1UA 1FF1A 2LMTA 2F2OA 5KSZA 2OGRA 4IK5A 2ZNEA 1E8AA 3FWBA 2G9BA 4JPZB 3WHUB 2BBMA 1QY3A 1Q4EA 2M7LA 1K95A 2VVIA 2ZRSA 3LVDA 1CNPA 1KK7Y 2I18A 1W7TA 2L2EA 3SVCA 4A4CA 2LE9B 5KTYA 2LC5A 3U0MA 1X02A 1V1GA 3SJSA 1CDLA 3O6BA 4IK8A 1CDNA 2QT2A 2KAYA 4PDZA 2KOTA 4OQWA 4KF5C 3QRXA 2TN4A 2GGMA 1SMGA 1KFXL 2Q91A 2PXSA 3DQLA 4KEXA 3SIAA 1KSMA 4PE4A 5HZSA 2QZ0A 4MZKA 1CDMA 1RTP1 3E5VA 4YGDB 4GGFC 2POXA 2CT9A 3PALA 5F9GA 1WLZA 1XO5A 4GPLB 4EMQA 2IS9A 5HZTA 1J7OA 1Y0VH 3AKAA 3LVCA 3BQ3A 1LXFC 1CFFA 2MBXA 4YI8A 1Z1PA 4W6OA 1QASA 2ZKMX 1J55A 1DMOA 3GJ1A 4U8DA 1IJ5A 1IKUA 1TIZA 3CLNA 4L12A 3GOFA 3NF0A 1BT6A 4J8AA 4Z4MA 4W6DA 4GGNA 4FTGA 3DPWA 1J1DA 3LSAA 1ZUZA 1JBZA 4GESB 2NXQA 1IQ3A 2KBMA 3DQ5A 3DPXA 3VRQA 3EK8A 4XJKB 3SSLA 4TZAA 4J88A 5DY6A 5CSIA 2WSNA 1KK8C 3K21A 2QLGB 5JOLA 1JBYA 1C4FA 3NSLA 2LP2A 5DTXA 3LS3A 2EC6B 4DUQA 1WRZA 4GUKA 1OZOA 4W6UA 2KI6C 4D1EA 4W6LA 1DT7B 5B8IB 2L0PA 2G3DB 1XFXO 2I2RE 3VHTB 1TNQA 3SVUA 1CM4A 5DTLA 4W7AA 4HRHA 2K7CA 1DJYA 1XFZO 4MZJA 2WCBA 1KWOC 5BQLA 1AVSA 5DRFA 5EB6A 3V3DA 1ZFSA 4L13A 2LLUA 2EMDA 2EHBA 1Q73A 1YFPA 2Y1MA 1DJHA 3SVRA 1RJVA 1KK7Z 2MAZA 4KW4A 1L7ZA 1QYOA 1TTXA 3GK2A 3DQAA 2AWJA 4JQ0D 3BYAA 4N3DA 4BY4A 4KF5A 2O29A 2CCMA 4MZLA 1EL4A 3E5TA 1BR4B 1TCFA 1DJIA 4TZGA 3AAJA 1W7IB 4KGFA 5I2OA 2L98A 4GGFA 1N0YA 3PATA 2FWQA 1OMRA 1YTZC 3IF7A 3LCPC 1MOVA 2PALA 3JVTC 2H5RA 5J2OA 4PHKA 4YGAA 1QIVA 4U2VA 2KYCA 4KAGA 2MA2A 1KFXS 2AWMA 1S6CA 2HF5A 2JT0A 4AR7A 4W72A 1QYFA 2AWLA 2BKIB 2JU0A 2FJUB 4LQUA 1SR6B 1IG5A 1YX8A 4PE7A 3A4UB 2G6YA 1UHNA 2KNEA 2M8UA 5HKYA 2GW3A 5ER5A 1BODA 1Q4BA 2M7NA 1XK4C 1DVIA 1AP4A 4AQJA 2F8PA 2ZMUA 1QX5B 3OX6A 4XL5A 1ZACA 3HCMA 2K7DA 4DIRA 4Z4KA 3CZTX 1DJZA 4GFTA 5G08A 1EMKA 1FI6A 2HQ8A 1SW8A 1F8HA 2O2BA 5DTZA 4PALA 4XOVA 3AKOA 1KQMC 3O4YA 4DKMA 1IRJA 3CFHA 2WHSA 3I5HB 2BL0B 4JWQA 3U8AA 3IQOA 3M0WA 5T3IA 4ZBLA 4ZF5A 5BT0A 1SL8A 1ZUXA 1LINA 5FVFA 3RWAA 4H48A 2HGYA 4LJDC 4Q7RA 1WLMA 1GGZA 5D69A 3SG7A 3PFVA 1WDCB 2L5XB 2M1KB 4KF4A 2H5PA 3DQNA 3TUYC 1W7JB 4R1EA 3OGOA 1IH0A 1UISA 2FCEA 2A56B 5FYXA 4UPGA 4DCKA 3SSYA 2VAEA 2MHHA 1FPWA 3OB2B 2ZO7A 2YE1A 1F4OA 1LA0A 2K7OA 5CSNA 1AK8A 4EDOA 3UFZA 1NX2A 2AUCA 1C7WA 4GBAA 2HPSA 4N5XA 2JZIA 1H4BA 5DKQA 2JADA 3DVKA 3H4SE 1GQMA 2JC2A 3EK4A 5J3XA 3TMRA 4JF9A 3I5IC 5F6TA 1L2OC 2NCPA 3SG3A 5AFPA 1MWNA 1RMPA 3SSVA 1SBJA 5EBJA 5LK4A 1HT9A 1Z1QA 4HE4A 3UG0A 5LTQA 1Y1UA 1OMVA 1SCMC 2OTEA 2WISA 1B8LA 4Q7UA 1YHGA 2YDZA 4LQTA 2JULA 3BXBA 1TRFA 2R2IA 2IE2A 2KSPA 1EMGA 1NIWA 5BPJA 4W6JA 4H3NA 2EGDA 2PMYA 2DUEA 3BOWB 5AXIA 1KYSA 1K90D 1XK4A 1S1EA 3IR8A 3OB1B 2KFGA 1NWDA 1F4QA 2M0RA 2FL1A 1UHIA 2O5GA 3LVAA 4RTCA 1MYWA 4ANJA 1MXEA 3MGFA 2D8NA 3DF0B 1YRUB 3TDUA 4I5JA 3TZ1A 4E68A 3OHMB 3TDIA 2DUIA 2WCFA 1UP5A 1Y1AA 5H89A 4JC2A 2HQWA 2Z1OA 2ISDA 1KFUL 1F09A 1DTLA 3DQ1A 1BG1A 1EMCA 3I5FC 1QS7A 2V4EC 4PHNA 2HFCA 5DQMA 5DQBA 3NXAA 4ORNA 1TNPA 4Q9XA 2ZN9A 2LLTA 5JJGA 3E5WA 1F54A 1NX1A 4LJDA 1H4UA 3SG6A 1A03A 2LAPA 1SK6D 4JEOA 2AAOA 2QRFA 4CFQA 5DTYA 4NQGA 5H87A 4ZF4A 3OX5A 2Q6PA 4YBHB 2KFHA 2KQ6A 4BY5A 2A48A 2COLB 1KK8B 3CFAA 2H2KA 5EJUA 3U8PA 3KHEA 1OMDA 2G2BA 4W7DA 3SV5A 1PVBA 2G5ZB 1RFJA 2WORA 3DQHA 2K61A 2H9WA 3EVUA 4PPJA 1XMZA 2GW4B 1RMOA 4H3LA 4JGEA 1B8CA 4W6IA 4MBEA 3PIBA 2ZO6A 2C9JA 1FW4A 1KWOB 4OKHA 1YUTA 3VRRA 1DJWA 4Q7TA 3A8RA 2BECA 3AI5A 2MRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFE A;  1XFV O;  1S3P A;  5DU0 A;  4OGS A;  2K7B A;  3DVJ A;  4R6D A;  1OOJ A;  2FOT A;  4KPI A;  3ZUF A;  1UHH A;  2K2A A;  3I19 A;  4P1Q A;  1B47 A;  2PVB A;  4YGC B;  4M2P A;  2H5O A;  4W73 A;  1CLM A;  2ICR A;  4W74 A;  2LVI A;  1XVJ A;  5FHV A;  5AAN A;  5H88 A;  4N1G A;  2K8M B;  3CR4 X;  5BTT A;  1S6J A;  2Z6X A;  3SSH A;  4NDD A;  4ZIO A;  3JVT B;  4DXN A;  5HYD A;  4OV2 A;  2FCD A;  4HQC A;  3CR5 X;  3TMT A;  2KBI A;  2DOQ A;  4PHM A;  1JC1 A;  3G9A A;  4H3M A;  1YHI A;  2QLI A;  4BDU A;  2QU1 A;  2Q57 A;  4XVP A;  3DQ9 A;  4MRY A;  1S6I A;  2H5Q A;  5LTP A;  2V4E A;  4AOM A;  3KCT A;  3DVE A;  2Y1N A;  1K9U A;  2L50 A;  1J7R A;  3SG5 A;  3SG2 A;  5AQB B;  1S6Z A;  2IB6 A;  3BUX B;  4W6S A;  1NX3 A;  3BX9 A;  4H47 A;  5DKR A;  2GGZ A;  5HZU A;  3BUN B;  2OTB A;  3WLC A;  1KFU S;  4IK3 A;  3MSE B;  2SAS A;  1YVH A;  2KI4 B;  1SCV A;  4DS7 A;  3GJ2 A;  4ZCU A;  2AH8 A;  1TNW A;  3DQK A;  2ZND A;  1R6P A;  2LV7 A;  4QJ4 B;  1EJ3 A;  3LL8 B;  4DXP A;  4ORA B;  2OKY A;  1N65 A;  1Y6W A;  1B1G A;  3EKH A;  2PAS A;  2BKH B;  1U5I B;  2KAV A;  1MR8 A;  1MHO A;  1NX0 A;  3NSO A;  1IGV A;  5IBW A;  1MUX A;  3KEV A;  5EHU A;  4IZN A;  1JSA A;  1KQM B;  2RH7 A;  1IWQ A;  1D1O A;  1RWY A;  1EME A;  1ALW A;  4KW8 A;  3BOW A;  4IK4 A;  3W1D A;  3DQE A;  2LUC A;  4CFR A;  2F3Z A;  1KCY A;  5TNC A;  1JFK A;  2JQ6 A;  2JT3 A;  3ZUJ A;  5PAL A;  3PM8 A;  1DJX A;  1JWD A;  1S36 A;  3DF0 A;  4IK9 A;  2NLN A;  3CBE A;  3TUY B;  2I7A A;  3LK1 A;  2AWK A;  3SRY A;  1XA9 A;  1CFD A;  5I8N A;  1SNL A;  1NUB A;  4XOW A;  4Q04 A;  4Q9W A;  1SYM A;  4HVF A;  2OTG C;  4TNC A;  4ZCV A;  3IP2 A;  2YE0 A;  3WCK A;  3WHT B;  3NT3 A;  4EUL A;  3CGL A;  3A8S A;  3CB9 A;  3SVN A;  4YGE B;  5FVI A;  2A4J A;  2B1U A;  3RWT A;  2JOJ A;  1TOP A;  2EMO A;  1Q4D A;  1QVI Y;  4GAO A;  2A53 B;  3I5I B;  4ZIN A;  3ZTF A;  1UUR A;  4DXO A;  1L2O B;  3SS0 A;  3DQF A;  3CTN A;  1ZGO A;  2B3P A;  2KI4 C;  4OR9 B;  2VRG A;  2BTJ A;  1Y1X A;  2G3O A;  2LVJ A;  4QJ5 B;  1OXE A;  4NDC A;  3EVP A;  1SCM B;  1CMG A;  3M24 A;  1A75 A;  1PVA A;  3DQ3 A;  5HW9 A;  2H8Q A;  4C0L A;  4ZF3 A;  2KI6 D;  3LF3 A;  4LJC A;  2LCP A;  1JF2 A;  1REC A;  4RYW A;  1AJ4 A;  3DQM A;  2QAC A;  1KQV A;  1W7S A;  5KTG A;  5K89 A;  5LTR A;  1YUS A;  1C07 A;  3WNX B;  5BTT B;  2PSR A;  1EMF A;  1MOU A;  5HLO A;  2B3Q A;  4KA9 A;  3TS5 C;  2WHU A;  1ZOT B;  4R6B A;  1R2U A;  4DXI A;  1QJT A;  4JRB A;  2VVJ A;  4W75 A;  2LHI A;  2GX2 A;  1ALV A;  4L1I A;  4CID A;  2L4H A;  2H6V A;  3ST0 A;  3I5F B;  1PRW A;  3BXC A;  2V4E B;  4HQ8 A;  1K94 A;  5HBD A;  2ZN8 A;  1GFL A;  2Y0G A;  1ZGQ A;  4ZFS A;  1M45 A;  1EMM A;  2O60 A;  3CWG A;  4LW5 A;  1G4Y R;  4EN1 A;  4CPV A;  1K96 A;  1QXT A;  4GOB A;  2Q4U A;  1YRT B;  3SVB A;  5HLV A;  1XFY O;  3IQQ A;  3D0Y A;  3DQ4 A;  3DQC A;  1SY9 A;  3PJ7 A;  2GX0 A;  2A52 B;  2G16 B;  2E30 A;  1WY9 A;  1LVC D;  3ICB A;  2K2F A;  2PRU A;  4JFG A;  4W6H A;  3OSR A;  2WSO A;  1OXF A;  3CD1 A;  3PN7 C;  1CLL A;  1GJY A;  2PXW A;  4W6T A;  1G33 A;  2GV5 A;  2DUG A;  1G8I A;  3GB3 A;  4W6F A;  5DPI A;  2IB5 A;  4MEW A;  3NT9 A;  1OE9 B;  1JF0 A;  5GQQ C;  3DQ2 A;  1B9A A;  5EXU A;  1GGX A;  1Q4A A;  1QVI Z;  3GK4 X;  2KGB C;  3U0L A;  4OHS A;  2HPW A;  2BCB A;  5HZO A;  1CFC A;  2QLE A;  2AHA A;  1RK9 A;  4W76 A;  4AQI A;  3NSK A;  4ORC B;  3EVV A;  4MN0 A;  1U5I A;  3O2P A;  4I5L B;  2LAN A;  1AUI B;  1BJF A;  2F3Y A;  4W6K A;  3PJB A;  2DUF A;  2LMU A;  3DQI A;  3SSP A;  2WC8 A;  5FVG A;  2L51 A;  5ER4 X;  2AMI A;  4W6A A;  3VRP A;  5AER A;  4ICB A;  3D10 A;  4P76 A;  1CV7 A;  1F55 A;  3H1O A;  2L4I A;  2A47 A;  4FQO A;  1NPQ A;  1EMA A;  3DQ6 A;  4LJB A;  4CLN A;  2QPT A;  1ODB A;  4OCI A;  3AI4 A;  4DRW A;  1GL4 A;  3BUW B;  1LKJ A;  1F71 A;  1XQM A;  1QLK A;  1CFP A;  1XYD A;  3JTD C;  2ARL A;  3ST3 A;  2RGI A;  3VGO A;  4XYN A;  2DUH A;  2JNX A;  5CPV A;  1G7K A;  1S5G Y;  2VZX A;  1BLQ A;  1RRX A;  1A75 B;  3AKB A;  3VK1 A;  2G6E A;  1YUU A;  3PLF B;  1DJG A;  4W69 A;  2BE6 A;  5DPG A;  1RM9 A;  4USL A;  4YI9 A;  1YJF A;  1IJ6 A;  2P4M A;  5HGE A;  3GEX A;  4DXM A;  1SKT A;  4YRU A;  1Q4C A;  3DQU A;  1NP8 A;  3BUO B;  2Z6Z A;  2LVV A;  3GL4 A;  1YHH A;  1RMM A;  1QYQ A;  2WUR A;  4WQ2 A;  1OQP A;  3PSR A;  1NCZ A;  1RRO A;  4L9M A;  1YR5 A;  3SIB A;  3TDZ A;  2LNK A;  3SST A;  1N2D A;  2JXL A;  2ZRT A;  2OJK A;  1IQ5 A;  2JT8 A;  3C1V A;  3DPZ A;  4W6C A;  2MJW B;  3SVD A;  3NEZ A;  2M3W A;  1SRA A;  4F0Z B;  1SL7 A;  1TCO B;  1B4C A;  2KAX A;  3WLD A;  3K1K A;  2HCG A;  4I5N B;  5KU1 A;  3SVE A;  4DKN A;  1PUL A;  4GF6 B;  2LM5 A;  3D0Y B;  1JC0 A;  1OSA A;  1SL9 A;  2O24 A;  3OSQ A;  2WIQ A;  1QLS A;  3DD4 A;  4KW9 A;  1B9C A;  2OTG B;  4W6M A;  5D7F A;  4HRG A;  1M46 A;  4W7E A;  4GNK B;  1TN4 A;  2M49 B;  4HSZ A;  5EXB A;  3ST2 A;  1EXR A;  4NWS A;  1W7U A;  1BFP A;  2WOS A;  2QLH A;  3LF4 B;  2HGD A;  1MQ1 A;  2LP3 A;  3GK1 A;  5EB7 A;  2E6W A;  1BU3 A;  5CSF A;  3DQ8 A;  3U0K A;  2NCO A;  4W77 A;  1K8U A;  3U8C A;  4YGB B;  2KHN A;  3NSI A;  1FI5 A;  3U0N A;  3VIC A;  5I2L A;  3EVR A;  1B7T Y;  4PHJ A;  5DPJ A;  2A54 B;  1A4P A;  1C7V A;  2FZU A;  1YUR A;  1NCX A;  1S5G Z;  3W1C A;  1YVL A;  4PCW A;  4QJ3 B;  4B30 B;  3HX4 A;  4P5O E;  3ZNI A;  4W6P A;  3ST4 A;  1FBV A;  2KFF A;  1CTR A;  3P8U A;  1H6R A;  3M22 A;  4RYS A;  3DVM A;  3AAK A;  2VVH A;  3VRN A;  3OP0 A;  2M9G A;  2OPO A;  2HQZ A;  1V1F A;  3CS1 A;  1JFJ A;  4C0J A;  2K0J A;  2F33 A;  1B8R A;  3SSK A;  3TS5 B;  1WRL A;  1PSR A;  2HQK A;  3DQ7 A;  3LK0 A;  3CFF A;  2JXC A;  2HRS A;  2LLS A;  1HUY A;  3I5G B;  1YX7 A;  2DDD A;  3LA1 A;  1XA5 A;  1JBA A;  3KPX A;  3KO0 A;  3ED8 A;  2CNP A;  4W7F A;  3DQO A;  1QX2 A;  1WRK A;  4XGY A;  5DRG A;  3VRO A;  1PK0 D;  2ZMW A;  4EDS A;  3NED A;  1AJ5 A;  1YJ2 A;  1LA3 A;  1JC2 A;  4MLW A;  2V53 A;  1F0B A;  2G6X A;  1DGV A;  4J89 A;  2OS8 B;  4I5K A;  1J7Q A;  1KYP A;  1DF0 A;  3BXK A;  4OJ0 A;  1BMO A;  1QXP A;  1NCY A;  1A29 A;  3PN7 B;  1MXL C;  3LLE A;  1H8B A;  3EKJ A;  2Z6Y A;  2EMN A;  1K9P A;  1UWO A;  4ZB1 A;  4PE0 A;  2LMV A;  2EC6 C;  2LVK A;  4UTS A;  3CR2 A;  1PSB A;  4OVN F;  5HKW A;  1A2X A;  2CXJ A;  4I2Y A;  3P28 A;  1YZW A;  1Q80 A;  4PPK A;  2BBN A;  1CDP A;  1PAL A;  4M2Q A;  2IOV A;  1SPY A;  3E3R A;  1HQV A;  3O78 A;  3SVO A;  1HCJ A;  1J1E A;  1S26 D;  3ZWH A;  1KP5 A;  1ZMZ A;  1ZGP A;  1EG3 A;  4WRI A;  3SVS A;  2Y4Q A;  2MLF C;  4KGE A;  5DKN A;  4N1F A;  2CTN A;  1XFW O;  2WCE A;  1B7T Z;  2M29 A;  4A4B A;  2HET A;  1CLB A;  5EXC I;  1BOC A;  4PE1 A;  1QX7 A;  3BXA A;  3ZUL A;  3I5G C;  4HRE E;  1DGU A;  2JTZ A;  3CGA A;  1F70 A;  4DXQ A;  2A50 B;  1K9K A;  5HKZ A;  4NDB A;  3FWC A;  3FS7 A;  1M39 A;  1CM1 A;  2KGR A;  1KSO A;  2H61 C;  1CB1 A;  3CD9 A;  2DD7 A;  4M2O A;  1UUS A;  1QTX A;  1EMB A;  1QV1 A;  1XAE A;  1TNX A;  4MRX A;  2OS8 C;  4W7R A;  1OXD A;  2KYF A;  3PJ5 A;  3JTD B;  2JPT A;  3WXA A;  1SR6 C;  2YFP A;  4MVF A;  2F2P A;  1JUO A;  3ADF A;  1J7P A;  1BF5 A;  1OZS A;  4W6B A;  1NSH A;  1VRK A;  2BCA A;  3H1R A;  2A46 A;  3RLZ A;  4XJK A;  2DD9 A;  3RM1 A;  1QIW A;  3EK7 A;  1M31 A;  4W7X A;  1GGW A;  1KYR A;  1BR1 B;  4W6R A;  1EML A;  4AS8 A;  1MF8 B;  1QV0 A;  5I2Q A;  2QLG A;  4P2Y B;  4IK1 A;  5CSJ A;  1K93 D;  1XFU O;  4W6G A;  1UHK A;  2I94 A;  3KCS A;  2WHT A;  1CKK A;  2KQY A;  3SG4 A;  4WQ3 A;  1AHR A;  1CMF A;  1M63 B;  4OY4 A;  3DQJ A;  3VHT A;  4IL1 A;  2JNF A;  3I5H C;  2BL0 C;  4B30 A;  4W6N A;  2MLE C;  2HJO A;  3BUM B;  2JRF A;  2WND A;  2P6B B;  2DDC A;  3O77 A;  3F45 A;  2LUX A;  4ORB B;  3FIA A;  2M97 A;  3DQD A;  2SCP A;  2BCX A;  1WDC C;  3KF9 A;  2G2S B;  3S05 A;  1UHJ A;  2ZFD A;  2VAD A;  4ETO A;  2OKW A;  2JTT A;  1DF0 B;  2C9I A;  4PPL A;  4C0K A;  2Y5I A;  4W7C A;  1K2H A;  5DPH A;  1EG4 A;  2JWW A;  5AEQ A;  2NZ0 A;  4HQ9 A;  1QAT A;  2BE4 A;  2LHL A;  4MSP A;  2H61 A;  2CBL A;  4B5Y A;  1XSS A;  1EH2 A;  2KDH A;  1NYA A;  2M1U A;  1FF1 A;  2LMT A;  2F2O A;  5KSZ A;  2OGR A;  4IK5 A;  2ZNE A;  1E8A A;  3FWB A;  2G9B A;  4JPZ B;  3WHU B;  2BBM A;  1QY3 A;  1Q4E A;  2M7L A;  1K95 A;  2VVI A;  2ZRS A;  3LVD A;  1CNP A;  1KK7 Y;  2I18 A;  1W7T A;  2L2E A;  3SVC A;  4A4C A;  2LE9 B;  5KTY A;  2LC5 A;  3U0M A;  1X02 A;  1V1G A;  3SJS A;  1CDL A;  3O6B A;  4IK8 A;  1CDN A;  2QT2 A;  2KAY A;  4PDZ A;  2KOT A;  4OQW A;  4KF5 C;  3QRX A;  2TN4 A;  2GGM A;  1SMG A;  1KFX L;  2Q91 A;  2PXS A;  3DQL A;  4KEX A;  3SIA A;  1KSM A;  4PE4 A;  5HZS A;  2QZ0 A;  4MZK A;  1CDM A;  1RTP 1;  3E5V A;  4YGD B;  4GGF C;  2POX A;  2CT9 A;  3PAL A;  5F9G A;  1WLZ A;  1XO5 A;  4GPL B;  4EMQ A;  2IS9 A;  5HZT A;  1J7O A;  1Y0V H;  3AKA A;  3LVC A;  3BQ3 A;  1LXF C;  1CFF A;  2MBX A;  4YI8 A;  1Z1P A;  4W6O A;  1QAS A;  2ZKM X;  1J55 A;  1DMO A;  3GJ1 A;  4U8D A;  1IJ5 A;  1IKU A;  1TIZ A;  3CLN A;  4L12 A;  3GOF A;  3NF0 A;  1BT6 A;  4J8A A;  4Z4M A;  4W6D A;  4GGN A;  4FTG A;  3DPW A;  1J1D A;  3LSA A;  1ZUZ A;  1JBZ A;  4GES B;  2NXQ A;  1IQ3 A;  2KBM A;  3DQ5 A;  3DPX A;  3VRQ A;  3EK8 A;  4XJK B;  3SSL A;  4TZA A;  4J88 A;  5DY6 A;  5CSI A;  2WSN A;  1KK8 C;  3K21 A;  2QLG B;  5JOL A;  1JBY A;  1C4F A;  3NSL A;  2LP2 A;  5DTX A;  3LS3 A;  2EC6 B;  4DUQ A;  1WRZ A;  4GUK A;  1OZO A;  4W6U A;  2KI6 C;  4D1E A;  4W6L A;  1DT7 B;  5B8I B;  2L0P A;  2G3D B;  1XFX O;  2I2R E;  3VHT B;  1TNQ A;  3SVU A;  1CM4 A;  5DTL A;  4W7A A;  4HRH A;  2K7C A;  1DJY A;  1XFZ O;  4MZJ A;  2WCB A;  1KWO C;  5BQL A;  1AVS A;  5DRF A;  5EB6 A;  3V3D A;  1ZFS A;  4L13 A;  2LLU A;  2EMD A;  2EHB A;  1Q73 A;  1YFP A;  2Y1M A;  1DJH A;  3SVR A;  1RJV A;  1KK7 Z;  2MAZ A;  4KW4 A;  1L7Z A;  1QYO A;  1TTX A;  3GK2 A;  3DQA A;  2AWJ A;  4JQ0 D;  3BYA A;  4N3D A;  4BY4 A;  4KF5 A;  2O29 A;  2CCM A;  4MZL A;  1EL4 A;  3E5T A;  1BR4 B;  1TCF A;  1DJI A;  4TZG A;  3AAJ A;  1W7I B;  4KGF A;  5I2O A;  2L98 A;  4GGF A;  1N0Y A;  3PAT A;  2FWQ A;  1OMR A;  1YTZ C;  3IF7 A;  3LCP C;  1MOV A;  2PAL A;  3JVT C;  2H5R A;  5J2O A;  4PHK A;  4YGA A;  1QIV A;  4U2V A;  2KYC A;  4KAG A;  2MA2 A;  1KFX S;  2AWM A;  1S6C A;  2HF5 A;  2JT0 A;  4AR7 A;  4W72 A;  1QYF A;  2AWL A;  2BKI B;  2JU0 A;  2FJU B;  4LQU A;  1SR6 B;  1IG5 A;  1YX8 A;  4PE7 A;  3A4U B;  2G6Y A;  1UHN A;  2KNE A;  2M8U A;  5HKY A;  2GW3 A;  5ER5 A;  1BOD A;  1Q4B A;  2M7N A;  1XK4 C;  1DVI A;  1AP4 A;  4AQJ A;  2F8P A;  2ZMU A;  1QX5 B;  3OX6 A;  4XL5 A;  1ZAC A;  3HCM A;  2K7D A;  4DIR A;  4Z4K A;  3CZT X;  1DJZ A;  4GFT A;  5G08 A;  1EMK A;  1FI6 A;  2HQ8 A;  1SW8 A;  1F8H A;  2O2B A;  5DTZ A;  4PAL A;  4XOV A;  3AKO A;  1KQM C;  3O4Y A;  4DKM A;  1IRJ A;  3CFH A;  2WHS A;  3I5H B;  2BL0 B;  4JWQ A;  3U8A A;  3IQO A;  3M0W A;  5T3I A;  4ZBL A;  4ZF5 A;  5BT0 A;  1SL8 A;  1ZUX A;  1LIN A;  5FVF A;  3RWA A;  4H48 A;  2HGY A;  4LJD C;  4Q7R A;  1WLM A;  1GGZ A;  5D69 A;  3SG7 A;  3PFV A;  1WDC B;  2L5X B;  2M1K B;  4KF4 A;  2H5P A;  3DQN A;  3TUY C;  1W7J B;  4R1E A;  3OGO A;  1IH0 A;  1UIS A;  2FCE A;  2A56 B;  5FYX A;  4UPG A;  4DCK A;  3SSY A;  2VAE A;  2MHH A;  1FPW A;  3OB2 B;  2ZO7 A;  2YE1 A;  1F4O A;  1LA0 A;  2K7O A;  5CSN A;  1AK8 A;  4EDO A;  3UFZ A;  1NX2 A;  2AUC A;  1C7W A;  4GBA A;  2HPS A;  4N5X A;  2JZI A;  1H4B A;  5DKQ A;  2JAD A;  3DVK A;  3H4S E;  1GQM A;  2JC2 A;  3EK4 A;  5J3X A;  3TMR A;  4JF9 A;  3I5I C;  5F6T A;  1L2O C;  2NCP A;  3SG3 A;  5AFP A;  1MWN A;  1RMP A;  3SSV A;  1SBJ A;  5EBJ A;  5LK4 A;  1HT9 A;  1Z1Q A;  4HE4 A;  3UG0 A;  5LTQ A;  1Y1U A;  1OMV A;  1SCM C;  2OTE A;  2WIS A;  1B8L A;  4Q7U A;  1YHG A;  2YDZ A;  4LQT A;  2JUL A;  3BXB A;  1TRF A;  2R2I A;  2IE2 A;  2KSP A;  1EMG A;  1NIW A;  5BPJ A;  4W6J A;  4H3N A;  2EGD A;  2PMY A;  2DUE A;  3BOW B;  5AXI A;  1KYS A;  1K90 D;  1XK4 A;  1S1E A;  3IR8 A;  3OB1 B;  2KFG A;  1NWD A;  1F4Q A;  2M0R A;  2FL1 A;  1UHI A;  2O5G A;  3LVA A;  4RTC A;  1MYW A;  4ANJ A;  1MXE A;  3MGF A;  2D8N A;  3DF0 B;  1YRU B;  3TDU A;  4I5J A;  3TZ1 A;  4E68 A;  3OHM B;  3TDI A;  2DUI A;  2WCF A;  1UP5 A;  1Y1A A;  5H89 A;  4JC2 A;  2HQW A;  2Z1O A;  2ISD A;  1KFU L;  1F09 A;  1DTL A;  3DQ1 A;  1BG1 A;  1EMC A;  3I5F C;  1QS7 A;  2V4E C;  4PHN A;  2HFC A;  5DQM A;  5DQB A;  3NXA A;  4ORN A;  1TNP A;  4Q9X A;  2ZN9 A;  2LLT A;  5JJG A;  3E5W A;  1F54 A;  1NX1 A;  4LJD A;  1H4U A;  3SG6 A;  1A03 A;  2LAP A;  1SK6 D;  4JEO A;  2AAO A;  2QRF A;  4CFQ A;  5DTY A;  4NQG A;  5H87 A;  4ZF4 A;  3OX5 A;  2Q6P A;  4YBH B;  2KFH A;  2KQ6 A;  4BY5 A;  2A48 A;  2COL B;  1KK8 B;  3CFA A;  2H2K A;  5EJU A;  3U8P A;  3KHE A;  1OMD A;  2G2B A;  4W7D A;  3SV5 A;  1PVB A;  2G5Z B;  1RFJ A;  2WOR A;  3DQH A;  2K61 A;  2H9W A;  3EVU A;  4PPJ A;  1XMZ A;  2GW4 B;  1RMO A;  4H3L A;  4JGE A;  1B8C A;  4W6I A;  4MBE A;  3PIB A;  2ZO6 A;  2C9J A;  1FW4 A;  1KWO B;  4OKH A;  1YUT A;  3VRR A;  1DJW A;  4Q7T A;  3A8R A;  2BEC A;  3AI5 A;  2MRD A; 
#chains in the Genus database with same CATH topology
 4PFE A;  1XFV O;  1S3P A;  5DU0 A;  4OGS A;  2K7B A;  3DVJ A;  4R6D A;  1OOJ A;  2FOT A;  4KPI A;  3ZUF A;  1UHH A;  2K2A A;  3I19 A;  4P1Q A;  1B47 A;  2PVB A;  1OOI X;  4YGC B;  4M2P A;  2H5O A;  1Z2C B;  4W73 A;  1CLM A;  2ICR A;  4W74 A;  2LVI A;  1XVJ A;  5FHV A;  5AAN A;  5H88 A;  4N1G A;  2K8M B;  3CR4 X;  5BTT A;  1S6J A;  2Z6X A;  3SSH A;  4NDD A;  3PM2 A;  4ZIO A;  3JVT B;  4DXN A;  5HYD A;  4OV2 A;  2FCD A;  4HQC A;  3CR5 X;  3TMT A;  2KBI A;  2DOQ A;  1C3Y A;  4PHM A;  1JC1 A;  3G9A A;  4H3M A;  1YHI A;  2QLI A;  4BDU A;  2QU1 A;  2Q57 A;  4XVP A;  3L4L A;  3DQ9 A;  4MRY A;  1W9Z A;  1S6I A;  2H5Q A;  5LTP A;  2V4E A;  4AOM A;  3KCT A;  3DVE A;  2Y1N A;  3D75 A;  1K9U A;  2L50 A;  1J7R A;  3SG5 A;  3SG2 A;  3D76 A;  5AQB B;  1S6Z A;  2IB6 A;  3BUX B;  4W6S A;  3BFA A;  1NX3 A;  3BX9 A;  4H47 A;  5DKR A;  2GGZ A;  5HZU A;  3BUN B;  2OTB A;  3WLC A;  1KFU S;  4IK3 A;  3MSE B;  2SAS A;  1YVH A;  2KI4 B;  1SCV A;  5FI7 A;  4DS7 A;  3GJ2 A;  4ZCU A;  2AH8 A;  1TNW A;  3DQK A;  2ZND A;  1R6P A;  2LV7 A;  4QJ4 B;  1EJ3 A;  2L2C A;  3LL8 B;  4DXP A;  2K60 A;  4ORA B;  2OKY A;  1N65 A;  1Y6W A;  2KLE A;  1B1G A;  3EKH A;  2PAS A;  2BKH B;  1U5I B;  2KAV A;  1MR8 A;  1MHO A;  1NX0 A;  3NSO A;  1IGV A;  5IBW A;  1MUX A;  3KEV A;  5EHU A;  4IZN A;  1JSA A;  1KQM B;  2RH7 A;  1IWQ A;  1D1O A;  1RWY A;  1EME A;  1ALW A;  4KW8 A;  3BOW A;  4IK4 A;  3W1D A;  3DQE A;  2LUC A;  4CFR A;  3L4A A;  2F3Z A;  1KCY A;  5TNC A;  1JFK A;  2JQ6 A;  2JT3 A;  3ZUJ A;  5PAL A;  3PM8 A;  1DJX A;  1JWD A;  1S36 A;  3DF0 A;  4IK9 A;  2NLN A;  3CBE A;  3TUY B;  2I7A A;  3LK1 A;  2AWK A;  3SRY A;  1XA9 A;  1CFD A;  5I8N A;  1SNL A;  1NUB A;  4XOW A;  4Q04 A;  4Q9W A;  1SYM A;  4HVF A;  2OTG C;  4TNC A;  4ZCV A;  3IP2 A;  2YE0 A;  3WCK A;  3WHT B;  3NT3 A;  4EUL A;  3CGL A;  3A8S A;  3CB9 A;  3SVN A;  4YGE B;  5FVI A;  2A4J A;  2B1U A;  3RWT A;  2JOJ A;  1TOP A;  2EMO A;  1Q4D A;  1QVI Y;  4GAO A;  2A53 B;  3I5I B;  4ZIN A;  3ZTF A;  1UUR A;  4DXO A;  1L2O B;  3SS0 A;  3DQF A;  3CTN A;  1ZGO A;  2B3P A;  2KI4 C;  2P71 A;  2VRG A;  4OR9 B;  2BTJ A;  1Y1X A;  2G3O A;  2LVJ A;  4QJ5 B;  1OXE A;  4NDC A;  2QEH A;  3EVP A;  1SCM B;  3NGV A;  1CMG A;  3M24 A;  1A75 A;  1PVA A;  3DQ3 A;  5HW9 A;  2H8Q A;  4C0L A;  4ZF3 A;  2KI6 D;  3LF3 A;  4LJC A;  2LCP A;  1JF2 A;  1REC A;  4RYW A;  1AJ4 A;  3DQM A;  2QAC A;  1KQV A;  1W7S A;  5KTG A;  5K89 A;  5LTR A;  1YUS A;  1C07 A;  3WNX B;  5BTT B;  2PSR A;  1EMF A;  1MOU A;  5HLO A;  2B3Q A;  4KA9 A;  3TS5 C;  2WHU A;  2WCH A;  1ZOT B;  4R6B A;  1R2U A;  4DXI A;  1QJT A;  4JRB A;  2VVJ A;  4W75 A;  2LHI A;  2GX2 A;  1ALV A;  4L1I A;  4CID A;  2L4H A;  2H6V A;  3ST0 A;  3I5F B;  1PRW A;  3BXC A;  2V4E B;  4HQ8 A;  1K94 A;  5HBD A;  2ZN8 A;  1GFL A;  2Y0G A;  1ZGQ A;  4ZFS A;  1SSE B;  2GTE A;  1M45 A;  1EMM A;  2O60 A;  3CWG A;  4LW5 A;  1G4Y R;  4EN1 A;  4CPV A;  1K96 A;  1QXT A;  4GOB A;  2Q4U A;  1YRT B;  3SVB A;  5HLV A;  1XFY O;  3IQQ A;  3D0Y A;  3DQ4 A;  3DQC A;  1SY9 A;  3PJ7 A;  2GX0 A;  2A52 B;  2G16 B;  2E30 A;  1WY9 A;  1LVC D;  3ICB A;  2K2F A;  1OOG A;  2PRU A;  4JFG A;  4W6H A;  3OSR A;  2WSO A;  1OXF A;  3CD1 A;  3PN7 C;  1CLL A;  1DQE A;  1GJY A;  2PXW A;  1XFR A;  1G33 A;  4W6T A;  2GV5 A;  2DUG A;  1G8I A;  3GB3 A;  4W6F A;  5DPI A;  2IB5 A;  4MEW A;  3NT9 A;  1OE9 B;  1JF0 A;  5GQQ C;  3DQ2 A;  1B9A A;  5EXU A;  1GGX A;  1Q4A A;  1QVI Z;  3CAB A;  3GK4 X;  2KGB C;  3U0L A;  4OHS A;  2HPW A;  2BCB A;  5HZO A;  1CFC A;  2QLE A;  2AHA A;  1RK9 A;  4W76 A;  4AQI A;  3S0G A;  1TWO A;  3NSK A;  4ORC B;  3EVV A;  4MN0 A;  1U5I A;  3O2P A;  4I5L B;  2LAN A;  1AUI B;  4JKT A;  1BJF A;  2F3Y A;  4W6K A;  3PJB A;  2DUF A;  2LMU A;  3DQI A;  3SSP A;  2WC8 A;  3QME A;  5FVG A;  2L51 A;  5ER4 X;  2AMI A;  4W6A A;  3VRP A;  5AER A;  4ICB A;  3NHI A;  3D10 A;  4P76 A;  1CV7 A;  1F55 A;  3H1O A;  2L4I A;  2A47 A;  4FQO A;  1NPQ A;  1EMA A;  3DQ6 A;  4LJB A;  4CLN A;  2QPT A;  1ODB A;  4OCI A;  3AI4 A;  3SS5 A;  4DRW A;  3DZT A;  1GL4 A;  3BUW B;  1LKJ A;  1F71 A;  1XQM A;  1QLK A;  1CFP A;  2WCJ A;  1XYD A;  3JTD C;  2ARL A;  3ST3 A;  2RGI A;  3VGO A;  4XYN A;  2DUH A;  2JNX A;  5CPV A;  1G7K A;  1S5G Y;  2VZX A;  1BLQ A;  1RRX A;  4INX A;  1A75 B;  3AKB A;  4IJ7 A;  3VK1 A;  2G6E A;  1YUU A;  3PLF B;  1DJG A;  2WCM A;  4W69 A;  2BE6 A;  2QDI A;  3FE8 A;  5DPG A;  1RM9 A;  4USL A;  4YI9 A;  1YJF A;  1IJ6 A;  2P4M A;  5HGE A;  3GEX A;  4DXM A;  1SKT A;  4YRU A;  1Q4C A;  3DQU A;  1NP8 A;  1TUZ A;  3BUO B;  2Z6Z A;  2LVV A;  3GL4 A;  1YHH A;  1RMM A;  1QYQ A;  2WUR A;  3R72 A;  4WQ2 A;  1OQP A;  3PSR A;  5FI2 A;  4FQT A;  3TDZ A;  1NCZ A;  1RRO A;  1YR5 A;  2KPH A;  4L9M A;  3SIB A;  2LNK A;  3SST A;  1N2D A;  2JXL A;  2ZRT A;  2OJK A;  1IQ5 A;  2L5Y A;  2JT8 A;  3C1V A;  3DPZ A;  4W6C A;  2MJW B;  3SVD A;  3NEZ A;  4PT1 A;  2M3W A;  4KYN A;  1SRA A;  4F0Z B;  1SL7 A;  1TCO B;  1B4C A;  2KAX A;  3WLD A;  3K1K A;  2HCG A;  4I5N B;  5KU1 A;  3SVE A;  4DKN A;  1PUL A;  4GF6 B;  2LM5 A;  3D0Y B;  1JC0 A;  1OSA A;  1SL9 A;  2O24 A;  3OSQ A;  2WIQ A;  1QLS A;  3DD4 A;  4KW9 A;  1B9C A;  2OTG B;  3CDN A;  3IVT A;  3Q8I A;  4W6M A;  5D7F A;  4HRG A;  1M46 A;  4W7E A;  1DEL A;  4GNK B;  1TN4 A;  2M49 B;  4HSZ A;  5EXB A;  3ST2 A;  1EXR A;  4NWS A;  1W7U A;  1BFP A;  2WOS A;  2QLH A;  3LF4 B;  2HGD A;  1MQ1 A;  2LP3 A;  3GK1 A;  5EB7 A;  3O4X A;  2E6W A;  1BU3 A;  5CSF A;  3DQ8 A;  3U0K A;  2NCO A;  3B7A A;  4W77 A;  1K8U A;  3U8C A;  4YGB B;  2KHN A;  3NSI A;  3R1P A;  1FI5 A;  3U0N A;  3VIC A;  5I2L A;  3EVR A;  1B7T Y;  4PHJ A;  5DPJ A;  2A54 B;  1A4P A;  1C7V A;  2FZU A;  1YUR A;  1NCX A;  3DY9 A;  1S5G Z;  3W1C A;  1YVL A;  4PCW A;  4QJ3 B;  4B30 B;  3HX4 A;  4P5O E;  3ZNI A;  4W6P A;  3ST4 A;  1FBV A;  2KFF A;  1CTR A;  3P8U A;  1H6R A;  3M22 A;  4RYS A;  3DVM A;  3AAK A;  2VVH A;  3VRN A;  3OP0 A;  2M9G A;  2OPO A;  2HQZ A;  1V1F A;  3CS1 A;  5DIC A;  1JFJ A;  2QEV A;  4C0J A;  4INW A;  2K0J A;  2F33 A;  1B8R A;  3SSK A;  3TS5 B;  1WRL A;  3DXL A;  1PSR A;  2WCK A;  2HQK A;  3DQ7 A;  3LK0 A;  3CFF A;  2JXC A;  2HRS A;  2LLS A;  1HUY A;  3I5G B;  1YX7 A;  2DDD A;  3LA1 A;  1XA5 A;  1JBA A;  3KPX A;  3KO0 A;  3ED8 A;  2CNP A;  4W7F A;  3DQO A;  2JPO A;  1QX2 A;  1WRK A;  4XGY A;  5DRG A;  3VRO A;  1PK0 D;  3BJH A;  2ZMW A;  4EDS A;  3NED A;  1AJ5 A;  1YJ2 A;  1LA3 A;  1JC2 A;  3CYZ A;  4MLW A;  2V53 A;  3RZS A;  1F0B A;  3D78 A;  2G6X A;  1DGV A;  4J89 A;  2OS8 B;  4I5K A;  1J7Q A;  3VB1 A;  1KYP A;  1DF0 A;  3BXK A;  4OJ0 A;  1BMO A;  1QXP A;  1NCY A;  1A29 A;  3PN7 B;  1MXL C;  3LLE A;  1H8B A;  3EKJ A;  2Z6Y A;  2EMN A;  1K9P A;  1UWO A;  3K1E A;  4ZB1 A;  2BAP A;  4PE0 A;  2LMV A;  2EC6 C;  2LVK A;  4UTS A;  3CR2 A;  1PSB A;  4OVN F;  5HKW A;  3S0D A;  1A2X A;  2CXJ A;  4I2Y A;  3P28 A;  3CZ2 A;  1YZW A;  1Q80 A;  4PPK A;  2H8V A;  3D77 A;  2BBN A;  1CDP A;  1PAL A;  4M2Q A;  2IOV A;  1SPY A;  3E3R A;  1HQV A;  3O78 A;  3SVO A;  1HCJ A;  1J1E A;  2WC5 A;  1S26 D;  3OGN A;  3ZWH A;  1KP5 A;  1ZMZ A;  1ZGP A;  1EG3 A;  4WRI A;  3SVS A;  2Y4Q A;  2MLF C;  4KGE A;  5DKN A;  4N1F A;  2CTN A;  1XFW O;  2WCE A;  1B7T Z;  2M29 A;  4A4B A;  2HET A;  1CLB A;  5EXC I;  2PQL A;  5FI6 A;  1BOC A;  4PE1 A;  1QX7 A;  3BXA A;  3ZUL A;  3I5G C;  4HRE E;  1DGU A;  2JTZ A;  3CGA A;  1F70 A;  3CZ0 A;  4DXQ A;  1ORG A;  2A50 B;  1K9K A;  5HKZ A;  4NDB A;  3FWC A;  3FS7 A;  2QEB A;  1M39 A;  1CM1 A;  2KGR A;  1KSO A;  2H61 C;  1CB1 A;  3CD9 A;  2DD7 A;  4M2O A;  1UUS A;  1QTX A;  1EMB A;  1QV1 A;  1XAE A;  1TNX A;  3DYE A;  4MRX A;  2OS8 C;  4W7R A;  1OXD A;  2KYF A;  3PJ5 A;  2KLD A;  3JTD B;  2JPT A;  3WXA A;  1SR6 C;  2YFP A;  4MVF A;  2F2P A;  3V2L A;  1JUO A;  3ADF A;  1J7P A;  1BF5 A;  1OZS A;  4W6B A;  1NSH A;  1VRK A;  3R1V A;  2BCA A;  3H1R A;  1OOF A;  2A46 A;  3RLZ A;  4XJK A;  2DD9 A;  3RM1 A;  1QIW A;  3EK7 A;  1M31 A;  4W7X A;  1GGW A;  1KYR A;  1BR1 B;  4W6R A;  1EML A;  4AS8 A;  1MF8 B;  1QV0 A;  5I2Q A;  2QLG A;  4P2Y B;  4IK1 A;  5CSJ A;  1K93 D;  1XFU O;  4W6G A;  1UHK A;  2I94 A;  3KCS A;  1Z4H A;  2WHT A;  1CKK A;  2KQY A;  3SG4 A;  4WQ3 A;  5I94 A;  2FJY A;  1AHR A;  1CMF A;  1M63 B;  4OY4 A;  3DQJ A;  3VHT A;  4IL1 A;  2JNF A;  3I5H C;  2BL0 C;  4B30 A;  1OOH A;  4W6N A;  2MLE C;  3BFH A;  2HJO A;  3BUM B;  2JRF A;  3S0F A;  2WND A;  2P6B B;  2DDC A;  3O77 A;  3F45 A;  2LUX A;  4ORB B;  3FIA A;  2M97 A;  3DQD A;  2SCP A;  2BCX A;  1WDC C;  3KF9 A;  2G2S B;  3S05 A;  1UHJ A;  2ZFD A;  2VAD A;  4ETO A;  2OKW A;  2JTT A;  1DF0 B;  2C9I A;  3EG5 B;  4PPL A;  4C0K A;  2Y5I A;  4W7C A;  1K2H A;  5DPH A;  3S0B A;  1EG4 A;  2JWW A;  5AEQ A;  2NZ0 A;  4HQ9 A;  3CZ1 A;  1QAT A;  2BE4 A;  1DC1 A;  2LHL A;  4MSP A;  2H61 A;  2CBL A;  4B5Y A;  1XSS A;  1EH2 A;  2KDH A;  1NYA A;  2M1U A;  1FF1 A;  2LMT A;  1QWV A;  2F2O A;  5KSZ A;  2OGR A;  4IK5 A;  2ZNE A;  1E8A A;  3FWB A;  2G9B A;  4JPZ B;  1LS8 A;  3WHU B;  2BBM A;  1QY3 A;  1Q4E A;  2M7L A;  1K95 A;  2VVI A;  2ZRS A;  3LVD A;  1CNP A;  1KK7 Y;  2I18 A;  1W7T A;  2L2E A;  3SVC A;  4A4C A;  2LE9 B;  5KTY A;  2LC5 A;  3U0M A;  1X02 A;  1V1G A;  3SJS A;  1CDL A;  3O6B A;  4IK8 A;  1CDN A;  3OBV A;  2KAY A;  2QT2 A;  4JD9 A;  4PDZ A;  2KOT A;  4OQW A;  4KF5 C;  3QRX A;  2TN4 A;  2GGM A;  1SMG A;  1KFX L;  2Q91 A;  2PXS A;  3DQL A;  4KEX A;  3SIA A;  1KSM A;  4PE4 A;  5HZS A;  2QZ0 A;  4MZK A;  1CDM A;  1RTP 1;  3E5V A;  4YGD B;  4GGF C;  2POX A;  2CT9 A;  3PAL A;  5F9G A;  1WLZ A;  1XO5 A;  4GPL B;  4EMQ A;  2IS9 A;  5HZT A;  1J7O A;  1Y0V H;  3AKA A;  3LVC A;  3BQ3 A;  1LXF C;  1CFF A;  2MBX A;  4YI8 A;  1Z1P A;  4W6O A;  1QAS A;  2ZKM X;  1J55 A;  1DMO A;  3GJ1 A;  4U8D A;  1IJ5 A;  1IKU A;  1TIZ A;  3CLN A;  4L12 A;  3GOF A;  3NF0 A;  1BT6 A;  4J8A A;  4Z4M A;  4W6D A;  4GGN A;  4FTG A;  3DPW A;  1J1D A;  3LSA A;  1ZUZ A;  1OW4 A;  1JBZ A;  2NXQ A;  1IQ3 A;  4GES B;  2KBM A;  3DQ5 A;  3DPX A;  3VRQ A;  3EK8 A;  4XJK B;  3SSL A;  4TZA A;  4J88 A;  5DY6 A;  5CSI A;  2WSN A;  1KK8 C;  3K21 A;  2QLG B;  5JOL A;  1JBY A;  1C4F A;  3NSL A;  2LP2 A;  3D74 A;  5DTX A;  3LS3 A;  2EC6 B;  4DUQ A;  1WRZ A;  4GUK A;  1OZO A;  4W6U A;  2KI6 C;  4D1E A;  4W6L A;  1DT7 B;  5B8I B;  2L0P A;  3R1O A;  2G3D B;  1XFX O;  2I2R E;  3BFB A;  3VHT B;  1TNQ A;  3SVU A;  1CM4 A;  5DTL A;  4W7A A;  4HRH A;  2K7C A;  2YGU A;  1DJY A;  3S0A A;  1XFZ O;  4MZJ A;  2WCB A;  1KWO C;  5BQL A;  1AVS A;  5DRF A;  5EB6 A;  3V3D A;  1ZFS A;  4L13 A;  2LLU A;  2EMD A;  2EHB A;  1Q73 A;  1YFP A;  2Y1M A;  1DJH A;  3SVR A;  1RJV A;  1KK7 Z;  2MAZ A;  4KW4 A;  1L7Z A;  1QYO A;  1TTX A;  3GK2 A;  5HL1 A;  3DQA A;  2AWJ A;  4JQ0 D;  3BYA A;  4N3D A;  4BY4 A;  4KF5 A;  2O29 A;  2CCM A;  4MZL A;  2P70 A;  1EL4 A;  3E5T A;  1BR4 B;  1TCF A;  1DJI A;  4TZG A;  3AAJ A;  1W7I B;  4KGF A;  3NHT A;  5I2O A;  2WCL A;  2L98 A;  4GGF A;  4F7F A;  1N0Y A;  3PAT A;  2FWQ A;  1OMR A;  1YTZ C;  3IF7 A;  3LCP C;  1MOV A;  2PAL A;  3JVT C;  2H5R A;  5J2O A;  4PHK A;  3SS3 A;  4YGA A;  1QIV A;  4U2V A;  2KYC A;  4KAG A;  2MA2 A;  2QEO A;  1KFX S;  2AWM A;  1S6C A;  2HF5 A;  5EL2 A;  2JT0 A;  4AR7 A;  4W72 A;  1QYF A;  2AWL A;  2BKI B;  2JU0 A;  2FJU B;  3S0E A;  4LQU A;  1SR6 B;  3B86 A;  1IG5 A;  1YX8 A;  4PE7 A;  3A4U B;  2G6Y A;  1UHN A;  2KNE A;  3SS4 A;  2M8U A;  5HKY A;  2GW3 A;  5ER5 A;  1BOD A;  1Q4B A;  2M7N A;  1AP4 A;  1XK4 C;  1DVI A;  4AQJ A;  2F8P A;  2ZMU A;  1QX5 B;  3OX6 A;  4XL5 A;  1ZAC A;  3HCM A;  2K7D A;  1P28 A;  4DIR A;  4Z4K A;  3CZT X;  1DJZ A;  4GFT A;  1TUJ A;  5G08 A;  1EMK A;  1FI6 A;  2HQ8 A;  1SW8 A;  1DEK A;  1F8H A;  2O2B A;  5DTZ A;  4PAL A;  4XOV A;  3AKO A;  1KQM C;  3O4Y A;  4DKM A;  1IRJ A;  3CFH A;  2WHS A;  3I5H B;  2BL0 B;  4JWQ A;  3U8A A;  3IQO A;  3M0W A;  5T3I A;  4ZBL A;  4ZF5 A;  3L47 A;  5BT0 A;  1SL8 A;  1ZUX A;  1LIN A;  5FVF A;  3RWA A;  4H48 A;  2HGY A;  4LJD C;  4Q7R A;  1WLM A;  1GGZ A;  3N7H A;  5D69 A;  3SG7 A;  3PFV A;  1WDC B;  2L5X B;  2M1K B;  4KF4 A;  2H5P A;  3DQN A;  3TUY C;  1W7J B;  4R1E A;  3OGO A;  1IH0 A;  1UIS A;  2FCE A;  5D3O A;  2A56 B;  5FYX A;  4UPG A;  4DCK A;  3SSY A;  2WC6 A;  2VAE A;  2MHH A;  1FPW A;  3OB2 B;  2ZO7 A;  3B6X A;  1GM0 A;  1T14 A;  2YE1 A;  1F4O A;  1LA0 A;  2K7O A;  3D73 A;  5CSN A;  1AK8 A;  4EDO A;  3UFZ A;  1NX2 A;  2AUC A;  1C7W A;  4GBA A;  2HPS A;  4N5X A;  2JZI A;  1H4B A;  5DKQ A;  2JAD A;  3DVK A;  3H4S E;  1GQM A;  2JC2 A;  3EK4 A;  5J3X A;  3TMR A;  4JF9 A;  3I5I C;  5F6T A;  1L2O C;  2NCP A;  3SG3 A;  5AFP A;  3FE6 A;  1RMP A;  1MWN A;  3SSV A;  1SBJ A;  5EBJ A;  5LK4 A;  1HT9 A;  1Z1Q A;  4HE4 A;  3UG0 A;  1C3Z A;  5LTQ A;  1Y1U A;  1OMV A;  1SCM C;  2OTE A;  2WIS A;  3PJI A;  1B8L A;  4Q7U A;  1YHG A;  2YDZ A;  4LQT A;  2JUL A;  3BXB A;  1TRF A;  2R2I A;  2IE2 A;  2KSP A;  1EMG A;  1NIW A;  5BPJ A;  4W6J A;  4H3N A;  1IIO A;  2EGD A;  2PMY A;  2DUE A;  3BOW B;  5AXI A;  1KYS A;  1K90 D;  1XK4 A;  1S1E A;  3IR8 A;  3OB1 B;  2KFG A;  1NWD A;  1F4Q A;  2M0R A;  2FL1 A;  4OZD A;  1UHI A;  2O5G A;  3LVA A;  3B87 A;  4RTC A;  1MYW A;  4ANJ A;  1MXE A;  3MGF A;  2D8N A;  3DF0 B;  1YRU B;  3TDU A;  4I5J A;  3TZ1 A;  3UNW A;  4E68 A;  3OHM B;  3TDI A;  2DUI A;  2WCF A;  1UP5 A;  1Y1A A;  5H89 A;  4JC2 A;  2HQW A;  2Z1O A;  2ISD A;  1KFU L;  1F09 A;  1DTL A;  3DQ1 A;  1BG1 A;  1EMC A;  3I5F C;  1QS7 A;  2V4E C;  4PHN A;  2HFC A;  5DQM A;  5DQB A;  3NXA A;  4ORN A;  1TNP A;  4Q9X A;  2ZN9 A;  2LLT A;  5JJG A;  3E5W A;  1F54 A;  1NX1 A;  4LJD A;  1H4U A;  3SG6 A;  1A03 A;  2LAP A;  1SK6 D;  4JEO A;  2AAO A;  2ERB A;  2QRF A;  4CFQ A;  5DTY A;  4NQG A;  5H87 A;  4ZF4 A;  3OX5 A;  2Q6P A;  3FE9 A;  4YBH B;  2KFH A;  2KQ6 A;  4BY5 A;  2A48 A;  2PYQ A;  2COL B;  1KK8 B;  3CFA A;  2H2K A;  5EJU A;  3U8P A;  3KHE A;  2BNX A;  1OMD A;  2G2B A;  3UO9 A;  4W7D A;  3SV5 A;  1PVB A;  2G5Z B;  1RFJ A;  2WOR A;  3DQH A;  2K61 A;  2H9W A;  3EVU A;  4PPJ A;  1XMZ A;  2GW4 B;  1RMO A;  4H3L A;  4JGE A;  1B8C A;  4W6I A;  4MBE A;  3PIB A;  2ZO6 A;  2C9J A;  1FW4 A;  3B88 A;  1KWO B;  4OKH A;  1YUT A;  3VRR A;  1DJW A;  4Q7T A;  3A8R A;  2BEC A;  3AI5 A;  2MRD A; 
#chains in the Genus database with same CATH homology
 4PFE A;  1XFV O;  1S3P A;  5DU0 A;  4OGS A;  2K7B A;  3DVJ A;  4R6D A;  1OOJ A;  2FOT A;  4KPI A;  3ZUF A;  1UHH A;  2K2A A;  3I19 A;  4P1Q A;  1B47 A;  2PVB A;  4YGC B;  4M2P A;  2H5O A;  4W73 A;  1CLM A;  2ICR A;  4W74 A;  2LVI A;  1XVJ A;  5FHV A;  5AAN A;  5H88 A;  4N1G A;  2K8M B;  3CR4 X;  5BTT A;  1S6J A;  2Z6X A;  3SSH A;  4NDD A;  4ZIO A;  3JVT B;  4DXN A;  5HYD A;  4OV2 A;  2FCD A;  4HQC A;  3CR5 X;  3TMT A;  2KBI A;  2DOQ A;  4PHM A;  1JC1 A;  3G9A A;  4H3M A;  1YHI A;  2QLI A;  4BDU A;  2QU1 A;  2Q57 A;  4XVP A;  3DQ9 A;  4MRY A;  1S6I A;  2H5Q A;  5LTP A;  2V4E A;  4AOM A;  3KCT A;  3DVE A;  2Y1N A;  1K9U A;  2L50 A;  1J7R A;  3SG5 A;  3SG2 A;  5AQB B;  1S6Z A;  2IB6 A;  3BUX B;  4W6S A;  1NX3 A;  3BX9 A;  4H47 A;  5DKR A;  2GGZ A;  5HZU A;  3BUN B;  2OTB A;  3WLC A;  1KFU S;  4IK3 A;  3MSE B;  2SAS A;  1YVH A;  2KI4 B;  1SCV A;  4DS7 A;  3GJ2 A;  4ZCU A;  2AH8 A;  1TNW A;  3DQK A;  2ZND A;  1R6P A;  2LV7 A;  4QJ4 B;  1EJ3 A;  3LL8 B;  4DXP A;  4ORA B;  2OKY A;  1N65 A;  1Y6W A;  1B1G A;  3EKH A;  2PAS A;  2BKH B;  1U5I B;  2KAV A;  1MR8 A;  1MHO A;  1NX0 A;  3NSO A;  1IGV A;  5IBW A;  1MUX A;  3KEV A;  5EHU A;  4IZN A;  1JSA A;  1KQM B;  2RH7 A;  1IWQ A;  1D1O A;  1RWY A;  1EME A;  1ALW A;  4KW8 A;  3BOW A;  4IK4 A;  3W1D A;  3DQE A;  2LUC A;  4CFR A;  2F3Z A;  1KCY A;  5TNC A;  1JFK A;  2JQ6 A;  2JT3 A;  3ZUJ A;  5PAL A;  3PM8 A;  1DJX A;  1JWD A;  1S36 A;  3DF0 A;  4IK9 A;  2NLN A;  3CBE A;  3TUY B;  2I7A A;  3LK1 A;  2AWK A;  3SRY A;  1XA9 A;  1CFD A;  5I8N A;  1SNL A;  1NUB A;  4XOW A;  4Q04 A;  4Q9W A;  1SYM A;  4HVF A;  2OTG C;  4TNC A;  4ZCV A;  3IP2 A;  2YE0 A;  3WCK A;  3WHT B;  3NT3 A;  4EUL A;  3CGL A;  3A8S A;  3CB9 A;  3SVN A;  4YGE B;  5FVI A;  2A4J A;  2B1U A;  3RWT A;  2JOJ A;  1TOP A;  2EMO A;  1Q4D A;  1QVI Y;  4GAO A;  2A53 B;  3I5I B;  4ZIN A;  3ZTF A;  1UUR A;  4DXO A;  1L2O B;  3SS0 A;  3DQF A;  3CTN A;  1ZGO A;  2B3P A;  2KI4 C;  4OR9 B;  2VRG A;  2BTJ A;  1Y1X A;  2G3O A;  2LVJ A;  4QJ5 B;  1OXE A;  4NDC A;  3EVP A;  1SCM B;  1CMG A;  3M24 A;  1A75 A;  1PVA A;  3DQ3 A;  5HW9 A;  2H8Q A;  4C0L A;  4ZF3 A;  2KI6 D;  3LF3 A;  4LJC A;  2LCP A;  1JF2 A;  1REC A;  4RYW A;  1AJ4 A;  3DQM A;  2QAC A;  1KQV A;  1W7S A;  5KTG A;  5K89 A;  5LTR A;  1YUS A;  1C07 A;  3WNX B;  5BTT B;  2PSR A;  1EMF A;  1MOU A;  5HLO A;  2B3Q A;  4KA9 A;  3TS5 C;  2WHU A;  1ZOT B;  4R6B A;  1R2U A;  4DXI A;  1QJT A;  4JRB A;  2VVJ A;  4W75 A;  2LHI A;  2GX2 A;  1ALV A;  4L1I A;  4CID A;  2L4H A;  2H6V A;  3ST0 A;  3I5F B;  1PRW A;  3BXC A;  2V4E B;  4HQ8 A;  1K94 A;  5HBD A;  2ZN8 A;  1GFL A;  2Y0G A;  1ZGQ A;  4ZFS A;  1M45 A;  1EMM A;  2O60 A;  3CWG A;  4LW5 A;  1G4Y R;  4EN1 A;  4CPV A;  1K96 A;  1QXT A;  4GOB A;  2Q4U A;  1YRT B;  3SVB A;  5HLV A;  1XFY O;  3IQQ A;  3D0Y A;  3DQ4 A;  3DQC A;  1SY9 A;  3PJ7 A;  2GX0 A;  2A52 B;  2G16 B;  2E30 A;  1WY9 A;  1LVC D;  3ICB A;  2K2F A;  2PRU A;  4JFG A;  4W6H A;  3OSR A;  2WSO A;  1OXF A;  3CD1 A;  3PN7 C;  1CLL A;  1GJY A;  2PXW A;  4W6T A;  1G33 A;  2GV5 A;  2DUG A;  1G8I A;  3GB3 A;  4W6F A;  5DPI A;  2IB5 A;  4MEW A;  3NT9 A;  1OE9 B;  1JF0 A;  5GQQ C;  3DQ2 A;  1B9A A;  5EXU A;  1GGX A;  1Q4A A;  1QVI Z;  3GK4 X;  2KGB C;  3U0L A;  4OHS A;  2HPW A;  2BCB A;  5HZO A;  1CFC A;  2QLE A;  2AHA A;  1RK9 A;  4W76 A;  4AQI A;  3NSK A;  4ORC B;  3EVV A;  4MN0 A;  1U5I A;  3O2P A;  4I5L B;  2LAN A;  1AUI B;  1BJF A;  2F3Y A;  4W6K A;  3PJB A;  2DUF A;  2LMU A;  3DQI A;  3SSP A;  2WC8 A;  5FVG A;  2L51 A;  5ER4 X;  2AMI A;  4W6A A;  3VRP A;  5AER A;  4ICB A;  3D10 A;  4P76 A;  1CV7 A;  1F55 A;  3H1O A;  2L4I A;  2A47 A;  4FQO A;  1NPQ A;  1EMA A;  3DQ6 A;  4LJB A;  4CLN A;  2QPT A;  1ODB A;  4OCI A;  3AI4 A;  4DRW A;  1GL4 A;  3BUW B;  1LKJ A;  1F71 A;  1XQM A;  1QLK A;  1CFP A;  1XYD A;  3JTD C;  2ARL A;  3ST3 A;  2RGI A;  3VGO A;  4XYN A;  2DUH A;  2JNX A;  5CPV A;  1G7K A;  1S5G Y;  2VZX A;  1BLQ A;  1RRX A;  1A75 B;  3AKB A;  3VK1 A;  2G6E A;  1YUU A;  3PLF B;  1DJG A;  4W69 A;  2BE6 A;  5DPG A;  1RM9 A;  4USL A;  4YI9 A;  1YJF A;  1IJ6 A;  2P4M A;  5HGE A;  3GEX A;  4DXM A;  1SKT A;  4YRU A;  1Q4C A;  3DQU A;  1NP8 A;  3BUO B;  2Z6Z A;  2LVV A;  3GL4 A;  1YHH A;  1RMM A;  1QYQ A;  2WUR A;  4WQ2 A;  1OQP A;  3PSR A;  1NCZ A;  1RRO A;  4L9M A;  1YR5 A;  3SIB A;  3TDZ A;  2LNK A;  3SST A;  1N2D A;  2JXL A;  2ZRT A;  2OJK A;  1IQ5 A;  2JT8 A;  3C1V A;  3DPZ A;  4W6C A;  2MJW B;  3SVD A;  3NEZ A;  2M3W A;  1SRA A;  4F0Z B;  1SL7 A;  1TCO B;  1B4C A;  2KAX A;  3WLD A;  3K1K A;  2HCG A;  4I5N B;  5KU1 A;  3SVE A;  4DKN A;  1PUL A;  4GF6 B;  2LM5 A;  3D0Y B;  1JC0 A;  1OSA A;  1SL9 A;  2O24 A;  3OSQ A;  2WIQ A;  1QLS A;  3DD4 A;  4KW9 A;  1B9C A;  2OTG B;  4W6M A;  5D7F A;  4HRG A;  1M46 A;  4W7E A;  4GNK B;  1TN4 A;  2M49 B;  4HSZ A;  5EXB A;  3ST2 A;  1EXR A;  4NWS A;  1W7U A;  1BFP A;  2WOS A;  2QLH A;  3LF4 B;  2HGD A;  1MQ1 A;  2LP3 A;  3GK1 A;  5EB7 A;  2E6W A;  1BU3 A;  5CSF A;  3DQ8 A;  3U0K A;  2NCO A;  4W77 A;  1K8U A;  3U8C A;  4YGB B;  2KHN A;  3NSI A;  1FI5 A;  3U0N A;  3VIC A;  5I2L A;  3EVR A;  1B7T Y;  4PHJ A;  5DPJ A;  2A54 B;  1A4P A;  1C7V A;  2FZU A;  1YUR A;  1NCX A;  1S5G Z;  3W1C A;  1YVL A;  4PCW A;  4QJ3 B;  4B30 B;  3HX4 A;  4P5O E;  3ZNI A;  4W6P A;  3ST4 A;  1FBV A;  2KFF A;  1CTR A;  3P8U A;  1H6R A;  3M22 A;  4RYS A;  3DVM A;  3AAK A;  2VVH A;  3VRN A;  3OP0 A;  2M9G A;  2OPO A;  2HQZ A;  1V1F A;  3CS1 A;  1JFJ A;  4C0J A;  2K0J A;  2F33 A;  1B8R A;  3SSK A;  3TS5 B;  1WRL A;  1PSR A;  2HQK A;  3DQ7 A;  3LK0 A;  3CFF A;  2JXC A;  2HRS A;  2LLS A;  1HUY A;  3I5G B;  1YX7 A;  2DDD A;  3LA1 A;  1XA5 A;  1JBA A;  3KPX A;  3KO0 A;  3ED8 A;  2CNP A;  4W7F A;  3DQO A;  1QX2 A;  1WRK A;  4XGY A;  5DRG A;  3VRO A;  1PK0 D;  2ZMW A;  4EDS A;  3NED A;  1AJ5 A;  1YJ2 A;  1LA3 A;  1JC2 A;  4MLW A;  2V53 A;  1F0B A;  2G6X A;  1DGV A;  4J89 A;  2OS8 B;  4I5K A;  1J7Q A;  1KYP A;  1DF0 A;  3BXK A;  4OJ0 A;  1BMO A;  1QXP A;  1NCY A;  1A29 A;  3PN7 B;  1MXL C;  3LLE A;  1H8B A;  3EKJ A;  2Z6Y A;  2EMN A;  1K9P A;  1UWO A;  4ZB1 A;  4PE0 A;  2LMV A;  2EC6 C;  2LVK A;  4UTS A;  3CR2 A;  1PSB A;  4OVN F;  5HKW A;  1A2X A;  2CXJ A;  4I2Y A;  3P28 A;  1YZW A;  1Q80 A;  4PPK A;  2BBN A;  1CDP A;  1PAL A;  4M2Q A;  2IOV A;  1SPY A;  3E3R A;  1HQV A;  3O78 A;  3SVO A;  1HCJ A;  1J1E A;  1S26 D;  3ZWH A;  1KP5 A;  1ZMZ A;  1ZGP A;  1EG3 A;  4WRI A;  3SVS A;  2Y4Q A;  2MLF C;  4KGE A;  5DKN A;  4N1F A;  2CTN A;  1XFW O;  2WCE A;  1B7T Z;  2M29 A;  4A4B A;  2HET A;  1CLB A;  5EXC I;  1BOC A;  4PE1 A;  1QX7 A;  3BXA A;  3ZUL A;  3I5G C;  4HRE E;  1DGU A;  2JTZ A;  3CGA A;  1F70 A;  4DXQ A;  2A50 B;  1K9K A;  5HKZ A;  4NDB A;  3FWC A;  3FS7 A;  1M39 A;  1CM1 A;  2KGR A;  1KSO A;  2H61 C;  1CB1 A;  3CD9 A;  2DD7 A;  4M2O A;  1UUS A;  1QTX A;  1EMB A;  1QV1 A;  1XAE A;  1TNX A;  4MRX A;  2OS8 C;  4W7R A;  1OXD A;  2KYF A;  3PJ5 A;  3JTD B;  2JPT A;  3WXA A;  1SR6 C;  2YFP A;  4MVF A;  2F2P A;  1JUO A;  3ADF A;  1J7P A;  1BF5 A;  1OZS A;  4W6B A;  1NSH A;  1VRK A;  2BCA A;  3H1R A;  2A46 A;  3RLZ A;  4XJK A;  2DD9 A;  3RM1 A;  1QIW A;  3EK7 A;  1M31 A;  4W7X A;  1GGW A;  1KYR A;  1BR1 B;  4W6R A;  1EML A;  4AS8 A;  1MF8 B;  1QV0 A;  5I2Q A;  2QLG A;  4P2Y B;  4IK1 A;  5CSJ A;  1K93 D;  1XFU O;  4W6G A;  1UHK A;  2I94 A;  3KCS A;  2WHT A;  1CKK A;  2KQY A;  3SG4 A;  4WQ3 A;  1AHR A;  1CMF A;  1M63 B;  4OY4 A;  3DQJ A;  3VHT A;  4IL1 A;  2JNF A;  3I5H C;  2BL0 C;  4B30 A;  4W6N A;  2MLE C;  2HJO A;  3BUM B;  2JRF A;  2WND A;  2P6B B;  2DDC A;  3O77 A;  3F45 A;  2LUX A;  4ORB B;  3FIA A;  2M97 A;  3DQD A;  2SCP A;  2BCX A;  1WDC C;  3KF9 A;  2G2S B;  3S05 A;  1UHJ A;  2ZFD A;  2VAD A;  4ETO A;  2OKW A;  2JTT A;  1DF0 B;  2C9I A;  4PPL A;  4C0K A;  2Y5I A;  4W7C A;  1K2H A;  5DPH A;  1EG4 A;  2JWW A;  5AEQ A;  2NZ0 A;  4HQ9 A;  1QAT A;  2BE4 A;  2LHL A;  4MSP A;  2H61 A;  2CBL A;  4B5Y A;  1XSS A;  1EH2 A;  2KDH A;  1NYA A;  2M1U A;  1FF1 A;  2LMT A;  2F2O A;  5KSZ A;  2OGR A;  4IK5 A;  2ZNE A;  1E8A A;  3FWB A;  2G9B A;  4JPZ B;  3WHU B;  2BBM A;  1QY3 A;  1Q4E A;  2M7L A;  1K95 A;  2VVI A;  2ZRS A;  3LVD A;  1CNP A;  1KK7 Y;  2I18 A;  1W7T A;  2L2E A;  3SVC A;  4A4C A;  2LE9 B;  5KTY A;  2LC5 A;  3U0M A;  1X02 A;  1V1G A;  3SJS A;  1CDL A;  3O6B A;  4IK8 A;  1CDN A;  2QT2 A;  2KAY A;  4PDZ A;  2KOT A;  4OQW A;  4KF5 C;  3QRX A;  2TN4 A;  2GGM A;  1SMG A;  1KFX L;  2Q91 A;  2PXS A;  3DQL A;  4KEX A;  3SIA A;  1KSM A;  4PE4 A;  5HZS A;  2QZ0 A;  4MZK A;  1CDM A;  1RTP 1;  3E5V A;  4YGD B;  4GGF C;  2POX A;  2CT9 A;  3PAL A;  5F9G A;  1WLZ A;  1XO5 A;  4GPL B;  4EMQ A;  2IS9 A;  5HZT A;  1J7O A;  1Y0V H;  3AKA A;  3LVC A;  3BQ3 A;  1LXF C;  1CFF A;  2MBX A;  4YI8 A;  1Z1P A;  4W6O A;  1QAS A;  2ZKM X;  1J55 A;  1DMO A;  3GJ1 A;  4U8D A;  1IJ5 A;  1IKU A;  1TIZ A;  3CLN A;  4L12 A;  3GOF A;  3NF0 A;  1BT6 A;  4J8A A;  4Z4M A;  4W6D A;  4GGN A;  4FTG A;  3DPW A;  1J1D A;  3LSA A;  1ZUZ A;  1JBZ A;  4GES B;  2NXQ A;  1IQ3 A;  2KBM A;  3DQ5 A;  3DPX A;  3VRQ A;  3EK8 A;  4XJK B;  3SSL A;  4TZA A;  4J88 A;  5DY6 A;  5CSI A;  2WSN A;  1KK8 C;  3K21 A;  2QLG B;  5JOL A;  1JBY A;  1C4F A;  3NSL A;  2LP2 A;  5DTX A;  3LS3 A;  2EC6 B;  4DUQ A;  1WRZ A;  4GUK A;  1OZO A;  4W6U A;  2KI6 C;  4D1E A;  4W6L A;  1DT7 B;  5B8I B;  2L0P A;  2G3D B;  1XFX O;  2I2R E;  3VHT B;  1TNQ A;  3SVU A;  1CM4 A;  5DTL A;  4W7A A;  4HRH A;  2K7C A;  1DJY A;  1XFZ O;  4MZJ A;  2WCB A;  1KWO C;  5BQL A;  1AVS A;  5DRF A;  5EB6 A;  3V3D A;  1ZFS A;  4L13 A;  2LLU A;  2EMD A;  2EHB A;  1Q73 A;  1YFP A;  2Y1M A;  1DJH A;  3SVR A;  1RJV A;  1KK7 Z;  2MAZ A;  4KW4 A;  1L7Z A;  1QYO A;  1TTX A;  3GK2 A;  3DQA A;  2AWJ A;  4JQ0 D;  3BYA A;  4N3D A;  4BY4 A;  4KF5 A;  2O29 A;  2CCM A;  4MZL A;  1EL4 A;  3E5T A;  1BR4 B;  1TCF A;  1DJI A;  4TZG A;  3AAJ A;  1W7I B;  4KGF A;  5I2O A;  2L98 A;  4GGF A;  1N0Y A;  3PAT A;  2FWQ A;  1OMR A;  1YTZ C;  3IF7 A;  3LCP C;  1MOV A;  2PAL A;  3JVT C;  2H5R A;  5J2O A;  4PHK A;  4YGA A;  1QIV A;  4U2V A;  2KYC A;  4KAG A;  2MA2 A;  1KFX S;  2AWM A;  1S6C A;  2HF5 A;  2JT0 A;  4AR7 A;  4W72 A;  1QYF A;  2AWL A;  2BKI B;  2JU0 A;  2FJU B;  4LQU A;  1SR6 B;  1IG5 A;  1YX8 A;  4PE7 A;  3A4U B;  2G6Y A;  1UHN A;  2KNE A;  2M8U A;  5HKY A;  2GW3 A;  5ER5 A;  1BOD A;  1Q4B A;  2M7N A;  1XK4 C;  1DVI A;  1AP4 A;  4AQJ A;  2F8P A;  2ZMU A;  1QX5 B;  3OX6 A;  4XL5 A;  1ZAC A;  3HCM A;  2K7D A;  4DIR A;  4Z4K A;  3CZT X;  1DJZ A;  4GFT A;  5G08 A;  1EMK A;  1FI6 A;  2HQ8 A;  1SW8 A;  1F8H A;  2O2B A;  5DTZ A;  4PAL A;  4XOV A;  3AKO A;  1KQM C;  3O4Y A;  4DKM A;  1IRJ A;  3CFH A;  2WHS A;  3I5H B;  2BL0 B;  4JWQ A;  3U8A A;  3IQO A;  3M0W A;  5T3I A;  4ZBL A;  4ZF5 A;  5BT0 A;  1SL8 A;  1ZUX A;  1LIN A;  5FVF A;  3RWA A;  4H48 A;  2HGY A;  4LJD C;  4Q7R A;  1WLM A;  1GGZ A;  5D69 A;  3SG7 A;  3PFV A;  1WDC B;  2L5X B;  2M1K B;  4KF4 A;  2H5P A;  3DQN A;  3TUY C;  1W7J B;  4R1E A;  3OGO A;  1IH0 A;  1UIS A;  2FCE A;  2A56 B;  5FYX A;  4UPG A;  4DCK A;  3SSY A;  2VAE A;  2MHH A;  1FPW A;  3OB2 B;  2ZO7 A;  2YE1 A;  1F4O A;  1LA0 A;  2K7O A;  5CSN A;  1AK8 A;  4EDO A;  3UFZ A;  1NX2 A;  2AUC A;  1C7W A;  4GBA A;  2HPS A;  4N5X A;  2JZI A;  1H4B A;  5DKQ A;  2JAD A;  3DVK A;  3H4S E;  1GQM A;  2JC2 A;  3EK4 A;  5J3X A;  3TMR A;  4JF9 A;  3I5I C;  5F6T A;  1L2O C;  2NCP A;  3SG3 A;  5AFP A;  1MWN A;  1RMP A;  3SSV A;  1SBJ A;  5EBJ A;  5LK4 A;  1HT9 A;  1Z1Q A;  4HE4 A;  3UG0 A;  5LTQ A;  1Y1U A;  1OMV A;  1SCM C;  2OTE A;  2WIS A;  1B8L A;  4Q7U A;  1YHG A;  2YDZ A;  4LQT A;  2JUL A;  3BXB A;  1TRF A;  2R2I A;  2IE2 A;  2KSP A;  1EMG A;  1NIW A;  5BPJ A;  4W6J A;  4H3N A;  2EGD A;  2PMY A;  2DUE A;  3BOW B;  5AXI A;  1KYS A;  1K90 D;  1XK4 A;  1S1E A;  3IR8 A;  3OB1 B;  2KFG A;  1NWD A;  1F4Q A;  2M0R A;  2FL1 A;  1UHI A;  2O5G A;  3LVA A;  4RTC A;  1MYW A;  4ANJ A;  1MXE A;  3MGF A;  2D8N A;  3DF0 B;  1YRU B;  3TDU A;  4I5J A;  3TZ1 A;  4E68 A;  3OHM B;  3TDI A;  2DUI A;  2WCF A;  1UP5 A;  1Y1A A;  5H89 A;  4JC2 A;  2HQW A;  2Z1O A;  2ISD A;  1KFU L;  1F09 A;  1DTL A;  3DQ1 A;  1BG1 A;  1EMC A;  3I5F C;  1QS7 A;  2V4E C;  4PHN A;  2HFC A;  5DQM A;  5DQB A;  3NXA A;  4ORN A;  1TNP A;  4Q9X A;  2ZN9 A;  2LLT A;  5JJG A;  3E5W A;  1F54 A;  1NX1 A;  4LJD A;  1H4U A;  3SG6 A;  1A03 A;  2LAP A;  1SK6 D;  4JEO A;  2AAO A;  2QRF A;  4CFQ A;  5DTY A;  4NQG A;  5H87 A;  4ZF4 A;  3OX5 A;  2Q6P A;  4YBH B;  2KFH A;  2KQ6 A;  4BY5 A;  2A48 A;  2COL B;  1KK8 B;  3CFA A;  2H2K A;  5EJU A;  3U8P A;  3KHE A;  1OMD A;  2G2B A;  4W7D A;  3SV5 A;  1PVB A;  2G5Z B;  1RFJ A;  2WOR A;  3DQH A;  2K61 A;  2H9W A;  3EVU A;  4PPJ A;  1XMZ A;  2GW4 B;  1RMO A;  4H3L A;  4JGE A;  1B8C A;  4W6I A;  4MBE A;  3PIB A;  2ZO6 A;  2C9J A;  1FW4 A;  1KWO B;  4OKH A;  1YUT A;  3VRR A;  1DJW A;  4Q7T A;  3A8R A;  2BEC A;  3AI5 A;  2MRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...