4W6HA

Crystal structure of full-length split gfp mutant d190c disulfide dimer, p 65 space group
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
225
structure length
224
Chain Sequence
KGEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQAFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGCGPVDLPDDHYLSTQTILSKDLNEKRDHMVLLEYVTAAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein D190C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 62
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w6hA00
5BQLA 2DUFA 4P1QA 3BXCA 3NT9A 4W6JA 5FHVA 2O2BA 3GB3A 2AWJA 3DQ1A 2H5QA 4PPLA 3UFZA 3AI5A 5DPIA 4IK4A 1ZUXA 2WURA 2QLGB 2OTEA 1QYQA 3OSRA 1KP5A 5DRGA 5EXUA 4ZINA 4B30A 2G2SB 4JF9A 4W69A 5HZOA 1MYWA 4PPKA 3DQ8A 2H9WA 2IB5A 4KA9A 4XVPA 4OQWA 2IE2A 3SSKA 3KCSA 2VVIA 2HRSA 4EMQA 4W6DA 5DTYA 1Z1PA 5LTRA 5KTGA 4PPJA 1RRXA 3ED8A 5HZSA 4W7CA 2HQKA 2G6YA 2H5OA 3K1KA 4L13A 4DXQA 5BT0A 3SG2A 3RWAA 4ZF3A 4Q7UA 2V4EA 4KF4A 5DPJA 2YFPA 2QLHA 4HQ9A 5HZUA 2HGDA 2H6VA 1Q4EA 3GJ1A 4Z4MA 3ST4A 5FVIA 2H8QA 2FWQA 3WLDA 4JEOA 1EMAA 4KW4A 4LJDA 4B30B 4EDSA 4W6AA 4ZBLA 4W76A 1F09A 4N3DA 3DQNA 5EXBA 2G16B 3CGLA 2A46A 4W6GA 4H47A 3DQJA 2AWMA 3H1OA 4W6UA 5H87A 1YHIA 1KYRA 4W6PA 3ZUFA 4HE4A 1BFPA 3DQ2A 2QRFA 2Q57A 3W1DA 1HCJA 3SSYA 1W7SA 2YDZA 3S05A 3SV5A 2V4EB 3BXBA 1KYPA 2WIQA 2B3QA 3SG3A 3E5WA 1GFLA 2AWLA 4W7AA 3EVUA 3DQEA 3GJ2A 1QYFA 3SVEA 3CD9A 3EVRA 4L1IA 5HGEA 1Q73A 2G6EA 4W6OA 4W7EA 3DQDA 2POXA 3E5TA 4IK5A 5EB7A 1Q4AA 2ZMWA 4H3LA 3WCKA 3SVOA 5BTTA 1G7KA 4Q7RA 3LVAA 5HZTA 4W74A 4DXNA 3TMRA 3SVBA 3SSTA 1QY3A 3ZULA 3DQ6A 2JADA 2DDDA 4W75A 3U8AA 2WHSA 3O77A 5LTPA 5DPGA 1YHHA 5DU0A 2P4MA 1OXEA 2C9IA 2HCGA 4OGSA 1JC0A 1Q4BA 3DQ4A 4TZAA 4DKMA 3SVUA 2FZUA 1ZGQA 5EXCI 2OGRA 3ST0A 2A53B 1KYSA 4W6RA 3IP2A 2Q6PA 1MOUA 3NEDA 2G3OA 2A52B 4ORNA 3SG4A 3DQOA 4Z4KA 2OJKA 2OTBA 1GL4A 3SSLA 2WHTA 2ZMUA 4LQUA 4W6FA 3EVVA 4OHSA 5BTTB 2VADA 2WHUA 4OY4A 3V3DA 4IK3A 4W6SA 4KF5A 2ZO7A 3P8UA 3ADFA 4KPIA 3ZTFA 2DUHA 2WSNA 2QU1A 1H4UA 3U0MA 4GESB 1EMFA 2BTJA 4GF6B 4B5YA 3DQ9A 4J88A 4ZF4A 3H1RA 5EBJA 4JC2A 3U0NA 4W73A 3LVCA 3CBEA 5HW9A 3DQ5A 4ZFSA 1YFPA 3SS0A 4JGEA 4GOBA 1YHGA 3DQIA 2YE0A 4IK9A 4DXPA 2AWKA 4HVFA 3NEZA 3BX9A 2QLIA 2G5ZB 3A8SA 3PIBA 4W6NA 1B9CA 3DQHA 3DQ3A 4W6MA 3W1CA 3LVDA 4LJCA 3EK7A 1GGXA 3DPZA 4DXOA 2HFCA 1XA9A 1YJFA 3CB9A 4W77A 1XAEA 4L12A 2IOVA 4HQCA 4W6BA 3ZUJA 2IB6A 4KEXA 3SSPA 1XMZA 3WLCA 3DQUA 3OSQA 3PJBA 2Z6ZA 1HUYA 4EN1A 3MGFA 2VAEA 5LTQA 3DQ7A 1XQMA 5H89A 3CD1A 5EHUA 1F0BA 2O24A 4ZB1A 3SVRA 4W6HA 2GW3A 4J8AA 3EVPA 4PFEA 5T3IA 2YE1A 1MOVA 1OXFA 2A50B 2DD9A 4XL5A 1EMBA 4KAGA 1QYOA 2G3DB 4ANJA 2WSOA 3CFHA 4IZNA 2VVHA 2G6XA 1CV7A 2HPWA 4TZGA 2V4EC 2DUIA 3LF4B 4RYWA 3PJ5A 1EMEA 5DTLA 3LS3A 1EMLA 4LW5A 2A54B 3SG5A 5DTXA 1EMMA 2B3PA 3IR8A 3SSHA 4BDUA 1H6RA 3EKHA 1Q4CA 4DKNA 4LJDC 4XOWA 4H3NA 1Z1QA 4DXIA 3SG7A 4AS8A 2DD7A 4HQ8A 4DXMA 5FVFA 3U0KA 3AKOA 2H5RA 2HQZA 2AH8A 3CFFA 3I19A 2QZ0A 5FVGA 2PXSA 4KW8A 1UISA 5J2OA 1YZWA 3KCTA 2DDCA 3LA1A 2ZO6A 1RMPA 4I2YA 4P76A 5DY6A 4W6TA 3VHTA 3ST2A 2FL1A 2AHAA 4R6DA 2QLEA 2OKWA 1ZGPA 3U8PA 3P28A 3EKJA 3DQAA 4JFGA 3DQFA 5LK4A 4KW9A 5DRFA 4W6KA 4OJ0A 1W7TA 3NF0A 3M22A 1QXTA 4AR7A 2DUEA 5H88A 3OGOA 3GL4A 1RM9A 4W7XA 1YJ2A 2O29A 4ZIOA 2Z6XA 5EB6A 1S6ZA 3SG6A 1JC1A 3SVNA 3GEXA 3LF3A 4Q9WA 4RTCA 2Y0GA 2Z6YA 5F9GA 3UG0A 2A48A 3VHTB 3G9AA 1EMGA 1JBYA 3AI4A 3U8CA 4NWSA 5DQBA 3DQCA 2VVJA 4JRBA 4W6IA 1XSSA 4XGYA 5HBDA 3DQLA 2C9JA 3SSVA 1OXDA 2Z1OA 4EDOA 4H3MA 4U2VA 1EMCA 3SVCA 5DQMA 4W7RA 3DQMA 1W7UA 2HJOA 4KGFA 4W6LA 3E5VA 3SVSA 4R6BA 2GW4B 5DTZA 2QT2A 4W72A 1RMOA 4Q7TA 2GX2A 2PXWA 4UTSA 2HGYA 2RH7A 2WISA 4Q9XA 3CFAA 2VZXA 3VK1A 3U0LA 2H5PA 2DUGA 4KF5C 3NT3A 2GX0A 3EK8A 3O78A 1ZGOA 1RMMA 3RWTA 2EMOA 2ICRA 4RYSA 3VICA 3BXAA 3LSAA 4EULA 3TMTA 5DPHA 1JBZA 4XOVA 3SVDA 4W7DA 5EJUA 2QLGA 1Q4DA 4H48A 2OKYA 3SRYA 4W6CA 3DPWA 4J89A 1C4FA 4W7FA 2A47A 2ARLA 2EMDA 4ZF5A 3PJ7A 4LJBA 3DQKA 3ST3A 4IK1A 2A56B 2EMNA 3EK4A 3M24A 3DPXA 4IK8A 4KGEA 4LQTA 1EMKA 5AQBB
chains in the Genus database with same CATH superfamily
5BQLA 2DUFA 4P1QA 3BXCA 3NT9A 4W6JA 5FHVA 2O2BA 3GB3A 2AWJA 3DQ1A 2H5QA 4PPLA 3UFZA 3AI5A 5DPIA 4IK4A 1ZUXA 2WURA 2QLGB 2OTEA 1QYQA 3OSRA 1KP5A 5DRGA 5EXUA 4ZINA 4B30A 2G2SB 4JF9A 4W69A 5HZOA 1MYWA 4PPKA 3DQ8A 2H9WA 2IB5A 4KA9A 4XVPA 4OQWA 2IE2A 3SSKA 3KCSA 2VVIA 2HRSA 4EMQA 4W6DA 5DTYA 1Z1PA 5LTRA 5KTGA 4PPJA 1RRXA 3ED8A 5HZSA 4W7CA 2HQKA 2G6YA 2H5OA 3K1KA 4L13A 4DXQA 5BT0A 3SG2A 3RWAA 4ZF3A 4Q7UA 2V4EA 4KF4A 5DPJA 2YFPA 2QLHA 4HQ9A 5HZUA 2HGDA 2H6VA 1Q4EA 3GJ1A 4Z4MA 3ST4A 5FVIA 2H8QA 2FWQA 3WLDA 4JEOA 1EMAA 4KW4A 4LJDA 4B30B 4EDSA 4W6AA 4ZBLA 4W76A 1F09A 4N3DA 3DQNA 5EXBA 2G16B 3CGLA 2A46A 4W6GA 4H47A 3DQJA 2AWMA 3H1OA 4W6UA 5H87A 1YHIA 1KYRA 4W6PA 3ZUFA 4HE4A 1BFPA 3DQ2A 2QRFA 2Q57A 3W1DA 1HCJA 3SSYA 1W7SA 2YDZA 3S05A 3SV5A 2V4EB 3BXBA 1KYPA 2WIQA 2B3QA 3SG3A 3E5WA 1GFLA 2AWLA 4W7AA 3EVUA 3DQEA 3GJ2A 1QYFA 3SVEA 3CD9A 3EVRA 4L1IA 5HGEA 1Q73A 2G6EA 4W6OA 4W7EA 3DQDA 2POXA 3E5TA 4IK5A 5EB7A 1Q4AA 2ZMWA 4H3LA 3WCKA 3SVOA 5BTTA 1G7KA 4Q7RA 3LVAA 5HZTA 4W74A 4DXNA 3TMRA 3SVBA 3SSTA 1QY3A 3ZULA 3DQ6A 2JADA 2DDDA 4W75A 3U8AA 2WHSA 3O77A 5LTPA 5DPGA 1YHHA 5DU0A 2P4MA 1OXEA 2C9IA 2HCGA 4OGSA 1JC0A 1Q4BA 3DQ4A 4TZAA 4DKMA 3SVUA 2FZUA 1ZGQA 5EXCI 2OGRA 3ST0A 2A53B 1KYSA 4W6RA 3IP2A 2Q6PA 1MOUA 3NEDA 2G3OA 2A52B 4ORNA 3SG4A 3DQOA 4Z4KA 2OJKA 2OTBA 1GL4A 3SSLA 2WHTA 2ZMUA 4LQUA 4W6FA 3EVVA 4OHSA 5BTTB 2VADA 2WHUA 4OY4A 3V3DA 4IK3A 4W6SA 4KF5A 2ZO7A 3P8UA 3ADFA 4KPIA 3ZTFA 2DUHA 2WSNA 2QU1A 1H4UA 3U0MA 4GESB 1EMFA 2BTJA 4GF6B 4B5YA 3DQ9A 4J88A 4ZF4A 3H1RA 5EBJA 4JC2A 3U0NA 4W73A 3LVCA 3CBEA 5HW9A 3DQ5A 4ZFSA 1YFPA 3SS0A 4JGEA 4GOBA 1YHGA 3DQIA 2YE0A 4IK9A 4DXPA 2AWKA 4HVFA 3NEZA 3BX9A 2QLIA 2G5ZB 3A8SA 3PIBA 4W6NA 1B9CA 3DQHA 3DQ3A 4W6MA 3W1CA 3LVDA 4LJCA 3EK7A 1GGXA 3DPZA 4DXOA 2HFCA 1XA9A 1YJFA 3CB9A 4W77A 1XAEA 4L12A 2IOVA 4HQCA 4W6BA 3ZUJA 2IB6A 4KEXA 3SSPA 1XMZA 3WLCA 3DQUA 3OSQA 3PJBA 2Z6ZA 1HUYA 4EN1A 3MGFA 2VAEA 5LTQA 3DQ7A 1XQMA 5H89A 3CD1A 5EHUA 1F0BA 2O24A 4ZB1A 3SVRA 4W6HA 2GW3A 4J8AA 3EVPA 4PFEA 5T3IA 2YE1A 1MOVA 1OXFA 2A50B 2DD9A 4XL5A 1EMBA 4KAGA 1QYOA 2G3DB 4ANJA 2WSOA 3CFHA 4IZNA 2VVHA 2G6XA 1CV7A 2HPWA 4TZGA 2V4EC 2DUIA 3LF4B 4RYWA 3PJ5A 1EMEA 5DTLA 3LS3A 1EMLA 4LW5A 2A54B 3SG5A 5DTXA 1EMMA 2B3PA 3IR8A 3SSHA 4BDUA 1H6RA 3EKHA 1Q4CA 4DKNA 4LJDC 4XOWA 4H3NA 1Z1QA 4DXIA 3SG7A 4AS8A 2DD7A 4HQ8A 4DXMA 5FVFA 3U0KA 3AKOA 2H5RA 2HQZA 2AH8A 3CFFA 3I19A 2QZ0A 5FVGA 2PXSA 4KW8A 1UISA 5J2OA 1YZWA 3KCTA 2DDCA 3LA1A 2ZO6A 1RMPA 4I2YA 4P76A 5DY6A 4W6TA 3VHTA 3ST2A 2FL1A 2AHAA 4R6DA 2QLEA 2OKWA 1ZGPA 3U8PA 3P28A 3EKJA 3DQAA 4JFGA 3DQFA 5LK4A 4KW9A 5DRFA 4W6KA 4OJ0A 1W7TA 3NF0A 3M22A 1QXTA 4AR7A 2DUEA 5H88A 3OGOA 3GL4A 1RM9A 4W7XA 1YJ2A 2O29A 4ZIOA 2Z6XA 5EB6A 1S6ZA 3SG6A 1JC1A 3SVNA 3GEXA 3LF3A 4Q9WA 4RTCA 2Y0GA 2Z6YA 5F9GA 3UG0A 2A48A 3VHTB 3G9AA 1EMGA 1JBYA 3AI4A 3U8CA 4NWSA 5DQBA 3DQCA 2VVJA 4JRBA 4W6IA 1XSSA 4XGYA 5HBDA 3DQLA 2C9JA 3SSVA 1OXDA 2Z1OA 4EDOA 4H3MA 4U2VA 1EMCA 3SVCA 5DQMA 4W7RA 3DQMA 1W7UA 2HJOA 4KGFA 4W6LA 3E5VA 3SVSA 4R6BA 2GW4B 5DTZA 2QT2A 4W72A 1RMOA 4Q7TA 2GX2A 2PXWA 4UTSA 2HGYA 2RH7A 2WISA 4Q9XA 3CFAA 2VZXA 3VK1A 3U0LA 2H5PA 2DUGA 4KF5C 3NT3A 2GX0A 3EK8A 3O78A 1ZGOA 1RMMA 3RWTA 2EMOA 2ICRA 4RYSA 3VICA 3BXAA 3LSAA 4EULA 3TMTA 5DPHA 1JBZA 4XOVA 3SVDA 4W7DA 5EJUA 2QLGA 1Q4DA 4H48A 2OKYA 3SRYA 4W6CA 3DPWA 4J89A 1C4FA 4W7FA 2A47A 2ARLA 2EMDA 4ZF5A 3PJ7A 4LJBA 3DQKA 3ST3A 4IK1A 2A56B 2EMNA 3EK4A 3M24A 3DPXA 4IK8A 4KGEA 4LQTA 1EMKA 5AQBB
chains in the Genus database with same CATH topology
5BQLA 2DUFA 4P1QA 3BXCA 3NT9A 4W6JA 5FHVA 2O2BA 3GB3A 2AWJA 3DQ1A 2H5QA 4PPLA 3UFZA 3AI5A 5DPIA 4IK4A 1ZUXA 2WURA 2QLGB 2OTEA 1QYQA 3OSRA 1KP5A 5DRGA 5EXUA 4ZINA 4B30A 2G2SB 4JF9A 4W69A 5HZOA 1MYWA 4PPKA 3DQ8A 2H9WA 2IB5A 4KA9A 4XVPA 4OQWA 2IE2A 3SSKA 3KCSA 2VVIA 2HRSA 4EMQA 4W6DA 5DTYA 1Z1PA 5LTRA 5KTGA 4PPJA 1RRXA 3ED8A 5HZSA 4W7CA 2HQKA 2G6YA 2H5OA 3K1KA 4L13A 4DXQA 5BT0A 3SG2A 3RWAA 4ZF3A 4Q7UA 2V4EA 4KF4A 5DPJA 2YFPA 2QLHA 4HQ9A 5HZUA 2HGDA 2H6VA 1Q4EA 3GJ1A 4Z4MA 3ST4A 5FVIA 2H8QA 2FWQA 3WLDA 4JEOA 1EMAA 4KW4A 4LJDA 4B30B 4EDSA 4W6AA 4ZBLA 4W76A 1F09A 4N3DA 3DQNA 5EXBA 2G16B 3CGLA 2A46A 4W6GA 4H47A 3DQJA 2AWMA 3H1OA 4W6UA 5H87A 1YHIA 1KYRA 4W6PA 3ZUFA 4HE4A 1BFPA 3DQ2A 2QRFA 2Q57A 3W1DA 1HCJA 3SSYA 1W7SA 2YDZA 3S05A 3SV5A 2V4EB 3BXBA 1KYPA 2WIQA 2B3QA 3SG3A 3E5WA 1GFLA 2AWLA 4W7AA 3EVUA 3DQEA 3GJ2A 1QYFA 3SVEA 3CD9A 3EVRA 4L1IA 5HGEA 1Q73A 2G6EA 4W6OA 4W7EA 3DQDA 2POXA 3E5TA 4IK5A 5EB7A 1Q4AA 2ZMWA 4H3LA 3WCKA 3SVOA 5BTTA 1G7KA 4Q7RA 3LVAA 5HZTA 4W74A 4DXNA 3TMRA 3SVBA 3SSTA 1QY3A 3ZULA 3DQ6A 2JADA 2DDDA 4W75A 3U8AA 2WHSA 3O77A 5LTPA 5DPGA 1YHHA 5DU0A 2P4MA 1OXEA 2C9IA 2HCGA 4OGSA 1JC0A 1Q4BA 3DQ4A 4TZAA 4DKMA 3SVUA 2FZUA 1ZGQA 5EXCI 2OGRA 3ST0A 2A53B 1KYSA 4W6RA 3IP2A 2Q6PA 1MOUA 3NEDA 2G3OA 2A52B 4ORNA 3SG4A 3DQOA 4Z4KA 2OJKA 2OTBA 1GL4A 3SSLA 2WHTA 2ZMUA 4LQUA 4W6FA 3EVVA 4OHSA 5BTTB 2VADA 2WHUA 4OY4A 3V3DA 4IK3A 4W6SA 4KF5A 2ZO7A 3P8UA 3ADFA 4KPIA 3ZTFA 2DUHA 2WSNA 2QU1A 1H4UA 3U0MA 4GESB 1EMFA 2BTJA 4GF6B 4B5YA 3DQ9A 4J88A 4ZF4A 3H1RA 5EBJA 4JC2A 3U0NA 4W73A 3LVCA 3CBEA 5HW9A 3DQ5A 4ZFSA 1YFPA 3SS0A 4JGEA 4GOBA 1YHGA 3DQIA 2YE0A 4IK9A 4DXPA 2AWKA 4HVFA 3NEZA 3BX9A 2QLIA 2G5ZB 3A8SA 3PIBA 4W6NA 1B9CA 3DQHA 3DQ3A 4W6MA 3W1CA 3LVDA 4LJCA 3EK7A 1GGXA 3DPZA 4DXOA 2HFCA 1XA9A 1YJFA 3CB9A 4W77A 1XAEA 4L12A 2IOVA 4HQCA 4W6BA 3ZUJA 2IB6A 4KEXA 3SSPA 1XMZA 3WLCA 3DQUA 3OSQA 3PJBA 2Z6ZA 1HUYA 4EN1A 3MGFA 2VAEA 5LTQA 3DQ7A 1XQMA 5H89A 3CD1A 5EHUA 1F0BA 2O24A 4ZB1A 3SVRA 4W6HA 2GW3A 4J8AA 3EVPA 4PFEA 5T3IA 2YE1A 1MOVA 1OXFA 2A50B 2DD9A 4XL5A 1EMBA 4KAGA 1QYOA 2G3DB 4ANJA 2WSOA 3CFHA 4IZNA 2VVHA 2G6XA 1CV7A 2HPWA 4TZGA 2V4EC 2DUIA 3LF4B 4RYWA 3PJ5A 1EMEA 5DTLA 3LS3A 1EMLA 4LW5A 2A54B 3SG5A 5DTXA 1EMMA 2B3PA 3IR8A 3SSHA 4BDUA 1H6RA 3EKHA 1Q4CA 4DKNA 4LJDC 4XOWA 4H3NA 1Z1QA 4DXIA 3SG7A 4AS8A 2DD7A 4HQ8A 4DXMA 5FVFA 3U0KA 3AKOA 2H5RA 2HQZA 2AH8A 3CFFA 3I19A 2QZ0A 5FVGA 2PXSA 4KW8A 1UISA 5J2OA 1YZWA 3KCTA 2DDCA 3LA1A 2ZO6A 1RMPA 4I2YA 4P76A 5DY6A 4W6TA 3VHTA 3ST2A 2FL1A 2AHAA 4R6DA 2QLEA 2OKWA 1ZGPA 3U8PA 3P28A 3EKJA 3DQAA 4JFGA 3DQFA 5LK4A 4KW9A 5DRFA 4W6KA 4OJ0A 1W7TA 3NF0A 3M22A 1QXTA 4AR7A 2DUEA 5H88A 3OGOA 3GL4A 1RM9A 4W7XA 1YJ2A 2O29A 4ZIOA 2Z6XA 5EB6A 1S6ZA 3SG6A 1JC1A 3SVNA 3GEXA 3LF3A 4Q9WA 4RTCA 2Y0GA 2Z6YA 5F9GA 3UG0A 2A48A 3VHTB 3G9AA 1EMGA 1JBYA 3AI4A 3U8CA 4NWSA 5DQBA 3DQCA 2VVJA 4JRBA 4W6IA 1XSSA 4XGYA 5HBDA 3DQLA 2C9JA 3SSVA 1OXDA 2Z1OA 4EDOA 4H3MA 4U2VA 1EMCA 3SVCA 5DQMA 4W7RA 3DQMA 1W7UA 2HJOA 4KGFA 4W6LA 3E5VA 3SVSA 4R6BA 2GW4B 5DTZA 2QT2A 4W72A 1RMOA 4Q7TA 2GX2A 2PXWA 4UTSA 2HGYA 2RH7A 2WISA 4Q9XA 3CFAA 2VZXA 3VK1A 3U0LA 2H5PA 2DUGA 4KF5C 3NT3A 2GX0A 3EK8A 3O78A 1ZGOA 1RMMA 3RWTA 2EMOA 2ICRA 4RYSA 3VICA 3BXAA 3LSAA 4EULA 3TMTA 5DPHA 1JBZA 4XOVA 3SVDA 4W7DA 5EJUA 2QLGA 1Q4DA 4H48A 2OKYA 3SRYA 4W6CA 3DPWA 4J89A 1C4FA 4W7FA 2A47A 2ARLA 2EMDA 4ZF5A 3PJ7A 4LJBA 3DQKA 3ST3A 4IK1A 2A56B 2EMNA 3EK4A 3M24A 3DPXA 4IK8A 4KGEA 4LQTA 1EMKA 5AQBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQL A;  2DUF A;  4P1Q A;  3BXC A;  3NT9 A;  4W6J A;  5FHV A;  2O2B A;  3GB3 A;  2AWJ A;  3DQ1 A;  2H5Q A;  4PPL A;  3UFZ A;  3AI5 A;  5DPI A;  4IK4 A;  1ZUX A;  2WUR A;  2QLG B;  2OTE A;  1QYQ A;  3OSR A;  1KP5 A;  5DRG A;  5EXU A;  4ZIN A;  4B30 A;  2G2S B;  4JF9 A;  4W69 A;  5HZO A;  1MYW A;  4PPK A;  3DQ8 A;  2H9W A;  2IB5 A;  4KA9 A;  4XVP A;  4OQW A;  2IE2 A;  3SSK A;  3KCS A;  2VVI A;  2HRS A;  4EMQ A;  4W6D A;  5DTY A;  1Z1P A;  5LTR A;  5KTG A;  4PPJ A;  1RRX A;  3ED8 A;  5HZS A;  4W7C A;  2HQK A;  2G6Y A;  2H5O A;  3K1K A;  4L13 A;  4DXQ A;  5BT0 A;  3SG2 A;  3RWA A;  4ZF3 A;  4Q7U A;  2V4E A;  4KF4 A;  5DPJ A;  2YFP A;  2QLH A;  4HQ9 A;  5HZU A;  2HGD A;  2H6V A;  1Q4E A;  3GJ1 A;  4Z4M A;  3ST4 A;  5FVI A;  2H8Q A;  2FWQ A;  3WLD A;  4JEO A;  1EMA A;  4KW4 A;  4LJD A;  4B30 B;  4EDS A;  4W6A A;  4ZBL A;  4W76 A;  1F09 A;  4N3D A;  3DQN A;  5EXB A;  2G16 B;  3CGL A;  2A46 A;  4W6G A;  4H47 A;  3DQJ A;  2AWM A;  3H1O A;  4W6U A;  5H87 A;  1YHI A;  1KYR A;  4W6P A;  3ZUF A;  4HE4 A;  1BFP A;  3DQ2 A;  2QRF A;  2Q57 A;  3W1D A;  1HCJ A;  3SSY A;  1W7S A;  2YDZ A;  3S05 A;  3SV5 A;  2V4E B;  3BXB A;  1KYP A;  2WIQ A;  2B3Q A;  3SG3 A;  3E5W A;  1GFL A;  2AWL A;  4W7A A;  3EVU A;  3DQE A;  3GJ2 A;  1QYF A;  3SVE A;  3CD9 A;  3EVR A;  4L1I A;  5HGE A;  1Q73 A;  2G6E A;  4W6O A;  4W7E A;  3DQD A;  2POX A;  3E5T A;  4IK5 A;  5EB7 A;  1Q4A A;  2ZMW A;  4H3L A;  3WCK A;  3SVO A;  5BTT A;  1G7K A;  4Q7R A;  3LVA A;  5HZT A;  4W74 A;  4DXN A;  3TMR A;  3SVB A;  3SST A;  1QY3 A;  3ZUL A;  3DQ6 A;  2JAD A;  2DDD A;  4W75 A;  3U8A A;  2WHS A;  3O77 A;  5LTP A;  5DPG A;  1YHH A;  5DU0 A;  2P4M A;  1OXE A;  2C9I A;  2HCG A;  4OGS A;  1JC0 A;  1Q4B A;  3DQ4 A;  4TZA A;  4DKM A;  3SVU A;  2FZU A;  1ZGQ A;  5EXC I;  2OGR A;  3ST0 A;  2A53 B;  1KYS A;  4W6R A;  3IP2 A;  2Q6P A;  1MOU A;  3NED A;  2G3O A;  2A52 B;  4ORN A;  3SG4 A;  3DQO A;  4Z4K A;  2OJK A;  2OTB A;  1GL4 A;  3SSL A;  2WHT A;  2ZMU A;  4LQU A;  4W6F A;  3EVV A;  4OHS A;  5BTT B;  2VAD A;  2WHU A;  4OY4 A;  3V3D A;  4IK3 A;  4W6S A;  4KF5 A;  2ZO7 A;  3P8U A;  3ADF A;  4KPI A;  3ZTF A;  2DUH A;  2WSN A;  2QU1 A;  1H4U A;  3U0M A;  4GES B;  1EMF A;  2BTJ A;  4GF6 B;  4B5Y A;  3DQ9 A;  4J88 A;  4ZF4 A;  3H1R A;  5EBJ A;  4JC2 A;  3U0N A;  4W73 A;  3LVC A;  3CBE A;  5HW9 A;  3DQ5 A;  4ZFS A;  1YFP A;  3SS0 A;  4JGE A;  4GOB A;  1YHG A;  3DQI A;  2YE0 A;  4IK9 A;  4DXP A;  2AWK A;  4HVF A;  3NEZ A;  3BX9 A;  2QLI A;  2G5Z B;  3A8S A;  3PIB A;  4W6N A;  1B9C A;  3DQH A;  3DQ3 A;  4W6M A;  3W1C A;  3LVD A;  4LJC A;  3EK7 A;  1GGX A;  3DPZ A;  4DXO A;  2HFC A;  1XA9 A;  1YJF A;  3CB9 A;  4W77 A;  1XAE A;  4L12 A;  2IOV A;  4HQC A;  4W6B A;  3ZUJ A;  2IB6 A;  4KEX A;  3SSP A;  1XMZ A;  3WLC A;  3DQU A;  3OSQ A;  3PJB A;  2Z6Z A;  1HUY A;  4EN1 A;  3MGF A;  2VAE A;  5LTQ A;  3DQ7 A;  1XQM A;  5H89 A;  3CD1 A;  5EHU A;  1F0B A;  2O24 A;  4ZB1 A;  3SVR A;  4W6H A;  2GW3 A;  4J8A A;  3EVP A;  4PFE A;  5T3I A;  2YE1 A;  1MOV A;  1OXF A;  2A50 B;  2DD9 A;  4XL5 A;  1EMB A;  4KAG A;  1QYO A;  2G3D B;  4ANJ A;  2WSO A;  3CFH A;  4IZN A;  2VVH A;  2G6X A;  1CV7 A;  2HPW A;  4TZG A;  2V4E C;  2DUI A;  3LF4 B;  4RYW A;  3PJ5 A;  1EME A;  5DTL A;  3LS3 A;  1EML A;  4LW5 A;  2A54 B;  3SG5 A;  5DTX A;  1EMM A;  2B3P A;  3IR8 A;  3SSH A;  4BDU A;  1H6R A;  3EKH A;  1Q4C A;  4DKN A;  4LJD C;  4XOW A;  4H3N A;  1Z1Q A;  4DXI A;  3SG7 A;  4AS8 A;  2DD7 A;  4HQ8 A;  4DXM A;  5FVF A;  3U0K A;  3AKO A;  2H5R A;  2HQZ A;  2AH8 A;  3CFF A;  3I19 A;  2QZ0 A;  5FVG A;  2PXS A;  4KW8 A;  1UIS A;  5J2O A;  1YZW A;  3KCT A;  2DDC A;  3LA1 A;  2ZO6 A;  1RMP A;  4I2Y A;  4P76 A;  5DY6 A;  4W6T A;  3VHT A;  3ST2 A;  2FL1 A;  2AHA A;  4R6D A;  2QLE A;  2OKW A;  1ZGP A;  3U8P A;  3P28 A;  3EKJ A;  3DQA A;  4JFG A;  3DQF A;  5LK4 A;  4KW9 A;  5DRF A;  4W6K A;  4OJ0 A;  1W7T A;  3NF0 A;  3M22 A;  1QXT A;  4AR7 A;  2DUE A;  5H88 A;  3OGO A;  3GL4 A;  1RM9 A;  4W7X A;  1YJ2 A;  2O29 A;  4ZIO A;  2Z6X A;  5EB6 A;  1S6Z A;  3SG6 A;  1JC1 A;  3SVN A;  3GEX A;  3LF3 A;  4Q9W A;  4RTC A;  2Y0G A;  2Z6Y A;  5F9G A;  3UG0 A;  2A48 A;  3VHT B;  3G9A A;  1EMG A;  1JBY A;  3AI4 A;  3U8C A;  4NWS A;  5DQB A;  3DQC A;  2VVJ A;  4JRB A;  4W6I A;  1XSS A;  4XGY A;  5HBD A;  3DQL A;  2C9J A;  3SSV A;  1OXD A;  2Z1O A;  4EDO A;  4H3M A;  4U2V A;  1EMC A;  3SVC A;  5DQM A;  4W7R A;  3DQM A;  1W7U A;  2HJO A;  4KGF A;  4W6L A;  3E5V A;  3SVS A;  4R6B A;  2GW4 B;  5DTZ A;  2QT2 A;  4W72 A;  1RMO A;  4Q7T A;  2GX2 A;  2PXW A;  4UTS A;  2HGY A;  2RH7 A;  2WIS A;  4Q9X A;  3CFA A;  2VZX A;  3VK1 A;  3U0L A;  2H5P A;  2DUG A;  4KF5 C;  3NT3 A;  2GX0 A;  3EK8 A;  3O78 A;  1ZGO A;  1RMM A;  3RWT A;  2EMO A;  2ICR A;  4RYS A;  3VIC A;  3BXA A;  3LSA A;  4EUL A;  3TMT A;  5DPH A;  1JBZ A;  4XOV A;  3SVD A;  4W7D A;  5EJU A;  2QLG A;  1Q4D A;  4H48 A;  2OKY A;  3SRY A;  4W6C A;  3DPW A;  4J89 A;  1C4F A;  4W7F A;  2A47 A;  2ARL A;  2EMD A;  4ZF5 A;  3PJ7 A;  4LJB A;  3DQK A;  3ST3 A;  4IK1 A;  2A56 B;  2EMN A;  3EK4 A;  3M24 A;  3DPX A;  4IK8 A;  4KGE A;  4LQT A;  1EMK A;  5AQB B; 
#chains in the Genus database with same CATH topology
 5BQL A;  2DUF A;  4P1Q A;  3BXC A;  3NT9 A;  4W6J A;  5FHV A;  2O2B A;  3GB3 A;  2AWJ A;  3DQ1 A;  2H5Q A;  4PPL A;  3UFZ A;  3AI5 A;  5DPI A;  4IK4 A;  1ZUX A;  2WUR A;  2QLG B;  2OTE A;  1QYQ A;  3OSR A;  1KP5 A;  5DRG A;  5EXU A;  4ZIN A;  4B30 A;  2G2S B;  4JF9 A;  4W69 A;  5HZO A;  1MYW A;  4PPK A;  3DQ8 A;  2H9W A;  2IB5 A;  4KA9 A;  4XVP A;  4OQW A;  2IE2 A;  3SSK A;  3KCS A;  2VVI A;  2HRS A;  4EMQ A;  4W6D A;  5DTY A;  1Z1P A;  5LTR A;  5KTG A;  4PPJ A;  1RRX A;  3ED8 A;  5HZS A;  4W7C A;  2HQK A;  2G6Y A;  2H5O A;  3K1K A;  4L13 A;  4DXQ A;  5BT0 A;  3SG2 A;  3RWA A;  4ZF3 A;  4Q7U A;  2V4E A;  4KF4 A;  5DPJ A;  2YFP A;  2QLH A;  4HQ9 A;  5HZU A;  2HGD A;  2H6V A;  1Q4E A;  3GJ1 A;  4Z4M A;  3ST4 A;  5FVI A;  2H8Q A;  2FWQ A;  3WLD A;  4JEO A;  1EMA A;  4KW4 A;  4LJD A;  4B30 B;  4EDS A;  4W6A A;  4ZBL A;  4W76 A;  1F09 A;  4N3D A;  3DQN A;  5EXB A;  2G16 B;  3CGL A;  2A46 A;  4W6G A;  4H47 A;  3DQJ A;  2AWM A;  3H1O A;  4W6U A;  5H87 A;  1YHI A;  1KYR A;  4W6P A;  3ZUF A;  4HE4 A;  1BFP A;  3DQ2 A;  2QRF A;  2Q57 A;  3W1D A;  1HCJ A;  3SSY A;  1W7S A;  2YDZ A;  3S05 A;  3SV5 A;  2V4E B;  3BXB A;  1KYP A;  2WIQ A;  2B3Q A;  3SG3 A;  3E5W A;  1GFL A;  2AWL A;  4W7A A;  3EVU A;  3DQE A;  3GJ2 A;  1QYF A;  3SVE A;  3CD9 A;  3EVR A;  4L1I A;  5HGE A;  1Q73 A;  2G6E A;  4W6O A;  4W7E A;  3DQD A;  2POX A;  3E5T A;  4IK5 A;  5EB7 A;  1Q4A A;  2ZMW A;  4H3L A;  3WCK A;  3SVO A;  5BTT A;  1G7K A;  4Q7R A;  3LVA A;  5HZT A;  4W74 A;  4DXN A;  3TMR A;  3SVB A;  3SST A;  1QY3 A;  3ZUL A;  3DQ6 A;  2JAD A;  2DDD A;  4W75 A;  3U8A A;  2WHS A;  3O77 A;  5LTP A;  5DPG A;  1YHH A;  5DU0 A;  2P4M A;  1OXE A;  2C9I A;  2HCG A;  4OGS A;  1JC0 A;  1Q4B A;  3DQ4 A;  4TZA A;  4DKM A;  3SVU A;  2FZU A;  1ZGQ A;  5EXC I;  2OGR A;  3ST0 A;  2A53 B;  1KYS A;  4W6R A;  3IP2 A;  2Q6P A;  1MOU A;  3NED A;  2G3O A;  2A52 B;  4ORN A;  3SG4 A;  3DQO A;  4Z4K A;  2OJK A;  2OTB A;  1GL4 A;  3SSL A;  2WHT A;  2ZMU A;  4LQU A;  4W6F A;  3EVV A;  4OHS A;  5BTT B;  2VAD A;  2WHU A;  4OY4 A;  3V3D A;  4IK3 A;  4W6S A;  4KF5 A;  2ZO7 A;  3P8U A;  3ADF A;  4KPI A;  3ZTF A;  2DUH A;  2WSN A;  2QU1 A;  1H4U A;  3U0M A;  4GES B;  1EMF A;  2BTJ A;  4GF6 B;  4B5Y A;  3DQ9 A;  4J88 A;  4ZF4 A;  3H1R A;  5EBJ A;  4JC2 A;  3U0N A;  4W73 A;  3LVC A;  3CBE A;  5HW9 A;  3DQ5 A;  4ZFS A;  1YFP A;  3SS0 A;  4JGE A;  4GOB A;  1YHG A;  3DQI A;  2YE0 A;  4IK9 A;  4DXP A;  2AWK A;  4HVF A;  3NEZ A;  3BX9 A;  2QLI A;  2G5Z B;  3A8S A;  3PIB A;  4W6N A;  1B9C A;  3DQH A;  3DQ3 A;  4W6M A;  3W1C A;  3LVD A;  4LJC A;  3EK7 A;  1GGX A;  3DPZ A;  4DXO A;  2HFC A;  1XA9 A;  1YJF A;  3CB9 A;  4W77 A;  1XAE A;  4L12 A;  2IOV A;  4HQC A;  4W6B A;  3ZUJ A;  2IB6 A;  4KEX A;  3SSP A;  1XMZ A;  3WLC A;  3DQU A;  3OSQ A;  3PJB A;  2Z6Z A;  1HUY A;  4EN1 A;  3MGF A;  2VAE A;  5LTQ A;  3DQ7 A;  1XQM A;  5H89 A;  3CD1 A;  5EHU A;  1F0B A;  2O24 A;  4ZB1 A;  3SVR A;  4W6H A;  2GW3 A;  4J8A A;  3EVP A;  4PFE A;  5T3I A;  2YE1 A;  1MOV A;  1OXF A;  2A50 B;  2DD9 A;  4XL5 A;  1EMB A;  4KAG A;  1QYO A;  2G3D B;  4ANJ A;  2WSO A;  3CFH A;  4IZN A;  2VVH A;  2G6X A;  1CV7 A;  2HPW A;  4TZG A;  2V4E C;  2DUI A;  3LF4 B;  4RYW A;  3PJ5 A;  1EME A;  5DTL A;  3LS3 A;  1EML A;  4LW5 A;  2A54 B;  3SG5 A;  5DTX A;  1EMM A;  2B3P A;  3IR8 A;  3SSH A;  4BDU A;  1H6R A;  3EKH A;  1Q4C A;  4DKN A;  4LJD C;  4XOW A;  4H3N A;  1Z1Q A;  4DXI A;  3SG7 A;  4AS8 A;  2DD7 A;  4HQ8 A;  4DXM A;  5FVF A;  3U0K A;  3AKO A;  2H5R A;  2HQZ A;  2AH8 A;  3CFF A;  3I19 A;  2QZ0 A;  5FVG A;  2PXS A;  4KW8 A;  1UIS A;  5J2O A;  1YZW A;  3KCT A;  2DDC A;  3LA1 A;  2ZO6 A;  1RMP A;  4I2Y A;  4P76 A;  5DY6 A;  4W6T A;  3VHT A;  3ST2 A;  2FL1 A;  2AHA A;  4R6D A;  2QLE A;  2OKW A;  1ZGP A;  3U8P A;  3P28 A;  3EKJ A;  3DQA A;  4JFG A;  3DQF A;  5LK4 A;  4KW9 A;  5DRF A;  4W6K A;  4OJ0 A;  1W7T A;  3NF0 A;  3M22 A;  1QXT A;  4AR7 A;  2DUE A;  5H88 A;  3OGO A;  3GL4 A;  1RM9 A;  4W7X A;  1YJ2 A;  2O29 A;  4ZIO A;  2Z6X A;  5EB6 A;  1S6Z A;  3SG6 A;  1JC1 A;  3SVN A;  3GEX A;  3LF3 A;  4Q9W A;  4RTC A;  2Y0G A;  2Z6Y A;  5F9G A;  3UG0 A;  2A48 A;  3VHT B;  3G9A A;  1EMG A;  1JBY A;  3AI4 A;  3U8C A;  4NWS A;  5DQB A;  3DQC A;  2VVJ A;  4JRB A;  4W6I A;  1XSS A;  4XGY A;  5HBD A;  3DQL A;  2C9J A;  3SSV A;  1OXD A;  2Z1O A;  4EDO A;  4H3M A;  4U2V A;  1EMC A;  3SVC A;  5DQM A;  4W7R A;  3DQM A;  1W7U A;  2HJO A;  4KGF A;  4W6L A;  3E5V A;  3SVS A;  4R6B A;  2GW4 B;  5DTZ A;  2QT2 A;  4W72 A;  1RMO A;  4Q7T A;  2GX2 A;  2PXW A;  4UTS A;  2HGY A;  2RH7 A;  2WIS A;  4Q9X A;  3CFA A;  2VZX A;  3VK1 A;  3U0L A;  2H5P A;  2DUG A;  4KF5 C;  3NT3 A;  2GX0 A;  3EK8 A;  3O78 A;  1ZGO A;  1RMM A;  3RWT A;  2EMO A;  2ICR A;  4RYS A;  3VIC A;  3BXA A;  3LSA A;  4EUL A;  3TMT A;  5DPH A;  1JBZ A;  4XOV A;  3SVD A;  4W7D A;  5EJU A;  2QLG A;  1Q4D A;  4H48 A;  2OKY A;  3SRY A;  4W6C A;  3DPW A;  4J89 A;  1C4F A;  4W7F A;  2A47 A;  2ARL A;  2EMD A;  4ZF5 A;  3PJ7 A;  4LJB A;  3DQK A;  3ST3 A;  4IK1 A;  2A56 B;  2EMN A;  3EK4 A;  3M24 A;  3DPX A;  4IK8 A;  4KGE A;  4LQT A;  1EMK A;  5AQB B; 
#chains in the Genus database with same CATH homology
 5BQL A;  2DUF A;  4P1Q A;  3BXC A;  3NT9 A;  4W6J A;  5FHV A;  2O2B A;  3GB3 A;  2AWJ A;  3DQ1 A;  2H5Q A;  4PPL A;  3UFZ A;  3AI5 A;  5DPI A;  4IK4 A;  1ZUX A;  2WUR A;  2QLG B;  2OTE A;  1QYQ A;  3OSR A;  1KP5 A;  5DRG A;  5EXU A;  4ZIN A;  4B30 A;  2G2S B;  4JF9 A;  4W69 A;  5HZO A;  1MYW A;  4PPK A;  3DQ8 A;  2H9W A;  2IB5 A;  4KA9 A;  4XVP A;  4OQW A;  2IE2 A;  3SSK A;  3KCS A;  2VVI A;  2HRS A;  4EMQ A;  4W6D A;  5DTY A;  1Z1P A;  5LTR A;  5KTG A;  4PPJ A;  1RRX A;  3ED8 A;  5HZS A;  4W7C A;  2HQK A;  2G6Y A;  2H5O A;  3K1K A;  4L13 A;  4DXQ A;  5BT0 A;  3SG2 A;  3RWA A;  4ZF3 A;  4Q7U A;  2V4E A;  4KF4 A;  5DPJ A;  2YFP A;  2QLH A;  4HQ9 A;  5HZU A;  2HGD A;  2H6V A;  1Q4E A;  3GJ1 A;  4Z4M A;  3ST4 A;  5FVI A;  2H8Q A;  2FWQ A;  3WLD A;  4JEO A;  1EMA A;  4KW4 A;  4LJD A;  4B30 B;  4EDS A;  4W6A A;  4ZBL A;  4W76 A;  1F09 A;  4N3D A;  3DQN A;  5EXB A;  2G16 B;  3CGL A;  2A46 A;  4W6G A;  4H47 A;  3DQJ A;  2AWM A;  3H1O A;  4W6U A;  5H87 A;  1YHI A;  1KYR A;  4W6P A;  3ZUF A;  4HE4 A;  1BFP A;  3DQ2 A;  2QRF A;  2Q57 A;  3W1D A;  1HCJ A;  3SSY A;  1W7S A;  2YDZ A;  3S05 A;  3SV5 A;  2V4E B;  3BXB A;  1KYP A;  2WIQ A;  2B3Q A;  3SG3 A;  3E5W A;  1GFL A;  2AWL A;  4W7A A;  3EVU A;  3DQE A;  3GJ2 A;  1QYF A;  3SVE A;  3CD9 A;  3EVR A;  4L1I A;  5HGE A;  1Q73 A;  2G6E A;  4W6O A;  4W7E A;  3DQD A;  2POX A;  3E5T A;  4IK5 A;  5EB7 A;  1Q4A A;  2ZMW A;  4H3L A;  3WCK A;  3SVO A;  5BTT A;  1G7K A;  4Q7R A;  3LVA A;  5HZT A;  4W74 A;  4DXN A;  3TMR A;  3SVB A;  3SST A;  1QY3 A;  3ZUL A;  3DQ6 A;  2JAD A;  2DDD A;  4W75 A;  3U8A A;  2WHS A;  3O77 A;  5LTP A;  5DPG A;  1YHH A;  5DU0 A;  2P4M A;  1OXE A;  2C9I A;  2HCG A;  4OGS A;  1JC0 A;  1Q4B A;  3DQ4 A;  4TZA A;  4DKM A;  3SVU A;  2FZU A;  1ZGQ A;  5EXC I;  2OGR A;  3ST0 A;  2A53 B;  1KYS A;  4W6R A;  3IP2 A;  2Q6P A;  1MOU A;  3NED A;  2G3O A;  2A52 B;  4ORN A;  3SG4 A;  3DQO A;  4Z4K A;  2OJK A;  2OTB A;  1GL4 A;  3SSL A;  2WHT A;  2ZMU A;  4LQU A;  4W6F A;  3EVV A;  4OHS A;  5BTT B;  2VAD A;  2WHU A;  4OY4 A;  3V3D A;  4IK3 A;  4W6S A;  4KF5 A;  2ZO7 A;  3P8U A;  3ADF A;  4KPI A;  3ZTF A;  2DUH A;  2WSN A;  2QU1 A;  1H4U A;  3U0M A;  4GES B;  1EMF A;  2BTJ A;  4GF6 B;  4B5Y A;  3DQ9 A;  4J88 A;  4ZF4 A;  3H1R A;  5EBJ A;  4JC2 A;  3U0N A;  4W73 A;  3LVC A;  3CBE A;  5HW9 A;  3DQ5 A;  4ZFS A;  1YFP A;  3SS0 A;  4JGE A;  4GOB A;  1YHG A;  3DQI A;  2YE0 A;  4IK9 A;  4DXP A;  2AWK A;  4HVF A;  3NEZ A;  3BX9 A;  2QLI A;  2G5Z B;  3A8S A;  3PIB A;  4W6N A;  1B9C A;  3DQH A;  3DQ3 A;  4W6M A;  3W1C A;  3LVD A;  4LJC A;  3EK7 A;  1GGX A;  3DPZ A;  4DXO A;  2HFC A;  1XA9 A;  1YJF A;  3CB9 A;  4W77 A;  1XAE A;  4L12 A;  2IOV A;  4HQC A;  4W6B A;  3ZUJ A;  2IB6 A;  4KEX A;  3SSP A;  1XMZ A;  3WLC A;  3DQU A;  3OSQ A;  3PJB A;  2Z6Z A;  1HUY A;  4EN1 A;  3MGF A;  2VAE A;  5LTQ A;  3DQ7 A;  1XQM A;  5H89 A;  3CD1 A;  5EHU A;  1F0B A;  2O24 A;  4ZB1 A;  3SVR A;  4W6H A;  2GW3 A;  4J8A A;  3EVP A;  4PFE A;  5T3I A;  2YE1 A;  1MOV A;  1OXF A;  2A50 B;  2DD9 A;  4XL5 A;  1EMB A;  4KAG A;  1QYO A;  2G3D B;  4ANJ A;  2WSO A;  3CFH A;  4IZN A;  2VVH A;  2G6X A;  1CV7 A;  2HPW A;  4TZG A;  2V4E C;  2DUI A;  3LF4 B;  4RYW A;  3PJ5 A;  1EME A;  5DTL A;  3LS3 A;  1EML A;  4LW5 A;  2A54 B;  3SG5 A;  5DTX A;  1EMM A;  2B3P A;  3IR8 A;  3SSH A;  4BDU A;  1H6R A;  3EKH A;  1Q4C A;  4DKN A;  4LJD C;  4XOW A;  4H3N A;  1Z1Q A;  4DXI A;  3SG7 A;  4AS8 A;  2DD7 A;  4HQ8 A;  4DXM A;  5FVF A;  3U0K A;  3AKO A;  2H5R A;  2HQZ A;  2AH8 A;  3CFF A;  3I19 A;  2QZ0 A;  5FVG A;  2PXS A;  4KW8 A;  1UIS A;  5J2O A;  1YZW A;  3KCT A;  2DDC A;  3LA1 A;  2ZO6 A;  1RMP A;  4I2Y A;  4P76 A;  5DY6 A;  4W6T A;  3VHT A;  3ST2 A;  2FL1 A;  2AHA A;  4R6D A;  2QLE A;  2OKW A;  1ZGP A;  3U8P A;  3P28 A;  3EKJ A;  3DQA A;  4JFG A;  3DQF A;  5LK4 A;  4KW9 A;  5DRF A;  4W6K A;  4OJ0 A;  1W7T A;  3NF0 A;  3M22 A;  1QXT A;  4AR7 A;  2DUE A;  5H88 A;  3OGO A;  3GL4 A;  1RM9 A;  4W7X A;  1YJ2 A;  2O29 A;  4ZIO A;  2Z6X A;  5EB6 A;  1S6Z A;  3SG6 A;  1JC1 A;  3SVN A;  3GEX A;  3LF3 A;  4Q9W A;  4RTC A;  2Y0G A;  2Z6Y A;  5F9G A;  3UG0 A;  2A48 A;  3VHT B;  3G9A A;  1EMG A;  1JBY A;  3AI4 A;  3U8C A;  4NWS A;  5DQB A;  3DQC A;  2VVJ A;  4JRB A;  4W6I A;  1XSS A;  4XGY A;  5HBD A;  3DQL A;  2C9J A;  3SSV A;  1OXD A;  2Z1O A;  4EDO A;  4H3M A;  4U2V A;  1EMC A;  3SVC A;  5DQM A;  4W7R A;  3DQM A;  1W7U A;  2HJO A;  4KGF A;  4W6L A;  3E5V A;  3SVS A;  4R6B A;  2GW4 B;  5DTZ A;  2QT2 A;  4W72 A;  1RMO A;  4Q7T A;  2GX2 A;  2PXW A;  4UTS A;  2HGY A;  2RH7 A;  2WIS A;  4Q9X A;  3CFA A;  2VZX A;  3VK1 A;  3U0L A;  2H5P A;  2DUG A;  4KF5 C;  3NT3 A;  2GX0 A;  3EK8 A;  3O78 A;  1ZGO A;  1RMM A;  3RWT A;  2EMO A;  2ICR A;  4RYS A;  3VIC A;  3BXA A;  3LSA A;  4EUL A;  3TMT A;  5DPH A;  1JBZ A;  4XOV A;  3SVD A;  4W7D A;  5EJU A;  2QLG A;  1Q4D A;  4H48 A;  2OKY A;  3SRY A;  4W6C A;  3DPW A;  4J89 A;  1C4F A;  4W7F A;  2A47 A;  2ARL A;  2EMD A;  4ZF5 A;  3PJ7 A;  4LJB A;  3DQK A;  3ST3 A;  4IK1 A;  2A56 B;  2EMN A;  3EK4 A;  3M24 A;  3DPX A;  4IK8 A;  4KGE A;  4LQT A;  1EMK A;  5AQB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...