3SG3A

Crystal structure of gcamp3-d380y
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 138
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg3A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg3A02
4IK3A 1ZGPA 3LLEA 1J7RA 1JF2A 2F2OA 1SRAA 3U0LA 5CSFA 1K9KA 2M1UA 1MOVA 3WNXB 1SR6B 2CTNA 1TOPA 2QLEA 3U0NA 3TDIA 3PIBA 3EKJA 3CTNA 5CPVA 4HQCA 3VHTA 2K7BA 1UHIA 3DQEA 3OB2B 4EULA 1QV1A 2FZUA 2NLNA 5HGEA 2K2FA 2O29A 3ST2A 5HLOA 1A03A 3SSPA 1GQMA 4TZAA 3PJ5A 4NQGA 4W7RA 3CWGA 2ZRSA 1Q4CA 2ZKMX 2KYCA 2QACA 4AQIA 1CMGA 3U8AA 1M31A 3DD4A 3S05A 5ER5A 4PE7A 4WQ3A 5BTTB 3I5IC 3U0MA 3GJ2A 1H6RA 2O5GA 1Y6WA 1YHGA 1ZUZA 2QU1A 2IB6A 5HZTA 2F8PA 3NSIA 3SVUA 2F33A 4NDBA 1CLMA 1DVIA 4W6NA 1EG3A 2JTZA 2P4MA 2KOTA 3SG7A 1KSOA 1ZUXA 4GGFC 3OHMB 3PN7B 2Q4UA 4Z4MA 5JJGA 1QTXA 1B8LA 1N2DA 3IQQA 1RMMA 3TZ1A 2EC6C 1F70A 1CNPA 4GESB 1XK4C 2KFHA 1B47A 4H3MA 1CMFA 1K90D 2TN4A 3ADFA 1JFJA 2JWWA 2LLSA 2RGIA 4W6OA 4PHKA 2ZFDA 5BT0A 1ZGOA 3K1KA 1HUYA 4JC2A 3VRQA 2B1UA 4JQ0D 2A50B 4KA9A 3BX9A 2KI4C 3DQ8A 4J89A 3PJBA 1F8HA 1J7QA 2ZO7A 4DKMA 3OGOA 2A53B 2OJKA 1XFWO 2EGDA 5H88A 1SPYA 3WCKA 4ZBLA 1EMKA 4D1EA 5EXUA 2LCPA 3UFZA 3VICA 2JNXA 1JBZA 1MOUA 2FCDA 2DD9A 3GOFA 4LJDC 2JC2A 1S1EA 2KHNA 3GK2A 3BUWB 3DQ4A 3O78A 1RTP1 2ZRTA 4W6FA 3SJSA 2IE2A 2OKWA 2KI4B 3CLNA 3BXAA 1PVBA 3CD9A 4M2QA 3I5HB 2MBXA 1RM9A 2M29A 2QT2A 3KHEA 4ZFSA 5HKZA 1JFKA 5KTGA 4KPIA 2LP2A 3NEZA 3DQIA 1IG5A 1JWDA 3TMTA 5DU0A 1K9UA 3M22A 3EVUA 4ORAB 1R6PA 3SVNA 4OR9B 4ZINA 4Z4KA 5KTYA 1PSRA 4KF5A 4LJDA 2EC6B 3BOWA 1ODBA 1W7UA 2YDZA 2QLGB 1BOCA 1D1OA 3SG6A 2MLEC 2O60A 1F54A 3MGFA 2G9BA 1A4PA 2WC8A 3D0YA 2HQ8A 4W6SA 1EJ3A 4W7EA 2KQYA 2WHSA 2NZ0A 1CFDA 5B8IB 3OP0A 2H2KA 2KGBC 2H8QA 1KQVA 5HZUA 5AFPA 4Q7RA 2O2BA 4HRGA 2VZXA 3DQNA 1MXEA 3OX6A 4N1GA 3NF0A 1MUXA 4GNKB 4EMQA 4W74A 1BLQA 3SS0A 1SNLA 2IOVA 4W6MA 1LA0A 2AWMA 3KO0A 2KNEA 3TMRA 1YJFA 1AVSA 2I2RE 4CFRA 5AANA 4C0JA 1J7PA 1DMOA 4BY4A 4AOMA 4ZCVA 4P1QA 1KK7Y 1EL4A 3A4UB 2WHUA 3SSHA 3HX4A 1QYOA 2L51A 3CS1A 1WDCC 3AI5A 2BCAA 1K94A 2JTTA 4U8DA 2K61A 3ST3A 1CB1A 1W7TA 1IJ5A 4ICBA 1B8RA 3HCMA 3E5TA 3H4SE 3LSAA 5BQLA 4P2YB 3DPZA 2HJOA 5EJUA 2G5ZB 3I5GB 2MLFC 1L7ZA 4W75A 1F09A 5DKNA 1G8IA 4HQ9A 5GQQC 2MA2A 3PN7C 1SBJA 1ZOTB 4YBHB 4XL5A 5HLVA 3IQOA 4M2PA 2BBNA 1DT7B 1NPQA 2L4HA 2DD7A 4I5JA 5DQMA 3CGLA 2KFGA 3CD1A 3SVDA 1FPWA 4FTGA 1XA5A 4PDZA 2HGDA 3CR5X 1CDNA 1BF5A 2COLB 4ZF5A 4MRYA 2SASA 5DTLA 1UHKA 1OXFA 1KK8B 2Z6YA 3SIBA 3DQ5A 2JXLA 4PFEA 3CZTX 1PK0D 4YRUA 3EVRA 3PATA 5DPHA 1M46A 5I2LA 5LTRA 1N65A 1KQMB 1LKJA 3NEDA 2H5QA 2EMOA 2DUGA 4W6TA 2I94A 3VGOA 4W6HA 5G08A 3WHUB 1XK4A 3KCTA 1JC1A 4J8AA 5DPIA 3BXCA 1H4BA 3VRPA 2V4EA 2A47A 2LVJA 2V4EB 2VVIA 2ZNEA 4HVFA 1X02A 1SYMA 4MEWA 4MSPA 2JT0A 4KW8A 3CBEA 1C7VA 3SVEA 3DVKA 3LVDA 3SRYA 1K96A 3O4YA 3RWAA 1KFXS 1S26D 4XGYA 4IK5A 4XJKB 2K7DA 3KF9A 2MHHA 2L50A 2LVIA 5H87A 1ALVA 3I5HC 5DKRA 1H4UA 3DVMA 1OQPA 1FW4A 2LUXA 1DJZA 1SW8A 2F3YA 3DQAA 3SSVA 2WHTA 3OSQA 3WLDA 1K2HA 1Q80A 2VRGA 3IP2A 1TNWA 1M39A 3LVCA 5FHVA 3BXBA 2ZO6A 4MVFA 2VVJA 1DTLA 2A52B 4C0KA 1S6IA 3QRXA 2NCPA 1F55A 1XFZO 2YFPA 4L13A 2FL1A 1B7TY 1BFPA 1Y1AA 4DS7A 2EMDA 2QLHA 4DXNA 4ZB1A 3K21A 4W7XA 4CFQA 4EDSA 2ZN8A 2VVHA 3DVEA 3O77A 4DXPA 3P28A 2JT8A 1YHHA 1YVHA 1HQVA 3W1CA 4H47A 4JF9A 2ZNDA 1EXRA 1EMGA 2HPWA 2Y1NA 4PHJA 3D0YB 1UHNA 1XMZA 2KI6D 3LCPC 1RRXA 1NWDA 4IK4A 4KF4A 1WRLA 4CLNA 1K93D 4W6KA 1W7JB 1KFUS 4CIDA 4Q7TA 2LUCA 2F3ZA 1QIWA 5I2QA 1HT9A 2K7CA 4CPVA 2Y1MA 2LLTA 4OCIA 1QV0A 4HREE 4DXIA 4MRXA 1FBVA 3LK0A 3TUYB 2HQWA 2DOQA 2I7AA 2R2IA 5DRFA 1YUSA 3LF3A 2G6YA 4W7DA 1ZGQA 2A48A 2JULA 4GFTA 5BTTA 5DQBA 1MWNA 1ZMZA 4UPGA 3BUMB 3PSRA 3KPXA 3U8PA 1SR6C 2Y4QA 3CFAA 5JOLA 2Q57A 3DF0B 1V1GA 3DQLA 2CBLA 2LC5A 1NX2A 5DTXA 1YX8A 1J7OA 3SVSA 1BT6A 4R1EA 3AKOA 2C9JA 1CDPA 4GGNA 1DJXA 4W7FA 3FS7A 4PALA 3NSLA 5HZOA 2BL0C 3SG3A 5F9GA 3EVPA 4YI9A 4IZNA 3EVVA 1L2OC 5EXBA 1TTXA 2WURA 4JFGA 4NDDA 2B3QA 3M0WA 4OQWA 2PRUA 2A56B 2QRFA 4HRHA 2OGRA 2CT9A 2KAVA 3I19A 3VHTB 2PALA 1UWOA 5I8NA 3CFFA 1TCOB 3BXKA 3KEVA 4ZF3A 1BR1B 1IJ6A 4C0LA 3ZUJA 3W1DA 1GGZA 2KAYA 5PALA 2VAEA 4W6UA 1CDLA 1EMAA 4N3DA 2V4EC 2Z6XA 1B9AA 2LV7A 2HCGA 4DXMA 3SVCA 1ZACA 4DIRA 1C4FA 1KSMA 4L9MA 2ARLA 2WNDA 3V3DA 1KFUL 1RJVA 2GX0A 4PHNA 2LVVA 1OMDA 1LINA 2JQ6A 3BOWB 2GW4B 1EG4A 1DJYA 2QPTA 2H61C 2H5RA 3I5GC 3EK7A 3TDUA 4XOVA 3BUOB 5LTPA 1XQMA 5K89A 1SCMB 2DDCA 3SG5A 5EB6A 2PSRA 3NXAA 4RYWA 4AR7A 2Y5IA 2KQ6A 4AS8A 3OX5A 4W6IA 1ZFSA 1AJ5A 1YUTA 4N5XA 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 1XAEA 2WORA 1FF1A 2EMNA 3SVOA 4IK8A 2P6BB 4P5OE 1GJYA 2AH8A 2O24A 4P76A 3AKAA 1M45A 1TN4A 4N1FA 1XSSA 1JBYA 1F4OA 1JC2A 2JZIA 4GBAA 5KSZA 3GEXA 1XYDA 2LMUA 5AQBB 2VADA 1J1EA 2M49B 2FJUB 1KQMC 1IWQA 1W7SA 1WRZA 3DQ9A 5KU1A 4W6CA 5D69A 1SKTA 2HQZA 1U5IA 2KBMA 2AMIA 4L1IA 2MJWB 1IRJA 1AP4A 1AJ4A 1RK9A 1EMCA 2PMYA 3GK4X 4XJKA 1PSBA 3DVJA 1OXEA 2G3OA 4B30A 1KYSA 4DXQA 3RWTA 1ALWA 3PM8A 1KFXL 3EK8A 2YE1A 3OSRA 4WRIA 2BCXA 1NCZA 1DJGA 3U0KA 1NX1A 2LNKA 4QJ5B 2HRSA 4WQ2A 1UHJA 4XYNA 4FQOA 1OXDA 2GGMA 4R6DA 3CGAA 2L4IA 4TNCA 2JT3A 4W76A 1YX7A 4LQTA 1DF0B 4DUQA 2AWKA 3LS3A 3LL8B 2EHBA 1SMGA 2G6XA 2HGYA 4ORBB 1SL8A 3I5FB 1S3PA 1Z1QA 1JSAA 3TDZA 5AXIA 5HBDA 4Q7UA 1CV7A 1V1FA 2H5PA 1RROA 2JOJA 1Q4AA 5CSJA 4Q9XA 4KW9A 4XVPA 4YGBB 4LJBA 1J55A 4PE1A 5FYXA 4YGCB 1EMMA 3SV5A 3LA1A 1MHOA 1CFFA 3DPXA 2MRDA 1KK8C 4W6PA 1CKKA 1QX2A 4DXOA 2AHAA 4ZF4A 1TIZA 1E8AA 2B3PA 1YRUB 4H3NA 1DF0A 2K7OA 1NCXA 2JPTA 2ICRA 4A4BA 1A2XA 4JGEA 1Q4DA 1TNXA 2BE6A 1OMRA 1QX5B 1CLBA 1JUOA 1RMOA 2G3DB 4I2YA 2I18A 1W7IB 4B30B 1KYRA 1NX0A 2C9IA 4IL1A 4L12A 1NP8A 3DPWA 3P8UA 1TCFA 1G7KA 3O6BA 5H89A 4OVNF 1RWYA 5DY6A 2LMVA 2SCPA 1EH2A 2H9WA 5LTQA 3TS5C 3H1RA 1CTRA 2G2BA 4IK9A 1YVLA 1A29A 3ZNIA 3NT9A 3LK1A 1SY9A 1YRTB 3DQKA 3VROA 1F4QA 4I5KA 2Z6ZA 2KI6C 4ORCB 2OTGB 4GUKA 1YJ2A 3MSEB 3ZUFA 2F2PA 1JC0A 4LW5A 3FWBA 3PJ7A 4MLWA 3PALA 4H48A 3EKHA 1TNPA 1AK8A 1GGWA 1UHHA 5CSNA 4MZLA 1XFYO 3WXAA 2ZMUA 1YUUA 1Z1PA 3JTDC 1B4CA 4I5NB 4YGEB 2M9GA 3TUYC 1UP5A 1YHIA 5DPGA 1EMBA 1KK7Z 4PPJA 3VK1A 1XO5A 2BE4A 1KP5A 1LXFC 3SG2A 3A8RA 1A75B 3FWCA 4HSZA 2FOTA 1CFCA 4W6AA 1MYWA 1KCYA 5FVGA 4W6DA 2WCEA 2DUIA 4TZGA 1RMPA 1RECA 5FVFA 1Q4BA 3H1OA 4B5YA 4YGAA 2PXSA 2BKIB 3I5IB 2M97A 4GF6B 2JNFA 1MF8B 2ZN9A 3BQ3A 2K8MB 3DQ7A 3SSYA 4YI8A 1K95A 4XOWA 1OZOA 3DQDA 4MN0A 4QJ4B 2M1KB 2QZ0A 1OSAA 1YTZC 3JTDB 4W6JA 4ZCUA 1UURA 1DGVA 1QVIY 2PASA 1BG1A 3NT3A 5EHUA 5CSIA 2M3WA 3BYAA 3E3RA 2LE9B 4A4CA 4W6GA 1WLMA 5HYDA 1NYAA 3WHTB 3F45A 2KSPA 2LLUA 2WIQA 1QIVA 1QYFA 2AUCA 1UISA 4LQUA 4W72A 2HF5A 2OKYA 5HW9A 1YR5A 1PULA 5EBJA 1S6ZA 1QATA 4BDUA 1G33A 1EMLA 5IBWA 1SK6D 2BCBA 1JBAA 5HKYA 1HCJA 2YE0A 4PPLA 3ICBA 5DTZA 1QYQA 1H8BA 4E68A 2AAOA 2Z1OA 1QXTA 1LA3A 2K0JA 2MAZA 2E6WA 1CLLA 4W73A 4U2VA 1A75A 2GW3A 4ZIOA 2KFFA 3DQOA 2LAPA 1QVIZ 1RFJA 1B1GA 3O2PA 2D8NA 2RH7A 4W7AA 5EXCI 4LJCA 1SL9A 2OTGC 1S6JA 3D10A 5J2OA 4I5LB 4PPKA 2WSNA 3DQCA 2KGRA 3JVTB 4R6BA 5DTYA 2M0RA 4GAOA 1NSHA 4RTCA 3U8CA 1IH0A 2JADA 2AWJA 2BKHB 4H3LA 2KBIA 4NDCA 3DQ2A 4AQJA 2OS8B 3AKBA 1J1DA 5I2OA 1FI5A 1BU3A 2GX2A 2H6VA 3ED8A 1WRKA 1M63B 1BJFA 3E5WA 5D7FA 2OPOA 3DQMA 2L0PA 2DUHA 3WLCA 2NXQA 4OJ0A 4W6LA 2A4JA 3C1VA 1K9PA 3E5VA 2L5XB 4W6BA 3GB3A 1B7TZ 3LF4B 1BODA 2Q6PA 4GPLB 3DQJA 5AERA 4W77A 3IF7A 1QJTA 1S5GY 1G4YR 2CCMA 1GFLA 3DQFA 1MXLC 1B9CA 1Y1XA 3A8SA 1QY3A 3RM1A 3AAJA 1GL4A 1XA9A 2WOSA 2DUFA 4W7CA 4IK1A 2NCOA 2JU0A 1KWOC 2BBMA 1MR8A 4DRWA 3ST0A 5EB7A 4W6RA 1XFXO 4OHSA 3AI4A 2POXA 2LM5A 2OTBA 1QLSA 1YZWA 4JEOA 1QXPA 2OTEA 4RYSA 3LVAA 1BMOA 3RLZA 1DGUA 1XFUO 4JRBA 1CM4A 4QJ3B 1SCVA 5F6TA 4PCWA 2QLIA 3DQ3A 1BR4B 1TNQA 4M2OA 5BPJA 3SSLA 2FWQA 1Y1UA 4W69A 2E30A 1WLZA 1Q4EA 4MZJA 1IQ5A 4EN1A 1DJWA 5FVIA 2WISA 3SVRA 2IB5A 3I5FC 2PVBA 3NSKA 3ZULA 2ZMWA 2HPSA 1U5IB 3DF0A 1NCYA 2IS9A 1Q73A 2BL0B 5ER4X 1DJHA 2A46A 1IKUA 4KW4A 1C7WA 1S5GZ 1XVJA 2WCFA 2WSOA 2G6EA 3DQUA 2LMTA 2CNPA 4OV2A 1NX3A 1XFVO 3IR8A 2CXJA 3NSOA 5J3XA 5DPJA 2L2EA 1VRKA 4UTSA 1PVAA 1QASA 1OE9B 1K8UA 2H61A 3OB1B 1YFPA 3ZWHA 1EMEA 1AUIB 3DQ6A 2H5OA 4Q9WA 3PLFB 4KF5C 2DDDA 1KYPA 3G9AA 3AAKA 4ANJA 1YURA 4KGEA 1TRFA 4DKNA 1NUBA 3PFVA 1DJIA 1IGVA 1OOJA 1FI6A 4ETOA 2KDHA 2L98A 1EMFA 1F0BA 3DQHA 1PALA 2WCBA 2G16B 3BUXB 1B8CA 3VRNA 2K2AA 1OMVA 3SIAA 2KYFA 2HFCA 1AHRA 3ZTFA 5TNCA 3TS5B 3ST4A 1OZSA 1PRWA 4KEXA 3VRRA 4J88A 2LVKA 4PE4A 3EK4A 1JF0A 4OGSA 3SG4A 2A54B 2QLGA 3SVBA 2FCEA 3GJ1A 1L2OB 2KAXA 5AEQA 2ISDA 2JXCA 2LHIA 3UG0A 1CDMA 1F71A 1CFPA 4YGDB 3FIAA 2V53A 2GV5A 2JRFA 2G2SB 1QX7A 4Q04A 3JVTC 4ORNA 1MQ1A 2LANA 2LP3A 2DUEA 4KAGA 4HQ8A 5HZSA 4PHMA 1GGXA 4OKHA 1WDCB 3M24A 4BY5A 2BTJA 2OS8C 3KCSA 1N0YA 1S6CA 3DQ1A 2GGZA 2PXWA 2M7LA 1Y0VH 2HQKA 1KWOB 2M7NA 1SCMC 4KGFA 4USLA 2M8UA 3SSKA 2AWLA 2LHLA 4PE0A 2Q91A 5HKWA 4F0ZB 4OY4A 4MBEA 1QS7A 3SSTA 3CR4X 2HETA 1C07A 1WY9A 1UUSA 1NIWA 2Y0GA 1SL7A 3CB9A 5T3IA 4GOBA 4MZKA 1R2UA 4GGFA 4HE4A 1QLKA 2BECA 1CM1A 3CFHA 5DRGA 4DCKA 3GL4A 5LK4A 4NWSA 1S36A 4EDOA 4JWQA 1LVCD 5DKQA
chains in the Genus database with same CATH superfamily
4IK3A 1ZGPA 3LLEA 1J7RA 1JF2A 2F2OA 1SRAA 3S0DA 3U0LA 5CSFA 5I94A 1K9KA 2M1UA 1MOVA 3CZ0A 1SR6B 3WNXB 2CTNA 1OOGA 1TOPA 2QLEA 3U0NA 3TDIA 3PIBA 3EKJA 3CTNA 5CPVA 4HQCA 3VHTA 2K7BA 1UHIA 3DQEA 3OB2B 4EULA 1QV1A 2FZUA 2NLNA 5HGEA 2K2FA 2O29A 3ST2A 5HLOA 1A03A 1IIOA 3SSPA 1GQMA 4TZAA 2JPOA 5DICA 3PJ5A 4NQGA 4W7RA 3CWGA 3FE9A 2ZRSA 1Q4CA 2ZKMX 2KYCA 1Z4HA 2QACA 4AQIA 1CMGA 3U8AA 1M31A 3DD4A 3S05A 5ER5A 4PE7A 3FE8A 3R72A 4WQ3A 3SS4A 5BTTB 3I5IC 3U0MA 3GJ2A 1H6RA 2O5GA 1Y6WA 1YHGA 1ZUZA 2QU1A 2IB6A 1TUJA 5HZTA 2F8PA 3NSIA 3SVUA 2F33A 4NDBA 1CLMA 1DVIA 4W6NA 1EG3A 2JTZA 2P4MA 2KOTA 3SG7A 1KSOA 1ZUXA 2ERBA 4GGFC 3OHMB 1GM0A 3PN7B 2Q4UA 4Z4MA 5JJGA 1QTXA 1B8LA 1N2DA 3IQQA 1RMMA 3TZ1A 2EC6C 1F70A 1CNPA 3B87A 4GESB 1XK4C 2KFHA 1B47A 4H3MA 3K1EA 1CMFA 1K90D 1DC1A 2TN4A 3ADFA 5FI7A 1JFJA 2JWWA 3IVTA 2LLSA 2RGIA 4W6OA 4PHKA 2ZFDA 3S0GA 5BT0A 1ZGOA 3K1KA 1HUYA 4JC2A 3VRQA 2B1UA 4JQ0D 2A50B 4KA9A 3BX9A 2KI4C 3DQ8A 4J89A 3PJBA 1F8HA 1J7QA 2ZO7A 4DKMA 3OGOA 2A53B 2P70A 2OJKA 1XFWO 2EGDA 2FJYA 5H88A 1SPYA 3VICA 1EMKA 5EXUA 4D1EA 4ZBLA 2LCPA 3UFZA 3WCKA 2JNXA 1JBZA 1MOUA 2FCDA 3B88A 2DD9A 3GOFA 4LJDC 2JC2A 1S1EA 2KHNA 3GK2A 3BUWB 3DQ4A 3O78A 1RTP1 2ZRTA 4W6FA 3SJSA 2IE2A 2OKWA 2KI4B 3CLNA 3BXAA 1PVBA 3CD9A 4M2QA 3I5HB 2MBXA 1RM9A 2M29A 2QT2A 3KHEA 4ZFSA 5HKZA 1JFKA 5KTGA 4KPIA 3S0EA 2LP2A 3NEZA 3DQIA 1IG5A 1JWDA 3TMTA 4INXA 5DU0A 1K9UA 3M22A 3EVUA 4ORAB 1R6PA 3SVNA 4OR9B 4ZINA 4Z4KA 5KTYA 1PSRA 4KF5A 4LJDA 2EC6B 3L4LA 3BOWA 1ODBA 1W7UA 2YDZA 2QLGB 1BOCA 1D1OA 3SG6A 2MLEC 2O60A 1F54A 3MGFA 2G9BA 1A4PA 2WC8A 3D0YA 2HQ8A 4W6SA 1EJ3A 4W7EA 2KQYA 2WHSA 2NZ0A 1CFDA 5B8IB 3OP0A 2H2KA 2KGBC 2H8QA 1KQVA 5HZUA 5AFPA 4Q7RA 2O2BA 4HRGA 2VZXA 3DQNA 1MXEA 3OX6A 4N1GA 3NF0A 1MUXA 4GNKB 4EMQA 4W74A 1BLQA 3SS0A 1SNLA 2IOVA 4W6MA 1LA0A 2AWMA 3KO0A 2KNEA 3TMRA 1YJFA 1AVSA 2I2RE 4CFRA 5AANA 4C0JA 1J7PA 1DMOA 4BY4A 4AOMA 4ZCVA 4P1QA 1KK7Y 1EL4A 3A4UB 2WHUA 3CZ2A 3SSHA 3HX4A 1QYOA 3S0AA 2L51A 3CS1A 1WDCC 3AI5A 2BCAA 1K94A 2JTTA 4U8DA 2K61A 3ST3A 1CB1A 1W7TA 1IJ5A 4ICBA 1B8RA 3HCMA 3E5TA 3H4SE 3LSAA 5BQLA 4P2YB 3DPZA 2HJOA 5EJUA 2G5ZB 3I5GB 2MLFC 1L7ZA 4W75A 1F09A 5DKNA 1G8IA 4HQ9A 5GQQC 2MA2A 3PN7C 3FE6A 1SBJA 1ZOTB 4YBHB 4XL5A 5HLVA 3IQOA 4M2PA 2BBNA 1DT7B 1NPQA 1XFRA 2L4HA 2DD7A 4I5JA 5DQMA 3CGLA 2KFGA 3CD1A 3SVDA 1FPWA 3B7AA 4FTGA 1XA5A 4PDZA 2HGDA 3CR5X 1CDNA 1BF5A 2COLB 4ZF5A 4MRYA 2SASA 5DTLA 1UHKA 1OXFA 1KK8B 2Z6YA 3SIBA 3DQ5A 2JXLA 4PFEA 3CZTX 1PK0D 4YRUA 3EVRA 3PATA 5DPHA 1M46A 5I2LA 5LTRA 1N65A 2PYQA 1KQMB 1LKJA 3NEDA 2H5QA 2EMOA 2DUGA 4W6TA 2I94A 3VGOA 4W6HA 5G08A 3WHUB 1XK4A 3KCTA 1JC1A 4J8AA 5DPIA 3BXCA 1H4BA 3VRPA 2V4EA 3BJHA 2A47A 2LVJA 2V4EB 2VVIA 2ZNEA 4HVFA 1X02A 3D77A 1SYMA 4MEWA 4MSPA 2JT0A 4KW8A 3CBEA 1C7VA 3SVEA 3DVKA 3LVDA 3SRYA 1K96A 3O4YA 3RWAA 1KFXS 1S26D 4XGYA 4IK5A 2WC5A 4XJKB 2K7DA 3KF9A 4PT1A 2MHHA 2L50A 2LVIA 5H87A 1ALVA 3I5HC 5DKRA 1H4UA 3DVMA 1OQPA 1FW4A 2LUXA 1DJZA 1SW8A 2F3YA 3DQAA 3SSVA 2WHTA 3OSQA 3WLDA 3D76A 1K2HA 1Q80A 2VRGA 3IP2A 1TNWA 1M39A 3LVCA 5FHVA 3BXBA 2ZO6A 4MVFA 2VVJA 1DTLA 2A52B 4C0KA 1S6IA 3QRXA 2NCPA 1F55A 1XFZO 2YFPA 4L13A 2FL1A 1W9ZA 1B7TY 1BFPA 1Y1AA 4DS7A 2KLDA 2EMDA 3L4AA 2QLHA 4DXNA 2YGUA 4ZB1A 3K21A 4W7XA 4CFQA 4EDSA 2ZN8A 2VVHA 3DVEA 3O77A 4DXPA 1Z2CB 3P28A 2JT8A 1YHHA 1YVHA 1HQVA 3R1OA 3W1CA 1DELA 4H47A 2K60A 4JF9A 2ZNDA 1OOFA 1EXRA 1EMGA 2HPWA 2Y1NA 4PHJA 3D0YB 1UHNA 1XMZA 2KI6D 3LCPC 1RRXA 3BFAA 2QEBA 3SS3A 1NWDA 4IK4A 4KF4A 1WRLA 4CLNA 1K93D 4W6KA 1W7JB 1KFUS 4CIDA 4Q7TA 2LUCA 2F3ZA 1LS8A 1QIWA 5I2QA 1HT9A 2K7CA 3OBVA 4CPVA 2Y1MA 2LLTA 4OCIA 1QV0A 4HREE 4DXIA 4MRXA 1FBVA 3LK0A 3TUYB 3B6XA 2HQWA 2DOQA 2I7AA 2R2IA 5DRFA 1YUSA 3LF3A 2G6YA 4W7DA 1ZGQA 2A48A 2JULA 3CDNA 4GFTA 5BTTA 1MWNA 1ZMZA 4UPGA 3BUMB 2WCKA 3PSRA 3KPXA 5DQBA 1SR6C 3U8PA 2Y4QA 3CFAA 5JOLA 2Q57A 3DF0B 3CZ1A 1V1GA 3DQLA 2CBLA 2LC5A 5FI2A 1NX2A 5DTXA 1YX8A 3SS5A 1J7OA 3SVSA 1BT6A 4R1EA 3AKOA 2C9JA 1CDPA 4GGNA 1DJXA 4W7FA 3FS7A 4PALA 2WCLA 3NSLA 5HZOA 2BL0C 3SG3A 3QMEA 5F9GA 3EVPA 3V2LA 3R1VA 4YI9A 4IZNA 3EVVA 1L2OC 5EXBA 1TTXA 2WURA 4JFGA 4KYNA 4NDDA 2B3QA 3M0WA 4OQWA 2PRUA 2A56B 2QRFA 4HRHA 2OGRA 2CT9A 2KAVA 4JKTA 3I19A 3VHTB 2PALA 1UWOA 5I8NA 3CFFA 1TCOB 3BXKA 3KEVA 4ZF3A 1BR1B 1IJ6A 4C0LA 3ZUJA 3W1DA 1GGZA 2KAYA 5PALA 2VAEA 4W6UA 1CDLA 1EMAA 4N3DA 3PJIA 2V4EC 2Z6XA 1B9AA 2LV7A 2HCGA 4DXMA 3SVCA 1ZACA 4DIRA 1C4FA 1KSMA 4L9MA 2ARLA 2WNDA 3V3DA 1KFUL 1RJVA 2GX0A 4PHNA 2LVVA 1OMDA 1LINA 2JQ6A 3BOWB 2GW4B 1EG4A 1DJYA 1OW4A 1P28A 1C3YA 2QPTA 2H61C 2H5RA 3I5GC 3EK7A 3TDUA 4XOVA 3BUOB 5LTPA 1XQMA 5K89A 1SCMB 2DDCA 3SG5A 5EB6A 2PSRA 3NXAA 4RYWA 4AR7A 2Y5IA 2KQ6A 4AS8A 3DXLA 3OX5A 4W6IA 1ZFSA 1AJ5A 1YUTA 4N5XA 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 1XAEA 2WORA 1FF1A 2EMNA 3SVOA 1ORGA 4IK8A 2P6BB 4P5OE 1GJYA 2AH8A 2O24A 4P76A 3AKAA 1M45A 1TN4A 4N1FA 1XSSA 1JBYA 2WCJA 1F4OA 1JC2A 2JZIA 4GBAA 1DQEA 5KSZA 3GEXA 1XYDA 2LMUA 5AQBB 3DZTA 1J1EA 2VADA 2M49B 2FJUB 1KQMC 1IWQA 1W7SA 1WRZA 3DQ9A 5D3OA 5KU1A 4W6CA 5D69A 1SKTA 2HQZA 1U5IA 2KBMA 2AMIA 4L1IA 2MJWB 1IRJA 1AP4A 1AJ4A 1RK9A 1EMCA 2GTEA 2PMYA 3GK4X 4XJKA 1PSBA 2KPHA 3DVJA 1OXEA 2G3OA 4OZDA 4B30A 1KYSA 4DXQA 3RWTA 1ALWA 3PM8A 1KFXL 3EK8A 2YE1A 3OSRA 4WRIA 2BCXA 1NCZA 1DJGA 3R1PA 3U0KA 3N7HA 1NX1A 2LNKA 4QJ5B 2HRSA 4WQ2A 1UHJA 4XYNA 4FQOA 1OXDA 2GGMA 4R6DA 3CGAA 2L4IA 4TNCA 2JT3A 4W76A 1YX7A 1DEKA 4LQTA 1DF0B 4DUQA 3D75A 2AWKA 3LS3A 3LL8B 2EHBA 3BFBA 1SMGA 2G6XA 2HGYA 4ORBB 1SL8A 3I5FB 1S3PA 1Z1QA 1JSAA 3TDZA 5AXIA 5HBDA 4Q7UA 1CV7A 1V1FA 2H5PA 1RROA 2JOJA 1Q4AA 5CSJA 4Q9XA 4KW9A 4XVPA 4YGBB 4LJBA 1J55A 4PE1A 5FYXA 4F7FA 4YGCB 1EMMA 1C3ZA 3SV5A 3LA1A 1MHOA 1CFFA 3DPXA 2MRDA 1KK8C 4W6PA 1CKKA 1QX2A 2QEVA 4DXOA 2AHAA 4ZF4A 1TIZA 1E8AA 3D78A 2B3PA 1YRUB 4H3NA 1DF0A 2K7OA 3PM2A 1NCXA 2JPTA 2ICRA 4A4BA 1A2XA 2BAPA 4JGEA 1Q4DA 1TNXA 2BE6A 1OMRA 1QX5B 1CLBA 1JUOA 1RMOA 2G3DB 4I2YA 2I18A 1W7IB 4B30B 1KYRA 1NX0A 2C9IA 4IL1A 4L12A 1NP8A 3DPWA 3VB1A 3P8UA 1TCFA 1G7KA 3O6BA 5H89A 3CABA 4OVNF 1RWYA 5DY6A 2LMVA 2SCPA 1EH2A 2H9WA 5LTQA 3TS5C 3H1RA 1CTRA 2G2BA 4IK9A 2WC6A 1YVLA 1A29A 3ZNIA 3NT9A 3LK1A 5FI6A 1SY9A 1YRTB 3DQKA 3VROA 1F4QA 4I5KA 3BFHA 2Z6ZA 2KI6C 4ORCB 2OTGB 4GUKA 2P71A 5EL2A 3UNWA 1YJ2A 3O4XA 3MSEB 3ZUFA 2F2PA 1JC0A 4LW5A 3FWBA 2H8VA 3PJ7A 4MLWA 3PALA 4H48A 3EKHA 1TNPA 1AK8A 1GGWA 3S0BA 1UHHA 5CSNA 4MZLA 1XFYO 3WXAA 2ZMUA 1YUUA 1Z1PA 3JTDC 1B4CA 4I5NB 4YGEB 5HL1A 2M9GA 3TUYC 1UP5A 1YHIA 5DPGA 2KLEA 1EMBA 1KK7Z 4PPJA 3VK1A 1XO5A 2BE4A 1KP5A 1LXFC 3SG2A 3A8RA 3NHIA 1A75B 3FWCA 4HSZA 2FOTA 1CFCA 4W6AA 1MYWA 1KCYA 5FVGA 4W6DA 2WCEA 2DUIA 4TZGA 1RMPA 1RECA 5FVFA 1Q4BA 3H1OA 4B5YA 4YGAA 2PXSA 2BKIB 3I5IB 2M97A 4GF6B 2JNFA 1MF8B 2ZN9A 3BQ3A 2K8MB 3DQ7A 3SSYA 4YI8A 4FQTA 1K95A 3RZSA 4XOWA 1OZOA 3DQDA 4MN0A 4QJ4B 2M1KB 2QZ0A 1OSAA 1YTZC 3DY9A 1T14A 3JTDB 4W6JA 4ZCUA 1UURA 1DGVA 1QVIY 2PASA 1BG1A 3NT3A 5EHUA 5CSIA 2M3WA 3BYAA 3E3RA 2LE9B 4A4CA 4W6GA 1WLMA 5HYDA 1NYAA 3WHTB 3F45A 2KSPA 2LLUA 2WIQA 1QIVA 1QYFA 2AUCA 1UISA 1OOHA 4LQUA 4W72A 2HF5A 2OKYA 5HW9A 1YR5A 1PULA 5EBJA 1S6ZA 1QATA 1G33A 3DYEA 4BDUA 2WCMA 1EMLA 5IBWA 3Q8IA 1SK6D 2BCBA 1JBAA 5HKYA 1HCJA 2YE0A 4PPLA 3ICBA 5DTZA 1QYQA 1H8BA 4E68A 2AAOA 2Z1OA 1QXTA 1LA3A 3NHTA 2K0JA 2MAZA 1TUZA 2E6WA 1CLLA 4W73A 4U2VA 1A75A 2GW3A 4ZIOA 2KFFA 3DQOA 2LAPA 1OOIX 1QVIZ 1RFJA 1B1GA 3O2PA 2D8NA 2RH7A 4W7AA 5EXCI 4LJCA 1SL9A 2OTGC 1S6JA 3D10A 5J2OA 4I5LB 4PPKA 2WSNA 3DQCA 2KGRA 3JVTB 4R6BA 5DTYA 2M0RA 4GAOA 1NSHA 4RTCA 3D73A 3U8CA 1IH0A 2JADA 2AWJA 2BKHB 4H3LA 3D74A 2KBIA 4NDCA 3DQ2A 4AQJA 2OS8B 3AKBA 1J1DA 2L2CA 5I2OA 1FI5A 1BU3A 2GX2A 2H6VA 3ED8A 1WRKA 1M63B 1BJFA 3E5WA 5D7FA 2OPOA 3DQMA 2L0PA 2DUHA 3WLCA 2NXQA 4OJ0A 2BNXA 4W6LA 2A4JA 3C1VA 1K9PA 3E5VA 2L5XB 4W6BA 3GB3A 1B7TZ 3L47A 3LF4B 2Q6PA 1BODA 4GPLB 1QWVA 3DQJA 5AERA 4W77A 3IF7A 1QJTA 1S5GY 1G4YR 2CCMA 1GFLA 3DQFA 1MXLC 1B9CA 1Y1XA 3A8SA 1QY3A 3RM1A 3AAJA 1GL4A 1XA9A 2WOSA 2DUFA 4W7CA 4IK1A 2NCOA 2JU0A 1KWOC 2BBMA 1MR8A 2WCHA 4DRWA 3ST0A 1TWOA 5EB7A 4W6RA 1XFXO 4OHSA 3AI4A 2POXA 2LM5A 2OTBA 1QLSA 1YZWA 4JEOA 1QXPA 2OTEA 4RYSA 3LVAA 1BMOA 3RLZA 4JD9A 2QDIA 1DGUA 1XFUO 4JRBA 3NGVA 1CM4A 4QJ3B 1SCVA 5F6TA 4PCWA 2QLIA 3DQ3A 1BR4B 1TNQA 4M2OA 5BPJA 3SSLA 2FWQA 1Y1UA 4W69A 2E30A 1WLZA 1Q4EA 4MZJA 1IQ5A 4EN1A 1DJWA 5FVIA 3EG5B 3UO9A 2QEHA 2QEOA 2WISA 3SVRA 2IB5A 3I5FC 2PVBA 3NSKA 3ZULA 2ZMWA 2HPSA 1U5IB 3DF0A 1NCYA 2IS9A 1Q73A 2BL0B 5ER4X 1DJHA 2A46A 1IKUA 4KW4A 1C7WA 1S5GZ 1XVJA 2WCFA 2WSOA 2G6EA 3DQUA 2LMTA 2CNPA 4OV2A 1NX3A 1XFVO 3IR8A 2CXJA 3NSOA 5J3XA 5DPJA 2L2EA 1VRKA 3B86A 1SSEB 4UTSA 1PVAA 1QASA 1OE9B 1K8UA 2H61A 3OB1B 1YFPA 3ZWHA 2L5YA 1EMEA 1AUIB 3DQ6A 2H5OA 4Q9WA 3PLFB 4KF5C 2DDDA 1KYPA 3G9AA 3AAKA 4ANJA 1YURA 4KGEA 1TRFA 4DKNA 1NUBA 3PFVA 1DJIA 1IGVA 1OOJA 1FI6A 4ETOA 2KDHA 2L98A 1EMFA 1F0BA 3DQHA 1PALA 2WCBA 2G16B 3BUXB 1B8CA 3VRNA 4IJ7A 2K2AA 1OMVA 3SIAA 2KYFA 2HFCA 1AHRA 3ZTFA 5TNCA 3TS5B 3ST4A 1OZSA 1PRWA 4KEXA 3VRRA 4J88A 2LVKA 4PE4A 3EK4A 1JF0A 4OGSA 3SG4A 2A54B 2QLGA 3SVBA 2FCEA 3GJ1A 1L2OB 2KAXA 5AEQA 2ISDA 2JXCA 2LHIA 3UG0A 1CDMA 1F71A 1CFPA 4YGDB 3FIAA 2V53A 2GV5A 2JRFA 2G2SB 1QX7A 4Q04A 3JVTC 3OGNA 4ORNA 1MQ1A 2LANA 2LP3A 2DUEA 4KAGA 4HQ8A 5HZSA 4PHMA 1GGXA 4OKHA 1WDCB 3M24A 4BY5A 2BTJA 2OS8C 3KCSA 1N0YA 1S6CA 3DQ1A 2GGZA 2PXWA 2M7LA 1Y0VH 2HQKA 1KWOB 2M7NA 1SCMC 4KGFA 4USLA 2M8UA 3SSKA 3S0FA 2AWLA 2LHLA 4PE0A 2Q91A 5HKWA 4F0ZB 4OY4A 4MBEA 1QS7A 3SSTA 3CR4X 2HETA 1C07A 1WY9A 1UUSA 1NIWA 2Y0GA 1SL7A 3CB9A 5T3IA 4GOBA 4MZKA 1R2UA 4GGFA 4HE4A 1QLKA 2BECA 1CM1A 3CFHA 5DRGA 4DCKA 3GL4A 5LK4A 4NWSA 1S36A 2PQLA 4EDOA 4INWA 4JWQA 3CYZA 1LVCD 5DKQA
chains in the Genus database with same CATH topology
4IK3A 1ZGPA 3LLEA 1J7RA 1JF2A 2F2OA 1SRAA 3U0LA 5CSFA 1K9KA 2M1UA 1MOVA 3WNXB 1SR6B 2CTNA 1TOPA 2QLEA 3U0NA 3TDIA 3PIBA 3EKJA 3CTNA 5CPVA 4HQCA 3VHTA 2K7BA 1UHIA 3DQEA 3OB2B 4EULA 1QV1A 2FZUA 2NLNA 5HGEA 2K2FA 2O29A 3ST2A 5HLOA 1A03A 3SSPA 1GQMA 4TZAA 3PJ5A 4NQGA 4W7RA 3CWGA 2ZRSA 1Q4CA 2ZKMX 2KYCA 2QACA 4AQIA 1CMGA 3U8AA 1M31A 3DD4A 3S05A 5ER5A 4PE7A 4WQ3A 5BTTB 3I5IC 3U0MA 3GJ2A 1H6RA 2O5GA 1Y6WA 1YHGA 1ZUZA 2QU1A 2IB6A 5HZTA 2F8PA 3NSIA 3SVUA 2F33A 4NDBA 1CLMA 1DVIA 4W6NA 1EG3A 2JTZA 2P4MA 2KOTA 3SG7A 1KSOA 1ZUXA 4GGFC 3OHMB 3PN7B 2Q4UA 4Z4MA 5JJGA 1QTXA 1B8LA 1N2DA 3IQQA 1RMMA 3TZ1A 2EC6C 1F70A 1CNPA 4GESB 1XK4C 2KFHA 1B47A 4H3MA 1CMFA 1K90D 2TN4A 3ADFA 1JFJA 2JWWA 2LLSA 2RGIA 4W6OA 4PHKA 2ZFDA 5BT0A 1ZGOA 3K1KA 1HUYA 4JC2A 3VRQA 2B1UA 4JQ0D 2A50B 4KA9A 3BX9A 2KI4C 3DQ8A 4J89A 3PJBA 1F8HA 1J7QA 2ZO7A 4DKMA 3OGOA 2A53B 2OJKA 1XFWO 2EGDA 5H88A 1SPYA 3WCKA 4ZBLA 1EMKA 4D1EA 5EXUA 2LCPA 3UFZA 3VICA 2JNXA 1JBZA 1MOUA 2FCDA 2DD9A 3GOFA 4LJDC 2JC2A 1S1EA 2KHNA 3GK2A 3BUWB 3DQ4A 3O78A 1RTP1 2ZRTA 4W6FA 3SJSA 2IE2A 2OKWA 2KI4B 3CLNA 3BXAA 1PVBA 3CD9A 4M2QA 3I5HB 2MBXA 1RM9A 2M29A 2QT2A 3KHEA 4ZFSA 5HKZA 1JFKA 5KTGA 4KPIA 2LP2A 3NEZA 3DQIA 1IG5A 1JWDA 3TMTA 5DU0A 1K9UA 3M22A 3EVUA 4ORAB 1R6PA 3SVNA 4OR9B 4ZINA 4Z4KA 5KTYA 1PSRA 4KF5A 4LJDA 2EC6B 3BOWA 1ODBA 1W7UA 2YDZA 2QLGB 1BOCA 1D1OA 3SG6A 2MLEC 2O60A 1F54A 3MGFA 2G9BA 1A4PA 2WC8A 3D0YA 2HQ8A 4W6SA 1EJ3A 4W7EA 2KQYA 2WHSA 2NZ0A 1CFDA 5B8IB 3OP0A 2H2KA 2KGBC 2H8QA 1KQVA 5HZUA 5AFPA 4Q7RA 2O2BA 4HRGA 2VZXA 3DQNA 1MXEA 3OX6A 4N1GA 3NF0A 1MUXA 4GNKB 4EMQA 4W74A 1BLQA 3SS0A 1SNLA 2IOVA 4W6MA 1LA0A 2AWMA 3KO0A 2KNEA 3TMRA 1YJFA 1AVSA 2I2RE 4CFRA 5AANA 4C0JA 1J7PA 1DMOA 4BY4A 4AOMA 4ZCVA 4P1QA 1KK7Y 1EL4A 3A4UB 2WHUA 3SSHA 3HX4A 1QYOA 2L51A 3CS1A 1WDCC 3AI5A 2BCAA 1K94A 2JTTA 4U8DA 2K61A 3ST3A 1CB1A 1W7TA 1IJ5A 4ICBA 1B8RA 3HCMA 3E5TA 3H4SE 3LSAA 5BQLA 4P2YB 3DPZA 2HJOA 5EJUA 2G5ZB 3I5GB 2MLFC 1L7ZA 4W75A 1F09A 5DKNA 1G8IA 4HQ9A 5GQQC 2MA2A 3PN7C 1SBJA 1ZOTB 4YBHB 4XL5A 5HLVA 3IQOA 4M2PA 2BBNA 1DT7B 1NPQA 2L4HA 2DD7A 4I5JA 5DQMA 3CGLA 2KFGA 3CD1A 3SVDA 1FPWA 4FTGA 1XA5A 4PDZA 2HGDA 3CR5X 1CDNA 1BF5A 2COLB 4ZF5A 4MRYA 2SASA 5DTLA 1UHKA 1OXFA 1KK8B 2Z6YA 3SIBA 3DQ5A 2JXLA 4PFEA 3CZTX 1PK0D 4YRUA 3EVRA 3PATA 5DPHA 1M46A 5I2LA 5LTRA 1N65A 1KQMB 1LKJA 3NEDA 2H5QA 2EMOA 2DUGA 4W6TA 2I94A 3VGOA 4W6HA 5G08A 3WHUB 1XK4A 3KCTA 1JC1A 4J8AA 5DPIA 3BXCA 1H4BA 3VRPA 2V4EA 2A47A 2LVJA 2V4EB 2VVIA 2ZNEA 4HVFA 1X02A 1SYMA 4MEWA 4MSPA 2JT0A 4KW8A 3CBEA 1C7VA 3SVEA 3DVKA 3LVDA 3SRYA 1K96A 3O4YA 3RWAA 1KFXS 1S26D 4XGYA 4IK5A 4XJKB 2K7DA 3KF9A 2MHHA 2L50A 2LVIA 5H87A 1ALVA 3I5HC 5DKRA 1H4UA 3DVMA 1OQPA 1FW4A 2LUXA 1DJZA 1SW8A 2F3YA 3DQAA 3SSVA 2WHTA 3OSQA 3WLDA 1K2HA 1Q80A 2VRGA 3IP2A 1TNWA 1M39A 3LVCA 5FHVA 3BXBA 2ZO6A 4MVFA 2VVJA 1DTLA 2A52B 4C0KA 1S6IA 3QRXA 2NCPA 1F55A 1XFZO 2YFPA 4L13A 2FL1A 1B7TY 1BFPA 1Y1AA 4DS7A 2EMDA 2QLHA 4DXNA 4ZB1A 3K21A 4W7XA 4CFQA 4EDSA 2ZN8A 2VVHA 3DVEA 3O77A 4DXPA 3P28A 2JT8A 1YHHA 1YVHA 1HQVA 3W1CA 4H47A 4JF9A 2ZNDA 1EXRA 1EMGA 2HPWA 2Y1NA 4PHJA 3D0YB 1UHNA 1XMZA 2KI6D 3LCPC 1RRXA 1NWDA 4IK4A 4KF4A 1WRLA 4CLNA 1K93D 4W6KA 1W7JB 1KFUS 4CIDA 4Q7TA 2LUCA 2F3ZA 1QIWA 5I2QA 1HT9A 2K7CA 4CPVA 2Y1MA 2LLTA 4OCIA 1QV0A 4HREE 4DXIA 4MRXA 1FBVA 3LK0A 3TUYB 2HQWA 2DOQA 2I7AA 2R2IA 5DRFA 1YUSA 3LF3A 2G6YA 4W7DA 1ZGQA 2A48A 2JULA 4GFTA 5BTTA 5DQBA 1MWNA 1ZMZA 4UPGA 3BUMB 3PSRA 3KPXA 3U8PA 1SR6C 2Y4QA 3CFAA 5JOLA 2Q57A 3DF0B 1V1GA 3DQLA 2CBLA 2LC5A 1NX2A 5DTXA 1YX8A 1J7OA 3SVSA 1BT6A 4R1EA 3AKOA 2C9JA 1CDPA 4GGNA 1DJXA 4W7FA 3FS7A 4PALA 3NSLA 5HZOA 2BL0C 3SG3A 5F9GA 3EVPA 4YI9A 4IZNA 3EVVA 1L2OC 5EXBA 1TTXA 2WURA 4JFGA 4NDDA 2B3QA 3M0WA 4OQWA 2PRUA 2A56B 2QRFA 4HRHA 2OGRA 2CT9A 2KAVA 3I19A 3VHTB 2PALA 1UWOA 5I8NA 3CFFA 1TCOB 3BXKA 3KEVA 4ZF3A 1BR1B 1IJ6A 4C0LA 3ZUJA 3W1DA 1GGZA 2KAYA 5PALA 2VAEA 4W6UA 1CDLA 1EMAA 4N3DA 2V4EC 2Z6XA 1B9AA 2LV7A 2HCGA 4DXMA 3SVCA 1ZACA 4DIRA 1C4FA 1KSMA 4L9MA 2ARLA 2WNDA 3V3DA 1KFUL 1RJVA 2GX0A 4PHNA 2LVVA 1OMDA 1LINA 2JQ6A 3BOWB 2GW4B 1EG4A 1DJYA 2QPTA 2H61C 2H5RA 3I5GC 3EK7A 3TDUA 4XOVA 3BUOB 5LTPA 1XQMA 5K89A 1SCMB 2DDCA 3SG5A 5EB6A 2PSRA 3NXAA 4RYWA 4AR7A 2Y5IA 2KQ6A 4AS8A 3OX5A 4W6IA 1ZFSA 1AJ5A 1YUTA 4N5XA 1IQ3A 4JPZB 3GK1A 3BUNB 3CR2A 1XAEA 2WORA 1FF1A 2EMNA 3SVOA 4IK8A 2P6BB 4P5OE 1GJYA 2AH8A 2O24A 4P76A 3AKAA 1M45A 1TN4A 4N1FA 1XSSA 1JBYA 1F4OA 1JC2A 2JZIA 4GBAA 5KSZA 3GEXA 1XYDA 2LMUA 5AQBB 2VADA 1J1EA 2M49B 2FJUB 1KQMC 1IWQA 1W7SA 1WRZA 3DQ9A 5KU1A 4W6CA 5D69A 1SKTA 2HQZA 1U5IA 2KBMA 2AMIA 4L1IA 2MJWB 1IRJA 1AP4A 1AJ4A 1RK9A 1EMCA 2PMYA 3GK4X 4XJKA 1PSBA 3DVJA 1OXEA 2G3OA 4B30A 1KYSA 4DXQA 3RWTA 1ALWA 3PM8A 1KFXL 3EK8A 2YE1A 3OSRA 4WRIA 2BCXA 1NCZA 1DJGA 3U0KA 1NX1A 2LNKA 4QJ5B 2HRSA 4WQ2A 1UHJA 4XYNA 4FQOA 1OXDA 2GGMA 4R6DA 3CGAA 2L4IA 4TNCA 2JT3A 4W76A 1YX7A 4LQTA 1DF0B 4DUQA 2AWKA 3LS3A 3LL8B 2EHBA 1SMGA 2G6XA 2HGYA 4ORBB 1SL8A 3I5FB 1S3PA 1Z1QA 1JSAA 3TDZA 5AXIA 5HBDA 4Q7UA 1CV7A 1V1FA 2H5PA 1RROA 2JOJA 1Q4AA 5CSJA 4Q9XA 4KW9A 4XVPA 4YGBB 4LJBA 1J55A 4PE1A 5FYXA 4YGCB 1EMMA 3SV5A 3LA1A 1MHOA 1CFFA 3DPXA 2MRDA 1KK8C 4W6PA 1CKKA 1QX2A 4DXOA 2AHAA 4ZF4A 1TIZA 1E8AA 2B3PA 1YRUB 4H3NA 1DF0A 2K7OA 1NCXA 2JPTA 2ICRA 4A4BA 1A2XA 4JGEA 1Q4DA 1TNXA 2BE6A 1OMRA 1QX5B 1CLBA 1JUOA 1RMOA 2G3DB 4I2YA 2I18A 1W7IB 4B30B 1KYRA 1NX0A 2C9IA 4IL1A 4L12A 1NP8A 3DPWA 3P8UA 1TCFA 1G7KA 3O6BA 5H89A 4OVNF 1RWYA 5DY6A 2LMVA 2SCPA 1EH2A 2H9WA 5LTQA 3TS5C 3H1RA 1CTRA 2G2BA 4IK9A 1YVLA 1A29A 3ZNIA 3NT9A 3LK1A 1SY9A 1YRTB 3DQKA 3VROA 1F4QA 4I5KA 2Z6ZA 2KI6C 4ORCB 2OTGB 4GUKA 1YJ2A 3MSEB 3ZUFA 2F2PA 1JC0A 4LW5A 3FWBA 3PJ7A 4MLWA 3PALA 4H48A 3EKHA 1TNPA 1AK8A 1GGWA 1UHHA 5CSNA 4MZLA 1XFYO 3WXAA 2ZMUA 1YUUA 1Z1PA 3JTDC 1B4CA 4I5NB 4YGEB 2M9GA 3TUYC 1UP5A 1YHIA 5DPGA 1EMBA 1KK7Z 4PPJA 3VK1A 1XO5A 2BE4A 1KP5A 1LXFC 3SG2A 3A8RA 1A75B 3FWCA 4HSZA 2FOTA 1CFCA 4W6AA 1MYWA 1KCYA 5FVGA 4W6DA 2WCEA 2DUIA 4TZGA 1RMPA 1RECA 5FVFA 1Q4BA 3H1OA 4B5YA 4YGAA 2PXSA 2BKIB 3I5IB 2M97A 4GF6B 2JNFA 1MF8B 2ZN9A 3BQ3A 2K8MB 3DQ7A 3SSYA 4YI8A 1K95A 4XOWA 1OZOA 3DQDA 4MN0A 4QJ4B 2M1KB 2QZ0A 1OSAA 1YTZC 3JTDB 4W6JA 4ZCUA 1UURA 1DGVA 1QVIY 2PASA 1BG1A 3NT3A 5EHUA 5CSIA 2M3WA 3BYAA 3E3RA 2LE9B 4A4CA 4W6GA 1WLMA 5HYDA 1NYAA 3WHTB 3F45A 2KSPA 2LLUA 2WIQA 1QIVA 1QYFA 2AUCA 1UISA 4LQUA 4W72A 2HF5A 2OKYA 5HW9A 1YR5A 1PULA 5EBJA 1S6ZA 1QATA 4BDUA 1G33A 1EMLA 5IBWA 1SK6D 2BCBA 1JBAA 5HKYA 1HCJA 2YE0A 4PPLA 3ICBA 5DTZA 1QYQA 1H8BA 4E68A 2AAOA 2Z1OA 1QXTA 1LA3A 2K0JA 2MAZA 2E6WA 1CLLA 4W73A 4U2VA 1A75A 2GW3A 4ZIOA 2KFFA 3DQOA 2LAPA 1QVIZ 1RFJA 1B1GA 3O2PA 2D8NA 2RH7A 4W7AA 5EXCI 4LJCA 1SL9A 2OTGC 1S6JA 3D10A 5J2OA 4I5LB 4PPKA 2WSNA 3DQCA 2KGRA 3JVTB 4R6BA 5DTYA 2M0RA 4GAOA 1NSHA 4RTCA 3U8CA 1IH0A 2JADA 2AWJA 2BKHB 4H3LA 2KBIA 4NDCA 3DQ2A 4AQJA 2OS8B 3AKBA 1J1DA 5I2OA 1FI5A 1BU3A 2GX2A 2H6VA 3ED8A 1WRKA 1M63B 1BJFA 3E5WA 5D7FA 2OPOA 3DQMA 2L0PA 2DUHA 3WLCA 2NXQA 4OJ0A 4W6LA 2A4JA 3C1VA 1K9PA 3E5VA 2L5XB 4W6BA 3GB3A 1B7TZ 3LF4B 1BODA 2Q6PA 4GPLB 3DQJA 5AERA 4W77A 3IF7A 1QJTA 1S5GY 1G4YR 2CCMA 1GFLA 3DQFA 1MXLC 1B9CA 1Y1XA 3A8SA 1QY3A 3RM1A 3AAJA 1GL4A 1XA9A 2WOSA 2DUFA 4W7CA 4IK1A 2NCOA 2JU0A 1KWOC 2BBMA 1MR8A 4DRWA 3ST0A 5EB7A 4W6RA 1XFXO 4OHSA 3AI4A 2POXA 2LM5A 2OTBA 1QLSA 1YZWA 4JEOA 1QXPA 2OTEA 4RYSA 3LVAA 1BMOA 3RLZA 1DGUA 1XFUO 4JRBA 1CM4A 4QJ3B 1SCVA 5F6TA 4PCWA 2QLIA 3DQ3A 1BR4B 1TNQA 4M2OA 5BPJA 3SSLA 2FWQA 1Y1UA 4W69A 2E30A 1WLZA 1Q4EA 4MZJA 1IQ5A 4EN1A 1DJWA 5FVIA 2WISA 3SVRA 2IB5A 3I5FC 2PVBA 3NSKA 3ZULA 2ZMWA 2HPSA 1U5IB 3DF0A 1NCYA 2IS9A 1Q73A 2BL0B 5ER4X 1DJHA 2A46A 1IKUA 4KW4A 1C7WA 1S5GZ 1XVJA 2WCFA 2WSOA 2G6EA 3DQUA 2LMTA 2CNPA 4OV2A 1NX3A 1XFVO 3IR8A 2CXJA 3NSOA 5J3XA 5DPJA 2L2EA 1VRKA 4UTSA 1PVAA 1QASA 1OE9B 1K8UA 2H61A 3OB1B 1YFPA 3ZWHA 1EMEA 1AUIB 3DQ6A 2H5OA 4Q9WA 3PLFB 4KF5C 2DDDA 1KYPA 3G9AA 3AAKA 4ANJA 1YURA 4KGEA 1TRFA 4DKNA 1NUBA 3PFVA 1DJIA 1IGVA 1OOJA 1FI6A 4ETOA 2KDHA 2L98A 1EMFA 1F0BA 3DQHA 1PALA 2WCBA 2G16B 3BUXB 1B8CA 3VRNA 2K2AA 1OMVA 3SIAA 2KYFA 2HFCA 1AHRA 3ZTFA 5TNCA 3TS5B 3ST4A 1OZSA 1PRWA 4KEXA 3VRRA 4J88A 2LVKA 4PE4A 3EK4A 1JF0A 4OGSA 3SG4A 2A54B 2QLGA 3SVBA 2FCEA 3GJ1A 1L2OB 2KAXA 5AEQA 2ISDA 2JXCA 2LHIA 3UG0A 1CDMA 1F71A 1CFPA 4YGDB 3FIAA 2V53A 2GV5A 2JRFA 2G2SB 1QX7A 4Q04A 3JVTC 4ORNA 1MQ1A 2LANA 2LP3A 2DUEA 4KAGA 4HQ8A 5HZSA 4PHMA 1GGXA 4OKHA 1WDCB 3M24A 4BY5A 2BTJA 2OS8C 3KCSA 1N0YA 1S6CA 3DQ1A 2GGZA 2PXWA 2M7LA 1Y0VH 2HQKA 1KWOB 2M7NA 1SCMC 4KGFA 4USLA 2M8UA 3SSKA 2AWLA 2LHLA 4PE0A 2Q91A 5HKWA 4F0ZB 4OY4A 4MBEA 1QS7A 3SSTA 3CR4X 2HETA 1C07A 1WY9A 1UUSA 1NIWA 2Y0GA 1SL7A 3CB9A 5T3IA 4GOBA 4MZKA 1R2UA 4GGFA 4HE4A 1QLKA 2BECA 1CM1A 3CFHA 5DRGA 4DCKA 3GL4A 5LK4A 4NWSA 1S36A 4EDOA 4JWQA 1LVCD 5DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK3 A;  1ZGP A;  3LLE A;  1J7R A;  1JF2 A;  2F2O A;  1SRA A;  3U0L A;  5CSF A;  1K9K A;  2M1U A;  1MOV A;  3WNX B;  1SR6 B;  2CTN A;  1TOP A;  2QLE A;  3U0N A;  3TDI A;  3PIB A;  3EKJ A;  3CTN A;  5CPV A;  4HQC A;  3VHT A;  2K7B A;  1UHI A;  3DQE A;  3OB2 B;  4EUL A;  1QV1 A;  2FZU A;  2NLN A;  5HGE A;  2K2F A;  2O29 A;  3ST2 A;  5HLO A;  1A03 A;  3SSP A;  1GQM A;  4TZA A;  3PJ5 A;  4NQG A;  4W7R A;  3CWG A;  2ZRS A;  1Q4C A;  2ZKM X;  2KYC A;  2QAC A;  4AQI A;  1CMG A;  3U8A A;  1M31 A;  3DD4 A;  3S05 A;  5ER5 A;  4PE7 A;  4WQ3 A;  5BTT B;  3I5I C;  3U0M A;  3GJ2 A;  1H6R A;  2O5G A;  1Y6W A;  1YHG A;  1ZUZ A;  2QU1 A;  2IB6 A;  5HZT A;  2F8P A;  3NSI A;  3SVU A;  2F33 A;  4NDB A;  1CLM A;  1DVI A;  4W6N A;  1EG3 A;  2JTZ A;  2P4M A;  2KOT A;  3SG7 A;  1KSO A;  1ZUX A;  4GGF C;  3OHM B;  3PN7 B;  2Q4U A;  4Z4M A;  5JJG A;  1QTX A;  1B8L A;  1N2D A;  3IQQ A;  1RMM A;  3TZ1 A;  2EC6 C;  1F70 A;  1CNP A;  4GES B;  1XK4 C;  2KFH A;  1B47 A;  4H3M A;  1CMF A;  1K90 D;  2TN4 A;  3ADF A;  1JFJ A;  2JWW A;  2LLS A;  2RGI A;  4W6O A;  4PHK A;  2ZFD A;  5BT0 A;  1ZGO A;  3K1K A;  1HUY A;  4JC2 A;  3VRQ A;  2B1U A;  4JQ0 D;  2A50 B;  4KA9 A;  3BX9 A;  2KI4 C;  3DQ8 A;  4J89 A;  3PJB A;  1F8H A;  1J7Q A;  2ZO7 A;  4DKM A;  3OGO A;  2A53 B;  2OJK A;  1XFW O;  2EGD A;  5H88 A;  1SPY A;  3WCK A;  4ZBL A;  1EMK A;  4D1E A;  5EXU A;  2LCP A;  3UFZ A;  3VIC A;  2JNX A;  1JBZ A;  1MOU A;  2FCD A;  2DD9 A;  3GOF A;  4LJD C;  2JC2 A;  1S1E A;  2KHN A;  3GK2 A;  3BUW B;  3DQ4 A;  3O78 A;  1RTP 1;  2ZRT A;  4W6F A;  3SJS A;  2IE2 A;  2OKW A;  2KI4 B;  3CLN A;  3BXA A;  1PVB A;  3CD9 A;  4M2Q A;  3I5H B;  2MBX A;  1RM9 A;  2M29 A;  2QT2 A;  3KHE A;  4ZFS A;  5HKZ A;  1JFK A;  5KTG A;  4KPI A;  2LP2 A;  3NEZ A;  3DQI A;  1IG5 A;  1JWD A;  3TMT A;  5DU0 A;  1K9U A;  3M22 A;  3EVU A;  4ORA B;  1R6P A;  3SVN A;  4OR9 B;  4ZIN A;  4Z4K A;  5KTY A;  1PSR A;  4KF5 A;  4LJD A;  2EC6 B;  3BOW A;  1ODB A;  1W7U A;  2YDZ A;  2QLG B;  1BOC A;  1D1O A;  3SG6 A;  2MLE C;  2O60 A;  1F54 A;  3MGF A;  2G9B A;  1A4P A;  2WC8 A;  3D0Y A;  2HQ8 A;  4W6S A;  1EJ3 A;  4W7E A;  2KQY A;  2WHS A;  2NZ0 A;  1CFD A;  5B8I B;  3OP0 A;  2H2K A;  2KGB C;  2H8Q A;  1KQV A;  5HZU A;  5AFP A;  4Q7R A;  2O2B A;  4HRG A;  2VZX A;  3DQN A;  1MXE A;  3OX6 A;  4N1G A;  3NF0 A;  1MUX A;  4GNK B;  4EMQ A;  4W74 A;  1BLQ A;  3SS0 A;  1SNL A;  2IOV A;  4W6M A;  1LA0 A;  2AWM A;  3KO0 A;  2KNE A;  3TMR A;  1YJF A;  1AVS A;  2I2R E;  4CFR A;  5AAN A;  4C0J A;  1J7P A;  1DMO A;  4BY4 A;  4AOM A;  4ZCV A;  4P1Q A;  1KK7 Y;  1EL4 A;  3A4U B;  2WHU A;  3SSH A;  3HX4 A;  1QYO A;  2L51 A;  3CS1 A;  1WDC C;  3AI5 A;  2BCA A;  1K94 A;  2JTT A;  4U8D A;  2K61 A;  3ST3 A;  1CB1 A;  1W7T A;  1IJ5 A;  4ICB A;  1B8R A;  3HCM A;  3E5T A;  3H4S E;  3LSA A;  5BQL A;  4P2Y B;  3DPZ A;  2HJO A;  5EJU A;  2G5Z B;  3I5G B;  2MLF C;  1L7Z A;  4W75 A;  1F09 A;  5DKN A;  1G8I A;  4HQ9 A;  5GQQ C;  2MA2 A;  3PN7 C;  1SBJ A;  1ZOT B;  4YBH B;  4XL5 A;  5HLV A;  3IQO A;  4M2P A;  2BBN A;  1DT7 B;  1NPQ A;  2L4H A;  2DD7 A;  4I5J A;  5DQM A;  3CGL A;  2KFG A;  3CD1 A;  3SVD A;  1FPW A;  4FTG A;  1XA5 A;  4PDZ A;  2HGD A;  3CR5 X;  1CDN A;  1BF5 A;  2COL B;  4ZF5 A;  4MRY A;  2SAS A;  5DTL A;  1UHK A;  1OXF A;  1KK8 B;  2Z6Y A;  3SIB A;  3DQ5 A;  2JXL A;  4PFE A;  3CZT X;  1PK0 D;  4YRU A;  3EVR A;  3PAT A;  5DPH A;  1M46 A;  5I2L A;  5LTR A;  1N65 A;  1KQM B;  1LKJ A;  3NED A;  2H5Q A;  2EMO A;  2DUG A;  4W6T A;  2I94 A;  3VGO A;  4W6H A;  5G08 A;  3WHU B;  1XK4 A;  3KCT A;  1JC1 A;  4J8A A;  5DPI A;  3BXC A;  1H4B A;  3VRP A;  2V4E A;  2A47 A;  2LVJ A;  2V4E B;  2VVI A;  2ZNE A;  4HVF A;  1X02 A;  1SYM A;  4MEW A;  4MSP A;  2JT0 A;  4KW8 A;  3CBE A;  1C7V A;  3SVE A;  3DVK A;  3LVD A;  3SRY A;  1K96 A;  3O4Y A;  3RWA A;  1KFX S;  1S26 D;  4XGY A;  4IK5 A;  4XJK B;  2K7D A;  3KF9 A;  2MHH A;  2L50 A;  2LVI A;  5H87 A;  1ALV A;  3I5H C;  5DKR A;  1H4U A;  3DVM A;  1OQP A;  1FW4 A;  2LUX A;  1DJZ A;  1SW8 A;  2F3Y A;  3DQA A;  3SSV A;  2WHT A;  3OSQ A;  3WLD A;  1K2H A;  1Q80 A;  2VRG A;  3IP2 A;  1TNW A;  1M39 A;  3LVC A;  5FHV A;  3BXB A;  2ZO6 A;  4MVF A;  2VVJ A;  1DTL A;  2A52 B;  4C0K A;  1S6I A;  3QRX A;  2NCP A;  1F55 A;  1XFZ O;  2YFP A;  4L13 A;  2FL1 A;  1B7T Y;  1BFP A;  1Y1A A;  4DS7 A;  2EMD A;  2QLH A;  4DXN A;  4ZB1 A;  3K21 A;  4W7X A;  4CFQ A;  4EDS A;  2ZN8 A;  2VVH A;  3DVE A;  3O77 A;  4DXP A;  3P28 A;  2JT8 A;  1YHH A;  1YVH A;  1HQV A;  3W1C A;  4H47 A;  4JF9 A;  2ZND A;  1EXR A;  1EMG A;  2HPW A;  2Y1N A;  4PHJ A;  3D0Y B;  1UHN A;  1XMZ A;  2KI6 D;  3LCP C;  1RRX A;  1NWD A;  4IK4 A;  4KF4 A;  1WRL A;  4CLN A;  1K93 D;  4W6K A;  1W7J B;  1KFU S;  4CID A;  4Q7T A;  2LUC A;  2F3Z A;  1QIW A;  5I2Q A;  1HT9 A;  2K7C A;  4CPV A;  2Y1M A;  2LLT A;  4OCI A;  1QV0 A;  4HRE E;  4DXI A;  4MRX A;  1FBV A;  3LK0 A;  3TUY B;  2HQW A;  2DOQ A;  2I7A A;  2R2I A;  5DRF A;  1YUS A;  3LF3 A;  2G6Y A;  4W7D A;  1ZGQ A;  2A48 A;  2JUL A;  4GFT A;  5BTT A;  5DQB A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  3PSR A;  3KPX A;  3U8P A;  1SR6 C;  2Y4Q A;  3CFA A;  5JOL A;  2Q57 A;  3DF0 B;  1V1G A;  3DQL A;  2CBL A;  2LC5 A;  1NX2 A;  5DTX A;  1YX8 A;  1J7O A;  3SVS A;  1BT6 A;  4R1E A;  3AKO A;  2C9J A;  1CDP A;  4GGN A;  1DJX A;  4W7F A;  3FS7 A;  4PAL A;  3NSL A;  5HZO A;  2BL0 C;  3SG3 A;  5F9G A;  3EVP A;  4YI9 A;  4IZN A;  3EVV A;  1L2O C;  5EXB A;  1TTX A;  2WUR A;  4JFG A;  4NDD A;  2B3Q A;  3M0W A;  4OQW A;  2PRU A;  2A56 B;  2QRF A;  4HRH A;  2OGR A;  2CT9 A;  2KAV A;  3I19 A;  3VHT B;  2PAL A;  1UWO A;  5I8N A;  3CFF A;  1TCO B;  3BXK A;  3KEV A;  4ZF3 A;  1BR1 B;  1IJ6 A;  4C0L A;  3ZUJ A;  3W1D A;  1GGZ A;  2KAY A;  5PAL A;  2VAE A;  4W6U A;  1CDL A;  1EMA A;  4N3D A;  2V4E C;  2Z6X A;  1B9A A;  2LV7 A;  2HCG A;  4DXM A;  3SVC A;  1ZAC A;  4DIR A;  1C4F A;  1KSM A;  4L9M A;  2ARL A;  2WND A;  3V3D A;  1KFU L;  1RJV A;  2GX0 A;  4PHN A;  2LVV A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  2GW4 B;  1EG4 A;  1DJY A;  2QPT A;  2H61 C;  2H5R A;  3I5G C;  3EK7 A;  3TDU A;  4XOV A;  3BUO B;  5LTP A;  1XQM A;  5K89 A;  1SCM B;  2DDC A;  3SG5 A;  5EB6 A;  2PSR A;  3NXA A;  4RYW A;  4AR7 A;  2Y5I A;  2KQ6 A;  4AS8 A;  3OX5 A;  4W6I A;  1ZFS A;  1AJ5 A;  1YUT A;  4N5X A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  1XAE A;  2WOR A;  1FF1 A;  2EMN A;  3SVO A;  4IK8 A;  2P6B B;  4P5O E;  1GJY A;  2AH8 A;  2O24 A;  4P76 A;  3AKA A;  1M45 A;  1TN4 A;  4N1F A;  1XSS A;  1JBY A;  1F4O A;  1JC2 A;  2JZI A;  4GBA A;  5KSZ A;  3GEX A;  1XYD A;  2LMU A;  5AQB B;  2VAD A;  1J1E A;  2M49 B;  2FJU B;  1KQM C;  1IWQ A;  1W7S A;  1WRZ A;  3DQ9 A;  5KU1 A;  4W6C A;  5D69 A;  1SKT A;  2HQZ A;  1U5I A;  2KBM A;  2AMI A;  4L1I A;  2MJW B;  1IRJ A;  1AP4 A;  1AJ4 A;  1RK9 A;  1EMC A;  2PMY A;  3GK4 X;  4XJK A;  1PSB A;  3DVJ A;  1OXE A;  2G3O A;  4B30 A;  1KYS A;  4DXQ A;  3RWT A;  1ALW A;  3PM8 A;  1KFX L;  3EK8 A;  2YE1 A;  3OSR A;  4WRI A;  2BCX A;  1NCZ A;  1DJG A;  3U0K A;  1NX1 A;  2LNK A;  4QJ5 B;  2HRS A;  4WQ2 A;  1UHJ A;  4XYN A;  4FQO A;  1OXD A;  2GGM A;  4R6D A;  3CGA A;  2L4I A;  4TNC A;  2JT3 A;  4W76 A;  1YX7 A;  4LQT A;  1DF0 B;  4DUQ A;  2AWK A;  3LS3 A;  3LL8 B;  2EHB A;  1SMG A;  2G6X A;  2HGY A;  4ORB B;  1SL8 A;  3I5F B;  1S3P A;  1Z1Q A;  1JSA A;  3TDZ A;  5AXI A;  5HBD A;  4Q7U A;  1CV7 A;  1V1F A;  2H5P A;  1RRO A;  2JOJ A;  1Q4A A;  5CSJ A;  4Q9X A;  4KW9 A;  4XVP A;  4YGB B;  4LJB A;  1J55 A;  4PE1 A;  5FYX A;  4YGC B;  1EMM A;  3SV5 A;  3LA1 A;  1MHO A;  1CFF A;  3DPX A;  2MRD A;  1KK8 C;  4W6P A;  1CKK A;  1QX2 A;  4DXO A;  2AHA A;  4ZF4 A;  1TIZ A;  1E8A A;  2B3P A;  1YRU B;  4H3N A;  1DF0 A;  2K7O A;  1NCX A;  2JPT A;  2ICR A;  4A4B A;  1A2X A;  4JGE A;  1Q4D A;  1TNX A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  1JUO A;  1RMO A;  2G3D B;  4I2Y A;  2I18 A;  1W7I B;  4B30 B;  1KYR A;  1NX0 A;  2C9I A;  4IL1 A;  4L12 A;  1NP8 A;  3DPW A;  3P8U A;  1TCF A;  1G7K A;  3O6B A;  5H89 A;  4OVN F;  1RWY A;  5DY6 A;  2LMV A;  2SCP A;  1EH2 A;  2H9W A;  5LTQ A;  3TS5 C;  3H1R A;  1CTR A;  2G2B A;  4IK9 A;  1YVL A;  1A29 A;  3ZNI A;  3NT9 A;  3LK1 A;  1SY9 A;  1YRT B;  3DQK A;  3VRO A;  1F4Q A;  4I5K A;  2Z6Z A;  2KI6 C;  4ORC B;  2OTG B;  4GUK A;  1YJ2 A;  3MSE B;  3ZUF A;  2F2P A;  1JC0 A;  4LW5 A;  3FWB A;  3PJ7 A;  4MLW A;  3PAL A;  4H48 A;  3EKH A;  1TNP A;  1AK8 A;  1GGW A;  1UHH A;  5CSN A;  4MZL A;  1XFY O;  3WXA A;  2ZMU A;  1YUU A;  1Z1P A;  3JTD C;  1B4C A;  4I5N B;  4YGE B;  2M9G A;  3TUY C;  1UP5 A;  1YHI A;  5DPG A;  1EMB A;  1KK7 Z;  4PPJ A;  3VK1 A;  1XO5 A;  2BE4 A;  1KP5 A;  1LXF C;  3SG2 A;  3A8R A;  1A75 B;  3FWC A;  4HSZ A;  2FOT A;  1CFC A;  4W6A A;  1MYW A;  1KCY A;  5FVG A;  4W6D A;  2WCE A;  2DUI A;  4TZG A;  1RMP A;  1REC A;  5FVF A;  1Q4B A;  3H1O A;  4B5Y A;  4YGA A;  2PXS A;  2BKI B;  3I5I B;  2M97 A;  4GF6 B;  2JNF A;  1MF8 B;  2ZN9 A;  3BQ3 A;  2K8M B;  3DQ7 A;  3SSY A;  4YI8 A;  1K95 A;  4XOW A;  1OZO A;  3DQD A;  4MN0 A;  4QJ4 B;  2M1K B;  2QZ0 A;  1OSA A;  1YTZ C;  3JTD B;  4W6J A;  4ZCU A;  1UUR A;  1DGV A;  1QVI Y;  2PAS A;  1BG1 A;  3NT3 A;  5EHU A;  5CSI A;  2M3W A;  3BYA A;  3E3R A;  2LE9 B;  4A4C A;  4W6G A;  1WLM A;  5HYD A;  1NYA A;  3WHT B;  3F45 A;  2KSP A;  2LLU A;  2WIQ A;  1QIV A;  1QYF A;  2AUC A;  1UIS A;  4LQU A;  4W72 A;  2HF5 A;  2OKY A;  5HW9 A;  1YR5 A;  1PUL A;  5EBJ A;  1S6Z A;  1QAT A;  4BDU A;  1G33 A;  1EML A;  5IBW A;  1SK6 D;  2BCB A;  1JBA A;  5HKY A;  1HCJ A;  2YE0 A;  4PPL A;  3ICB A;  5DTZ A;  1QYQ A;  1H8B A;  4E68 A;  2AAO A;  2Z1O A;  1QXT A;  1LA3 A;  2K0J A;  2MAZ A;  2E6W A;  1CLL A;  4W73 A;  4U2V A;  1A75 A;  2GW3 A;  4ZIO A;  2KFF A;  3DQO A;  2LAP A;  1QVI Z;  1RFJ A;  1B1G A;  3O2P A;  2D8N A;  2RH7 A;  4W7A A;  5EXC I;  4LJC A;  1SL9 A;  2OTG C;  1S6J A;  3D10 A;  5J2O A;  4I5L B;  4PPK A;  2WSN A;  3DQC A;  2KGR A;  3JVT B;  4R6B A;  5DTY A;  2M0R A;  4GAO A;  1NSH A;  4RTC A;  3U8C A;  1IH0 A;  2JAD A;  2AWJ A;  2BKH B;  4H3L A;  2KBI A;  4NDC A;  3DQ2 A;  4AQJ A;  2OS8 B;  3AKB A;  1J1D A;  5I2O A;  1FI5 A;  1BU3 A;  2GX2 A;  2H6V A;  3ED8 A;  1WRK A;  1M63 B;  1BJF A;  3E5W A;  5D7F A;  2OPO A;  3DQM A;  2L0P A;  2DUH A;  3WLC A;  2NXQ A;  4OJ0 A;  4W6L A;  2A4J A;  3C1V A;  1K9P A;  3E5V A;  2L5X B;  4W6B A;  3GB3 A;  1B7T Z;  3LF4 B;  1BOD A;  2Q6P A;  4GPL B;  3DQJ A;  5AER A;  4W77 A;  3IF7 A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1GFL A;  3DQF A;  1MXL C;  1B9C A;  1Y1X A;  3A8S A;  1QY3 A;  3RM1 A;  3AAJ A;  1GL4 A;  1XA9 A;  2WOS A;  2DUF A;  4W7C A;  4IK1 A;  2NCO A;  2JU0 A;  1KWO C;  2BBM A;  1MR8 A;  4DRW A;  3ST0 A;  5EB7 A;  4W6R A;  1XFX O;  4OHS A;  3AI4 A;  2POX A;  2LM5 A;  2OTB A;  1QLS A;  1YZW A;  4JEO A;  1QXP A;  2OTE A;  4RYS A;  3LVA A;  1BMO A;  3RLZ A;  1DGU A;  1XFU O;  4JRB A;  1CM4 A;  4QJ3 B;  1SCV A;  5F6T A;  4PCW A;  2QLI A;  3DQ3 A;  1BR4 B;  1TNQ A;  4M2O A;  5BPJ A;  3SSL A;  2FWQ A;  1Y1U A;  4W69 A;  2E30 A;  1WLZ A;  1Q4E A;  4MZJ A;  1IQ5 A;  4EN1 A;  1DJW A;  5FVI A;  2WIS A;  3SVR A;  2IB5 A;  3I5F C;  2PVB A;  3NSK A;  3ZUL A;  2ZMW A;  2HPS A;  1U5I B;  3DF0 A;  1NCY A;  2IS9 A;  1Q73 A;  2BL0 B;  5ER4 X;  1DJH A;  2A46 A;  1IKU A;  4KW4 A;  1C7W A;  1S5G Z;  1XVJ A;  2WCF A;  2WSO A;  2G6E A;  3DQU A;  2LMT A;  2CNP A;  4OV2 A;  1NX3 A;  1XFV O;  3IR8 A;  2CXJ A;  3NSO A;  5J3X A;  5DPJ A;  2L2E A;  1VRK A;  4UTS A;  1PVA A;  1QAS A;  1OE9 B;  1K8U A;  2H61 A;  3OB1 B;  1YFP A;  3ZWH A;  1EME A;  1AUI B;  3DQ6 A;  2H5O A;  4Q9W A;  3PLF B;  4KF5 C;  2DDD A;  1KYP A;  3G9A A;  3AAK A;  4ANJ A;  1YUR A;  4KGE A;  1TRF A;  4DKN A;  1NUB A;  3PFV A;  1DJI A;  1IGV A;  1OOJ A;  1FI6 A;  4ETO A;  2KDH A;  2L98 A;  1EMF A;  1F0B A;  3DQH A;  1PAL A;  2WCB A;  2G16 B;  3BUX B;  1B8C A;  3VRN A;  2K2A A;  1OMV A;  3SIA A;  2KYF A;  2HFC A;  1AHR A;  3ZTF A;  5TNC A;  3TS5 B;  3ST4 A;  1OZS A;  1PRW A;  4KEX A;  3VRR A;  4J88 A;  2LVK A;  4PE4 A;  3EK4 A;  1JF0 A;  4OGS A;  3SG4 A;  2A54 B;  2QLG A;  3SVB A;  2FCE A;  3GJ1 A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  2JXC A;  2LHI A;  3UG0 A;  1CDM A;  1F71 A;  1CFP A;  4YGD B;  3FIA A;  2V53 A;  2GV5 A;  2JRF A;  2G2S B;  1QX7 A;  4Q04 A;  3JVT C;  4ORN A;  1MQ1 A;  2LAN A;  2LP3 A;  2DUE A;  4KAG A;  4HQ8 A;  5HZS A;  4PHM A;  1GGX A;  4OKH A;  1WDC B;  3M24 A;  4BY5 A;  2BTJ A;  2OS8 C;  3KCS A;  1N0Y A;  1S6C A;  3DQ1 A;  2GGZ A;  2PXW A;  2M7L A;  1Y0V H;  2HQK A;  1KWO B;  2M7N A;  1SCM C;  4KGF A;  4USL A;  2M8U A;  3SSK A;  2AWL A;  2LHL A;  4PE0 A;  2Q91 A;  5HKW A;  4F0Z B;  4OY4 A;  4MBE A;  1QS7 A;  3SST A;  3CR4 X;  2HET A;  1C07 A;  1WY9 A;  1UUS A;  1NIW A;  2Y0G A;  1SL7 A;  3CB9 A;  5T3I A;  4GOB A;  4MZK A;  1R2U A;  4GGF A;  4HE4 A;  1QLK A;  2BEC A;  1CM1 A;  3CFH A;  5DRG A;  4DCK A;  3GL4 A;  5LK4 A;  4NWS A;  1S36 A;  4EDO A;  4JWQ A;  1LVC D;  5DKQ A; 
#chains in the Genus database with same CATH topology
 4IK3 A;  1ZGP A;  3LLE A;  1J7R A;  1JF2 A;  2F2O A;  1SRA A;  3S0D A;  3U0L A;  5CSF A;  5I94 A;  1K9K A;  2M1U A;  1MOV A;  3CZ0 A;  1SR6 B;  3WNX B;  2CTN A;  1OOG A;  1TOP A;  2QLE A;  3U0N A;  3TDI A;  3PIB A;  3EKJ A;  3CTN A;  5CPV A;  4HQC A;  3VHT A;  2K7B A;  1UHI A;  3DQE A;  3OB2 B;  4EUL A;  1QV1 A;  2FZU A;  2NLN A;  5HGE A;  2K2F A;  2O29 A;  3ST2 A;  5HLO A;  1A03 A;  1IIO A;  3SSP A;  1GQM A;  4TZA A;  2JPO A;  5DIC A;  3PJ5 A;  4NQG A;  4W7R A;  3CWG A;  3FE9 A;  2ZRS A;  1Q4C A;  2ZKM X;  2KYC A;  1Z4H A;  2QAC A;  4AQI A;  1CMG A;  3U8A A;  1M31 A;  3DD4 A;  3S05 A;  5ER5 A;  4PE7 A;  3FE8 A;  3R72 A;  4WQ3 A;  3SS4 A;  5BTT B;  3I5I C;  3U0M A;  3GJ2 A;  1H6R A;  2O5G A;  1Y6W A;  1YHG A;  1ZUZ A;  2QU1 A;  2IB6 A;  1TUJ A;  5HZT A;  2F8P A;  3NSI A;  3SVU A;  2F33 A;  4NDB A;  1CLM A;  1DVI A;  4W6N A;  1EG3 A;  2JTZ A;  2P4M A;  2KOT A;  3SG7 A;  1KSO A;  1ZUX A;  2ERB A;  4GGF C;  3OHM B;  1GM0 A;  3PN7 B;  2Q4U A;  4Z4M A;  5JJG A;  1QTX A;  1B8L A;  1N2D A;  3IQQ A;  1RMM A;  3TZ1 A;  2EC6 C;  1F70 A;  1CNP A;  3B87 A;  4GES B;  1XK4 C;  2KFH A;  1B47 A;  4H3M A;  3K1E A;  1CMF A;  1K90 D;  1DC1 A;  2TN4 A;  3ADF A;  5FI7 A;  1JFJ A;  2JWW A;  3IVT A;  2LLS A;  2RGI A;  4W6O A;  4PHK A;  2ZFD A;  3S0G A;  5BT0 A;  1ZGO A;  3K1K A;  1HUY A;  4JC2 A;  3VRQ A;  2B1U A;  4JQ0 D;  2A50 B;  4KA9 A;  3BX9 A;  2KI4 C;  3DQ8 A;  4J89 A;  3PJB A;  1F8H A;  1J7Q A;  2ZO7 A;  4DKM A;  3OGO A;  2A53 B;  2P70 A;  2OJK A;  1XFW O;  2EGD A;  2FJY A;  5H88 A;  1SPY A;  3VIC A;  1EMK A;  5EXU A;  4D1E A;  4ZBL A;  2LCP A;  3UFZ A;  3WCK A;  2JNX A;  1JBZ A;  1MOU A;  2FCD A;  3B88 A;  2DD9 A;  3GOF A;  4LJD C;  2JC2 A;  1S1E A;  2KHN A;  3GK2 A;  3BUW B;  3DQ4 A;  3O78 A;  1RTP 1;  2ZRT A;  4W6F A;  3SJS A;  2IE2 A;  2OKW A;  2KI4 B;  3CLN A;  3BXA A;  1PVB A;  3CD9 A;  4M2Q A;  3I5H B;  2MBX A;  1RM9 A;  2M29 A;  2QT2 A;  3KHE A;  4ZFS A;  5HKZ A;  1JFK A;  5KTG A;  4KPI A;  3S0E A;  2LP2 A;  3NEZ A;  3DQI A;  1IG5 A;  1JWD A;  3TMT A;  4INX A;  5DU0 A;  1K9U A;  3M22 A;  3EVU A;  4ORA B;  1R6P A;  3SVN A;  4OR9 B;  4ZIN A;  4Z4K A;  5KTY A;  1PSR A;  4KF5 A;  4LJD A;  2EC6 B;  3L4L A;  3BOW A;  1ODB A;  1W7U A;  2YDZ A;  2QLG B;  1BOC A;  1D1O A;  3SG6 A;  2MLE C;  2O60 A;  1F54 A;  3MGF A;  2G9B A;  1A4P A;  2WC8 A;  3D0Y A;  2HQ8 A;  4W6S A;  1EJ3 A;  4W7E A;  2KQY A;  2WHS A;  2NZ0 A;  1CFD A;  5B8I B;  3OP0 A;  2H2K A;  2KGB C;  2H8Q A;  1KQV A;  5HZU A;  5AFP A;  4Q7R A;  2O2B A;  4HRG A;  2VZX A;  3DQN A;  1MXE A;  3OX6 A;  4N1G A;  3NF0 A;  1MUX A;  4GNK B;  4EMQ A;  4W74 A;  1BLQ A;  3SS0 A;  1SNL A;  2IOV A;  4W6M A;  1LA0 A;  2AWM A;  3KO0 A;  2KNE A;  3TMR A;  1YJF A;  1AVS A;  2I2R E;  4CFR A;  5AAN A;  4C0J A;  1J7P A;  1DMO A;  4BY4 A;  4AOM A;  4ZCV A;  4P1Q A;  1KK7 Y;  1EL4 A;  3A4U B;  2WHU A;  3CZ2 A;  3SSH A;  3HX4 A;  1QYO A;  3S0A A;  2L51 A;  3CS1 A;  1WDC C;  3AI5 A;  2BCA A;  1K94 A;  2JTT A;  4U8D A;  2K61 A;  3ST3 A;  1CB1 A;  1W7T A;  1IJ5 A;  4ICB A;  1B8R A;  3HCM A;  3E5T A;  3H4S E;  3LSA A;  5BQL A;  4P2Y B;  3DPZ A;  2HJO A;  5EJU A;  2G5Z B;  3I5G B;  2MLF C;  1L7Z A;  4W75 A;  1F09 A;  5DKN A;  1G8I A;  4HQ9 A;  5GQQ C;  2MA2 A;  3PN7 C;  3FE6 A;  1SBJ A;  1ZOT B;  4YBH B;  4XL5 A;  5HLV A;  3IQO A;  4M2P A;  2BBN A;  1DT7 B;  1NPQ A;  1XFR A;  2L4H A;  2DD7 A;  4I5J A;  5DQM A;  3CGL A;  2KFG A;  3CD1 A;  3SVD A;  1FPW A;  3B7A A;  4FTG A;  1XA5 A;  4PDZ A;  2HGD A;  3CR5 X;  1CDN A;  1BF5 A;  2COL B;  4ZF5 A;  4MRY A;  2SAS A;  5DTL A;  1UHK A;  1OXF A;  1KK8 B;  2Z6Y A;  3SIB A;  3DQ5 A;  2JXL A;  4PFE A;  3CZT X;  1PK0 D;  4YRU A;  3EVR A;  3PAT A;  5DPH A;  1M46 A;  5I2L A;  5LTR A;  1N65 A;  2PYQ A;  1KQM B;  1LKJ A;  3NED A;  2H5Q A;  2EMO A;  2DUG A;  4W6T A;  2I94 A;  3VGO A;  4W6H A;  5G08 A;  3WHU B;  1XK4 A;  3KCT A;  1JC1 A;  4J8A A;  5DPI A;  3BXC A;  1H4B A;  3VRP A;  2V4E A;  3BJH A;  2A47 A;  2LVJ A;  2V4E B;  2VVI A;  2ZNE A;  4HVF A;  1X02 A;  3D77 A;  1SYM A;  4MEW A;  4MSP A;  2JT0 A;  4KW8 A;  3CBE A;  1C7V A;  3SVE A;  3DVK A;  3LVD A;  3SRY A;  1K96 A;  3O4Y A;  3RWA A;  1KFX S;  1S26 D;  4XGY A;  4IK5 A;  2WC5 A;  4XJK B;  2K7D A;  3KF9 A;  4PT1 A;  2MHH A;  2L50 A;  2LVI A;  5H87 A;  1ALV A;  3I5H C;  5DKR A;  1H4U A;  3DVM A;  1OQP A;  1FW4 A;  2LUX A;  1DJZ A;  1SW8 A;  2F3Y A;  3DQA A;  3SSV A;  2WHT A;  3OSQ A;  3WLD A;  3D76 A;  1K2H A;  1Q80 A;  2VRG A;  3IP2 A;  1TNW A;  1M39 A;  3LVC A;  5FHV A;  3BXB A;  2ZO6 A;  4MVF A;  2VVJ A;  1DTL A;  2A52 B;  4C0K A;  1S6I A;  3QRX A;  2NCP A;  1F55 A;  1XFZ O;  2YFP A;  4L13 A;  2FL1 A;  1W9Z A;  1B7T Y;  1BFP A;  1Y1A A;  4DS7 A;  2KLD A;  2EMD A;  3L4A A;  2QLH A;  4DXN A;  2YGU A;  4ZB1 A;  3K21 A;  4W7X A;  4CFQ A;  4EDS A;  2ZN8 A;  2VVH A;  3DVE A;  3O77 A;  4DXP A;  1Z2C B;  3P28 A;  2JT8 A;  1YHH A;  1YVH A;  1HQV A;  3R1O A;  3W1C A;  1DEL A;  4H47 A;  2K60 A;  4JF9 A;  2ZND A;  1OOF A;  1EXR A;  1EMG A;  2HPW A;  2Y1N A;  4PHJ A;  3D0Y B;  1UHN A;  1XMZ A;  2KI6 D;  3LCP C;  1RRX A;  3BFA A;  2QEB A;  3SS3 A;  1NWD A;  4IK4 A;  4KF4 A;  1WRL A;  4CLN A;  1K93 D;  4W6K A;  1W7J B;  1KFU S;  4CID A;  4Q7T A;  2LUC A;  2F3Z A;  1LS8 A;  1QIW A;  5I2Q A;  1HT9 A;  2K7C A;  3OBV A;  4CPV A;  2Y1M A;  2LLT A;  4OCI A;  1QV0 A;  4HRE E;  4DXI A;  4MRX A;  1FBV A;  3LK0 A;  3TUY B;  3B6X A;  2HQW A;  2DOQ A;  2I7A A;  2R2I A;  5DRF A;  1YUS A;  3LF3 A;  2G6Y A;  4W7D A;  1ZGQ A;  2A48 A;  2JUL A;  3CDN A;  4GFT A;  5BTT A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  2WCK A;  3PSR A;  3KPX A;  5DQB A;  1SR6 C;  3U8P A;  2Y4Q A;  3CFA A;  5JOL A;  2Q57 A;  3DF0 B;  3CZ1 A;  1V1G A;  3DQL A;  2CBL A;  2LC5 A;  5FI2 A;  1NX2 A;  5DTX A;  1YX8 A;  3SS5 A;  1J7O A;  3SVS A;  1BT6 A;  4R1E A;  3AKO A;  2C9J A;  1CDP A;  4GGN A;  1DJX A;  4W7F A;  3FS7 A;  4PAL A;  2WCL A;  3NSL A;  5HZO A;  2BL0 C;  3SG3 A;  3QME A;  5F9G A;  3EVP A;  3V2L A;  3R1V A;  4YI9 A;  4IZN A;  3EVV A;  1L2O C;  5EXB A;  1TTX A;  2WUR A;  4JFG A;  4KYN A;  4NDD A;  2B3Q A;  3M0W A;  4OQW A;  2PRU A;  2A56 B;  2QRF A;  4HRH A;  2OGR A;  2CT9 A;  2KAV A;  4JKT A;  3I19 A;  3VHT B;  2PAL A;  1UWO A;  5I8N A;  3CFF A;  1TCO B;  3BXK A;  3KEV A;  4ZF3 A;  1BR1 B;  1IJ6 A;  4C0L A;  3ZUJ A;  3W1D A;  1GGZ A;  2KAY A;  5PAL A;  2VAE A;  4W6U A;  1CDL A;  1EMA A;  4N3D A;  3PJI A;  2V4E C;  2Z6X A;  1B9A A;  2LV7 A;  2HCG A;  4DXM A;  3SVC A;  1ZAC A;  4DIR A;  1C4F A;  1KSM A;  4L9M A;  2ARL A;  2WND A;  3V3D A;  1KFU L;  1RJV A;  2GX0 A;  4PHN A;  2LVV A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  2GW4 B;  1EG4 A;  1DJY A;  1OW4 A;  1P28 A;  1C3Y A;  2QPT A;  2H61 C;  2H5R A;  3I5G C;  3EK7 A;  3TDU A;  4XOV A;  3BUO B;  5LTP A;  1XQM A;  5K89 A;  1SCM B;  2DDC A;  3SG5 A;  5EB6 A;  2PSR A;  3NXA A;  4RYW A;  4AR7 A;  2Y5I A;  2KQ6 A;  4AS8 A;  3DXL A;  3OX5 A;  4W6I A;  1ZFS A;  1AJ5 A;  1YUT A;  4N5X A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  1XAE A;  2WOR A;  1FF1 A;  2EMN A;  3SVO A;  1ORG A;  4IK8 A;  2P6B B;  4P5O E;  1GJY A;  2AH8 A;  2O24 A;  4P76 A;  3AKA A;  1M45 A;  1TN4 A;  4N1F A;  1XSS A;  1JBY A;  2WCJ A;  1F4O A;  1JC2 A;  2JZI A;  4GBA A;  1DQE A;  5KSZ A;  3GEX A;  1XYD A;  2LMU A;  5AQB B;  3DZT A;  1J1E A;  2VAD A;  2M49 B;  2FJU B;  1KQM C;  1IWQ A;  1W7S A;  1WRZ A;  3DQ9 A;  5D3O A;  5KU1 A;  4W6C A;  5D69 A;  1SKT A;  2HQZ A;  1U5I A;  2KBM A;  2AMI A;  4L1I A;  2MJW B;  1IRJ A;  1AP4 A;  1AJ4 A;  1RK9 A;  1EMC A;  2GTE A;  2PMY A;  3GK4 X;  4XJK A;  1PSB A;  2KPH A;  3DVJ A;  1OXE A;  2G3O A;  4OZD A;  4B30 A;  1KYS A;  4DXQ A;  3RWT A;  1ALW A;  3PM8 A;  1KFX L;  3EK8 A;  2YE1 A;  3OSR A;  4WRI A;  2BCX A;  1NCZ A;  1DJG A;  3R1P A;  3U0K A;  3N7H A;  1NX1 A;  2LNK A;  4QJ5 B;  2HRS A;  4WQ2 A;  1UHJ A;  4XYN A;  4FQO A;  1OXD A;  2GGM A;  4R6D A;  3CGA A;  2L4I A;  4TNC A;  2JT3 A;  4W76 A;  1YX7 A;  1DEK A;  4LQT A;  1DF0 B;  4DUQ A;  3D75 A;  2AWK A;  3LS3 A;  3LL8 B;  2EHB A;  3BFB A;  1SMG A;  2G6X A;  2HGY A;  4ORB B;  1SL8 A;  3I5F B;  1S3P A;  1Z1Q A;  1JSA A;  3TDZ A;  5AXI A;  5HBD A;  4Q7U A;  1CV7 A;  1V1F A;  2H5P A;  1RRO A;  2JOJ A;  1Q4A A;  5CSJ A;  4Q9X A;  4KW9 A;  4XVP A;  4YGB B;  4LJB A;  1J55 A;  4PE1 A;  5FYX A;  4F7F A;  4YGC B;  1EMM A;  1C3Z A;  3SV5 A;  3LA1 A;  1MHO A;  1CFF A;  3DPX A;  2MRD A;  1KK8 C;  4W6P A;  1CKK A;  1QX2 A;  2QEV A;  4DXO A;  2AHA A;  4ZF4 A;  1TIZ A;  1E8A A;  3D78 A;  2B3P A;  1YRU B;  4H3N A;  1DF0 A;  2K7O A;  3PM2 A;  1NCX A;  2JPT A;  2ICR A;  4A4B A;  1A2X A;  2BAP A;  4JGE A;  1Q4D A;  1TNX A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  1JUO A;  1RMO A;  2G3D B;  4I2Y A;  2I18 A;  1W7I B;  4B30 B;  1KYR A;  1NX0 A;  2C9I A;  4IL1 A;  4L12 A;  1NP8 A;  3DPW A;  3VB1 A;  3P8U A;  1TCF A;  1G7K A;  3O6B A;  5H89 A;  3CAB A;  4OVN F;  1RWY A;  5DY6 A;  2LMV A;  2SCP A;  1EH2 A;  2H9W A;  5LTQ A;  3TS5 C;  3H1R A;  1CTR A;  2G2B A;  4IK9 A;  2WC6 A;  1YVL A;  1A29 A;  3ZNI A;  3NT9 A;  3LK1 A;  5FI6 A;  1SY9 A;  1YRT B;  3DQK A;  3VRO A;  1F4Q A;  4I5K A;  3BFH A;  2Z6Z A;  2KI6 C;  4ORC B;  2OTG B;  4GUK A;  2P71 A;  5EL2 A;  3UNW A;  1YJ2 A;  3O4X A;  3MSE B;  3ZUF A;  2F2P A;  1JC0 A;  4LW5 A;  3FWB A;  2H8V A;  3PJ7 A;  4MLW A;  3PAL A;  4H48 A;  3EKH A;  1TNP A;  1AK8 A;  1GGW A;  3S0B A;  1UHH A;  5CSN A;  4MZL A;  1XFY O;  3WXA A;  2ZMU A;  1YUU A;  1Z1P A;  3JTD C;  1B4C A;  4I5N B;  4YGE B;  5HL1 A;  2M9G A;  3TUY C;  1UP5 A;  1YHI A;  5DPG A;  2KLE A;  1EMB A;  1KK7 Z;  4PPJ A;  3VK1 A;  1XO5 A;  2BE4 A;  1KP5 A;  1LXF C;  3SG2 A;  3A8R A;  3NHI A;  1A75 B;  3FWC A;  4HSZ A;  2FOT A;  1CFC A;  4W6A A;  1MYW A;  1KCY A;  5FVG A;  4W6D A;  2WCE A;  2DUI A;  4TZG A;  1RMP A;  1REC A;  5FVF A;  1Q4B A;  3H1O A;  4B5Y A;  4YGA A;  2PXS A;  2BKI B;  3I5I B;  2M97 A;  4GF6 B;  2JNF A;  1MF8 B;  2ZN9 A;  3BQ3 A;  2K8M B;  3DQ7 A;  3SSY A;  4YI8 A;  4FQT A;  1K95 A;  3RZS A;  4XOW A;  1OZO A;  3DQD A;  4MN0 A;  4QJ4 B;  2M1K B;  2QZ0 A;  1OSA A;  1YTZ C;  3DY9 A;  1T14 A;  3JTD B;  4W6J A;  4ZCU A;  1UUR A;  1DGV A;  1QVI Y;  2PAS A;  1BG1 A;  3NT3 A;  5EHU A;  5CSI A;  2M3W A;  3BYA A;  3E3R A;  2LE9 B;  4A4C A;  4W6G A;  1WLM A;  5HYD A;  1NYA A;  3WHT B;  3F45 A;  2KSP A;  2LLU A;  2WIQ A;  1QIV A;  1QYF A;  2AUC A;  1UIS A;  1OOH A;  4LQU A;  4W72 A;  2HF5 A;  2OKY A;  5HW9 A;  1YR5 A;  1PUL A;  5EBJ A;  1S6Z A;  1QAT A;  1G33 A;  3DYE A;  4BDU A;  2WCM A;  1EML A;  5IBW A;  3Q8I A;  1SK6 D;  2BCB A;  1JBA A;  5HKY A;  1HCJ A;  2YE0 A;  4PPL A;  3ICB A;  5DTZ A;  1QYQ A;  1H8B A;  4E68 A;  2AAO A;  2Z1O A;  1QXT A;  1LA3 A;  3NHT A;  2K0J A;  2MAZ A;  1TUZ A;  2E6W A;  1CLL A;  4W73 A;  4U2V A;  1A75 A;  2GW3 A;  4ZIO A;  2KFF A;  3DQO A;  2LAP A;  1OOI X;  1QVI Z;  1RFJ A;  1B1G A;  3O2P A;  2D8N A;  2RH7 A;  4W7A A;  5EXC I;  4LJC A;  1SL9 A;  2OTG C;  1S6J A;  3D10 A;  5J2O A;  4I5L B;  4PPK A;  2WSN A;  3DQC A;  2KGR A;  3JVT B;  4R6B A;  5DTY A;  2M0R A;  4GAO A;  1NSH A;  4RTC A;  3D73 A;  3U8C A;  1IH0 A;  2JAD A;  2AWJ A;  2BKH B;  4H3L A;  3D74 A;  2KBI A;  4NDC A;  3DQ2 A;  4AQJ A;  2OS8 B;  3AKB A;  1J1D A;  2L2C A;  5I2O A;  1FI5 A;  1BU3 A;  2GX2 A;  2H6V A;  3ED8 A;  1WRK A;  1M63 B;  1BJF A;  3E5W A;  5D7F A;  2OPO A;  3DQM A;  2L0P A;  2DUH A;  3WLC A;  2NXQ A;  4OJ0 A;  2BNX A;  4W6L A;  2A4J A;  3C1V A;  1K9P A;  3E5V A;  2L5X B;  4W6B A;  3GB3 A;  1B7T Z;  3L47 A;  3LF4 B;  2Q6P A;  1BOD A;  4GPL B;  1QWV A;  3DQJ A;  5AER A;  4W77 A;  3IF7 A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1GFL A;  3DQF A;  1MXL C;  1B9C A;  1Y1X A;  3A8S A;  1QY3 A;  3RM1 A;  3AAJ A;  1GL4 A;  1XA9 A;  2WOS A;  2DUF A;  4W7C A;  4IK1 A;  2NCO A;  2JU0 A;  1KWO C;  2BBM A;  1MR8 A;  2WCH A;  4DRW A;  3ST0 A;  1TWO A;  5EB7 A;  4W6R A;  1XFX O;  4OHS A;  3AI4 A;  2POX A;  2LM5 A;  2OTB A;  1QLS A;  1YZW A;  4JEO A;  1QXP A;  2OTE A;  4RYS A;  3LVA A;  1BMO A;  3RLZ A;  4JD9 A;  2QDI A;  1DGU A;  1XFU O;  4JRB A;  3NGV A;  1CM4 A;  4QJ3 B;  1SCV A;  5F6T A;  4PCW A;  2QLI A;  3DQ3 A;  1BR4 B;  1TNQ A;  4M2O A;  5BPJ A;  3SSL A;  2FWQ A;  1Y1U A;  4W69 A;  2E30 A;  1WLZ A;  1Q4E A;  4MZJ A;  1IQ5 A;  4EN1 A;  1DJW A;  5FVI A;  3EG5 B;  3UO9 A;  2QEH A;  2QEO A;  2WIS A;  3SVR A;  2IB5 A;  3I5F C;  2PVB A;  3NSK A;  3ZUL A;  2ZMW A;  2HPS A;  1U5I B;  3DF0 A;  1NCY A;  2IS9 A;  1Q73 A;  2BL0 B;  5ER4 X;  1DJH A;  2A46 A;  1IKU A;  4KW4 A;  1C7W A;  1S5G Z;  1XVJ A;  2WCF A;  2WSO A;  2G6E A;  3DQU A;  2LMT A;  2CNP A;  4OV2 A;  1NX3 A;  1XFV O;  3IR8 A;  2CXJ A;  3NSO A;  5J3X A;  5DPJ A;  2L2E A;  1VRK A;  3B86 A;  1SSE B;  4UTS A;  1PVA A;  1QAS A;  1OE9 B;  1K8U A;  2H61 A;  3OB1 B;  1YFP A;  3ZWH A;  2L5Y A;  1EME A;  1AUI B;  3DQ6 A;  2H5O A;  4Q9W A;  3PLF B;  4KF5 C;  2DDD A;  1KYP A;  3G9A A;  3AAK A;  4ANJ A;  1YUR A;  4KGE A;  1TRF A;  4DKN A;  1NUB A;  3PFV A;  1DJI A;  1IGV A;  1OOJ A;  1FI6 A;  4ETO A;  2KDH A;  2L98 A;  1EMF A;  1F0B A;  3DQH A;  1PAL A;  2WCB A;  2G16 B;  3BUX B;  1B8C A;  3VRN A;  4IJ7 A;  2K2A A;  1OMV A;  3SIA A;  2KYF A;  2HFC A;  1AHR A;  3ZTF A;  5TNC A;  3TS5 B;  3ST4 A;  1OZS A;  1PRW A;  4KEX A;  3VRR A;  4J88 A;  2LVK A;  4PE4 A;  3EK4 A;  1JF0 A;  4OGS A;  3SG4 A;  2A54 B;  2QLG A;  3SVB A;  2FCE A;  3GJ1 A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  2JXC A;  2LHI A;  3UG0 A;  1CDM A;  1F71 A;  1CFP A;  4YGD B;  3FIA A;  2V53 A;  2GV5 A;  2JRF A;  2G2S B;  1QX7 A;  4Q04 A;  3JVT C;  3OGN A;  4ORN A;  1MQ1 A;  2LAN A;  2LP3 A;  2DUE A;  4KAG A;  4HQ8 A;  5HZS A;  4PHM A;  1GGX A;  4OKH A;  1WDC B;  3M24 A;  4BY5 A;  2BTJ A;  2OS8 C;  3KCS A;  1N0Y A;  1S6C A;  3DQ1 A;  2GGZ A;  2PXW A;  2M7L A;  1Y0V H;  2HQK A;  1KWO B;  2M7N A;  1SCM C;  4KGF A;  4USL A;  2M8U A;  3SSK A;  3S0F A;  2AWL A;  2LHL A;  4PE0 A;  2Q91 A;  5HKW A;  4F0Z B;  4OY4 A;  4MBE A;  1QS7 A;  3SST A;  3CR4 X;  2HET A;  1C07 A;  1WY9 A;  1UUS A;  1NIW A;  2Y0G A;  1SL7 A;  3CB9 A;  5T3I A;  4GOB A;  4MZK A;  1R2U A;  4GGF A;  4HE4 A;  1QLK A;  2BEC A;  1CM1 A;  3CFH A;  5DRG A;  4DCK A;  3GL4 A;  5LK4 A;  4NWS A;  1S36 A;  2PQL A;  4EDO A;  4INW A;  4JWQ A;  3CYZ A;  1LVC D;  5DKQ A; 
#chains in the Genus database with same CATH homology
 4IK3 A;  1ZGP A;  3LLE A;  1J7R A;  1JF2 A;  2F2O A;  1SRA A;  3U0L A;  5CSF A;  1K9K A;  2M1U A;  1MOV A;  3WNX B;  1SR6 B;  2CTN A;  1TOP A;  2QLE A;  3U0N A;  3TDI A;  3PIB A;  3EKJ A;  3CTN A;  5CPV A;  4HQC A;  3VHT A;  2K7B A;  1UHI A;  3DQE A;  3OB2 B;  4EUL A;  1QV1 A;  2FZU A;  2NLN A;  5HGE A;  2K2F A;  2O29 A;  3ST2 A;  5HLO A;  1A03 A;  3SSP A;  1GQM A;  4TZA A;  3PJ5 A;  4NQG A;  4W7R A;  3CWG A;  2ZRS A;  1Q4C A;  2ZKM X;  2KYC A;  2QAC A;  4AQI A;  1CMG A;  3U8A A;  1M31 A;  3DD4 A;  3S05 A;  5ER5 A;  4PE7 A;  4WQ3 A;  5BTT B;  3I5I C;  3U0M A;  3GJ2 A;  1H6R A;  2O5G A;  1Y6W A;  1YHG A;  1ZUZ A;  2QU1 A;  2IB6 A;  5HZT A;  2F8P A;  3NSI A;  3SVU A;  2F33 A;  4NDB A;  1CLM A;  1DVI A;  4W6N A;  1EG3 A;  2JTZ A;  2P4M A;  2KOT A;  3SG7 A;  1KSO A;  1ZUX A;  4GGF C;  3OHM B;  3PN7 B;  2Q4U A;  4Z4M A;  5JJG A;  1QTX A;  1B8L A;  1N2D A;  3IQQ A;  1RMM A;  3TZ1 A;  2EC6 C;  1F70 A;  1CNP A;  4GES B;  1XK4 C;  2KFH A;  1B47 A;  4H3M A;  1CMF A;  1K90 D;  2TN4 A;  3ADF A;  1JFJ A;  2JWW A;  2LLS A;  2RGI A;  4W6O A;  4PHK A;  2ZFD A;  5BT0 A;  1ZGO A;  3K1K A;  1HUY A;  4JC2 A;  3VRQ A;  2B1U A;  4JQ0 D;  2A50 B;  4KA9 A;  3BX9 A;  2KI4 C;  3DQ8 A;  4J89 A;  3PJB A;  1F8H A;  1J7Q A;  2ZO7 A;  4DKM A;  3OGO A;  2A53 B;  2OJK A;  1XFW O;  2EGD A;  5H88 A;  1SPY A;  3WCK A;  4ZBL A;  1EMK A;  4D1E A;  5EXU A;  2LCP A;  3UFZ A;  3VIC A;  2JNX A;  1JBZ A;  1MOU A;  2FCD A;  2DD9 A;  3GOF A;  4LJD C;  2JC2 A;  1S1E A;  2KHN A;  3GK2 A;  3BUW B;  3DQ4 A;  3O78 A;  1RTP 1;  2ZRT A;  4W6F A;  3SJS A;  2IE2 A;  2OKW A;  2KI4 B;  3CLN A;  3BXA A;  1PVB A;  3CD9 A;  4M2Q A;  3I5H B;  2MBX A;  1RM9 A;  2M29 A;  2QT2 A;  3KHE A;  4ZFS A;  5HKZ A;  1JFK A;  5KTG A;  4KPI A;  2LP2 A;  3NEZ A;  3DQI A;  1IG5 A;  1JWD A;  3TMT A;  5DU0 A;  1K9U A;  3M22 A;  3EVU A;  4ORA B;  1R6P A;  3SVN A;  4OR9 B;  4ZIN A;  4Z4K A;  5KTY A;  1PSR A;  4KF5 A;  4LJD A;  2EC6 B;  3BOW A;  1ODB A;  1W7U A;  2YDZ A;  2QLG B;  1BOC A;  1D1O A;  3SG6 A;  2MLE C;  2O60 A;  1F54 A;  3MGF A;  2G9B A;  1A4P A;  2WC8 A;  3D0Y A;  2HQ8 A;  4W6S A;  1EJ3 A;  4W7E A;  2KQY A;  2WHS A;  2NZ0 A;  1CFD A;  5B8I B;  3OP0 A;  2H2K A;  2KGB C;  2H8Q A;  1KQV A;  5HZU A;  5AFP A;  4Q7R A;  2O2B A;  4HRG A;  2VZX A;  3DQN A;  1MXE A;  3OX6 A;  4N1G A;  3NF0 A;  1MUX A;  4GNK B;  4EMQ A;  4W74 A;  1BLQ A;  3SS0 A;  1SNL A;  2IOV A;  4W6M A;  1LA0 A;  2AWM A;  3KO0 A;  2KNE A;  3TMR A;  1YJF A;  1AVS A;  2I2R E;  4CFR A;  5AAN A;  4C0J A;  1J7P A;  1DMO A;  4BY4 A;  4AOM A;  4ZCV A;  4P1Q A;  1KK7 Y;  1EL4 A;  3A4U B;  2WHU A;  3SSH A;  3HX4 A;  1QYO A;  2L51 A;  3CS1 A;  1WDC C;  3AI5 A;  2BCA A;  1K94 A;  2JTT A;  4U8D A;  2K61 A;  3ST3 A;  1CB1 A;  1W7T A;  1IJ5 A;  4ICB A;  1B8R A;  3HCM A;  3E5T A;  3H4S E;  3LSA A;  5BQL A;  4P2Y B;  3DPZ A;  2HJO A;  5EJU A;  2G5Z B;  3I5G B;  2MLF C;  1L7Z A;  4W75 A;  1F09 A;  5DKN A;  1G8I A;  4HQ9 A;  5GQQ C;  2MA2 A;  3PN7 C;  1SBJ A;  1ZOT B;  4YBH B;  4XL5 A;  5HLV A;  3IQO A;  4M2P A;  2BBN A;  1DT7 B;  1NPQ A;  2L4H A;  2DD7 A;  4I5J A;  5DQM A;  3CGL A;  2KFG A;  3CD1 A;  3SVD A;  1FPW A;  4FTG A;  1XA5 A;  4PDZ A;  2HGD A;  3CR5 X;  1CDN A;  1BF5 A;  2COL B;  4ZF5 A;  4MRY A;  2SAS A;  5DTL A;  1UHK A;  1OXF A;  1KK8 B;  2Z6Y A;  3SIB A;  3DQ5 A;  2JXL A;  4PFE A;  3CZT X;  1PK0 D;  4YRU A;  3EVR A;  3PAT A;  5DPH A;  1M46 A;  5I2L A;  5LTR A;  1N65 A;  1KQM B;  1LKJ A;  3NED A;  2H5Q A;  2EMO A;  2DUG A;  4W6T A;  2I94 A;  3VGO A;  4W6H A;  5G08 A;  3WHU B;  1XK4 A;  3KCT A;  1JC1 A;  4J8A A;  5DPI A;  3BXC A;  1H4B A;  3VRP A;  2V4E A;  2A47 A;  2LVJ A;  2V4E B;  2VVI A;  2ZNE A;  4HVF A;  1X02 A;  1SYM A;  4MEW A;  4MSP A;  2JT0 A;  4KW8 A;  3CBE A;  1C7V A;  3SVE A;  3DVK A;  3LVD A;  3SRY A;  1K96 A;  3O4Y A;  3RWA A;  1KFX S;  1S26 D;  4XGY A;  4IK5 A;  4XJK B;  2K7D A;  3KF9 A;  2MHH A;  2L50 A;  2LVI A;  5H87 A;  1ALV A;  3I5H C;  5DKR A;  1H4U A;  3DVM A;  1OQP A;  1FW4 A;  2LUX A;  1DJZ A;  1SW8 A;  2F3Y A;  3DQA A;  3SSV A;  2WHT A;  3OSQ A;  3WLD A;  1K2H A;  1Q80 A;  2VRG A;  3IP2 A;  1TNW A;  1M39 A;  3LVC A;  5FHV A;  3BXB A;  2ZO6 A;  4MVF A;  2VVJ A;  1DTL A;  2A52 B;  4C0K A;  1S6I A;  3QRX A;  2NCP A;  1F55 A;  1XFZ O;  2YFP A;  4L13 A;  2FL1 A;  1B7T Y;  1BFP A;  1Y1A A;  4DS7 A;  2EMD A;  2QLH A;  4DXN A;  4ZB1 A;  3K21 A;  4W7X A;  4CFQ A;  4EDS A;  2ZN8 A;  2VVH A;  3DVE A;  3O77 A;  4DXP A;  3P28 A;  2JT8 A;  1YHH A;  1YVH A;  1HQV A;  3W1C A;  4H47 A;  4JF9 A;  2ZND A;  1EXR A;  1EMG A;  2HPW A;  2Y1N A;  4PHJ A;  3D0Y B;  1UHN A;  1XMZ A;  2KI6 D;  3LCP C;  1RRX A;  1NWD A;  4IK4 A;  4KF4 A;  1WRL A;  4CLN A;  1K93 D;  4W6K A;  1W7J B;  1KFU S;  4CID A;  4Q7T A;  2LUC A;  2F3Z A;  1QIW A;  5I2Q A;  1HT9 A;  2K7C A;  4CPV A;  2Y1M A;  2LLT A;  4OCI A;  1QV0 A;  4HRE E;  4DXI A;  4MRX A;  1FBV A;  3LK0 A;  3TUY B;  2HQW A;  2DOQ A;  2I7A A;  2R2I A;  5DRF A;  1YUS A;  3LF3 A;  2G6Y A;  4W7D A;  1ZGQ A;  2A48 A;  2JUL A;  4GFT A;  5BTT A;  5DQB A;  1MWN A;  1ZMZ A;  4UPG A;  3BUM B;  3PSR A;  3KPX A;  3U8P A;  1SR6 C;  2Y4Q A;  3CFA A;  5JOL A;  2Q57 A;  3DF0 B;  1V1G A;  3DQL A;  2CBL A;  2LC5 A;  1NX2 A;  5DTX A;  1YX8 A;  1J7O A;  3SVS A;  1BT6 A;  4R1E A;  3AKO A;  2C9J A;  1CDP A;  4GGN A;  1DJX A;  4W7F A;  3FS7 A;  4PAL A;  3NSL A;  5HZO A;  2BL0 C;  3SG3 A;  5F9G A;  3EVP A;  4YI9 A;  4IZN A;  3EVV A;  1L2O C;  5EXB A;  1TTX A;  2WUR A;  4JFG A;  4NDD A;  2B3Q A;  3M0W A;  4OQW A;  2PRU A;  2A56 B;  2QRF A;  4HRH A;  2OGR A;  2CT9 A;  2KAV A;  3I19 A;  3VHT B;  2PAL A;  1UWO A;  5I8N A;  3CFF A;  1TCO B;  3BXK A;  3KEV A;  4ZF3 A;  1BR1 B;  1IJ6 A;  4C0L A;  3ZUJ A;  3W1D A;  1GGZ A;  2KAY A;  5PAL A;  2VAE A;  4W6U A;  1CDL A;  1EMA A;  4N3D A;  2V4E C;  2Z6X A;  1B9A A;  2LV7 A;  2HCG A;  4DXM A;  3SVC A;  1ZAC A;  4DIR A;  1C4F A;  1KSM A;  4L9M A;  2ARL A;  2WND A;  3V3D A;  1KFU L;  1RJV A;  2GX0 A;  4PHN A;  2LVV A;  1OMD A;  1LIN A;  2JQ6 A;  3BOW B;  2GW4 B;  1EG4 A;  1DJY A;  2QPT A;  2H61 C;  2H5R A;  3I5G C;  3EK7 A;  3TDU A;  4XOV A;  3BUO B;  5LTP A;  1XQM A;  5K89 A;  1SCM B;  2DDC A;  3SG5 A;  5EB6 A;  2PSR A;  3NXA A;  4RYW A;  4AR7 A;  2Y5I A;  2KQ6 A;  4AS8 A;  3OX5 A;  4W6I A;  1ZFS A;  1AJ5 A;  1YUT A;  4N5X A;  1IQ3 A;  4JPZ B;  3GK1 A;  3BUN B;  3CR2 A;  1XAE A;  2WOR A;  1FF1 A;  2EMN A;  3SVO A;  4IK8 A;  2P6B B;  4P5O E;  1GJY A;  2AH8 A;  2O24 A;  4P76 A;  3AKA A;  1M45 A;  1TN4 A;  4N1F A;  1XSS A;  1JBY A;  1F4O A;  1JC2 A;  2JZI A;  4GBA A;  5KSZ A;  3GEX A;  1XYD A;  2LMU A;  5AQB B;  2VAD A;  1J1E A;  2M49 B;  2FJU B;  1KQM C;  1IWQ A;  1W7S A;  1WRZ A;  3DQ9 A;  5KU1 A;  4W6C A;  5D69 A;  1SKT A;  2HQZ A;  1U5I A;  2KBM A;  2AMI A;  4L1I A;  2MJW B;  1IRJ A;  1AP4 A;  1AJ4 A;  1RK9 A;  1EMC A;  2PMY A;  3GK4 X;  4XJK A;  1PSB A;  3DVJ A;  1OXE A;  2G3O A;  4B30 A;  1KYS A;  4DXQ A;  3RWT A;  1ALW A;  3PM8 A;  1KFX L;  3EK8 A;  2YE1 A;  3OSR A;  4WRI A;  2BCX A;  1NCZ A;  1DJG A;  3U0K A;  1NX1 A;  2LNK A;  4QJ5 B;  2HRS A;  4WQ2 A;  1UHJ A;  4XYN A;  4FQO A;  1OXD A;  2GGM A;  4R6D A;  3CGA A;  2L4I A;  4TNC A;  2JT3 A;  4W76 A;  1YX7 A;  4LQT A;  1DF0 B;  4DUQ A;  2AWK A;  3LS3 A;  3LL8 B;  2EHB A;  1SMG A;  2G6X A;  2HGY A;  4ORB B;  1SL8 A;  3I5F B;  1S3P A;  1Z1Q A;  1JSA A;  3TDZ A;  5AXI A;  5HBD A;  4Q7U A;  1CV7 A;  1V1F A;  2H5P A;  1RRO A;  2JOJ A;  1Q4A A;  5CSJ A;  4Q9X A;  4KW9 A;  4XVP A;  4YGB B;  4LJB A;  1J55 A;  4PE1 A;  5FYX A;  4YGC B;  1EMM A;  3SV5 A;  3LA1 A;  1MHO A;  1CFF A;  3DPX A;  2MRD A;  1KK8 C;  4W6P A;  1CKK A;  1QX2 A;  4DXO A;  2AHA A;  4ZF4 A;  1TIZ A;  1E8A A;  2B3P A;  1YRU B;  4H3N A;  1DF0 A;  2K7O A;  1NCX A;  2JPT A;  2ICR A;  4A4B A;  1A2X A;  4JGE A;  1Q4D A;  1TNX A;  2BE6 A;  1OMR A;  1QX5 B;  1CLB A;  1JUO A;  1RMO A;  2G3D B;  4I2Y A;  2I18 A;  1W7I B;  4B30 B;  1KYR A;  1NX0 A;  2C9I A;  4IL1 A;  4L12 A;  1NP8 A;  3DPW A;  3P8U A;  1TCF A;  1G7K A;  3O6B A;  5H89 A;  4OVN F;  1RWY A;  5DY6 A;  2LMV A;  2SCP A;  1EH2 A;  2H9W A;  5LTQ A;  3TS5 C;  3H1R A;  1CTR A;  2G2B A;  4IK9 A;  1YVL A;  1A29 A;  3ZNI A;  3NT9 A;  3LK1 A;  1SY9 A;  1YRT B;  3DQK A;  3VRO A;  1F4Q A;  4I5K A;  2Z6Z A;  2KI6 C;  4ORC B;  2OTG B;  4GUK A;  1YJ2 A;  3MSE B;  3ZUF A;  2F2P A;  1JC0 A;  4LW5 A;  3FWB A;  3PJ7 A;  4MLW A;  3PAL A;  4H48 A;  3EKH A;  1TNP A;  1AK8 A;  1GGW A;  1UHH A;  5CSN A;  4MZL A;  1XFY O;  3WXA A;  2ZMU A;  1YUU A;  1Z1P A;  3JTD C;  1B4C A;  4I5N B;  4YGE B;  2M9G A;  3TUY C;  1UP5 A;  1YHI A;  5DPG A;  1EMB A;  1KK7 Z;  4PPJ A;  3VK1 A;  1XO5 A;  2BE4 A;  1KP5 A;  1LXF C;  3SG2 A;  3A8R A;  1A75 B;  3FWC A;  4HSZ A;  2FOT A;  1CFC A;  4W6A A;  1MYW A;  1KCY A;  5FVG A;  4W6D A;  2WCE A;  2DUI A;  4TZG A;  1RMP A;  1REC A;  5FVF A;  1Q4B A;  3H1O A;  4B5Y A;  4YGA A;  2PXS A;  2BKI B;  3I5I B;  2M97 A;  4GF6 B;  2JNF A;  1MF8 B;  2ZN9 A;  3BQ3 A;  2K8M B;  3DQ7 A;  3SSY A;  4YI8 A;  1K95 A;  4XOW A;  1OZO A;  3DQD A;  4MN0 A;  4QJ4 B;  2M1K B;  2QZ0 A;  1OSA A;  1YTZ C;  3JTD B;  4W6J A;  4ZCU A;  1UUR A;  1DGV A;  1QVI Y;  2PAS A;  1BG1 A;  3NT3 A;  5EHU A;  5CSI A;  2M3W A;  3BYA A;  3E3R A;  2LE9 B;  4A4C A;  4W6G A;  1WLM A;  5HYD A;  1NYA A;  3WHT B;  3F45 A;  2KSP A;  2LLU A;  2WIQ A;  1QIV A;  1QYF A;  2AUC A;  1UIS A;  4LQU A;  4W72 A;  2HF5 A;  2OKY A;  5HW9 A;  1YR5 A;  1PUL A;  5EBJ A;  1S6Z A;  1QAT A;  4BDU A;  1G33 A;  1EML A;  5IBW A;  1SK6 D;  2BCB A;  1JBA A;  5HKY A;  1HCJ A;  2YE0 A;  4PPL A;  3ICB A;  5DTZ A;  1QYQ A;  1H8B A;  4E68 A;  2AAO A;  2Z1O A;  1QXT A;  1LA3 A;  2K0J A;  2MAZ A;  2E6W A;  1CLL A;  4W73 A;  4U2V A;  1A75 A;  2GW3 A;  4ZIO A;  2KFF A;  3DQO A;  2LAP A;  1QVI Z;  1RFJ A;  1B1G A;  3O2P A;  2D8N A;  2RH7 A;  4W7A A;  5EXC I;  4LJC A;  1SL9 A;  2OTG C;  1S6J A;  3D10 A;  5J2O A;  4I5L B;  4PPK A;  2WSN A;  3DQC A;  2KGR A;  3JVT B;  4R6B A;  5DTY A;  2M0R A;  4GAO A;  1NSH A;  4RTC A;  3U8C A;  1IH0 A;  2JAD A;  2AWJ A;  2BKH B;  4H3L A;  2KBI A;  4NDC A;  3DQ2 A;  4AQJ A;  2OS8 B;  3AKB A;  1J1D A;  5I2O A;  1FI5 A;  1BU3 A;  2GX2 A;  2H6V A;  3ED8 A;  1WRK A;  1M63 B;  1BJF A;  3E5W A;  5D7F A;  2OPO A;  3DQM A;  2L0P A;  2DUH A;  3WLC A;  2NXQ A;  4OJ0 A;  4W6L A;  2A4J A;  3C1V A;  1K9P A;  3E5V A;  2L5X B;  4W6B A;  3GB3 A;  1B7T Z;  3LF4 B;  1BOD A;  2Q6P A;  4GPL B;  3DQJ A;  5AER A;  4W77 A;  3IF7 A;  1QJT A;  1S5G Y;  1G4Y R;  2CCM A;  1GFL A;  3DQF A;  1MXL C;  1B9C A;  1Y1X A;  3A8S A;  1QY3 A;  3RM1 A;  3AAJ A;  1GL4 A;  1XA9 A;  2WOS A;  2DUF A;  4W7C A;  4IK1 A;  2NCO A;  2JU0 A;  1KWO C;  2BBM A;  1MR8 A;  4DRW A;  3ST0 A;  5EB7 A;  4W6R A;  1XFX O;  4OHS A;  3AI4 A;  2POX A;  2LM5 A;  2OTB A;  1QLS A;  1YZW A;  4JEO A;  1QXP A;  2OTE A;  4RYS A;  3LVA A;  1BMO A;  3RLZ A;  1DGU A;  1XFU O;  4JRB A;  1CM4 A;  4QJ3 B;  1SCV A;  5F6T A;  4PCW A;  2QLI A;  3DQ3 A;  1BR4 B;  1TNQ A;  4M2O A;  5BPJ A;  3SSL A;  2FWQ A;  1Y1U A;  4W69 A;  2E30 A;  1WLZ A;  1Q4E A;  4MZJ A;  1IQ5 A;  4EN1 A;  1DJW A;  5FVI A;  2WIS A;  3SVR A;  2IB5 A;  3I5F C;  2PVB A;  3NSK A;  3ZUL A;  2ZMW A;  2HPS A;  1U5I B;  3DF0 A;  1NCY A;  2IS9 A;  1Q73 A;  2BL0 B;  5ER4 X;  1DJH A;  2A46 A;  1IKU A;  4KW4 A;  1C7W A;  1S5G Z;  1XVJ A;  2WCF A;  2WSO A;  2G6E A;  3DQU A;  2LMT A;  2CNP A;  4OV2 A;  1NX3 A;  1XFV O;  3IR8 A;  2CXJ A;  3NSO A;  5J3X A;  5DPJ A;  2L2E A;  1VRK A;  4UTS A;  1PVA A;  1QAS A;  1OE9 B;  1K8U A;  2H61 A;  3OB1 B;  1YFP A;  3ZWH A;  1EME A;  1AUI B;  3DQ6 A;  2H5O A;  4Q9W A;  3PLF B;  4KF5 C;  2DDD A;  1KYP A;  3G9A A;  3AAK A;  4ANJ A;  1YUR A;  4KGE A;  1TRF A;  4DKN A;  1NUB A;  3PFV A;  1DJI A;  1IGV A;  1OOJ A;  1FI6 A;  4ETO A;  2KDH A;  2L98 A;  1EMF A;  1F0B A;  3DQH A;  1PAL A;  2WCB A;  2G16 B;  3BUX B;  1B8C A;  3VRN A;  2K2A A;  1OMV A;  3SIA A;  2KYF A;  2HFC A;  1AHR A;  3ZTF A;  5TNC A;  3TS5 B;  3ST4 A;  1OZS A;  1PRW A;  4KEX A;  3VRR A;  4J88 A;  2LVK A;  4PE4 A;  3EK4 A;  1JF0 A;  4OGS A;  3SG4 A;  2A54 B;  2QLG A;  3SVB A;  2FCE A;  3GJ1 A;  1L2O B;  2KAX A;  5AEQ A;  2ISD A;  2JXC A;  2LHI A;  3UG0 A;  1CDM A;  1F71 A;  1CFP A;  4YGD B;  3FIA A;  2V53 A;  2GV5 A;  2JRF A;  2G2S B;  1QX7 A;  4Q04 A;  3JVT C;  4ORN A;  1MQ1 A;  2LAN A;  2LP3 A;  2DUE A;  4KAG A;  4HQ8 A;  5HZS A;  4PHM A;  1GGX A;  4OKH A;  1WDC B;  3M24 A;  4BY5 A;  2BTJ A;  2OS8 C;  3KCS A;  1N0Y A;  1S6C A;  3DQ1 A;  2GGZ A;  2PXW A;  2M7L A;  1Y0V H;  2HQK A;  1KWO B;  2M7N A;  1SCM C;  4KGF A;  4USL A;  2M8U A;  3SSK A;  2AWL A;  2LHL A;  4PE0 A;  2Q91 A;  5HKW A;  4F0Z B;  4OY4 A;  4MBE A;  1QS7 A;  3SST A;  3CR4 X;  2HET A;  1C07 A;  1WY9 A;  1UUS A;  1NIW A;  2Y0G A;  1SL7 A;  3CB9 A;  5T3I A;  4GOB A;  4MZK A;  1R2U A;  4GGF A;  4HE4 A;  1QLK A;  2BEC A;  1CM1 A;  3CFH A;  5DRG A;  4DCK A;  3GL4 A;  5LK4 A;  4NWS A;  1S36 A;  4EDO A;  4JWQ A;  1LVC D;  5DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...