3SG3A

Crystal structure of gcamp3-d380y
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 138
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg3A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg3A02
1DJHA 2QLGA 1FBVA 2DDDA 2DUEA 1JBAA 4YGBB 5DTZA 2LP2A 1MUXA 3WHUB 5H89A 1QYQA 2D8NA 1YVLA 1AVSA 1EMCA 3M22A 1ZUXA 3SSPA 3LVCA 4R6BA 1KWOB 3I5HC 2MHHA 2M1UA 4XJKA 2RGIA 3TDUA 1YUSA 1E8AA 3SVUA 4YGEB 2ZMUA 1H4UA 1L2OB 1SL7A 2LLTA 5HBDA 3I19A 3U0NA 1FI6A 3O77A 1GL4A 1DF0B 3OX5A 2QLIA 1KYPA 1QV0A 2AWJA 2WSNA 5AEQA 1H8BA 2JT0A 1QX7A 2A56B 3I5GC 4XL5A 3AAJA 5CSFA 1Q4CA 3BUXB 5CSJA 2A48A 1PRWA 2K2FA 2M1KB 4C0LA 3D0YB 3GK2A 1KFUL 1QVIZ 1CFDA 2VRGA 4CFQA 1IJ6A 1TCFA 1TOPA 1TTXA 4LQUA 3WXAA 2VVJA 4H47A 5KTGA 4OR9B 3AKBA 4W6NA 2DUIA 2AWLA 4LJDC 1WRZA 2C9IA 4NDCA 3WCKA 1H4BA 2ZMWA 1IH0A 4XVPA 1LVCD 1OSAA 4ZCVA 1PSRA 2WHUA 1JFKA 3JVTC 4KPIA 1CM4A 2JQ6A 3ZUFA 2L0PA 3LL8B 4HQ8A 3PFVA 3DQ2A 1EMEA 4Q9WA 4W73A 5EB7A 5EXCI 2BCAA 4WRIA 1S3PA 4FTGA 2AMIA 1KSMA 3PIBA 2H61C 3BXBA 2KGBC 4PHMA 1XQMA 3I5FB 1N65A 2CNPA 5EXUA 2KGRA 1L7ZA 1K9KA 3EK7A 3SSVA 1Q4EA 1W7TA 2ZNEA 1XSSA 5DRFA 3DQ8A 2LHLA 1AP4A 5HZOA 3EKHA 1J7RA 1M31A 5HKZA 4MN0A 4ZINA 4BY5A 2A53B 3SVEA 4GBAA 2PALA 2TN4A 4CLNA 4P76A 4RTCA 1YFPA 4ICBA 4A4BA 4ZF3A 5DU0A 3RLZA 4KW4A 1KQMC 1OOJA 2K0JA 5DKNA 1XYDA 4IL1A 3G9AA 5HYDA 3IP2A 4R6DA 2FCDA 2Y1NA 2L2EA 3SG3A 4W6PA 1A4PA 1UP5A 3FIAA 1F0BA 3FWBA 3F45A 1XAEA 1DT7B 4P2YB 1SCMB 1OXEA 2KBIA 3DQAA 4DS7A 4IZNA 2LC5A 4MLWA 5KU1A 3BX9A 2LMTA 2H61A 2GW3A 4QJ5B 2QACA 4N3DA 1LA3A 4W6RA 4HVFA 1DVIA 5JOLA 2RH7A 2L5XB 2A54B 5KTYA 4HRGA 1JC1A 4NQGA 4NDDA 4ORCB 1YURA 3PJBA 2EMNA 1PVAA 2LVIA 2JXCA 3VHTB 5D7FA 3A4UB 4OGSA 4XOVA 2Z6ZA 1DJWA 4JEOA 3VROA 5HKYA 3RWAA 1HUYA 4OKHA 3EK4A 2KNEA 1DGVA 3PN7B 3SIBA 1WDCB 1V1GA 1K94A 1EMKA 3GEXA 1NIWA 1J55A 4CFRA 3OSQA 2BE6A 2OKWA 1RECA 2NLNA 2LNKA 3E5VA 1Z1QA 1EMMA 1QLSA 1EJ3A 3JTDB 4OY4A 5DKRA 3AAKA 2QLGB 1Z1PA 1F4QA 2CXJA 3OGOA 4PE4A 1QYFA 1ALVA 2H5PA 3SVBA 4ZF4A 1B8RA 3ZNIA 2MAZA 2ZRTA 2K8MB 3LK0A 1K8UA 1KFXL 5H88A 2OGRA 4A4CA 1A29A 2BKHB 4XJKB 1PSBA 2M7NA 3H1OA 1NP8A 3TDIA 3KO0A 2KSPA 2K61A 3NSIA 2EMOA 3RWTA 1AHRA 3PALA 1YHHA 5JJGA 1FW4A 3OX6A 1B7TZ 3EVPA 4RYSA 3IQQA 5DPGA 5FVGA 1QIWA 3NF0A 2EC6C 1QASA 2Y1MA 2GGMA 1NPQA 1WLZA 1SR6C 4H48A 1S5GZ 1AJ4A 2SCPA 1D1OA 3UFZA 1EG3A 1ALWA 4MZJA 4DKMA 2OTEA 4P5OE 2ZN9A 4JPZB 2G3OA 4L13A 4W75A 1NX1A 1XA5A 1IWQA 1K96A 1JBYA 3DD4A 1MXLC 1F8HA 1LINA 3DVEA 2COLB 1YR5A 2BTJA 4N5XA 3DQLA 2BECA 4W6OA 1UHNA 1OZSA 3SVCA 4EN1A 4H3NA 3MSEB 2KI6D 1RMMA 2YFPA 2GGZA 3O6BA 4UPGA 3ZULA 4MZKA 3IQOA 4Z4MA 4HREE 2I94A 1KSOA 2LP3A 4I5LB 4IK3A 2CTNA 4PPJA 2M8UA 1OQPA 3M24A 4JQ0D 1JUOA 2G6YA 1WY9A 2YE0A 3ED8A 2I7AA 5J3XA 2M3WA 1S6JA 3DPWA 2B1UA 4LJBA 5DQMA 3VK1A 2G6EA 4L1IA 2FZUA 1YX7A 2M29A 4MEWA 2K7BA 2DUGA 5IBWA 5LTPA 3DQEA 3BXKA 5CSIA 2VAEA 4EDSA 3SVDA 4W6SA 1W7SA 5EB6A 1F09A 1QLKA 1F71A 1SPYA 2HQWA 1S26D 4DRWA 4PHNA 5DKQA 1YRTB 3GL4A 4ZFSA 2L51A 4PCWA 1BG1A 1Y6WA 5EBJA 3DQ7A 2LLUA 4HQ9A 2G2BA 4MRYA 2Y4QA 1IQ5A 2ZKMX 3U8AA 4BY4A 5F6TA 1XO5A 4OQWA 1NYAA 4P1QA 2PVBA 3NEZA 1QATA 1SKTA 5CPVA 3JVTB 1ZGOA 1C07A 4Q9XA 1F54A 1QIVA 1BFPA 2FL1A 3CWGA 2JADA 3ST4A 5BT0A 5DPJA 1QY3A 2AH8A 3BQ3A 4ORBB 5HZSA 4I5KA 3UG0A 1B47A 2H2KA 4W6AA 1ZFSA 4DIRA 1XK4A 3TS5B 3AKAA 4AS8A 4WQ3A 2MJWB 1K9PA 4H3MA 4KGEA 4KW9A 1W7JB 4JGEA 1Y1AA 3W1CA 3GK1A 4GFTA 2KAYA 3TUYC 4DXPA 2YDZA 1EMAA 4AQIA 5FVIA 4LQTA 2V4EC 3BXCA 2G3DB 2F3ZA 1SNLA 1NSHA 2PXSA 3SSTA 1G33A 1AK8A 4DXIA 3DQKA 2Y5IA 4PALA 5I8NA 2L98A 4W7AA 4W72A 2BL0C 2ARLA 5DTXA 3SSLA 3SVNA 5DQBA 4UTSA 3SG2A 2PRUA 4XYNA 3U0KA 4Q7TA 3PJ7A 2Y0GA 1S5GY 3VRQA 3CB9A 1JC2A 2PMYA 5B8IB 4RYWA 3A8RA 1RWYA 3OSRA 1R2UA 1CB1A 4USLA 2JNFA 3SG6A 2KDHA 2AAOA 4W7DA 4PE0A 1K2HA 3BOWA 2M49B 1JF2A 4KF4A 3RM1A 3GJ2A 2IB6A 4IK4A 2WCEA 5AFPA 1S6ZA 3MGFA 3DQUA 5EHUA 1CLLA 1SY9A 4DKNA 1K93D 2PASA 1BLQA 2F2PA 1C7WA 1MR8A 3KF9A 5ER5A 2ICRA 5HZUA 2K7CA 4W7XA 2Z1OA 3HCMA 1DMOA 1CDPA 2HPWA 2BCBA 1KWOC 2GW4B 2AUCA 3DQOA 2PXWA 2WORA 2H5OA 1ZGPA 3LK1A 3IF7A 4PE7A 4PE1A 4JWQA 1L2OC 1N0YA 3CLNA 1IKUA 4KA9A 5TNCA 3SVSA 3VRPA 4MRXA 3P28A 2HGYA 1WRKA 1ZMZA 1RM9A 1YZWA 3VRRA 4J88A 2KAVA 3SRYA 1PK0D 4CIDA 4LJDA 1DJIA 2IE2A 3DF0A 1YHGA 1UHJA 4GPLB 5HLOA 3TMRA 2LUXA 1OMDA 2FJUB 1X02A 4WQ2A 3H4SE 3DQMA 5DRGA 5G08A 3EKJA 5BTTA 4ORNA 3H1RA 4YBHB 1B4CA 4TZAA 3LVDA 2Q91A 4AOMA 1SYMA 3CBEA 2LCPA 3DVMA 3SSKA 1GGZA 2LVVA 1EMLA 4KF5C 1RFJA 1CFFA 2KFGA 2G6XA 1Q80A 1SBJA 3DPZA 1CTRA 3QRXA 4M2PA 1SL8A 2H5QA 2HGDA 1IG5A 2A47A 2LUCA 1WRLA 1CLBA 1B8CA 4U8DA 2VADA 4MZLA 1A2XA 2EC6B 1K95A 3NT9A 1EH2A 3GOFA 2LAPA 1NUBA 3E5WA 4OVNF 4I5NB 5LK4A 5DY6A 4GESB 2K2AA 3E3RA 2OJKA 1S6IA 4GUKA 1OXFA 1DJZA 4ZBLA 2H6VA 3PM8A 4R1EA 2K7OA 1MWNA 3I5FC 3BUMB 3TZ1A 3VICA 1DJXA 3CFHA 1CFCA 5BQLA 1RROA 5ER4X 4D1EA 4MBEA 2BCXA 2JT8A 2DUFA 2WHTA 1BU3A 1VRKA 1A75A 2WNDA 5FYXA 2KHNA 2HQZA 5AQBB 2LVJA 4W6TA 4JFGA 3EVVA 2F33A 1BF5A 1QVIY 1YJFA 4NWSA 1TCOB 4PDZA 1QJTA 1B1GA 2IOVA 1C4FA 1M63B 1YVHA 4M2QA 3U0LA 4PFEA 2DUHA 2WOSA 2MLEC 5I2LA 2KYFA 1EL4A 2ZO6A 4W76A 3SJSA 1TIZA 2JTTA 1SCMC 2LHIA 1BJFA 2HF5A 3DQNA 3ZUJA 3I5IB 4Q7RA 2HCGA 4BDUA 2LMVA 2FCEA 1KK7Z 3DQ9A 1V1FA 4GGFC 1QS7A 3NXAA 3LSAA 5LTRA 3EVUA 2BKIB 3P8UA 4PPLA 2QT2A 2ZFDA 1IGVA 1B9CA 3DQIA 3SSYA 4EULA 1TNPA 5K89A 2WURA 2OTBA 3SSHA 2KQYA 1PALA 2E30A 2CBLA 1UHIA 4U2VA 1QXTA 3OP0A 2ISDA 2B3QA 1OMRA 1JF0A 3LA1A 4KGFA 1Q73A 1F55A 4NDBA 4KAGA 3K1KA 5CSNA 1M46A 2A50B 1BR4B 1EMFA 2LE9B 4Z4KA 1QV1A 3PN7C 3LF3A 1CDLA 3D10A 3DQ6A 4AR7A 1GGXA 4GNKB 3LF4B 1F4OA 3SG4A 1XFZO 2LVKA 3GB3A 2SASA 4B30A 3I5HB 1BMOA 2JU0A 1RRXA 4DXMA 3SG7A 4YGCB 1SL9A 3BOWB 4QJ4B 1TN4A 1JSAA 3E5TA 3JTDC 4HRHA 1CLMA 4W6DA 2LM5A 1S36A 2KOTA 4W6BA 1LXFC 2JTZA 1Y1UA 1QX5B 5AANA 3CFFA 4GGFA 2JWWA 2KAXA 4W6LA 3PLFB 2JXLA 2HETA 3I5GB 2Q6PA 3GK4X 4LJCA 2G16B 1OZOA 3ST2A 3DQDA 1W7IB 5BPJA 3CTNA 4ORAB 1JFJA 2KI4C 1NWDA 1AJ5A 5DPIA 2CCMA 4OHSA 4W6IA 2DD7A 3AI5A 1U5IA 1YTZC 4HSZA 3HX4A 1GQMA 2ZO7A 3PSRA 2DOQA 2BL0B 3KEVA 2P6BB 3DQ5A 1XMZA 3V3DA 4TNCA 2QZ0A 1CDMA 2KBMA 3DF0B 3CD1A 1ODBA 1ZACA 4J89A 2OS8C 3KHEA 2E6WA 1ZUZA 2H5RA 2DD9A 1CV7A 5BTTB 2KFFA 1J7PA 4PHKA 2QLEA 1SMGA 1XVJA 1EMGA 2I2RE 2HPSA 1Q4AA 1H6RA 1DJYA 3CZTX 3DVKA 1EXRA 4I5JA 2A52B 4E68A 1OE9B 4CPVA 1XFWO 4EMQA 3U8PA 3KPXA 2HFCA 4YI8A 1K90D 5HZTA 3ST0A 2L4HA 4KEXA 1KK8C 1JBZA 1KFXS 2OTGC 3LLEA 1BT6A 1IJ5A 3ICBA 3C1VA 2VVIA 2JC2A 4W77A 1CNPA 2HQKA 1KYRA 3VGOA 3PATA 2LLSA 1RJVA 3OHMB 1CM1A 1WLMA 2HRSA 1PVBA 2M97A 1OMVA 2JZIA 2EHBA 1KQVA 1KQMB 2GV5A 1C7VA 3BUNB 3AI4A 1B7TY 1KK7Y 2MBXA 4XGYA 3CD9A 3SIAA 1DTLA 1A75B 1J1DA 2V53A 3BXAA 2M9GA 5AXIA 1AUIB 1TNWA 2L50A 4HQCA 1SCVA 1UURA 3K21A 5AERA 4IK5A 2Z6YA 4YGAA 5I2OA 1YX8A 2ZNDA 2EMDA 1F70A 5HGEA 3ZTFA 4C0JA 3SVOA 4W6UA 4ZF5A 4ETOA 2POXA 3DQ4A 1ZOTB 1SRAA 1MYWA 2WCFA 1IQ3A 4PHJA 2LANA 2F8PA 2Q57A 2WIQA 1YHIA 2JNXA 3CFAA 1MOUA 1M39A 1HQVA 1YRUB 2H8QA 4GF6B 1S6CA 5EXBA 2IS9A 4JRBA 2JRFA 3A8SA 3KCSA 4YI9A 1Y0VH 2V4EA 3NSOA 4FQOA 4W6MA 5DTLA 1QTXA 2JPTA 1G4YR 3TS5C 2Z6XA 3DQ3A 4N1GA 3LVAA 3WNXB 1KCYA 1GFLA 3PJ5A 4ANJA 2C9JA 1QX2A 2WISA 3TMTA 1M45A 3KCTA 1BODA 1YUUA 2F3YA 3OB2B 3AKOA 1CMFA 1NCZA 1TNXA 4JF9A 3O78A 4XOWA 3U8CA 1GGWA 1RMOA 3GJ1A 3SG5A 2AWMA 3DQHA 3DQ1A 2FOTA 4PPKA 3BYAA 4YRUA 1CMGA 5HW9A 1UISA 4IK8A 5GQQC 1HT9A 4B30B 2LV7A 3NSLA 2JULA 2GX2A 2BBMA 1IRJA 1N2DA 2L4IA 5FVFA 3LS3A 4QJ3B 1J1EA 3DPXA 2AHAA 3NSKA 1RTP1 3BUWB 1YUTA 3SVRA 4MVFA 3DQFA 2AWKA 5T3IA 4W7FA 2G2SB 2K7DA 1SW8A 4HE4A 1FF1A 1SR6B 2H9WA 4GGNA 1Q4DA 4DXNA 3WLCA 2IB5A 3SV5A 2GX0A 5EJUA 4JC2A 1DF0A 3NT3A 2HJOA 4N1FA 3O2PA 2M7LA 1RMPA 1U5IB 5DTYA 4OJ0A 5PALA 3WHTB 4ZIOA 1XFVO 3SS0A 3NEDA 3D0YA 1GJYA 3DQJA 2BBNA 2I18A 3S05A 1NCXA 2ZRSA 5FHVA 2G5ZB 3DVJA 4DCKA 2OKYA 4OV2A 2MRDA 1G7KA 3CS1A 1KFUS 1CDNA 1EMBA 2OPOA 2O2BA 5I2QA 4W6JA 1JWDA 3U0MA 2O60A 1FI5A 2QLHA 1MOVA 4DXOA 1J7QA 4KF5A 2JOJA 4GOBA 3EK8A 2PSRA 1FPWA 2WSOA 1MQ1A 4DUQA 4OCIA 3WLDA 2MLFC 1XFUO 2NCOA 2DDCA 1XA9A 4LW5A 4C0KA 2VZXA 4W6CA 1NCYA 4IK1A 3ST3A 4IK9A 1UUSA 2QRFA 1S1EA 1UHKA 3BUOB 3W1DA 1NX3A 4J8AA 1Q4BA 1DGUA 1TRFA 2KI4B 1TNQA 1CKKA 4W7RA 1B8LA 3FS7A 3LCPC 2KFHA 2MA2A 1MHOA 2F2OA 1UWOA 1RK9A 4EDOA 2NZ0A 4ZCUA 2G9BA 2QU1A 2BE4A 3FWCA 2YE1A 1BOCA 1LA0A 4TZGA 2VVHA 4W6HA 2WHSA 3TDZA 2OS8B 5HKWA 1XFYO 2M0RA 1QYOA 4W6GA 5H87A 1PULA 1NX0A 4W6FA 4H3LA 2KQ6A 1WDCC 2O5GA 4L12A 1KP5A 1NX2A 4I2YA 1W7UA 1YJ2A 1HCJA 1MF8B 1QXPA 4W74A 4YGDB 2HQ8A 2CT9A 4DXQA 3CR2A 2JT3A 3M0WA 5J2OA 1A03A 1ZGQA 3OB1B 4F0ZB 1XFXO 2FWQA 1CFPA 4W6KA 2Q4UA 1KK8B 1SK6D 2OTGB 2QPTA 3CGAA 2LMUA 2R2IA 1DJGA 3CR5X 2WCBA 2KI6C 5HLVA 1K9UA 3CR4X 1Y1XA 2A4JA 1J7OA 1UHHA 3TUYB 5DPHA 3VRNA 2NCPA 2V4EB 2A46A 2ZN8A 2O24A 1XK4C 5D69A 1G8IA 3VHTA 1B9AA 3I5IC 3O4YA 4W7CA 4B5YA 4GAOA 3DQCA 4M2OA 2O29A 3IR8A 1EG4A 4AQJA 4W69A 4Q04A 2KYCA 1KYSA 1BR1B 5KSZA 3ADFA 2B3PA 3EVRA 3CGLA 4MSPA 1OXDA 3ZWHA 1LKJA 2P4MA 2EGDA 1R6PA 4W7EA 5F9GA 4ZB1A 1JC0A 2WC8A 4KW8A 5LTQA 1MXEA 4L9MA 4Q7UA 2NXQA
chains in the Genus database with same CATH superfamily
1DJHA 2QLGA 1FBVA 2DDDA 2DUEA 1JBAA 4YGBB 5DTZA 2LP2A 1MUXA 3WHUB 5H89A 1QYQA 2D8NA 1YVLA 1AVSA 1EMCA 3M22A 1ZUXA 3SSPA 3LVCA 4R6BA 1KWOB 3I5HC 2MHHA 2M1UA 4XJKA 2RGIA 3TDUA 1YUSA 1E8AA 3SVUA 4YGEB 2ZMUA 2PYQA 1H4UA 1L2OB 1SL7A 2LLTA 5HBDA 3I19A 3U0NA 1FI6A 3O77A 1GL4A 1DF0B 3OX5A 2QLIA 1KYPA 1QV0A 2AWJA 2WSNA 5AEQA 1H8BA 2JT0A 1QX7A 2A56B 3I5GC 4XL5A 3AAJA 5EL2A 5CSFA 1Q4CA 3BUXB 5CSJA 2A48A 1PRWA 2K2FA 2M1KB 4C0LA 3D0YB 3GK2A 1KFUL 1QVIZ 1CFDA 3L47A 2VRGA 4CFQA 2WCKA 1IJ6A 1TCFA 1TOPA 1TTXA 4LQUA 3WXAA 2VVJA 4H47A 5KTGA 4OR9B 3AKBA 4W6NA 2DUIA 3R1OA 2AWLA 4LJDC 1WRZA 2C9IA 4NDCA 3WCKA 1H4BA 2ZMWA 1IH0A 4XVPA 1LVCD 1OSAA 4ZCVA 2BAPA 1PSRA 2WHUA 1JFKA 3JVTC 4KPIA 3OBVA 1CM4A 2JQ6A 3ZUFA 2L0PA 3LL8B 4HQ8A 3PFVA 3DQ2A 1EMEA 4Q9WA 4W73A 5EB7A 5EXCI 2BCAA 3PJIA 4WRIA 1S3PA 4FTGA 2AMIA 1KSMA 3DY9A 3PIBA 2H61C 3BXBA 2KGBC 4PHMA 1XQMA 3I5FB 1N65A 2CNPA 1LS8A 5EXUA 2KGRA 1L7ZA 1K9KA 3EK7A 3SSVA 1Q4EA 1W7TA 2ZNEA 1XSSA 5DRFA 3DQ8A 2LHLA 1AP4A 5HZOA 3EKHA 1J7RA 1M31A 5HKZA 4MN0A 4ZINA 4BY5A 2A53B 3SVEA 4GBAA 2PALA 2TN4A 4CLNA 4P76A 1YFPA 4RTCA 4ICBA 4A4BA 4ZF3A 5DU0A 3RLZA 4KW4A 1KQMC 1OOJA 2K0JA 5DKNA 1XYDA 4IL1A 3G9AA 5HYDA 3IP2A 4R6DA 2FCDA 2Y1NA 2L2EA 3SG3A 4W6PA 1A4PA 1UP5A 3FIAA 1F0BA 3FWBA 3F45A 1XAEA 1DT7B 4P2YB 1SCMB 1OXEA 2KBIA 3DQAA 4DS7A 4IZNA 2LC5A 4MLWA 1SSEB 2WCHA 5KU1A 3BX9A 2LMTA 2H61A 2GW3A 4QJ5B 2QACA 4N3DA 1LA3A 4W6RA 4HVFA 1DVIA 2KLEA 5JOLA 3R72A 2RH7A 2L5XB 2A54B 5KTYA 4HRGA 1JC1A 4NQGA 4NDDA 4ORCB 1YURA 3PJBA 2EMNA 1PVAA 2LVIA 2JXCA 3VHTB 5D7FA 3A4UB 4OGSA 4XOVA 2Z6ZA 1DJWA 4JEOA 1OW4A 5D3OA 3VROA 5HKYA 3RWAA 1HUYA 4OKHA 3EK4A 2KNEA 1DGVA 4PT1A 3PN7B 3SIBA 1WDCB 1V1GA 1K94A 1EMKA 3GEXA 1NIWA 1J55A 4CFRA 3OSQA 2BE6A 2OKWA 1RECA 2NLNA 2LNKA 3E5VA 1Z1QA 1EMMA 1OOFA 1QLSA 1EJ3A 3JTDB 4OY4A 5DKRA 3AAKA 2QLGB 1Z1PA 1F4QA 2CXJA 3OGOA 4PE4A 3D77A 1QYFA 1ALVA 3IVTA 2H5PA 3SVBA 4ZF4A 3V2LA 1B8RA 3ZNIA 2MAZA 2ZRTA 3R1VA 2K8MB 3LK0A 1K8UA 1KFXL 5H88A 2OGRA 4A4CA 1A29A 2BKHB 4XJKB 1PSBA 2M7NA 3H1OA 1NP8A 3TDIA 3KO0A 2KSPA 3NHTA 2K61A 3NSIA 2FJYA 2EMOA 3RWTA 1AHRA 3PALA 3D75A 1YHHA 5JJGA 1FW4A 3OX6A 1B7TZ 3EVPA 4RYSA 3IQQA 5DPGA 5FVGA 1QIWA 2EC6C 3S0BA 1QASA 2Y1MA 3NF0A 2GGMA 1NPQA 1WLZA 1SR6C 4H48A 3O4XA 1S5GZ 1AJ4A 2SCPA 1D1OA 3UFZA 1EG3A 1ALWA 5FI6A 4MZJA 4DKMA 2OTEA 4P5OE 2ZN9A 3UO9A 4JPZB 2G3OA 4L13A 4W75A 2JPOA 1NX1A 1XA5A 1IWQA 1K96A 1JBYA 3DD4A 1MXLC 1F8HA 1LINA 3DVEA 1DQEA 2COLB 1YR5A 2BTJA 4N5XA 3DQLA 2BECA 4W6OA 1UHNA 1OZSA 3SVCA 1T14A 3B87A 4EN1A 4H3NA 3MSEB 2KI6D 1RMMA 2YFPA 2GGZA 3NHIA 3O6BA 4UPGA 3ZULA 4MZKA 3IQOA 4Z4MA 4HREE 2I94A 1KSOA 2LP3A 1OOGA 4I5LB 4IK3A 2CTNA 3S0GA 4PPJA 2M8UA 1OQPA 3M24A 2WCMA 4JQ0D 1JUOA 3ED8A 1WY9A 3BFBA 2YE0A 2G6YA 2I7AA 5J3XA 2M3WA 1S6JA 3DPWA 2B1UA 3PM2A 4LJBA 5DQMA 3VK1A 2G6EA 4L1IA 2FZUA 1YX7A 5FI2A 2M29A 4MEWA 2DUGA 2K7BA 5IBWA 5LTPA 3DQEA 3BXKA 5CSIA 2VAEA 4EDSA 3SVDA 4W6SA 1W7SA 5EB6A 1P28A 1F09A 1QLKA 1F71A 3D76A 1SPYA 3D74A 2HQWA 1S26D 4DRWA 4PHNA 5DKQA 1YRTB 3GL4A 4ZFSA 2L51A 4PCWA 1BG1A 2ERBA 1Y6WA 4IJ7A 5EBJA 3DQ7A 2LLUA 4HQ9A 2G2BA 4MRYA 2Y4QA 1IQ5A 2ZKMX 2WCLA 3U8AA 4BY4A 5F6TA 1XO5A 4OQWA 1NYAA 4P1QA 2PVBA 3NEZA 1QATA 1SKTA 5CPVA 3JVTB 1ZGOA 1C07A 3SS4A 4Q9XA 1F54A 1QIVA 1TUJA 1BFPA 2FL1A 3CWGA 2JADA 3ST4A 5BT0A 5DPJA 1QY3A 2AH8A 3BQ3A 4ORBB 5HZSA 4I5KA 3UG0A 1B47A 2H2KA 4W6AA 1ZFSA 4DIRA 1XK4A 3TS5B 3AKAA 4AS8A 4WQ3A 2MJWB 1K9PA 4H3MA 4KGEA 4KW9A 1W7JB 4JGEA 1Y1AA 3W1CA 3GK1A 4GFTA 2KAYA 3TUYC 4DXPA 2YDZA 1EMAA 4AQIA 5FVIA 4LQTA 2V4EC 3BXCA 2G3DB 2F3ZA 1SNLA 1NSHA 2PXSA 3SSTA 1G33A 1AK8A 4DXIA 3DQKA 2Y5IA 3D78A 4PALA 5I8NA 2L98A 4W7AA 1XFRA 4W72A 2BL0C 2ARLA 5DTXA 3SSLA 3SVNA 3SS3A 5DQBA 4UTSA 3SG2A 1QWVA 2PRUA 4XYNA 3U0KA 4Q7TA 3PJ7A 2Y0GA 1S5GY 3VRQA 3CB9A 1JC2A 1DC1A 2PMYA 5B8IB 4RYWA 3A8RA 1RWYA 3OSRA 1R2UA 1CB1A 4USLA 2JNFA 3SG6A 2KDHA 2AAOA 4W7DA 4PE0A 1K2HA 3BOWA 2M49B 1JF2A 4KF4A 3RM1A 3GJ2A 2IB6A 3B88A 4IK4A 2WCEA 5AFPA 1S6ZA 3MGFA 3DQUA 5EHUA 1CLLA 3B7AA 1SY9A 4DKNA 1K93D 2PASA 1BLQA 2F2PA 1C7WA 1MR8A 3KF9A 5ER5A 2ICRA 5HZUA 2K7CA 4W7XA 2Z1OA 3HCMA 1DMOA 1CDPA 2HPWA 2BCBA 1KWOC 2GW4B 2AUCA 3DQOA 2PXWA 2WORA 2H5OA 1ZGPA 3LK1A 3IF7A 4PE7A 4PE1A 4JWQA 1L2OC 1N0YA 3CLNA 3QMEA 1IKUA 4KA9A 5TNCA 3SVSA 3VRPA 4MRXA 3P28A 2HGYA 1WRKA 1ZMZA 1RM9A 1YZWA 3VRRA 4J88A 3DYEA 2KAVA 3SRYA 1PK0D 4CIDA 4LJDA 1DJIA 2IE2A 3DF0A 1YHGA 1UHJA 4GPLB 3RZSA 5HLOA 3TMRA 2LUXA 1OMDA 2FJUB 1X02A 4WQ2A 3H4SE 3DQMA 5DRGA 3CZ2A 5G08A 3EKJA 3BFAA 5BTTA 4ORNA 3H1RA 4YBHB 1B4CA 4TZAA 3LVDA 2Q91A 4AOMA 1SYMA 3CBEA 2LCPA 3DVMA 3SSKA 1GGZA 2LVVA 1EMLA 4KF5C 1RFJA 1CFFA 2KFGA 2G6XA 3S0FA 1Q80A 1SBJA 3DPZA 1CTRA 3QRXA 4M2PA 1SL8A 2H5QA 2HGDA 1IG5A 2A47A 2LUCA 1WRLA 1CLBA 1B8CA 4U8DA 2VADA 4MZLA 4FQTA 1A2XA 2EC6B 1K95A 3NT9A 1EH2A 3GOFA 2LAPA 1NUBA 3E5WA 4OVNF 4I5NB 5LK4A 5DY6A 4GESB 2K2AA 3E3RA 2OJKA 1S6IA 4GUKA 2WC5A 1OXFA 1DJZA 4ZBLA 2H6VA 3PM8A 4R1EA 2K7OA 1MWNA 2YGUA 2P71A 3I5FC 3BUMB 3TZ1A 3S0AA 3VICA 1DJXA 3CFHA 1OOIX 1CFCA 5BQLA 1RROA 5ER4X 4D1EA 4MBEA 2BCXA 2JT8A 2DUFA 2WHTA 1BU3A 3BFHA 2KPHA 1VRKA 1A75A 1IIOA 2WNDA 5FYXA 2QDIA 2KHNA 2HQZA 5AQBB 2LVJA 4W6TA 4JFGA 3EVVA 2F33A 1BF5A 1QVIY 1YJFA 4NWSA 1TCOB 4PDZA 1QJTA 1B1GA 2IOVA 1C4FA 1M63B 1YVHA 4M2QA 3U0LA 4PFEA 2DUHA 2WOSA 2PQLA 3FE8A 2MLEC 5I2LA 2KYFA 1EL4A 2ZO6A 4W76A 3SJSA 1TIZA 2JTTA 1SCMC 2LHIA 2GTEA 1BJFA 2HF5A 3DQNA 3ZUJA 3I5IB 4Q7RA 2HCGA 4BDUA 2LMVA 2FCEA 1KK7Z 3DQ9A 1V1FA 4GGFC 3CZ0A 1QS7A 3NXAA 3LSAA 5LTRA 3EVUA 2BKIB 3P8UA 4PPLA 2QT2A 2ZFDA 3CDNA 1IGVA 1B9CA 3DQIA 3SSYA 4EULA 1TNPA 5K89A 2WURA 2OTBA 3SSHA 2KQYA 1PALA 2E30A 2CBLA 1UHIA 4U2VA 1QXTA 3OP0A 2ISDA 2B3QA 1OMRA 1JF0A 3LA1A 4KGFA 1Q73A 1F55A 4NDBA 4KAGA 3K1KA 5CSNA 3L4LA 1M46A 2A50B 1BR4B 1EMFA 2LE9B 4Z4KA 1ORGA 1QV1A 3PN7C 3LF3A 1CDLA 3B6XA 3D10A 3DQ6A 4AR7A 1GGXA 4GNKB 3LF4B 1F4OA 3SG4A 1XFZO 2LVKA 3GB3A 2SASA 4B30A 3I5HB 1TWOA 1BMOA 2JU0A 1RRXA 4DXMA 5FI7A 3UNWA 3SG7A 4YGCB 1SL9A 3BOWB 4QJ4B 1TN4A 1JSAA 3E5TA 3JTDC 4HRHA 1CLMA 4W6DA 2LM5A 2L2CA 1S36A 2KOTA 4W6BA 1LXFC 2JTZA 1Y1UA 1QX5B 5AANA 3CFFA 4GGFA 2JWWA 2KAXA 4W6LA 3PLFB 2JXLA 2HETA 3I5GB 2Q6PA 3GK4X 4LJCA 2G16B 1OZOA 3ST2A 3DQDA 3SS5A 1W7IB 5BPJA 3CTNA 4ORAB 1JFJA 2KI4C 1NWDA 1AJ5A 5DPIA 2CCMA 4OHSA 4W6IA 2DD7A 3AI5A 1U5IA 1YTZC 4HSZA 3HX4A 3R1PA 1GQMA 2ZO7A 3PSRA 2DOQA 2BL0B 3KEVA 2P6BB 3DQ5A 1XMZA 3V3DA 4TNCA 2QZ0A 1W9ZA 2BNXA 1CDMA 2KBMA 3DF0B 3CD1A 1ODBA 1ZACA 4J89A 2OS8C 3KHEA 2E6WA 1ZUZA 2H5RA 2DD9A 1CV7A 5BTTB 2KFFA 1J7PA 4PHKA 2QLEA 1SMGA 1XVJA 1EMGA 3CABA 2I2RE 4F7FA 2HPSA 1Q4AA 1H6RA 1DJYA 3CZTX 3DVKA 4INXA 1EXRA 4I5JA 2A52B 4E68A 1OE9B 4CPVA 1C3YA 1XFWO 4EMQA 3U8PA 3KPXA 2HFCA 4YI8A 1K90D 5HL1A 5HZTA 3ST0A 2L4HA 4KEXA 1KK8C 1JBZA 1KFXS 2OTGC 3LLEA 3L4AA 1BT6A 1IJ5A 3ICBA 3C1VA 2VVIA 2JC2A 4W77A 1CNPA 2HQKA 1KYRA 3VGOA 3OGNA 3PATA 2LLSA 1RJVA 3OHMB 1CM1A 1WLMA 2HRSA 1PVBA 2M97A 4KYNA 1OMVA 2JZIA 3NGVA 2EHBA 1KQVA 1KQMB 2GV5A 1C7VA 3BUNB 3AI4A 1B7TY 1KK7Y 2MBXA 4XGYA 3CD9A 3BJHA 2P70A 3SIAA 4INWA 1DTLA 1A75B 1J1DA 2V53A 3BXAA 2M9GA 5AXIA 1AUIB 1TNWA 2L50A 4HQCA 1SCVA 1UURA 3K21A 2KLDA 5AERA 4IK5A 2Z6YA 4YGAA 5I2OA 5I94A 1YX8A 1DEKA 2ZNDA 2EMDA 1F70A 5HGEA 3ZTFA 4C0JA 3SVOA 4W6UA 4ZF5A 4ETOA 2POXA 3DQ4A 1ZOTB 1SRAA 1MYWA 2QEVA 2WCFA 1IQ3A 2L5YA 4PHJA 2LANA 2QEHA 2F8PA 2Q57A 2WIQA 1YHIA 2JNXA 3CFAA 1MOUA 1M39A 1HQVA 1YRUB 2H8QA 4GF6B 1S6CA 5EXBA 2IS9A 4JRBA 2JRFA 3A8SA 3KCSA 4YI9A 1Y0VH 2V4EA 3NSOA 4FQOA 4W6MA 5DTLA 1QTXA 2JPTA 1G4YR 3TS5C 2Z6XA 3DQ3A 4N1GA 3LVAA 3WNXB 1KCYA 1GFLA 3PJ5A 4ANJA 2H8VA 2C9JA 1QX2A 2WISA 2QEOA 3VB1A 3TMTA 1M45A 3KCTA 1BODA 1YUUA 2F3YA 3OB2B 3AKOA 1CMFA 1NCZA 1TNXA 4JF9A 3O78A 4XOWA 3CYZA 3U8CA 1GGWA 3Q8IA 1RMOA 3GJ1A 3SG5A 2AWMA 3DQHA 3DQ1A 2FOTA 4PPKA 3BYAA 4YRUA 1CMGA 5HW9A 1UISA 4IK8A 5GQQC 1HT9A 4B30B 2LV7A 3NSLA 2JULA 2GX2A 2BBMA 1IRJA 1N2DA 2L4IA 5FVFA 3LS3A 4QJ3B 1J1EA 3DPXA 2AHAA 2WC6A 3NSKA 4JD9A 1C3ZA 1RTP1 3K1EA 3D73A 2WCJA 3BUWB 2QEBA 1YUTA 3SVRA 4MVFA 3DQFA 2AWKA 5T3IA 4W7FA 2G2SB 3S0DA 4JKTA 2K7DA 1SW8A 4HE4A 1FF1A 1SR6B 2H9WA 4GGNA 1Q4DA 4DXNA 3WLCA 2IB5A 3SV5A 2GX0A 5EJUA 4JC2A 1DF0A 3NT3A 2HJOA 4N1FA 3O2PA 2M7LA 1RMPA 1U5IB 5DTYA 4OJ0A 5PALA 3WHTB 4ZIOA 1XFVO 3DXLA 3SS0A 3NEDA 3D0YA 1GJYA 3DQJA 4OZDA 2BBNA 2I18A 3S05A 3CZ1A 1NCXA 2ZRSA 5FHVA 1TUZA 2G5ZB 3DVJA 4DCKA 2OKYA 4OV2A 3FE9A 2MRDA 1G7KA 3CS1A 1KFUS 1CDNA 1EMBA 2OPOA 2O2BA 5I2QA 4W6JA 1JWDA 3U0MA 3FE6A 2O60A 1FI5A 2QLHA 1MOVA 4DXOA 1J7QA 4KF5A 1DELA 2JOJA 4GOBA 3EK8A 2PSRA 1FPWA 2WSOA 1MQ1A 4DUQA 4OCIA 3WLDA 2MLFC 1XFUO 2NCOA 3B86A 2DDCA 1XA9A 4LW5A 4C0KA 2VZXA 4W6CA 1NCYA 4IK1A 3ST3A 4IK9A 1UUSA 2QRFA 1S1EA 1UHKA 3BUOB 3W1DA 1NX3A 1OOHA 4J8AA 1Q4BA 1DGUA 1TRFA 2KI4B 1TNQA 2K60A 1CKKA 4W7RA 1B8LA 3FS7A 3LCPC 2KFHA 2MA2A 1MHOA 2F2OA 1UWOA 1RK9A 4EDOA 2NZ0A 4ZCUA 2G9BA 2QU1A 2BE4A 3FWCA 2YE1A 1BOCA 1LA0A 4TZGA 2VVHA 4W6HA 3DZTA 2WHSA 3TDZA 2OS8B 5HKWA 1XFYO 2M0RA 1QYOA 4W6GA 5H87A 1PULA 1NX0A 4W6FA 4H3LA 2KQ6A 1WDCC 1Z2CB 2O5GA 4L12A 1KP5A 1NX2A 3EG5B 4I2YA 1W7UA 1YJ2A 1HCJA 1MF8B 3S0EA 1QXPA 4W74A 4YGDB 2HQ8A 2CT9A 4DXQA 3CR2A 2JT3A 3M0WA 5J2OA 1A03A 1ZGQA 3OB1B 4F0ZB 1XFXO 2FWQA 1CFPA 4W6KA 2Q4UA 1KK8B 1SK6D 2OTGB 2QPTA 3CGAA 2LMUA 2R2IA 1DJGA 3CR5X 2WCBA 1GM0A 2KI6C 5HLVA 1K9UA 3CR4X 1Y1XA 2A4JA 1J7OA 1UHHA 3TUYB 5DPHA 3VRNA 2NCPA 2V4EB 2A46A 2ZN8A 2O24A 1XK4C 5D69A 1G8IA 3VHTA 1B9AA 3I5IC 3O4YA 4W7CA 4B5YA 4GAOA 1Z4HA 3DQCA 4M2OA 3N7HA 2O29A 3IR8A 1EG4A 4AQJA 4W69A 4Q04A 2KYCA 1KYSA 1BR1B 5KSZA 3ADFA 2B3PA 5DICA 3EVRA 3CGLA 4MSPA 1OXDA 3ZWHA 1LKJA 2P4MA 2EGDA 1R6PA 4W7EA 5F9GA 4ZB1A 1JC0A 2WC8A 4KW8A 5LTQA 1MXEA 4L9MA 4Q7UA 2NXQA
chains in the Genus database with same CATH topology
1DJHA 2QLGA 1FBVA 2DDDA 2DUEA 1JBAA 4YGBB 5DTZA 2LP2A 1MUXA 3WHUB 5H89A 1QYQA 2D8NA 1YVLA 1AVSA 1EMCA 3M22A 1ZUXA 3SSPA 3LVCA 4R6BA 1KWOB 3I5HC 2MHHA 2M1UA 4XJKA 2RGIA 3TDUA 1YUSA 1E8AA 3SVUA 4YGEB 2ZMUA 1H4UA 1L2OB 1SL7A 2LLTA 5HBDA 3I19A 3U0NA 1FI6A 3O77A 1GL4A 1DF0B 3OX5A 2QLIA 1KYPA 1QV0A 2AWJA 2WSNA 5AEQA 1H8BA 2JT0A 1QX7A 2A56B 3I5GC 4XL5A 3AAJA 5CSFA 1Q4CA 3BUXB 5CSJA 2A48A 1PRWA 2K2FA 2M1KB 4C0LA 3D0YB 3GK2A 1KFUL 1QVIZ 1CFDA 2VRGA 4CFQA 1IJ6A 1TCFA 1TOPA 1TTXA 4LQUA 3WXAA 2VVJA 4H47A 5KTGA 4OR9B 3AKBA 4W6NA 2DUIA 2AWLA 4LJDC 1WRZA 2C9IA 4NDCA 3WCKA 1H4BA 2ZMWA 1IH0A 4XVPA 1LVCD 1OSAA 4ZCVA 1PSRA 2WHUA 1JFKA 3JVTC 4KPIA 1CM4A 2JQ6A 3ZUFA 2L0PA 3LL8B 4HQ8A 3PFVA 3DQ2A 1EMEA 4Q9WA 4W73A 5EB7A 5EXCI 2BCAA 4WRIA 1S3PA 4FTGA 2AMIA 1KSMA 3PIBA 2H61C 3BXBA 2KGBC 4PHMA 1XQMA 3I5FB 1N65A 2CNPA 5EXUA 2KGRA 1L7ZA 1K9KA 3EK7A 3SSVA 1Q4EA 1W7TA 2ZNEA 1XSSA 5DRFA 3DQ8A 2LHLA 1AP4A 5HZOA 3EKHA 1J7RA 1M31A 5HKZA 4MN0A 4ZINA 4BY5A 2A53B 3SVEA 4GBAA 2PALA 2TN4A 4CLNA 4P76A 4RTCA 1YFPA 4ICBA 4A4BA 4ZF3A 5DU0A 3RLZA 4KW4A 1KQMC 1OOJA 2K0JA 5DKNA 1XYDA 4IL1A 3G9AA 5HYDA 3IP2A 4R6DA 2FCDA 2Y1NA 2L2EA 3SG3A 4W6PA 1A4PA 1UP5A 3FIAA 1F0BA 3FWBA 3F45A 1XAEA 1DT7B 4P2YB 1SCMB 1OXEA 2KBIA 3DQAA 4DS7A 4IZNA 2LC5A 4MLWA 5KU1A 3BX9A 2LMTA 2H61A 2GW3A 4QJ5B 2QACA 4N3DA 1LA3A 4W6RA 4HVFA 1DVIA 5JOLA 2RH7A 2L5XB 2A54B 5KTYA 4HRGA 1JC1A 4NQGA 4NDDA 4ORCB 1YURA 3PJBA 2EMNA 1PVAA 2LVIA 2JXCA 3VHTB 5D7FA 3A4UB 4OGSA 4XOVA 2Z6ZA 1DJWA 4JEOA 3VROA 5HKYA 3RWAA 1HUYA 4OKHA 3EK4A 2KNEA 1DGVA 3PN7B 3SIBA 1WDCB 1V1GA 1K94A 1EMKA 3GEXA 1NIWA 1J55A 4CFRA 3OSQA 2BE6A 2OKWA 1RECA 2NLNA 2LNKA 3E5VA 1Z1QA 1EMMA 1QLSA 1EJ3A 3JTDB 4OY4A 5DKRA 3AAKA 2QLGB 1Z1PA 1F4QA 2CXJA 3OGOA 4PE4A 1QYFA 1ALVA 2H5PA 3SVBA 4ZF4A 1B8RA 3ZNIA 2MAZA 2ZRTA 2K8MB 3LK0A 1K8UA 1KFXL 5H88A 2OGRA 4A4CA 1A29A 2BKHB 4XJKB 1PSBA 2M7NA 3H1OA 1NP8A 3TDIA 3KO0A 2KSPA 2K61A 3NSIA 2EMOA 3RWTA 1AHRA 3PALA 1YHHA 5JJGA 1FW4A 3OX6A 1B7TZ 3EVPA 4RYSA 3IQQA 5DPGA 5FVGA 1QIWA 3NF0A 2EC6C 1QASA 2Y1MA 2GGMA 1NPQA 1WLZA 1SR6C 4H48A 1S5GZ 1AJ4A 2SCPA 1D1OA 3UFZA 1EG3A 1ALWA 4MZJA 4DKMA 2OTEA 4P5OE 2ZN9A 4JPZB 2G3OA 4L13A 4W75A 1NX1A 1XA5A 1IWQA 1K96A 1JBYA 3DD4A 1MXLC 1F8HA 1LINA 3DVEA 2COLB 1YR5A 2BTJA 4N5XA 3DQLA 2BECA 4W6OA 1UHNA 1OZSA 3SVCA 4EN1A 4H3NA 3MSEB 2KI6D 1RMMA 2YFPA 2GGZA 3O6BA 4UPGA 3ZULA 4MZKA 3IQOA 4Z4MA 4HREE 2I94A 1KSOA 2LP3A 4I5LB 4IK3A 2CTNA 4PPJA 2M8UA 1OQPA 3M24A 4JQ0D 1JUOA 2G6YA 1WY9A 2YE0A 3ED8A 2I7AA 5J3XA 2M3WA 1S6JA 3DPWA 2B1UA 4LJBA 5DQMA 3VK1A 2G6EA 4L1IA 2FZUA 1YX7A 2M29A 4MEWA 2K7BA 2DUGA 5IBWA 5LTPA 3DQEA 3BXKA 5CSIA 2VAEA 4EDSA 3SVDA 4W6SA 1W7SA 5EB6A 1F09A 1QLKA 1F71A 1SPYA 2HQWA 1S26D 4DRWA 4PHNA 5DKQA 1YRTB 3GL4A 4ZFSA 2L51A 4PCWA 1BG1A 1Y6WA 5EBJA 3DQ7A 2LLUA 4HQ9A 2G2BA 4MRYA 2Y4QA 1IQ5A 2ZKMX 3U8AA 4BY4A 5F6TA 1XO5A 4OQWA 1NYAA 4P1QA 2PVBA 3NEZA 1QATA 1SKTA 5CPVA 3JVTB 1ZGOA 1C07A 4Q9XA 1F54A 1QIVA 1BFPA 2FL1A 3CWGA 2JADA 3ST4A 5BT0A 5DPJA 1QY3A 2AH8A 3BQ3A 4ORBB 5HZSA 4I5KA 3UG0A 1B47A 2H2KA 4W6AA 1ZFSA 4DIRA 1XK4A 3TS5B 3AKAA 4AS8A 4WQ3A 2MJWB 1K9PA 4H3MA 4KGEA 4KW9A 1W7JB 4JGEA 1Y1AA 3W1CA 3GK1A 4GFTA 2KAYA 3TUYC 4DXPA 2YDZA 1EMAA 4AQIA 5FVIA 4LQTA 2V4EC 3BXCA 2G3DB 2F3ZA 1SNLA 1NSHA 2PXSA 3SSTA 1G33A 1AK8A 4DXIA 3DQKA 2Y5IA 4PALA 5I8NA 2L98A 4W7AA 4W72A 2BL0C 2ARLA 5DTXA 3SSLA 3SVNA 5DQBA 4UTSA 3SG2A 2PRUA 4XYNA 3U0KA 4Q7TA 3PJ7A 2Y0GA 1S5GY 3VRQA 3CB9A 1JC2A 2PMYA 5B8IB 4RYWA 3A8RA 1RWYA 3OSRA 1R2UA 1CB1A 4USLA 2JNFA 3SG6A 2KDHA 2AAOA 4W7DA 4PE0A 1K2HA 3BOWA 2M49B 1JF2A 4KF4A 3RM1A 3GJ2A 2IB6A 4IK4A 2WCEA 5AFPA 1S6ZA 3MGFA 3DQUA 5EHUA 1CLLA 1SY9A 4DKNA 1K93D 2PASA 1BLQA 2F2PA 1C7WA 1MR8A 3KF9A 5ER5A 2ICRA 5HZUA 2K7CA 4W7XA 2Z1OA 3HCMA 1DMOA 1CDPA 2HPWA 2BCBA 1KWOC 2GW4B 2AUCA 3DQOA 2PXWA 2WORA 2H5OA 1ZGPA 3LK1A 3IF7A 4PE7A 4PE1A 4JWQA 1L2OC 1N0YA 3CLNA 1IKUA 4KA9A 5TNCA 3SVSA 3VRPA 4MRXA 3P28A 2HGYA 1WRKA 1ZMZA 1RM9A 1YZWA 3VRRA 4J88A 2KAVA 3SRYA 1PK0D 4CIDA 4LJDA 1DJIA 2IE2A 3DF0A 1YHGA 1UHJA 4GPLB 5HLOA 3TMRA 2LUXA 1OMDA 2FJUB 1X02A 4WQ2A 3H4SE 3DQMA 5DRGA 5G08A 3EKJA 5BTTA 4ORNA 3H1RA 4YBHB 1B4CA 4TZAA 3LVDA 2Q91A 4AOMA 1SYMA 3CBEA 2LCPA 3DVMA 3SSKA 1GGZA 2LVVA 1EMLA 4KF5C 1RFJA 1CFFA 2KFGA 2G6XA 1Q80A 1SBJA 3DPZA 1CTRA 3QRXA 4M2PA 1SL8A 2H5QA 2HGDA 1IG5A 2A47A 2LUCA 1WRLA 1CLBA 1B8CA 4U8DA 2VADA 4MZLA 1A2XA 2EC6B 1K95A 3NT9A 1EH2A 3GOFA 2LAPA 1NUBA 3E5WA 4OVNF 4I5NB 5LK4A 5DY6A 4GESB 2K2AA 3E3RA 2OJKA 1S6IA 4GUKA 1OXFA 1DJZA 4ZBLA 2H6VA 3PM8A 4R1EA 2K7OA 1MWNA 3I5FC 3BUMB 3TZ1A 3VICA 1DJXA 3CFHA 1CFCA 5BQLA 1RROA 5ER4X 4D1EA 4MBEA 2BCXA 2JT8A 2DUFA 2WHTA 1BU3A 1VRKA 1A75A 2WNDA 5FYXA 2KHNA 2HQZA 5AQBB 2LVJA 4W6TA 4JFGA 3EVVA 2F33A 1BF5A 1QVIY 1YJFA 4NWSA 1TCOB 4PDZA 1QJTA 1B1GA 2IOVA 1C4FA 1M63B 1YVHA 4M2QA 3U0LA 4PFEA 2DUHA 2WOSA 2MLEC 5I2LA 2KYFA 1EL4A 2ZO6A 4W76A 3SJSA 1TIZA 2JTTA 1SCMC 2LHIA 1BJFA 2HF5A 3DQNA 3ZUJA 3I5IB 4Q7RA 2HCGA 4BDUA 2LMVA 2FCEA 1KK7Z 3DQ9A 1V1FA 4GGFC 1QS7A 3NXAA 3LSAA 5LTRA 3EVUA 2BKIB 3P8UA 4PPLA 2QT2A 2ZFDA 1IGVA 1B9CA 3DQIA 3SSYA 4EULA 1TNPA 5K89A 2WURA 2OTBA 3SSHA 2KQYA 1PALA 2E30A 2CBLA 1UHIA 4U2VA 1QXTA 3OP0A 2ISDA 2B3QA 1OMRA 1JF0A 3LA1A 4KGFA 1Q73A 1F55A 4NDBA 4KAGA 3K1KA 5CSNA 1M46A 2A50B 1BR4B 1EMFA 2LE9B 4Z4KA 1QV1A 3PN7C 3LF3A 1CDLA 3D10A 3DQ6A 4AR7A 1GGXA 4GNKB 3LF4B 1F4OA 3SG4A 1XFZO 2LVKA 3GB3A 2SASA 4B30A 3I5HB 1BMOA 2JU0A 1RRXA 4DXMA 3SG7A 4YGCB 1SL9A 3BOWB 4QJ4B 1TN4A 1JSAA 3E5TA 3JTDC 4HRHA 1CLMA 4W6DA 2LM5A 1S36A 2KOTA 4W6BA 1LXFC 2JTZA 1Y1UA 1QX5B 5AANA 3CFFA 4GGFA 2JWWA 2KAXA 4W6LA 3PLFB 2JXLA 2HETA 3I5GB 2Q6PA 3GK4X 4LJCA 2G16B 1OZOA 3ST2A 3DQDA 1W7IB 5BPJA 3CTNA 4ORAB 1JFJA 2KI4C 1NWDA 1AJ5A 5DPIA 2CCMA 4OHSA 4W6IA 2DD7A 3AI5A 1U5IA 1YTZC 4HSZA 3HX4A 1GQMA 2ZO7A 3PSRA 2DOQA 2BL0B 3KEVA 2P6BB 3DQ5A 1XMZA 3V3DA 4TNCA 2QZ0A 1CDMA 2KBMA 3DF0B 3CD1A 1ODBA 1ZACA 4J89A 2OS8C 3KHEA 2E6WA 1ZUZA 2H5RA 2DD9A 1CV7A 5BTTB 2KFFA 1J7PA 4PHKA 2QLEA 1SMGA 1XVJA 1EMGA 2I2RE 2HPSA 1Q4AA 1H6RA 1DJYA 3CZTX 3DVKA 1EXRA 4I5JA 2A52B 4E68A 1OE9B 4CPVA 1XFWO 4EMQA 3U8PA 3KPXA 2HFCA 4YI8A 1K90D 5HZTA 3ST0A 2L4HA 4KEXA 1KK8C 1JBZA 1KFXS 2OTGC 3LLEA 1BT6A 1IJ5A 3ICBA 3C1VA 2VVIA 2JC2A 4W77A 1CNPA 2HQKA 1KYRA 3VGOA 3PATA 2LLSA 1RJVA 3OHMB 1CM1A 1WLMA 2HRSA 1PVBA 2M97A 1OMVA 2JZIA 2EHBA 1KQVA 1KQMB 2GV5A 1C7VA 3BUNB 3AI4A 1B7TY 1KK7Y 2MBXA 4XGYA 3CD9A 3SIAA 1DTLA 1A75B 1J1DA 2V53A 3BXAA 2M9GA 5AXIA 1AUIB 1TNWA 2L50A 4HQCA 1SCVA 1UURA 3K21A 5AERA 4IK5A 2Z6YA 4YGAA 5I2OA 1YX8A 2ZNDA 2EMDA 1F70A 5HGEA 3ZTFA 4C0JA 3SVOA 4W6UA 4ZF5A 4ETOA 2POXA 3DQ4A 1ZOTB 1SRAA 1MYWA 2WCFA 1IQ3A 4PHJA 2LANA 2F8PA 2Q57A 2WIQA 1YHIA 2JNXA 3CFAA 1MOUA 1M39A 1HQVA 1YRUB 2H8QA 4GF6B 1S6CA 5EXBA 2IS9A 4JRBA 2JRFA 3A8SA 3KCSA 4YI9A 1Y0VH 2V4EA 3NSOA 4FQOA 4W6MA 5DTLA 1QTXA 2JPTA 1G4YR 3TS5C 2Z6XA 3DQ3A 4N1GA 3LVAA 3WNXB 1KCYA 1GFLA 3PJ5A 4ANJA 2C9JA 1QX2A 2WISA 3TMTA 1M45A 3KCTA 1BODA 1YUUA 2F3YA 3OB2B 3AKOA 1CMFA 1NCZA 1TNXA 4JF9A 3O78A 4XOWA 3U8CA 1GGWA 1RMOA 3GJ1A 3SG5A 2AWMA 3DQHA 3DQ1A 2FOTA 4PPKA 3BYAA 4YRUA 1CMGA 5HW9A 1UISA 4IK8A 5GQQC 1HT9A 4B30B 2LV7A 3NSLA 2JULA 2GX2A 2BBMA 1IRJA 1N2DA 2L4IA 5FVFA 3LS3A 4QJ3B 1J1EA 3DPXA 2AHAA 3NSKA 1RTP1 3BUWB 1YUTA 3SVRA 4MVFA 3DQFA 2AWKA 5T3IA 4W7FA 2G2SB 2K7DA 1SW8A 4HE4A 1FF1A 1SR6B 2H9WA 4GGNA 1Q4DA 4DXNA 3WLCA 2IB5A 3SV5A 2GX0A 5EJUA 4JC2A 1DF0A 3NT3A 2HJOA 4N1FA 3O2PA 2M7LA 1RMPA 1U5IB 5DTYA 4OJ0A 5PALA 3WHTB 4ZIOA 1XFVO 3SS0A 3NEDA 3D0YA 1GJYA 3DQJA 2BBNA 2I18A 3S05A 1NCXA 2ZRSA 5FHVA 2G5ZB 3DVJA 4DCKA 2OKYA 4OV2A 2MRDA 1G7KA 3CS1A 1KFUS 1CDNA 1EMBA 2OPOA 2O2BA 5I2QA 4W6JA 1JWDA 3U0MA 2O60A 1FI5A 2QLHA 1MOVA 4DXOA 1J7QA 4KF5A 2JOJA 4GOBA 3EK8A 2PSRA 1FPWA 2WSOA 1MQ1A 4DUQA 4OCIA 3WLDA 2MLFC 1XFUO 2NCOA 2DDCA 1XA9A 4LW5A 4C0KA 2VZXA 4W6CA 1NCYA 4IK1A 3ST3A 4IK9A 1UUSA 2QRFA 1S1EA 1UHKA 3BUOB 3W1DA 1NX3A 4J8AA 1Q4BA 1DGUA 1TRFA 2KI4B 1TNQA 1CKKA 4W7RA 1B8LA 3FS7A 3LCPC 2KFHA 2MA2A 1MHOA 2F2OA 1UWOA 1RK9A 4EDOA 2NZ0A 4ZCUA 2G9BA 2QU1A 2BE4A 3FWCA 2YE1A 1BOCA 1LA0A 4TZGA 2VVHA 4W6HA 2WHSA 3TDZA 2OS8B 5HKWA 1XFYO 2M0RA 1QYOA 4W6GA 5H87A 1PULA 1NX0A 4W6FA 4H3LA 2KQ6A 1WDCC 2O5GA 4L12A 1KP5A 1NX2A 4I2YA 1W7UA 1YJ2A 1HCJA 1MF8B 1QXPA 4W74A 4YGDB 2HQ8A 2CT9A 4DXQA 3CR2A 2JT3A 3M0WA 5J2OA 1A03A 1ZGQA 3OB1B 4F0ZB 1XFXO 2FWQA 1CFPA 4W6KA 2Q4UA 1KK8B 1SK6D 2OTGB 2QPTA 3CGAA 2LMUA 2R2IA 1DJGA 3CR5X 2WCBA 2KI6C 5HLVA 1K9UA 3CR4X 1Y1XA 2A4JA 1J7OA 1UHHA 3TUYB 5DPHA 3VRNA 2NCPA 2V4EB 2A46A 2ZN8A 2O24A 1XK4C 5D69A 1G8IA 3VHTA 1B9AA 3I5IC 3O4YA 4W7CA 4B5YA 4GAOA 3DQCA 4M2OA 2O29A 3IR8A 1EG4A 4AQJA 4W69A 4Q04A 2KYCA 1KYSA 1BR1B 5KSZA 3ADFA 2B3PA 3EVRA 3CGLA 4MSPA 1OXDA 3ZWHA 1LKJA 2P4MA 2EGDA 1R6PA 4W7EA 5F9GA 4ZB1A 1JC0A 2WC8A 4KW8A 5LTQA 1MXEA 4L9MA 4Q7UA 2NXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJH A;  2QLG A;  1FBV A;  2DDD A;  2DUE A;  1JBA A;  4YGB B;  5DTZ A;  2LP2 A;  1MUX A;  3WHU B;  5H89 A;  1QYQ A;  2D8N A;  1YVL A;  1AVS A;  1EMC A;  3M22 A;  1ZUX A;  3SSP A;  3LVC A;  4R6B A;  1KWO B;  3I5H C;  2MHH A;  2M1U A;  4XJK A;  2RGI A;  3TDU A;  1YUS A;  1E8A A;  3SVU A;  4YGE B;  2ZMU A;  1H4U A;  1L2O B;  1SL7 A;  2LLT A;  5HBD A;  3I19 A;  3U0N A;  1FI6 A;  3O77 A;  1GL4 A;  1DF0 B;  3OX5 A;  2QLI A;  1KYP A;  1QV0 A;  2AWJ A;  2WSN A;  5AEQ A;  1H8B A;  2JT0 A;  1QX7 A;  2A56 B;  3I5G C;  4XL5 A;  3AAJ A;  5CSF A;  1Q4C A;  3BUX B;  5CSJ A;  2A48 A;  1PRW A;  2K2F A;  2M1K B;  4C0L A;  3D0Y B;  3GK2 A;  1KFU L;  1QVI Z;  1CFD A;  2VRG A;  4CFQ A;  1IJ6 A;  1TCF A;  1TOP A;  1TTX A;  4LQU A;  3WXA A;  2VVJ A;  4H47 A;  5KTG A;  4OR9 B;  3AKB A;  4W6N A;  2DUI A;  2AWL A;  4LJD C;  1WRZ A;  2C9I A;  4NDC A;  3WCK A;  1H4B A;  2ZMW A;  1IH0 A;  4XVP A;  1LVC D;  1OSA A;  4ZCV A;  1PSR A;  2WHU A;  1JFK A;  3JVT C;  4KPI A;  1CM4 A;  2JQ6 A;  3ZUF A;  2L0P A;  3LL8 B;  4HQ8 A;  3PFV A;  3DQ2 A;  1EME A;  4Q9W A;  4W73 A;  5EB7 A;  5EXC I;  2BCA A;  4WRI A;  1S3P A;  4FTG A;  2AMI A;  1KSM A;  3PIB A;  2H61 C;  3BXB A;  2KGB C;  4PHM A;  1XQM A;  3I5F B;  1N65 A;  2CNP A;  5EXU A;  2KGR A;  1L7Z A;  1K9K A;  3EK7 A;  3SSV A;  1Q4E A;  1W7T A;  2ZNE A;  1XSS A;  5DRF A;  3DQ8 A;  2LHL A;  1AP4 A;  5HZO A;  3EKH A;  1J7R A;  1M31 A;  5HKZ A;  4MN0 A;  4ZIN A;  4BY5 A;  2A53 B;  3SVE A;  4GBA A;  2PAL A;  2TN4 A;  4CLN A;  4P76 A;  4RTC A;  1YFP A;  4ICB A;  4A4B A;  4ZF3 A;  5DU0 A;  3RLZ A;  4KW4 A;  1KQM C;  1OOJ A;  2K0J A;  5DKN A;  1XYD A;  4IL1 A;  3G9A A;  5HYD A;  3IP2 A;  4R6D A;  2FCD A;  2Y1N A;  2L2E A;  3SG3 A;  4W6P A;  1A4P A;  1UP5 A;  3FIA A;  1F0B A;  3FWB A;  3F45 A;  1XAE A;  1DT7 B;  4P2Y B;  1SCM B;  1OXE A;  2KBI A;  3DQA A;  4DS7 A;  4IZN A;  2LC5 A;  4MLW A;  5KU1 A;  3BX9 A;  2LMT A;  2H61 A;  2GW3 A;  4QJ5 B;  2QAC A;  4N3D A;  1LA3 A;  4W6R A;  4HVF A;  1DVI A;  5JOL A;  2RH7 A;  2L5X B;  2A54 B;  5KTY A;  4HRG A;  1JC1 A;  4NQG A;  4NDD A;  4ORC B;  1YUR A;  3PJB A;  2EMN A;  1PVA A;  2LVI A;  2JXC A;  3VHT B;  5D7F A;  3A4U B;  4OGS A;  4XOV A;  2Z6Z A;  1DJW A;  4JEO A;  3VRO A;  5HKY A;  3RWA A;  1HUY A;  4OKH A;  3EK4 A;  2KNE A;  1DGV A;  3PN7 B;  3SIB A;  1WDC B;  1V1G A;  1K94 A;  1EMK A;  3GEX A;  1NIW A;  1J55 A;  4CFR A;  3OSQ A;  2BE6 A;  2OKW A;  1REC A;  2NLN A;  2LNK A;  3E5V A;  1Z1Q A;  1EMM A;  1QLS A;  1EJ3 A;  3JTD B;  4OY4 A;  5DKR A;  3AAK A;  2QLG B;  1Z1P A;  1F4Q A;  2CXJ A;  3OGO A;  4PE4 A;  1QYF A;  1ALV A;  2H5P A;  3SVB A;  4ZF4 A;  1B8R A;  3ZNI A;  2MAZ A;  2ZRT A;  2K8M B;  3LK0 A;  1K8U A;  1KFX L;  5H88 A;  2OGR A;  4A4C A;  1A29 A;  2BKH B;  4XJK B;  1PSB A;  2M7N A;  3H1O A;  1NP8 A;  3TDI A;  3KO0 A;  2KSP A;  2K61 A;  3NSI A;  2EMO A;  3RWT A;  1AHR A;  3PAL A;  1YHH A;  5JJG A;  1FW4 A;  3OX6 A;  1B7T Z;  3EVP A;  4RYS A;  3IQQ A;  5DPG A;  5FVG A;  1QIW A;  3NF0 A;  2EC6 C;  1QAS A;  2Y1M A;  2GGM A;  1NPQ A;  1WLZ A;  1SR6 C;  4H48 A;  1S5G Z;  1AJ4 A;  2SCP A;  1D1O A;  3UFZ A;  1EG3 A;  1ALW A;  4MZJ A;  4DKM A;  2OTE A;  4P5O E;  2ZN9 A;  4JPZ B;  2G3O A;  4L13 A;  4W75 A;  1NX1 A;  1XA5 A;  1IWQ A;  1K96 A;  1JBY A;  3DD4 A;  1MXL C;  1F8H A;  1LIN A;  3DVE A;  2COL B;  1YR5 A;  2BTJ A;  4N5X A;  3DQL A;  2BEC A;  4W6O A;  1UHN A;  1OZS A;  3SVC A;  4EN1 A;  4H3N A;  3MSE B;  2KI6 D;  1RMM A;  2YFP A;  2GGZ A;  3O6B A;  4UPG A;  3ZUL A;  4MZK A;  3IQO A;  4Z4M A;  4HRE E;  2I94 A;  1KSO A;  2LP3 A;  4I5L B;  4IK3 A;  2CTN A;  4PPJ A;  2M8U A;  1OQP A;  3M24 A;  4JQ0 D;  1JUO A;  2G6Y A;  1WY9 A;  2YE0 A;  3ED8 A;  2I7A A;  5J3X A;  2M3W A;  1S6J A;  3DPW A;  2B1U A;  4LJB A;  5DQM A;  3VK1 A;  2G6E A;  4L1I A;  2FZU A;  1YX7 A;  2M29 A;  4MEW A;  2K7B A;  2DUG A;  5IBW A;  5LTP A;  3DQE A;  3BXK A;  5CSI A;  2VAE A;  4EDS A;  3SVD A;  4W6S A;  1W7S A;  5EB6 A;  1F09 A;  1QLK A;  1F71 A;  1SPY A;  2HQW A;  1S26 D;  4DRW A;  4PHN A;  5DKQ A;  1YRT B;  3GL4 A;  4ZFS A;  2L51 A;  4PCW A;  1BG1 A;  1Y6W A;  5EBJ A;  3DQ7 A;  2LLU A;  4HQ9 A;  2G2B A;  4MRY A;  2Y4Q A;  1IQ5 A;  2ZKM X;  3U8A A;  4BY4 A;  5F6T A;  1XO5 A;  4OQW A;  1NYA A;  4P1Q A;  2PVB A;  3NEZ A;  1QAT A;  1SKT A;  5CPV A;  3JVT B;  1ZGO A;  1C07 A;  4Q9X A;  1F54 A;  1QIV A;  1BFP A;  2FL1 A;  3CWG A;  2JAD A;  3ST4 A;  5BT0 A;  5DPJ A;  1QY3 A;  2AH8 A;  3BQ3 A;  4ORB B;  5HZS A;  4I5K A;  3UG0 A;  1B47 A;  2H2K A;  4W6A A;  1ZFS A;  4DIR A;  1XK4 A;  3TS5 B;  3AKA A;  4AS8 A;  4WQ3 A;  2MJW B;  1K9P A;  4H3M A;  4KGE A;  4KW9 A;  1W7J B;  4JGE A;  1Y1A A;  3W1C A;  3GK1 A;  4GFT A;  2KAY A;  3TUY C;  4DXP A;  2YDZ A;  1EMA A;  4AQI A;  5FVI A;  4LQT A;  2V4E C;  3BXC A;  2G3D B;  2F3Z A;  1SNL A;  1NSH A;  2PXS A;  3SST A;  1G33 A;  1AK8 A;  4DXI A;  3DQK A;  2Y5I A;  4PAL A;  5I8N A;  2L98 A;  4W7A A;  4W72 A;  2BL0 C;  2ARL A;  5DTX A;  3SSL A;  3SVN A;  5DQB A;  4UTS A;  3SG2 A;  2PRU A;  4XYN A;  3U0K A;  4Q7T A;  3PJ7 A;  2Y0G A;  1S5G Y;  3VRQ A;  3CB9 A;  1JC2 A;  2PMY A;  5B8I B;  4RYW A;  3A8R A;  1RWY A;  3OSR A;  1R2U A;  1CB1 A;  4USL A;  2JNF A;  3SG6 A;  2KDH A;  2AAO A;  4W7D A;  4PE0 A;  1K2H A;  3BOW A;  2M49 B;  1JF2 A;  4KF4 A;  3RM1 A;  3GJ2 A;  2IB6 A;  4IK4 A;  2WCE A;  5AFP A;  1S6Z A;  3MGF A;  3DQU A;  5EHU A;  1CLL A;  1SY9 A;  4DKN A;  1K93 D;  2PAS A;  1BLQ A;  2F2P A;  1C7W A;  1MR8 A;  3KF9 A;  5ER5 A;  2ICR A;  5HZU A;  2K7C A;  4W7X A;  2Z1O A;  3HCM A;  1DMO A;  1CDP A;  2HPW A;  2BCB A;  1KWO C;  2GW4 B;  2AUC A;  3DQO A;  2PXW A;  2WOR A;  2H5O A;  1ZGP A;  3LK1 A;  3IF7 A;  4PE7 A;  4PE1 A;  4JWQ A;  1L2O C;  1N0Y A;  3CLN A;  1IKU A;  4KA9 A;  5TNC A;  3SVS A;  3VRP A;  4MRX A;  3P28 A;  2HGY A;  1WRK A;  1ZMZ A;  1RM9 A;  1YZW A;  3VRR A;  4J88 A;  2KAV A;  3SRY A;  1PK0 D;  4CID A;  4LJD A;  1DJI A;  2IE2 A;  3DF0 A;  1YHG A;  1UHJ A;  4GPL B;  5HLO A;  3TMR A;  2LUX A;  1OMD A;  2FJU B;  1X02 A;  4WQ2 A;  3H4S E;  3DQM A;  5DRG A;  5G08 A;  3EKJ A;  5BTT A;  4ORN A;  3H1R A;  4YBH B;  1B4C A;  4TZA A;  3LVD A;  2Q91 A;  4AOM A;  1SYM A;  3CBE A;  2LCP A;  3DVM A;  3SSK A;  1GGZ A;  2LVV A;  1EML A;  4KF5 C;  1RFJ A;  1CFF A;  2KFG A;  2G6X A;  1Q80 A;  1SBJ A;  3DPZ A;  1CTR A;  3QRX A;  4M2P A;  1SL8 A;  2H5Q A;  2HGD A;  1IG5 A;  2A47 A;  2LUC A;  1WRL A;  1CLB A;  1B8C A;  4U8D A;  2VAD A;  4MZL A;  1A2X A;  2EC6 B;  1K95 A;  3NT9 A;  1EH2 A;  3GOF A;  2LAP A;  1NUB A;  3E5W A;  4OVN F;  4I5N B;  5LK4 A;  5DY6 A;  4GES B;  2K2A A;  3E3R A;  2OJK A;  1S6I A;  4GUK A;  1OXF A;  1DJZ A;  4ZBL A;  2H6V A;  3PM8 A;  4R1E A;  2K7O A;  1MWN A;  3I5F C;  3BUM B;  3TZ1 A;  3VIC A;  1DJX A;  3CFH A;  1CFC A;  5BQL A;  1RRO A;  5ER4 X;  4D1E A;  4MBE A;  2BCX A;  2JT8 A;  2DUF A;  2WHT A;  1BU3 A;  1VRK A;  1A75 A;  2WND A;  5FYX A;  2KHN A;  2HQZ A;  5AQB B;  2LVJ A;  4W6T A;  4JFG A;  3EVV A;  2F33 A;  1BF5 A;  1QVI Y;  1YJF A;  4NWS A;  1TCO B;  4PDZ A;  1QJT A;  1B1G A;  2IOV A;  1C4F A;  1M63 B;  1YVH A;  4M2Q A;  3U0L A;  4PFE A;  2DUH A;  2WOS A;  2MLE C;  5I2L A;  2KYF A;  1EL4 A;  2ZO6 A;  4W76 A;  3SJS A;  1TIZ A;  2JTT A;  1SCM C;  2LHI A;  1BJF A;  2HF5 A;  3DQN A;  3ZUJ A;  3I5I B;  4Q7R A;  2HCG A;  4BDU A;  2LMV A;  2FCE A;  1KK7 Z;  3DQ9 A;  1V1F A;  4GGF C;  1QS7 A;  3NXA A;  3LSA A;  5LTR A;  3EVU A;  2BKI B;  3P8U A;  4PPL A;  2QT2 A;  2ZFD A;  1IGV A;  1B9C A;  3DQI A;  3SSY A;  4EUL A;  1TNP A;  5K89 A;  2WUR A;  2OTB A;  3SSH A;  2KQY A;  1PAL A;  2E30 A;  2CBL A;  1UHI A;  4U2V A;  1QXT A;  3OP0 A;  2ISD A;  2B3Q A;  1OMR A;  1JF0 A;  3LA1 A;  4KGF A;  1Q73 A;  1F55 A;  4NDB A;  4KAG A;  3K1K A;  5CSN A;  1M46 A;  2A50 B;  1BR4 B;  1EMF A;  2LE9 B;  4Z4K A;  1QV1 A;  3PN7 C;  3LF3 A;  1CDL A;  3D10 A;  3DQ6 A;  4AR7 A;  1GGX A;  4GNK B;  3LF4 B;  1F4O A;  3SG4 A;  1XFZ O;  2LVK A;  3GB3 A;  2SAS A;  4B30 A;  3I5H B;  1BMO A;  2JU0 A;  1RRX A;  4DXM A;  3SG7 A;  4YGC B;  1SL9 A;  3BOW B;  4QJ4 B;  1TN4 A;  1JSA A;  3E5T A;  3JTD C;  4HRH A;  1CLM A;  4W6D A;  2LM5 A;  1S36 A;  2KOT A;  4W6B A;  1LXF C;  2JTZ A;  1Y1U A;  1QX5 B;  5AAN A;  3CFF A;  4GGF A;  2JWW A;  2KAX A;  4W6L A;  3PLF B;  2JXL A;  2HET A;  3I5G B;  2Q6P A;  3GK4 X;  4LJC A;  2G16 B;  1OZO A;  3ST2 A;  3DQD A;  1W7I B;  5BPJ A;  3CTN A;  4ORA B;  1JFJ A;  2KI4 C;  1NWD A;  1AJ5 A;  5DPI A;  2CCM A;  4OHS A;  4W6I A;  2DD7 A;  3AI5 A;  1U5I A;  1YTZ C;  4HSZ A;  3HX4 A;  1GQM A;  2ZO7 A;  3PSR A;  2DOQ A;  2BL0 B;  3KEV A;  2P6B B;  3DQ5 A;  1XMZ A;  3V3D A;  4TNC A;  2QZ0 A;  1CDM A;  2KBM A;  3DF0 B;  3CD1 A;  1ODB A;  1ZAC A;  4J89 A;  2OS8 C;  3KHE A;  2E6W A;  1ZUZ A;  2H5R A;  2DD9 A;  1CV7 A;  5BTT B;  2KFF A;  1J7P A;  4PHK A;  2QLE A;  1SMG A;  1XVJ A;  1EMG A;  2I2R E;  2HPS A;  1Q4A A;  1H6R A;  1DJY A;  3CZT X;  3DVK A;  1EXR A;  4I5J A;  2A52 B;  4E68 A;  1OE9 B;  4CPV A;  1XFW O;  4EMQ A;  3U8P A;  3KPX A;  2HFC A;  4YI8 A;  1K90 D;  5HZT A;  3ST0 A;  2L4H A;  4KEX A;  1KK8 C;  1JBZ A;  1KFX S;  2OTG C;  3LLE A;  1BT6 A;  1IJ5 A;  3ICB A;  3C1V A;  2VVI A;  2JC2 A;  4W77 A;  1CNP A;  2HQK A;  1KYR A;  3VGO A;  3PAT A;  2LLS A;  1RJV A;  3OHM B;  1CM1 A;  1WLM A;  2HRS A;  1PVB A;  2M97 A;  1OMV A;  2JZI A;  2EHB A;  1KQV A;  1KQM B;  2GV5 A;  1C7V A;  3BUN B;  3AI4 A;  1B7T Y;  1KK7 Y;  2MBX A;  4XGY A;  3CD9 A;  3SIA A;  1DTL A;  1A75 B;  1J1D A;  2V53 A;  3BXA A;  2M9G A;  5AXI A;  1AUI B;  1TNW A;  2L50 A;  4HQC A;  1SCV A;  1UUR A;  3K21 A;  5AER A;  4IK5 A;  2Z6Y A;  4YGA A;  5I2O A;  1YX8 A;  2ZND A;  2EMD A;  1F70 A;  5HGE A;  3ZTF A;  4C0J A;  3SVO A;  4W6U A;  4ZF5 A;  4ETO A;  2POX A;  3DQ4 A;  1ZOT B;  1SRA A;  1MYW A;  2WCF A;  1IQ3 A;  4PHJ A;  2LAN A;  2F8P A;  2Q57 A;  2WIQ A;  1YHI A;  2JNX A;  3CFA A;  1MOU A;  1M39 A;  1HQV A;  1YRU B;  2H8Q A;  4GF6 B;  1S6C A;  5EXB A;  2IS9 A;  4JRB A;  2JRF A;  3A8S A;  3KCS A;  4YI9 A;  1Y0V H;  2V4E A;  3NSO A;  4FQO A;  4W6M A;  5DTL A;  1QTX A;  2JPT A;  1G4Y R;  3TS5 C;  2Z6X A;  3DQ3 A;  4N1G A;  3LVA A;  3WNX B;  1KCY A;  1GFL A;  3PJ5 A;  4ANJ A;  2C9J A;  1QX2 A;  2WIS A;  3TMT A;  1M45 A;  3KCT A;  1BOD A;  1YUU A;  2F3Y A;  3OB2 B;  3AKO A;  1CMF A;  1NCZ A;  1TNX A;  4JF9 A;  3O78 A;  4XOW A;  3U8C A;  1GGW A;  1RMO A;  3GJ1 A;  3SG5 A;  2AWM A;  3DQH A;  3DQ1 A;  2FOT A;  4PPK A;  3BYA A;  4YRU A;  1CMG A;  5HW9 A;  1UIS A;  4IK8 A;  5GQQ C;  1HT9 A;  4B30 B;  2LV7 A;  3NSL A;  2JUL A;  2GX2 A;  2BBM A;  1IRJ A;  1N2D A;  2L4I A;  5FVF A;  3LS3 A;  4QJ3 B;  1J1E A;  3DPX A;  2AHA A;  3NSK A;  1RTP 1;  3BUW B;  1YUT A;  3SVR A;  4MVF A;  3DQF A;  2AWK A;  5T3I A;  4W7F A;  2G2S B;  2K7D A;  1SW8 A;  4HE4 A;  1FF1 A;  1SR6 B;  2H9W A;  4GGN A;  1Q4D A;  4DXN A;  3WLC A;  2IB5 A;  3SV5 A;  2GX0 A;  5EJU A;  4JC2 A;  1DF0 A;  3NT3 A;  2HJO A;  4N1F A;  3O2P A;  2M7L A;  1RMP A;  1U5I B;  5DTY A;  4OJ0 A;  5PAL A;  3WHT B;  4ZIO A;  1XFV O;  3SS0 A;  3NED A;  3D0Y A;  1GJY A;  3DQJ A;  2BBN A;  2I18 A;  3S05 A;  1NCX A;  2ZRS A;  5FHV A;  2G5Z B;  3DVJ A;  4DCK A;  2OKY A;  4OV2 A;  2MRD A;  1G7K A;  3CS1 A;  1KFU S;  1CDN A;  1EMB A;  2OPO A;  2O2B A;  5I2Q A;  4W6J A;  1JWD A;  3U0M A;  2O60 A;  1FI5 A;  2QLH A;  1MOV A;  4DXO A;  1J7Q A;  4KF5 A;  2JOJ A;  4GOB A;  3EK8 A;  2PSR A;  1FPW A;  2WSO A;  1MQ1 A;  4DUQ A;  4OCI A;  3WLD A;  2MLF C;  1XFU O;  2NCO A;  2DDC A;  1XA9 A;  4LW5 A;  4C0K A;  2VZX A;  4W6C A;  1NCY A;  4IK1 A;  3ST3 A;  4IK9 A;  1UUS A;  2QRF A;  1S1E A;  1UHK A;  3BUO B;  3W1D A;  1NX3 A;  4J8A A;  1Q4B A;  1DGU A;  1TRF A;  2KI4 B;  1TNQ A;  1CKK A;  4W7R A;  1B8L A;  3FS7 A;  3LCP C;  2KFH A;  2MA2 A;  1MHO A;  2F2O A;  1UWO A;  1RK9 A;  4EDO A;  2NZ0 A;  4ZCU A;  2G9B A;  2QU1 A;  2BE4 A;  3FWC A;  2YE1 A;  1BOC A;  1LA0 A;  4TZG A;  2VVH A;  4W6H A;  2WHS A;  3TDZ A;  2OS8 B;  5HKW A;  1XFY O;  2M0R A;  1QYO A;  4W6G A;  5H87 A;  1PUL A;  1NX0 A;  4W6F A;  4H3L A;  2KQ6 A;  1WDC C;  2O5G A;  4L12 A;  1KP5 A;  1NX2 A;  4I2Y A;  1W7U A;  1YJ2 A;  1HCJ A;  1MF8 B;  1QXP A;  4W74 A;  4YGD B;  2HQ8 A;  2CT9 A;  4DXQ A;  3CR2 A;  2JT3 A;  3M0W A;  5J2O A;  1A03 A;  1ZGQ A;  3OB1 B;  4F0Z B;  1XFX O;  2FWQ A;  1CFP A;  4W6K A;  2Q4U A;  1KK8 B;  1SK6 D;  2OTG B;  2QPT A;  3CGA A;  2LMU A;  2R2I A;  1DJG A;  3CR5 X;  2WCB A;  2KI6 C;  5HLV A;  1K9U A;  3CR4 X;  1Y1X A;  2A4J A;  1J7O A;  1UHH A;  3TUY B;  5DPH A;  3VRN A;  2NCP A;  2V4E B;  2A46 A;  2ZN8 A;  2O24 A;  1XK4 C;  5D69 A;  1G8I A;  3VHT A;  1B9A A;  3I5I C;  3O4Y A;  4W7C A;  4B5Y A;  4GAO A;  3DQC A;  4M2O A;  2O29 A;  3IR8 A;  1EG4 A;  4AQJ A;  4W69 A;  4Q04 A;  2KYC A;  1KYS A;  1BR1 B;  5KSZ A;  3ADF A;  2B3P A;  3EVR A;  3CGL A;  4MSP A;  1OXD A;  3ZWH A;  1LKJ A;  2P4M A;  2EGD A;  1R6P A;  4W7E A;  5F9G A;  4ZB1 A;  1JC0 A;  2WC8 A;  4KW8 A;  5LTQ A;  1MXE A;  4L9M A;  4Q7U A;  2NXQ A; 
#chains in the Genus database with same CATH topology
 1DJH A;  2QLG A;  1FBV A;  2DDD A;  2DUE A;  1JBA A;  4YGB B;  5DTZ A;  2LP2 A;  1MUX A;  3WHU B;  5H89 A;  1QYQ A;  2D8N A;  1YVL A;  1AVS A;  1EMC A;  3M22 A;  1ZUX A;  3SSP A;  3LVC A;  4R6B A;  1KWO B;  3I5H C;  2MHH A;  2M1U A;  4XJK A;  2RGI A;  3TDU A;  1YUS A;  1E8A A;  3SVU A;  4YGE B;  2ZMU A;  2PYQ A;  1H4U A;  1L2O B;  1SL7 A;  2LLT A;  5HBD A;  3I19 A;  3U0N A;  1FI6 A;  3O77 A;  1GL4 A;  1DF0 B;  3OX5 A;  2QLI A;  1KYP A;  1QV0 A;  2AWJ A;  2WSN A;  5AEQ A;  1H8B A;  2JT0 A;  1QX7 A;  2A56 B;  3I5G C;  4XL5 A;  3AAJ A;  5EL2 A;  5CSF A;  1Q4C A;  3BUX B;  5CSJ A;  2A48 A;  1PRW A;  2K2F A;  2M1K B;  4C0L A;  3D0Y B;  3GK2 A;  1KFU L;  1QVI Z;  1CFD A;  3L47 A;  2VRG A;  4CFQ A;  2WCK A;  1IJ6 A;  1TCF A;  1TOP A;  1TTX A;  4LQU A;  3WXA A;  2VVJ A;  4H47 A;  5KTG A;  4OR9 B;  3AKB A;  4W6N A;  2DUI A;  3R1O A;  2AWL A;  4LJD C;  1WRZ A;  2C9I A;  4NDC A;  3WCK A;  1H4B A;  2ZMW A;  1IH0 A;  4XVP A;  1LVC D;  1OSA A;  4ZCV A;  2BAP A;  1PSR A;  2WHU A;  1JFK A;  3JVT C;  4KPI A;  3OBV A;  1CM4 A;  2JQ6 A;  3ZUF A;  2L0P A;  3LL8 B;  4HQ8 A;  3PFV A;  3DQ2 A;  1EME A;  4Q9W A;  4W73 A;  5EB7 A;  5EXC I;  2BCA A;  3PJI A;  4WRI A;  1S3P A;  4FTG A;  2AMI A;  1KSM A;  3DY9 A;  3PIB A;  2H61 C;  3BXB A;  2KGB C;  4PHM A;  1XQM A;  3I5F B;  1N65 A;  2CNP A;  1LS8 A;  5EXU A;  2KGR A;  1L7Z A;  1K9K A;  3EK7 A;  3SSV A;  1Q4E A;  1W7T A;  2ZNE A;  1XSS A;  5DRF A;  3DQ8 A;  2LHL A;  1AP4 A;  5HZO A;  3EKH A;  1J7R A;  1M31 A;  5HKZ A;  4MN0 A;  4ZIN A;  4BY5 A;  2A53 B;  3SVE A;  4GBA A;  2PAL A;  2TN4 A;  4CLN A;  4P76 A;  1YFP A;  4RTC A;  4ICB A;  4A4B A;  4ZF3 A;  5DU0 A;  3RLZ A;  4KW4 A;  1KQM C;  1OOJ A;  2K0J A;  5DKN A;  1XYD A;  4IL1 A;  3G9A A;  5HYD A;  3IP2 A;  4R6D A;  2FCD A;  2Y1N A;  2L2E A;  3SG3 A;  4W6P A;  1A4P A;  1UP5 A;  3FIA A;  1F0B A;  3FWB A;  3F45 A;  1XAE A;  1DT7 B;  4P2Y B;  1SCM B;  1OXE A;  2KBI A;  3DQA A;  4DS7 A;  4IZN A;  2LC5 A;  4MLW A;  1SSE B;  2WCH A;  5KU1 A;  3BX9 A;  2LMT A;  2H61 A;  2GW3 A;  4QJ5 B;  2QAC A;  4N3D A;  1LA3 A;  4W6R A;  4HVF A;  1DVI A;  2KLE A;  5JOL A;  3R72 A;  2RH7 A;  2L5X B;  2A54 B;  5KTY A;  4HRG A;  1JC1 A;  4NQG A;  4NDD A;  4ORC B;  1YUR A;  3PJB A;  2EMN A;  1PVA A;  2LVI A;  2JXC A;  3VHT B;  5D7F A;  3A4U B;  4OGS A;  4XOV A;  2Z6Z A;  1DJW A;  4JEO A;  1OW4 A;  5D3O A;  3VRO A;  5HKY A;  3RWA A;  1HUY A;  4OKH A;  3EK4 A;  2KNE A;  1DGV A;  4PT1 A;  3PN7 B;  3SIB A;  1WDC B;  1V1G A;  1K94 A;  1EMK A;  3GEX A;  1NIW A;  1J55 A;  4CFR A;  3OSQ A;  2BE6 A;  2OKW A;  1REC A;  2NLN A;  2LNK A;  3E5V A;  1Z1Q A;  1EMM A;  1OOF A;  1QLS A;  1EJ3 A;  3JTD B;  4OY4 A;  5DKR A;  3AAK A;  2QLG B;  1Z1P A;  1F4Q A;  2CXJ A;  3OGO A;  4PE4 A;  3D77 A;  1QYF A;  1ALV A;  3IVT A;  2H5P A;  3SVB A;  4ZF4 A;  3V2L A;  1B8R A;  3ZNI A;  2MAZ A;  2ZRT A;  3R1V A;  2K8M B;  3LK0 A;  1K8U A;  1KFX L;  5H88 A;  2OGR A;  4A4C A;  1A29 A;  2BKH B;  4XJK B;  1PSB A;  2M7N A;  3H1O A;  1NP8 A;  3TDI A;  3KO0 A;  2KSP A;  3NHT A;  2K61 A;  3NSI A;  2FJY A;  2EMO A;  3RWT A;  1AHR A;  3PAL A;  3D75 A;  1YHH A;  5JJG A;  1FW4 A;  3OX6 A;  1B7T Z;  3EVP A;  4RYS A;  3IQQ A;  5DPG A;  5FVG A;  1QIW A;  2EC6 C;  3S0B A;  1QAS A;  2Y1M A;  3NF0 A;  2GGM A;  1NPQ A;  1WLZ A;  1SR6 C;  4H48 A;  3O4X A;  1S5G Z;  1AJ4 A;  2SCP A;  1D1O A;  3UFZ A;  1EG3 A;  1ALW A;  5FI6 A;  4MZJ A;  4DKM A;  2OTE A;  4P5O E;  2ZN9 A;  3UO9 A;  4JPZ B;  2G3O A;  4L13 A;  4W75 A;  2JPO A;  1NX1 A;  1XA5 A;  1IWQ A;  1K96 A;  1JBY A;  3DD4 A;  1MXL C;  1F8H A;  1LIN A;  3DVE A;  1DQE A;  2COL B;  1YR5 A;  2BTJ A;  4N5X A;  3DQL A;  2BEC A;  4W6O A;  1UHN A;  1OZS A;  3SVC A;  1T14 A;  3B87 A;  4EN1 A;  4H3N A;  3MSE B;  2KI6 D;  1RMM A;  2YFP A;  2GGZ A;  3NHI A;  3O6B A;  4UPG A;  3ZUL A;  4MZK A;  3IQO A;  4Z4M A;  4HRE E;  2I94 A;  1KSO A;  2LP3 A;  1OOG A;  4I5L B;  4IK3 A;  2CTN A;  3S0G A;  4PPJ A;  2M8U A;  1OQP A;  3M24 A;  2WCM A;  4JQ0 D;  1JUO A;  3ED8 A;  1WY9 A;  3BFB A;  2YE0 A;  2G6Y A;  2I7A A;  5J3X A;  2M3W A;  1S6J A;  3DPW A;  2B1U A;  3PM2 A;  4LJB A;  5DQM A;  3VK1 A;  2G6E A;  4L1I A;  2FZU A;  1YX7 A;  5FI2 A;  2M29 A;  4MEW A;  2DUG A;  2K7B A;  5IBW A;  5LTP A;  3DQE A;  3BXK A;  5CSI A;  2VAE A;  4EDS A;  3SVD A;  4W6S A;  1W7S A;  5EB6 A;  1P28 A;  1F09 A;  1QLK A;  1F71 A;  3D76 A;  1SPY A;  3D74 A;  2HQW A;  1S26 D;  4DRW A;  4PHN A;  5DKQ A;  1YRT B;  3GL4 A;  4ZFS A;  2L51 A;  4PCW A;  1BG1 A;  2ERB A;  1Y6W A;  4IJ7 A;  5EBJ A;  3DQ7 A;  2LLU A;  4HQ9 A;  2G2B A;  4MRY A;  2Y4Q A;  1IQ5 A;  2ZKM X;  2WCL A;  3U8A A;  4BY4 A;  5F6T A;  1XO5 A;  4OQW A;  1NYA A;  4P1Q A;  2PVB A;  3NEZ A;  1QAT A;  1SKT A;  5CPV A;  3JVT B;  1ZGO A;  1C07 A;  3SS4 A;  4Q9X A;  1F54 A;  1QIV A;  1TUJ A;  1BFP A;  2FL1 A;  3CWG A;  2JAD A;  3ST4 A;  5BT0 A;  5DPJ A;  1QY3 A;  2AH8 A;  3BQ3 A;  4ORB B;  5HZS A;  4I5K A;  3UG0 A;  1B47 A;  2H2K A;  4W6A A;  1ZFS A;  4DIR A;  1XK4 A;  3TS5 B;  3AKA A;  4AS8 A;  4WQ3 A;  2MJW B;  1K9P A;  4H3M A;  4KGE A;  4KW9 A;  1W7J B;  4JGE A;  1Y1A A;  3W1C A;  3GK1 A;  4GFT A;  2KAY A;  3TUY C;  4DXP A;  2YDZ A;  1EMA A;  4AQI A;  5FVI A;  4LQT A;  2V4E C;  3BXC A;  2G3D B;  2F3Z A;  1SNL A;  1NSH A;  2PXS A;  3SST A;  1G33 A;  1AK8 A;  4DXI A;  3DQK A;  2Y5I A;  3D78 A;  4PAL A;  5I8N A;  2L98 A;  4W7A A;  1XFR A;  4W72 A;  2BL0 C;  2ARL A;  5DTX A;  3SSL A;  3SVN A;  3SS3 A;  5DQB A;  4UTS A;  3SG2 A;  1QWV A;  2PRU A;  4XYN A;  3U0K A;  4Q7T A;  3PJ7 A;  2Y0G A;  1S5G Y;  3VRQ A;  3CB9 A;  1JC2 A;  1DC1 A;  2PMY A;  5B8I B;  4RYW A;  3A8R A;  1RWY A;  3OSR A;  1R2U A;  1CB1 A;  4USL A;  2JNF A;  3SG6 A;  2KDH A;  2AAO A;  4W7D A;  4PE0 A;  1K2H A;  3BOW A;  2M49 B;  1JF2 A;  4KF4 A;  3RM1 A;  3GJ2 A;  2IB6 A;  3B88 A;  4IK4 A;  2WCE A;  5AFP A;  1S6Z A;  3MGF A;  3DQU A;  5EHU A;  1CLL A;  3B7A A;  1SY9 A;  4DKN A;  1K93 D;  2PAS A;  1BLQ A;  2F2P A;  1C7W A;  1MR8 A;  3KF9 A;  5ER5 A;  2ICR A;  5HZU A;  2K7C A;  4W7X A;  2Z1O A;  3HCM A;  1DMO A;  1CDP A;  2HPW A;  2BCB A;  1KWO C;  2GW4 B;  2AUC A;  3DQO A;  2PXW A;  2WOR A;  2H5O A;  1ZGP A;  3LK1 A;  3IF7 A;  4PE7 A;  4PE1 A;  4JWQ A;  1L2O C;  1N0Y A;  3CLN A;  3QME A;  1IKU A;  4KA9 A;  5TNC A;  3SVS A;  3VRP A;  4MRX A;  3P28 A;  2HGY A;  1WRK A;  1ZMZ A;  1RM9 A;  1YZW A;  3VRR A;  4J88 A;  3DYE A;  2KAV A;  3SRY A;  1PK0 D;  4CID A;  4LJD A;  1DJI A;  2IE2 A;  3DF0 A;  1YHG A;  1UHJ A;  4GPL B;  3RZS A;  5HLO A;  3TMR A;  2LUX A;  1OMD A;  2FJU B;  1X02 A;  4WQ2 A;  3H4S E;  3DQM A;  5DRG A;  3CZ2 A;  5G08 A;  3EKJ A;  3BFA A;  5BTT A;  4ORN A;  3H1R A;  4YBH B;  1B4C A;  4TZA A;  3LVD A;  2Q91 A;  4AOM A;  1SYM A;  3CBE A;  2LCP A;  3DVM A;  3SSK A;  1GGZ A;  2LVV A;  1EML A;  4KF5 C;  1RFJ A;  1CFF A;  2KFG A;  2G6X A;  3S0F A;  1Q80 A;  1SBJ A;  3DPZ A;  1CTR A;  3QRX A;  4M2P A;  1SL8 A;  2H5Q A;  2HGD A;  1IG5 A;  2A47 A;  2LUC A;  1WRL A;  1CLB A;  1B8C A;  4U8D A;  2VAD A;  4MZL A;  4FQT A;  1A2X A;  2EC6 B;  1K95 A;  3NT9 A;  1EH2 A;  3GOF A;  2LAP A;  1NUB A;  3E5W A;  4OVN F;  4I5N B;  5LK4 A;  5DY6 A;  4GES B;  2K2A A;  3E3R A;  2OJK A;  1S6I A;  4GUK A;  2WC5 A;  1OXF A;  1DJZ A;  4ZBL A;  2H6V A;  3PM8 A;  4R1E A;  2K7O A;  1MWN A;  2YGU A;  2P71 A;  3I5F C;  3BUM B;  3TZ1 A;  3S0A A;  3VIC A;  1DJX A;  3CFH A;  1OOI X;  1CFC A;  5BQL A;  1RRO A;  5ER4 X;  4D1E A;  4MBE A;  2BCX A;  2JT8 A;  2DUF A;  2WHT A;  1BU3 A;  3BFH A;  2KPH A;  1VRK A;  1A75 A;  1IIO A;  2WND A;  5FYX A;  2QDI A;  2KHN A;  2HQZ A;  5AQB B;  2LVJ A;  4W6T A;  4JFG A;  3EVV A;  2F33 A;  1BF5 A;  1QVI Y;  1YJF A;  4NWS A;  1TCO B;  4PDZ A;  1QJT A;  1B1G A;  2IOV A;  1C4F A;  1M63 B;  1YVH A;  4M2Q A;  3U0L A;  4PFE A;  2DUH A;  2WOS A;  2PQL A;  3FE8 A;  2MLE C;  5I2L A;  2KYF A;  1EL4 A;  2ZO6 A;  4W76 A;  3SJS A;  1TIZ A;  2JTT A;  1SCM C;  2LHI A;  2GTE A;  1BJF A;  2HF5 A;  3DQN A;  3ZUJ A;  3I5I B;  4Q7R A;  2HCG A;  4BDU A;  2LMV A;  2FCE A;  1KK7 Z;  3DQ9 A;  1V1F A;  4GGF C;  3CZ0 A;  1QS7 A;  3NXA A;  3LSA A;  5LTR A;  3EVU A;  2BKI B;  3P8U A;  4PPL A;  2QT2 A;  2ZFD A;  3CDN A;  1IGV A;  1B9C A;  3DQI A;  3SSY A;  4EUL A;  1TNP A;  5K89 A;  2WUR A;  2OTB A;  3SSH A;  2KQY A;  1PAL A;  2E30 A;  2CBL A;  1UHI A;  4U2V A;  1QXT A;  3OP0 A;  2ISD A;  2B3Q A;  1OMR A;  1JF0 A;  3LA1 A;  4KGF A;  1Q73 A;  1F55 A;  4NDB A;  4KAG A;  3K1K A;  5CSN A;  3L4L A;  1M46 A;  2A50 B;  1BR4 B;  1EMF A;  2LE9 B;  4Z4K A;  1ORG A;  1QV1 A;  3PN7 C;  3LF3 A;  1CDL A;  3B6X A;  3D10 A;  3DQ6 A;  4AR7 A;  1GGX A;  4GNK B;  3LF4 B;  1F4O A;  3SG4 A;  1XFZ O;  2LVK A;  3GB3 A;  2SAS A;  4B30 A;  3I5H B;  1TWO A;  1BMO A;  2JU0 A;  1RRX A;  4DXM A;  5FI7 A;  3UNW A;  3SG7 A;  4YGC B;  1SL9 A;  3BOW B;  4QJ4 B;  1TN4 A;  1JSA A;  3E5T A;  3JTD C;  4HRH A;  1CLM A;  4W6D A;  2LM5 A;  2L2C A;  1S36 A;  2KOT A;  4W6B A;  1LXF C;  2JTZ A;  1Y1U A;  1QX5 B;  5AAN A;  3CFF A;  4GGF A;  2JWW A;  2KAX A;  4W6L A;  3PLF B;  2JXL A;  2HET A;  3I5G B;  2Q6P A;  3GK4 X;  4LJC A;  2G16 B;  1OZO A;  3ST2 A;  3DQD A;  3SS5 A;  1W7I B;  5BPJ A;  3CTN A;  4ORA B;  1JFJ A;  2KI4 C;  1NWD A;  1AJ5 A;  5DPI A;  2CCM A;  4OHS A;  4W6I A;  2DD7 A;  3AI5 A;  1U5I A;  1YTZ C;  4HSZ A;  3HX4 A;  3R1P A;  1GQM A;  2ZO7 A;  3PSR A;  2DOQ A;  2BL0 B;  3KEV A;  2P6B B;  3DQ5 A;  1XMZ A;  3V3D A;  4TNC A;  2QZ0 A;  1W9Z A;  2BNX A;  1CDM A;  2KBM A;  3DF0 B;  3CD1 A;  1ODB A;  1ZAC A;  4J89 A;  2OS8 C;  3KHE A;  2E6W A;  1ZUZ A;  2H5R A;  2DD9 A;  1CV7 A;  5BTT B;  2KFF A;  1J7P A;  4PHK A;  2QLE A;  1SMG A;  1XVJ A;  1EMG A;  3CAB A;  2I2R E;  4F7F A;  2HPS A;  1Q4A A;  1H6R A;  1DJY A;  3CZT X;  3DVK A;  4INX A;  1EXR A;  4I5J A;  2A52 B;  4E68 A;  1OE9 B;  4CPV A;  1C3Y A;  1XFW O;  4EMQ A;  3U8P A;  3KPX A;  2HFC A;  4YI8 A;  1K90 D;  5HL1 A;  5HZT A;  3ST0 A;  2L4H A;  4KEX A;  1KK8 C;  1JBZ A;  1KFX S;  2OTG C;  3LLE A;  3L4A A;  1BT6 A;  1IJ5 A;  3ICB A;  3C1V A;  2VVI A;  2JC2 A;  4W77 A;  1CNP A;  2HQK A;  1KYR A;  3VGO A;  3OGN A;  3PAT A;  2LLS A;  1RJV A;  3OHM B;  1CM1 A;  1WLM A;  2HRS A;  1PVB A;  2M97 A;  4KYN A;  1OMV A;  2JZI A;  3NGV A;  2EHB A;  1KQV A;  1KQM B;  2GV5 A;  1C7V A;  3BUN B;  3AI4 A;  1B7T Y;  1KK7 Y;  2MBX A;  4XGY A;  3CD9 A;  3BJH A;  2P70 A;  3SIA A;  4INW A;  1DTL A;  1A75 B;  1J1D A;  2V53 A;  3BXA A;  2M9G A;  5AXI A;  1AUI B;  1TNW A;  2L50 A;  4HQC A;  1SCV A;  1UUR A;  3K21 A;  2KLD A;  5AER A;  4IK5 A;  2Z6Y A;  4YGA A;  5I2O A;  5I94 A;  1YX8 A;  1DEK A;  2ZND A;  2EMD A;  1F70 A;  5HGE A;  3ZTF A;  4C0J A;  3SVO A;  4W6U A;  4ZF5 A;  4ETO A;  2POX A;  3DQ4 A;  1ZOT B;  1SRA A;  1MYW A;  2QEV A;  2WCF A;  1IQ3 A;  2L5Y A;  4PHJ A;  2LAN A;  2QEH A;  2F8P A;  2Q57 A;  2WIQ A;  1YHI A;  2JNX A;  3CFA A;  1MOU A;  1M39 A;  1HQV A;  1YRU B;  2H8Q A;  4GF6 B;  1S6C A;  5EXB A;  2IS9 A;  4JRB A;  2JRF A;  3A8S A;  3KCS A;  4YI9 A;  1Y0V H;  2V4E A;  3NSO A;  4FQO A;  4W6M A;  5DTL A;  1QTX A;  2JPT A;  1G4Y R;  3TS5 C;  2Z6X A;  3DQ3 A;  4N1G A;  3LVA A;  3WNX B;  1KCY A;  1GFL A;  3PJ5 A;  4ANJ A;  2H8V A;  2C9J A;  1QX2 A;  2WIS A;  2QEO A;  3VB1 A;  3TMT A;  1M45 A;  3KCT A;  1BOD A;  1YUU A;  2F3Y A;  3OB2 B;  3AKO A;  1CMF A;  1NCZ A;  1TNX A;  4JF9 A;  3O78 A;  4XOW A;  3CYZ A;  3U8C A;  1GGW A;  3Q8I A;  1RMO A;  3GJ1 A;  3SG5 A;  2AWM A;  3DQH A;  3DQ1 A;  2FOT A;  4PPK A;  3BYA A;  4YRU A;  1CMG A;  5HW9 A;  1UIS A;  4IK8 A;  5GQQ C;  1HT9 A;  4B30 B;  2LV7 A;  3NSL A;  2JUL A;  2GX2 A;  2BBM A;  1IRJ A;  1N2D A;  2L4I A;  5FVF A;  3LS3 A;  4QJ3 B;  1J1E A;  3DPX A;  2AHA A;  2WC6 A;  3NSK A;  4JD9 A;  1C3Z A;  1RTP 1;  3K1E A;  3D73 A;  2WCJ A;  3BUW B;  2QEB A;  1YUT A;  3SVR A;  4MVF A;  3DQF A;  2AWK A;  5T3I A;  4W7F A;  2G2S B;  3S0D A;  4JKT A;  2K7D A;  1SW8 A;  4HE4 A;  1FF1 A;  1SR6 B;  2H9W A;  4GGN A;  1Q4D A;  4DXN A;  3WLC A;  2IB5 A;  3SV5 A;  2GX0 A;  5EJU A;  4JC2 A;  1DF0 A;  3NT3 A;  2HJO A;  4N1F A;  3O2P A;  2M7L A;  1RMP A;  1U5I B;  5DTY A;  4OJ0 A;  5PAL A;  3WHT B;  4ZIO A;  1XFV O;  3DXL A;  3SS0 A;  3NED A;  3D0Y A;  1GJY A;  3DQJ A;  4OZD A;  2BBN A;  2I18 A;  3S05 A;  3CZ1 A;  1NCX A;  2ZRS A;  5FHV A;  1TUZ A;  2G5Z B;  3DVJ A;  4DCK A;  2OKY A;  4OV2 A;  3FE9 A;  2MRD A;  1G7K A;  3CS1 A;  1KFU S;  1CDN A;  1EMB A;  2OPO A;  2O2B A;  5I2Q A;  4W6J A;  1JWD A;  3U0M A;  3FE6 A;  2O60 A;  1FI5 A;  2QLH A;  1MOV A;  4DXO A;  1J7Q A;  4KF5 A;  1DEL A;  2JOJ A;  4GOB A;  3EK8 A;  2PSR A;  1FPW A;  2WSO A;  1MQ1 A;  4DUQ A;  4OCI A;  3WLD A;  2MLF C;  1XFU O;  2NCO A;  3B86 A;  2DDC A;  1XA9 A;  4LW5 A;  4C0K A;  2VZX A;  4W6C A;  1NCY A;  4IK1 A;  3ST3 A;  4IK9 A;  1UUS A;  2QRF A;  1S1E A;  1UHK A;  3BUO B;  3W1D A;  1NX3 A;  1OOH A;  4J8A A;  1Q4B A;  1DGU A;  1TRF A;  2KI4 B;  1TNQ A;  2K60 A;  1CKK A;  4W7R A;  1B8L A;  3FS7 A;  3LCP C;  2KFH A;  2MA2 A;  1MHO A;  2F2O A;  1UWO A;  1RK9 A;  4EDO A;  2NZ0 A;  4ZCU A;  2G9B A;  2QU1 A;  2BE4 A;  3FWC A;  2YE1 A;  1BOC A;  1LA0 A;  4TZG A;  2VVH A;  4W6H A;  3DZT A;  2WHS A;  3TDZ A;  2OS8 B;  5HKW A;  1XFY O;  2M0R A;  1QYO A;  4W6G A;  5H87 A;  1PUL A;  1NX0 A;  4W6F A;  4H3L A;  2KQ6 A;  1WDC C;  1Z2C B;  2O5G A;  4L12 A;  1KP5 A;  1NX2 A;  3EG5 B;  4I2Y A;  1W7U A;  1YJ2 A;  1HCJ A;  1MF8 B;  3S0E A;  1QXP A;  4W74 A;  4YGD B;  2HQ8 A;  2CT9 A;  4DXQ A;  3CR2 A;  2JT3 A;  3M0W A;  5J2O A;  1A03 A;  1ZGQ A;  3OB1 B;  4F0Z B;  1XFX O;  2FWQ A;  1CFP A;  4W6K A;  2Q4U A;  1KK8 B;  1SK6 D;  2OTG B;  2QPT A;  3CGA A;  2LMU A;  2R2I A;  1DJG A;  3CR5 X;  2WCB A;  1GM0 A;  2KI6 C;  5HLV A;  1K9U A;  3CR4 X;  1Y1X A;  2A4J A;  1J7O A;  1UHH A;  3TUY B;  5DPH A;  3VRN A;  2NCP A;  2V4E B;  2A46 A;  2ZN8 A;  2O24 A;  1XK4 C;  5D69 A;  1G8I A;  3VHT A;  1B9A A;  3I5I C;  3O4Y A;  4W7C A;  4B5Y A;  4GAO A;  1Z4H A;  3DQC A;  4M2O A;  3N7H A;  2O29 A;  3IR8 A;  1EG4 A;  4AQJ A;  4W69 A;  4Q04 A;  2KYC A;  1KYS A;  1BR1 B;  5KSZ A;  3ADF A;  2B3P A;  5DIC A;  3EVR A;  3CGL A;  4MSP A;  1OXD A;  3ZWH A;  1LKJ A;  2P4M A;  2EGD A;  1R6P A;  4W7E A;  5F9G A;  4ZB1 A;  1JC0 A;  2WC8 A;  4KW8 A;  5LTQ A;  1MXE A;  4L9M A;  4Q7U A;  2NXQ A; 
#chains in the Genus database with same CATH homology
 1DJH A;  2QLG A;  1FBV A;  2DDD A;  2DUE A;  1JBA A;  4YGB B;  5DTZ A;  2LP2 A;  1MUX A;  3WHU B;  5H89 A;  1QYQ A;  2D8N A;  1YVL A;  1AVS A;  1EMC A;  3M22 A;  1ZUX A;  3SSP A;  3LVC A;  4R6B A;  1KWO B;  3I5H C;  2MHH A;  2M1U A;  4XJK A;  2RGI A;  3TDU A;  1YUS A;  1E8A A;  3SVU A;  4YGE B;  2ZMU A;  1H4U A;  1L2O B;  1SL7 A;  2LLT A;  5HBD A;  3I19 A;  3U0N A;  1FI6 A;  3O77 A;  1GL4 A;  1DF0 B;  3OX5 A;  2QLI A;  1KYP A;  1QV0 A;  2AWJ A;  2WSN A;  5AEQ A;  1H8B A;  2JT0 A;  1QX7 A;  2A56 B;  3I5G C;  4XL5 A;  3AAJ A;  5CSF A;  1Q4C A;  3BUX B;  5CSJ A;  2A48 A;  1PRW A;  2K2F A;  2M1K B;  4C0L A;  3D0Y B;  3GK2 A;  1KFU L;  1QVI Z;  1CFD A;  2VRG A;  4CFQ A;  1IJ6 A;  1TCF A;  1TOP A;  1TTX A;  4LQU A;  3WXA A;  2VVJ A;  4H47 A;  5KTG A;  4OR9 B;  3AKB A;  4W6N A;  2DUI A;  2AWL A;  4LJD C;  1WRZ A;  2C9I A;  4NDC A;  3WCK A;  1H4B A;  2ZMW A;  1IH0 A;  4XVP A;  1LVC D;  1OSA A;  4ZCV A;  1PSR A;  2WHU A;  1JFK A;  3JVT C;  4KPI A;  1CM4 A;  2JQ6 A;  3ZUF A;  2L0P A;  3LL8 B;  4HQ8 A;  3PFV A;  3DQ2 A;  1EME A;  4Q9W A;  4W73 A;  5EB7 A;  5EXC I;  2BCA A;  4WRI A;  1S3P A;  4FTG A;  2AMI A;  1KSM A;  3PIB A;  2H61 C;  3BXB A;  2KGB C;  4PHM A;  1XQM A;  3I5F B;  1N65 A;  2CNP A;  5EXU A;  2KGR A;  1L7Z A;  1K9K A;  3EK7 A;  3SSV A;  1Q4E A;  1W7T A;  2ZNE A;  1XSS A;  5DRF A;  3DQ8 A;  2LHL A;  1AP4 A;  5HZO A;  3EKH A;  1J7R A;  1M31 A;  5HKZ A;  4MN0 A;  4ZIN A;  4BY5 A;  2A53 B;  3SVE A;  4GBA A;  2PAL A;  2TN4 A;  4CLN A;  4P76 A;  4RTC A;  1YFP A;  4ICB A;  4A4B A;  4ZF3 A;  5DU0 A;  3RLZ A;  4KW4 A;  1KQM C;  1OOJ A;  2K0J A;  5DKN A;  1XYD A;  4IL1 A;  3G9A A;  5HYD A;  3IP2 A;  4R6D A;  2FCD A;  2Y1N A;  2L2E A;  3SG3 A;  4W6P A;  1A4P A;  1UP5 A;  3FIA A;  1F0B A;  3FWB A;  3F45 A;  1XAE A;  1DT7 B;  4P2Y B;  1SCM B;  1OXE A;  2KBI A;  3DQA A;  4DS7 A;  4IZN A;  2LC5 A;  4MLW A;  5KU1 A;  3BX9 A;  2LMT A;  2H61 A;  2GW3 A;  4QJ5 B;  2QAC A;  4N3D A;  1LA3 A;  4W6R A;  4HVF A;  1DVI A;  5JOL A;  2RH7 A;  2L5X B;  2A54 B;  5KTY A;  4HRG A;  1JC1 A;  4NQG A;  4NDD A;  4ORC B;  1YUR A;  3PJB A;  2EMN A;  1PVA A;  2LVI A;  2JXC A;  3VHT B;  5D7F A;  3A4U B;  4OGS A;  4XOV A;  2Z6Z A;  1DJW A;  4JEO A;  3VRO A;  5HKY A;  3RWA A;  1HUY A;  4OKH A;  3EK4 A;  2KNE A;  1DGV A;  3PN7 B;  3SIB A;  1WDC B;  1V1G A;  1K94 A;  1EMK A;  3GEX A;  1NIW A;  1J55 A;  4CFR A;  3OSQ A;  2BE6 A;  2OKW A;  1REC A;  2NLN A;  2LNK A;  3E5V A;  1Z1Q A;  1EMM A;  1QLS A;  1EJ3 A;  3JTD B;  4OY4 A;  5DKR A;  3AAK A;  2QLG B;  1Z1P A;  1F4Q A;  2CXJ A;  3OGO A;  4PE4 A;  1QYF A;  1ALV A;  2H5P A;  3SVB A;  4ZF4 A;  1B8R A;  3ZNI A;  2MAZ A;  2ZRT A;  2K8M B;  3LK0 A;  1K8U A;  1KFX L;  5H88 A;  2OGR A;  4A4C A;  1A29 A;  2BKH B;  4XJK B;  1PSB A;  2M7N A;  3H1O A;  1NP8 A;  3TDI A;  3KO0 A;  2KSP A;  2K61 A;  3NSI A;  2EMO A;  3RWT A;  1AHR A;  3PAL A;  1YHH A;  5JJG A;  1FW4 A;  3OX6 A;  1B7T Z;  3EVP A;  4RYS A;  3IQQ A;  5DPG A;  5FVG A;  1QIW A;  3NF0 A;  2EC6 C;  1QAS A;  2Y1M A;  2GGM A;  1NPQ A;  1WLZ A;  1SR6 C;  4H48 A;  1S5G Z;  1AJ4 A;  2SCP A;  1D1O A;  3UFZ A;  1EG3 A;  1ALW A;  4MZJ A;  4DKM A;  2OTE A;  4P5O E;  2ZN9 A;  4JPZ B;  2G3O A;  4L13 A;  4W75 A;  1NX1 A;  1XA5 A;  1IWQ A;  1K96 A;  1JBY A;  3DD4 A;  1MXL C;  1F8H A;  1LIN A;  3DVE A;  2COL B;  1YR5 A;  2BTJ A;  4N5X A;  3DQL A;  2BEC A;  4W6O A;  1UHN A;  1OZS A;  3SVC A;  4EN1 A;  4H3N A;  3MSE B;  2KI6 D;  1RMM A;  2YFP A;  2GGZ A;  3O6B A;  4UPG A;  3ZUL A;  4MZK A;  3IQO A;  4Z4M A;  4HRE E;  2I94 A;  1KSO A;  2LP3 A;  4I5L B;  4IK3 A;  2CTN A;  4PPJ A;  2M8U A;  1OQP A;  3M24 A;  4JQ0 D;  1JUO A;  2G6Y A;  1WY9 A;  2YE0 A;  3ED8 A;  2I7A A;  5J3X A;  2M3W A;  1S6J A;  3DPW A;  2B1U A;  4LJB A;  5DQM A;  3VK1 A;  2G6E A;  4L1I A;  2FZU A;  1YX7 A;  2M29 A;  4MEW A;  2K7B A;  2DUG A;  5IBW A;  5LTP A;  3DQE A;  3BXK A;  5CSI A;  2VAE A;  4EDS A;  3SVD A;  4W6S A;  1W7S A;  5EB6 A;  1F09 A;  1QLK A;  1F71 A;  1SPY A;  2HQW A;  1S26 D;  4DRW A;  4PHN A;  5DKQ A;  1YRT B;  3GL4 A;  4ZFS A;  2L51 A;  4PCW A;  1BG1 A;  1Y6W A;  5EBJ A;  3DQ7 A;  2LLU A;  4HQ9 A;  2G2B A;  4MRY A;  2Y4Q A;  1IQ5 A;  2ZKM X;  3U8A A;  4BY4 A;  5F6T A;  1XO5 A;  4OQW A;  1NYA A;  4P1Q A;  2PVB A;  3NEZ A;  1QAT A;  1SKT A;  5CPV A;  3JVT B;  1ZGO A;  1C07 A;  4Q9X A;  1F54 A;  1QIV A;  1BFP A;  2FL1 A;  3CWG A;  2JAD A;  3ST4 A;  5BT0 A;  5DPJ A;  1QY3 A;  2AH8 A;  3BQ3 A;  4ORB B;  5HZS A;  4I5K A;  3UG0 A;  1B47 A;  2H2K A;  4W6A A;  1ZFS A;  4DIR A;  1XK4 A;  3TS5 B;  3AKA A;  4AS8 A;  4WQ3 A;  2MJW B;  1K9P A;  4H3M A;  4KGE A;  4KW9 A;  1W7J B;  4JGE A;  1Y1A A;  3W1C A;  3GK1 A;  4GFT A;  2KAY A;  3TUY C;  4DXP A;  2YDZ A;  1EMA A;  4AQI A;  5FVI A;  4LQT A;  2V4E C;  3BXC A;  2G3D B;  2F3Z A;  1SNL A;  1NSH A;  2PXS A;  3SST A;  1G33 A;  1AK8 A;  4DXI A;  3DQK A;  2Y5I A;  4PAL A;  5I8N A;  2L98 A;  4W7A A;  4W72 A;  2BL0 C;  2ARL A;  5DTX A;  3SSL A;  3SVN A;  5DQB A;  4UTS A;  3SG2 A;  2PRU A;  4XYN A;  3U0K A;  4Q7T A;  3PJ7 A;  2Y0G A;  1S5G Y;  3VRQ A;  3CB9 A;  1JC2 A;  2PMY A;  5B8I B;  4RYW A;  3A8R A;  1RWY A;  3OSR A;  1R2U A;  1CB1 A;  4USL A;  2JNF A;  3SG6 A;  2KDH A;  2AAO A;  4W7D A;  4PE0 A;  1K2H A;  3BOW A;  2M49 B;  1JF2 A;  4KF4 A;  3RM1 A;  3GJ2 A;  2IB6 A;  4IK4 A;  2WCE A;  5AFP A;  1S6Z A;  3MGF A;  3DQU A;  5EHU A;  1CLL A;  1SY9 A;  4DKN A;  1K93 D;  2PAS A;  1BLQ A;  2F2P A;  1C7W A;  1MR8 A;  3KF9 A;  5ER5 A;  2ICR A;  5HZU A;  2K7C A;  4W7X A;  2Z1O A;  3HCM A;  1DMO A;  1CDP A;  2HPW A;  2BCB A;  1KWO C;  2GW4 B;  2AUC A;  3DQO A;  2PXW A;  2WOR A;  2H5O A;  1ZGP A;  3LK1 A;  3IF7 A;  4PE7 A;  4PE1 A;  4JWQ A;  1L2O C;  1N0Y A;  3CLN A;  1IKU A;  4KA9 A;  5TNC A;  3SVS A;  3VRP A;  4MRX A;  3P28 A;  2HGY A;  1WRK A;  1ZMZ A;  1RM9 A;  1YZW A;  3VRR A;  4J88 A;  2KAV A;  3SRY A;  1PK0 D;  4CID A;  4LJD A;  1DJI A;  2IE2 A;  3DF0 A;  1YHG A;  1UHJ A;  4GPL B;  5HLO A;  3TMR A;  2LUX A;  1OMD A;  2FJU B;  1X02 A;  4WQ2 A;  3H4S E;  3DQM A;  5DRG A;  5G08 A;  3EKJ A;  5BTT A;  4ORN A;  3H1R A;  4YBH B;  1B4C A;  4TZA A;  3LVD A;  2Q91 A;  4AOM A;  1SYM A;  3CBE A;  2LCP A;  3DVM A;  3SSK A;  1GGZ A;  2LVV A;  1EML A;  4KF5 C;  1RFJ A;  1CFF A;  2KFG A;  2G6X A;  1Q80 A;  1SBJ A;  3DPZ A;  1CTR A;  3QRX A;  4M2P A;  1SL8 A;  2H5Q A;  2HGD A;  1IG5 A;  2A47 A;  2LUC A;  1WRL A;  1CLB A;  1B8C A;  4U8D A;  2VAD A;  4MZL A;  1A2X A;  2EC6 B;  1K95 A;  3NT9 A;  1EH2 A;  3GOF A;  2LAP A;  1NUB A;  3E5W A;  4OVN F;  4I5N B;  5LK4 A;  5DY6 A;  4GES B;  2K2A A;  3E3R A;  2OJK A;  1S6I A;  4GUK A;  1OXF A;  1DJZ A;  4ZBL A;  2H6V A;  3PM8 A;  4R1E A;  2K7O A;  1MWN A;  3I5F C;  3BUM B;  3TZ1 A;  3VIC A;  1DJX A;  3CFH A;  1CFC A;  5BQL A;  1RRO A;  5ER4 X;  4D1E A;  4MBE A;  2BCX A;  2JT8 A;  2DUF A;  2WHT A;  1BU3 A;  1VRK A;  1A75 A;  2WND A;  5FYX A;  2KHN A;  2HQZ A;  5AQB B;  2LVJ A;  4W6T A;  4JFG A;  3EVV A;  2F33 A;  1BF5 A;  1QVI Y;  1YJF A;  4NWS A;  1TCO B;  4PDZ A;  1QJT A;  1B1G A;  2IOV A;  1C4F A;  1M63 B;  1YVH A;  4M2Q A;  3U0L A;  4PFE A;  2DUH A;  2WOS A;  2MLE C;  5I2L A;  2KYF A;  1EL4 A;  2ZO6 A;  4W76 A;  3SJS A;  1TIZ A;  2JTT A;  1SCM C;  2LHI A;  1BJF A;  2HF5 A;  3DQN A;  3ZUJ A;  3I5I B;  4Q7R A;  2HCG A;  4BDU A;  2LMV A;  2FCE A;  1KK7 Z;  3DQ9 A;  1V1F A;  4GGF C;  1QS7 A;  3NXA A;  3LSA A;  5LTR A;  3EVU A;  2BKI B;  3P8U A;  4PPL A;  2QT2 A;  2ZFD A;  1IGV A;  1B9C A;  3DQI A;  3SSY A;  4EUL A;  1TNP A;  5K89 A;  2WUR A;  2OTB A;  3SSH A;  2KQY A;  1PAL A;  2E30 A;  2CBL A;  1UHI A;  4U2V A;  1QXT A;  3OP0 A;  2ISD A;  2B3Q A;  1OMR A;  1JF0 A;  3LA1 A;  4KGF A;  1Q73 A;  1F55 A;  4NDB A;  4KAG A;  3K1K A;  5CSN A;  1M46 A;  2A50 B;  1BR4 B;  1EMF A;  2LE9 B;  4Z4K A;  1QV1 A;  3PN7 C;  3LF3 A;  1CDL A;  3D10 A;  3DQ6 A;  4AR7 A;  1GGX A;  4GNK B;  3LF4 B;  1F4O A;  3SG4 A;  1XFZ O;  2LVK A;  3GB3 A;  2SAS A;  4B30 A;  3I5H B;  1BMO A;  2JU0 A;  1RRX A;  4DXM A;  3SG7 A;  4YGC B;  1SL9 A;  3BOW B;  4QJ4 B;  1TN4 A;  1JSA A;  3E5T A;  3JTD C;  4HRH A;  1CLM A;  4W6D A;  2LM5 A;  1S36 A;  2KOT A;  4W6B A;  1LXF C;  2JTZ A;  1Y1U A;  1QX5 B;  5AAN A;  3CFF A;  4GGF A;  2JWW A;  2KAX A;  4W6L A;  3PLF B;  2JXL A;  2HET A;  3I5G B;  2Q6P A;  3GK4 X;  4LJC A;  2G16 B;  1OZO A;  3ST2 A;  3DQD A;  1W7I B;  5BPJ A;  3CTN A;  4ORA B;  1JFJ A;  2KI4 C;  1NWD A;  1AJ5 A;  5DPI A;  2CCM A;  4OHS A;  4W6I A;  2DD7 A;  3AI5 A;  1U5I A;  1YTZ C;  4HSZ A;  3HX4 A;  1GQM A;  2ZO7 A;  3PSR A;  2DOQ A;  2BL0 B;  3KEV A;  2P6B B;  3DQ5 A;  1XMZ A;  3V3D A;  4TNC A;  2QZ0 A;  1CDM A;  2KBM A;  3DF0 B;  3CD1 A;  1ODB A;  1ZAC A;  4J89 A;  2OS8 C;  3KHE A;  2E6W A;  1ZUZ A;  2H5R A;  2DD9 A;  1CV7 A;  5BTT B;  2KFF A;  1J7P A;  4PHK A;  2QLE A;  1SMG A;  1XVJ A;  1EMG A;  2I2R E;  2HPS A;  1Q4A A;  1H6R A;  1DJY A;  3CZT X;  3DVK A;  1EXR A;  4I5J A;  2A52 B;  4E68 A;  1OE9 B;  4CPV A;  1XFW O;  4EMQ A;  3U8P A;  3KPX A;  2HFC A;  4YI8 A;  1K90 D;  5HZT A;  3ST0 A;  2L4H A;  4KEX A;  1KK8 C;  1JBZ A;  1KFX S;  2OTG C;  3LLE A;  1BT6 A;  1IJ5 A;  3ICB A;  3C1V A;  2VVI A;  2JC2 A;  4W77 A;  1CNP A;  2HQK A;  1KYR A;  3VGO A;  3PAT A;  2LLS A;  1RJV A;  3OHM B;  1CM1 A;  1WLM A;  2HRS A;  1PVB A;  2M97 A;  1OMV A;  2JZI A;  2EHB A;  1KQV A;  1KQM B;  2GV5 A;  1C7V A;  3BUN B;  3AI4 A;  1B7T Y;  1KK7 Y;  2MBX A;  4XGY A;  3CD9 A;  3SIA A;  1DTL A;  1A75 B;  1J1D A;  2V53 A;  3BXA A;  2M9G A;  5AXI A;  1AUI B;  1TNW A;  2L50 A;  4HQC A;  1SCV A;  1UUR A;  3K21 A;  5AER A;  4IK5 A;  2Z6Y A;  4YGA A;  5I2O A;  1YX8 A;  2ZND A;  2EMD A;  1F70 A;  5HGE A;  3ZTF A;  4C0J A;  3SVO A;  4W6U A;  4ZF5 A;  4ETO A;  2POX A;  3DQ4 A;  1ZOT B;  1SRA A;  1MYW A;  2WCF A;  1IQ3 A;  4PHJ A;  2LAN A;  2F8P A;  2Q57 A;  2WIQ A;  1YHI A;  2JNX A;  3CFA A;  1MOU A;  1M39 A;  1HQV A;  1YRU B;  2H8Q A;  4GF6 B;  1S6C A;  5EXB A;  2IS9 A;  4JRB A;  2JRF A;  3A8S A;  3KCS A;  4YI9 A;  1Y0V H;  2V4E A;  3NSO A;  4FQO A;  4W6M A;  5DTL A;  1QTX A;  2JPT A;  1G4Y R;  3TS5 C;  2Z6X A;  3DQ3 A;  4N1G A;  3LVA A;  3WNX B;  1KCY A;  1GFL A;  3PJ5 A;  4ANJ A;  2C9J A;  1QX2 A;  2WIS A;  3TMT A;  1M45 A;  3KCT A;  1BOD A;  1YUU A;  2F3Y A;  3OB2 B;  3AKO A;  1CMF A;  1NCZ A;  1TNX A;  4JF9 A;  3O78 A;  4XOW A;  3U8C A;  1GGW A;  1RMO A;  3GJ1 A;  3SG5 A;  2AWM A;  3DQH A;  3DQ1 A;  2FOT A;  4PPK A;  3BYA A;  4YRU A;  1CMG A;  5HW9 A;  1UIS A;  4IK8 A;  5GQQ C;  1HT9 A;  4B30 B;  2LV7 A;  3NSL A;  2JUL A;  2GX2 A;  2BBM A;  1IRJ A;  1N2D A;  2L4I A;  5FVF A;  3LS3 A;  4QJ3 B;  1J1E A;  3DPX A;  2AHA A;  3NSK A;  1RTP 1;  3BUW B;  1YUT A;  3SVR A;  4MVF A;  3DQF A;  2AWK A;  5T3I A;  4W7F A;  2G2S B;  2K7D A;  1SW8 A;  4HE4 A;  1FF1 A;  1SR6 B;  2H9W A;  4GGN A;  1Q4D A;  4DXN A;  3WLC A;  2IB5 A;  3SV5 A;  2GX0 A;  5EJU A;  4JC2 A;  1DF0 A;  3NT3 A;  2HJO A;  4N1F A;  3O2P A;  2M7L A;  1RMP A;  1U5I B;  5DTY A;  4OJ0 A;  5PAL A;  3WHT B;  4ZIO A;  1XFV O;  3SS0 A;  3NED A;  3D0Y A;  1GJY A;  3DQJ A;  2BBN A;  2I18 A;  3S05 A;  1NCX A;  2ZRS A;  5FHV A;  2G5Z B;  3DVJ A;  4DCK A;  2OKY A;  4OV2 A;  2MRD A;  1G7K A;  3CS1 A;  1KFU S;  1CDN A;  1EMB A;  2OPO A;  2O2B A;  5I2Q A;  4W6J A;  1JWD A;  3U0M A;  2O60 A;  1FI5 A;  2QLH A;  1MOV A;  4DXO A;  1J7Q A;  4KF5 A;  2JOJ A;  4GOB A;  3EK8 A;  2PSR A;  1FPW A;  2WSO A;  1MQ1 A;  4DUQ A;  4OCI A;  3WLD A;  2MLF C;  1XFU O;  2NCO A;  2DDC A;  1XA9 A;  4LW5 A;  4C0K A;  2VZX A;  4W6C A;  1NCY A;  4IK1 A;  3ST3 A;  4IK9 A;  1UUS A;  2QRF A;  1S1E A;  1UHK A;  3BUO B;  3W1D A;  1NX3 A;  4J8A A;  1Q4B A;  1DGU A;  1TRF A;  2KI4 B;  1TNQ A;  1CKK A;  4W7R A;  1B8L A;  3FS7 A;  3LCP C;  2KFH A;  2MA2 A;  1MHO A;  2F2O A;  1UWO A;  1RK9 A;  4EDO A;  2NZ0 A;  4ZCU A;  2G9B A;  2QU1 A;  2BE4 A;  3FWC A;  2YE1 A;  1BOC A;  1LA0 A;  4TZG A;  2VVH A;  4W6H A;  2WHS A;  3TDZ A;  2OS8 B;  5HKW A;  1XFY O;  2M0R A;  1QYO A;  4W6G A;  5H87 A;  1PUL A;  1NX0 A;  4W6F A;  4H3L A;  2KQ6 A;  1WDC C;  2O5G A;  4L12 A;  1KP5 A;  1NX2 A;  4I2Y A;  1W7U A;  1YJ2 A;  1HCJ A;  1MF8 B;  1QXP A;  4W74 A;  4YGD B;  2HQ8 A;  2CT9 A;  4DXQ A;  3CR2 A;  2JT3 A;  3M0W A;  5J2O A;  1A03 A;  1ZGQ A;  3OB1 B;  4F0Z B;  1XFX O;  2FWQ A;  1CFP A;  4W6K A;  2Q4U A;  1KK8 B;  1SK6 D;  2OTG B;  2QPT A;  3CGA A;  2LMU A;  2R2I A;  1DJG A;  3CR5 X;  2WCB A;  2KI6 C;  5HLV A;  1K9U A;  3CR4 X;  1Y1X A;  2A4J A;  1J7O A;  1UHH A;  3TUY B;  5DPH A;  3VRN A;  2NCP A;  2V4E B;  2A46 A;  2ZN8 A;  2O24 A;  1XK4 C;  5D69 A;  1G8I A;  3VHT A;  1B9A A;  3I5I C;  3O4Y A;  4W7C A;  4B5Y A;  4GAO A;  3DQC A;  4M2O A;  2O29 A;  3IR8 A;  1EG4 A;  4AQJ A;  4W69 A;  4Q04 A;  2KYC A;  1KYS A;  1BR1 B;  5KSZ A;  3ADF A;  2B3P A;  3EVR A;  3CGL A;  4MSP A;  1OXD A;  3ZWH A;  1LKJ A;  2P4M A;  2EGD A;  1R6P A;  4W7E A;  5F9G A;  4ZB1 A;  1JC0 A;  2WC8 A;  4KW8 A;  5LTQ A;  1MXE A;  4L9M A;  4Q7U A;  2NXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...