3EK4A

Calcium-saturated gcamp2 monomer
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
348
Chain Sequence
KTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 111
structure length 348
sequence length 367
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek4A02
1J1EA 3K1KA 1NX3A 1TOPA 5CPVA 3SG5A 2COLB 3PIBA 1JC2A 2GX0A 3DQ2A 2H9WA 1UP5A 2ZO7A 2F2OA 2Y1NA 1YVHA 2WSOA 3OSQA 5I2QA 3TMRA 2KI6D 5EB7A 3DQAA 4W7AA 2VAEA 4KF5C 1QTXA 3BX9A 2BTJA 1K8UA 1K94A 3CTNA 4YGAA 1VRKA 1NIWA 2V4EC 5BTTB 1OZSA 4PHMA 2A4JA 2HJOA 2JOJA 3SS0A 1QV0A 2HETA 1MOUA 3FWCA 3LCPC 1HT9A 1EMFA 1F70A 2O29A 2ZNEA 2G5ZB 3E5VA 1B7TY 2Q6PA 1K2HA 2LVVA 1Z1QA 2L2EA 1PULA 3VRRA 3DQNA 2H5QA 1KK7Z 1L2OB 1F0BA 1QX7A 2P6BB 2Y4QA 1H8BA 1JBZA 2V4EB 4ZIOA 1F71A 1M45A 1K9UA 5J2OA 2CTNA 3TMTA 5FVIA 4XL5A 2LLTA 3CB9A 2AHAA 5FHVA 4OVNF 5LTRA 5I2OA 3OSRA 4J89A 1RECA 5H88A 2CBLA 3RLZA 1UHHA 4ZCUA 1UHKA 2MBXA 2QACA 1NCZA 1SNLA 3GJ2A 4MBEA 2MHHA 4OJ0A 3SVDA 2EC6B 4PDZA 2Q4UA 2QZ0A 4DXPA 1XVJA 2LLSA 3AKAA 1DJHA 4ORCB 1F4OA 2B3QA 4JEOA 1YFPA 4L1IA 3LL8B 3GJ1A 2HGDA 2JULA 1UISA 4PE4A 1M46A 3GB3A 1TN4A 3AAJA 4NDDA 4GFTA 3DD4A 2EGDA 4HVFA 4JRBA 3M22A 2Q91A 2G16B 4KW8A 1GGZA 3CBEA 3SV5A 3VHTA 2VADA 1BJFA 3K21A 2DUHA 1B9AA 1OMRA 1Q80A 4WQ2A 3GL4A 1QX2A 3VROA 4XVPA 2K61A 2IB6A 1YHGA 1XFWO 1ZFSA 1QY3A 1BLQA 1M63B 1SR6C 1EG3A 2H6VA 2G3OA 2QPTA 2MLEC 4QJ4B 3BUNB 4Z4MA 5CSNA 1IWQA 3PFVA 3LF4B 1KFUL 4XOVA 3EKJA 2JXLA 1BOCA 2ICRA 2PALA 2AUCA 2HGYA 1NX0A 2KQYA 5HZUA 2O2BA 4IK8A 4OQWA 3H1RA 2A53B 4MSPA 3NSIA 4YBHB 1KFXS 1SR6B 1SL9A 4DXMA 3SG2A 3TDIA 4OGSA 3BUOB 4YGBB 4LJCA 4PPLA 3DQ3A 3TS5B 1SK6D 2KYFA 3LSAA 5DTYA 4DXOA 3LVDA 1GGXA 3CFHA 3DQ1A 3E5WA 2ZKMX 5ER5A 2M1KB 4R6BA 1JSAA 1B47A 4C0KA 3BOWA 5KTGA 2JTTA 4EDOA 4PE1A 1SCMB 5HKZA 1CFFA 4ANJA 1J55A 4L9MA 2HFCA 2FL1A 4RYSA 2LNKA 3VRQA 1QYQA 2MA2A 2ZO6A 3O77A 4ZINA 1GQMA 2KBIA 2YE0A 2LUCA 2PSRA 2WISA 5HBDA 4HQCA 1AJ5A 1SPYA 3M0WA 5D7FA 1BFPA 1IRJA 1OXFA 2H61A 1S26D 4CPVA 2OPOA 2M7LA 4JF9A 3U8PA 4LJDA 3SG4A 1CB1A 1GL4A 4TZAA 1NCXA 2HQKA 2JU0A 1W7UA 3OB2B 5EJUA 2NLNA 5FVGA 1JFKA 2BBMA 4IK3A 2KAYA 1SL8A 2WSNA 2M7NA 3GK4X 2FZUA 1J7QA 1WDCC 1YX7A 2LAPA 4W6GA 3W1DA 1C4FA 5JOLA 2ZMUA 3SSKA 2WHTA 1G4YR 1KQVA 4W6UA 1G8IA 1QVIY 5JJGA 5F9GA 5IBWA 2BKHB 2GGZA 1IH0A 1RTP1 1LVCD 3SG7A 2MJWB 3NXAA 5HW9A 1YVLA 3NT9A 3SVUA 3E3RA 2GW3A 3DQKA 1AUIB 2WIQA 2DDDA 3I5FC 4WQ3A 1DMOA 1XA9A 4W6SA 5LTPA 3DVEA 2B1UA 5HZOA 3BYAA 2Y5IA 1L7ZA 1TIZA 5I2LA 4DKMA 2IB5A 1S6ZA 2VVIA 2K7OA 5EB6A 1OXDA 3OX6A 2LVJA 4JQ0D 3DQFA 1F8HA 3KCSA 3NSKA 2R2IA 1W7IB 2BECA 3TDZA 1DJGA 5HYDA 5EHUA 2BCAA 2JADA 1KQMB 4MZLA 2CNPA 2H61C 4KGEA 2KQ6A 3I5IB 1C7VA 3CGLA 3KEVA 2KBMA 4L12A 4QJ5B 2P4MA 1MYWA 3NT3A 2Z6XA 1CV7A 4P76A 4MVFA 4DS7A 4W72A 1PALA 1ALWA 1Q4CA 1DTLA 3VGOA 1J7OA 1H4UA 2DOQA 3IR8A 1S5GY 2ARLA 1NX1A 3GEXA 3M24A 3NEZA 3U0LA 3KO0A 3ADFA 4JFGA 2CXJA 3BXCA 1S6JA 5BQLA 5HLVA 4USLA 3DF0B 1N65A 5AEQA 4W6NA 3HX4A 3UFZA 4ORNA 2B3PA 1JF0A 2KNEA 4EDSA 1WRLA 5AXIA 3DQ9A 4BDUA 1WY9A 3SSVA 1N0YA 2BCXA 3ZUJA 3RWAA 1PVBA 2EHBA 2IE2A 1KFXL 1JBYA 2HCGA 1KP5A 4AS8A 5KTYA 1MR8A 4W6MA 4XGYA 3SG3A 2L5XB 4W74A 4H47A 1KWOB 1YURA 4W77A 3P8UA 3WLDA 3RM1A 1FBVA 1LINA 2EMNA 2QT2A 2LVIA 4XYNA 2L98A 2MLFC 2GW4B 2IOVA 2F3YA 3NSLA 3I5IC 3EVUA 2L4HA 1TNXA 2VRGA 2G9BA 1QJTA 2F33A 3OP0A 2RH7A 4KW4A 1ZGOA 3ZUFA 4W6CA 2CCMA 2GGMA 1CNPA 4DRWA 2PMYA 3VRNA 4Q04A 3EK7A 1W7TA 3DQHA 1AHRA 1DJZA 1G7KA 1HCJA 4W6PA 2HPWA 3WNXB 1BF5A 3ST4A 2LM5A 2V53A 3U0NA 1A4PA 1A29A 1E8AA 2LLUA 5DU0A 1BU3A 1QLKA 4PHJA 2L4IA 2NXQA 3ED8A 3CLNA 1CLLA 4MEWA 4KAGA 3CGAA 2VZXA 1UHNA 1XFVO 2LMUA 3SVOA 5FVFA 4M2OA 2K8MB 2OJKA 2I18A 1MQ1A 3OB1B 1JC0A 3IF7A 2PXWA 1XMZA 1S5GZ 4F0ZB 3GK1A 5BTTA 4IK4A 5LK4A 2M29A 4ZF3A 5HKWA 1WDCB 1S36A 2QU1A 4ZFSA 1W7SA 3DQ4A 1EMKA 2A48A 4LQUA 2VVHA 1IGVA 1YX8A 4W7FA 1IJ5A 1IG5A 2YDZA 1TCFA 3SG6A 5KU1A 4FTGA 4U8DA 3LS3A 4P1QA 1EMBA 2F3ZA 2OTGB 2LHLA 3AI5A 4D1EA 5KSZA 1H4BA 4W6HA 2K2FA 1HQVA 2Z6ZA 1DJYA 1XYDA 2I94A 2O5GA 3O4YA 3PN7C 1QXTA 4LQTA 2ZNDA 1ZUXA 2G6XA 4H48A 5K89A 3NEDA 2KGBC 3SVBA 4JGEA 2EMDA 1J7RA 3WXAA 1CKKA 5HZSA 2D8NA 2BCBA 1MOVA 2JTZA 2JT0A 2HQ8A 1AVSA 1JUOA 4M2PA 2NZ0A 1UUSA 2WHUA 2KFHA 1BMOA 2I2RE 2JZIA 3O78A 3PN7B 2QRFA 1HUYA 4CFQA 4W6OA 2L0PA 2F2PA 4MRYA 1A03A 4DXNA 1SY9A 2AMIA 1TCOB 1Z1PA 2E30A 2JT8A 4W7DA 3OGOA 2QLIA 2HF5A 4XJKB 2FOTA 1B4CA 5AANA 1DF0A 3MSEB 1RJVA 1XFUO 1MF8B 3AKBA 3ZULA 3CD1A 5HZTA 2WCBA 4NDBA 4HRHA 3SSYA 1EJ3A 1IJ6A 1KK8C 2KYCA 1EMLA 3EK4A 4AR7A 4ZBLA 2JPTA 1EMCA 1RMPA 3PJBA 1CM1A 2AAOA 1CFPA 4W6JA 3W1CA 1SL7A 5D69A 4PPJA 3VICA 1R6PA 1XFXO 1Y1AA 5DKQA 5EXUA 4C0JA 1OZOA 4GOBA 2LANA 4PE7A 1YRTB 2PRUA 2LE9B 1L2OC 2FCEA 5CSFA 3SIBA 2KOTA 3V3DA 1MWNA 2HPSA 4Q7RA 1S6CA 5DKNA 1KK7Y 1MXLC 3ST2A 3ZNIA 2ZN9A 1K93D 1PVAA 1NCYA 1V1GA 1ALVA 1K9PA 1TNWA 1XFZO 1YHIA 2JC2A 3D0YA 3DPWA 4I5KA 1YUSA 1LA3A 4OKHA 4MN0A 4I5LB 4I5NB 1NYAA 5HKYA 1ZGQA 3DQOA 3GK2A 4W7CA 5BT0A 1WLMA 3HCMA 2G3DB 4W6IA 5B8IB 2LP3A 4ZB1A 1Q4DA 1BODA 2K2AA 1B1GA 4L13A 1B9CA 3NF0A 2BE4A 1EG4A 5ER4X 3AAKA 3C1VA 1JFJA 3A8SA 4W76A 1RK9A 3DQDA 2JT3A 4ORAB 5DPJA 2VVJA 1XAEA 2AH8A 3NSOA 3LA1A 2WNDA 2C9IA 2SASA 4AOMA 3PJ7A 1IQ3A 1BR1B 5EXBA 5H87A 1A75A 4C0LA 4KF5A 2F8PA 1QX5B 5DPHA 2K0JA 3H4SE 4GESB 1DF0B 1DJIA 3TDUA 1S6IA 2KGRA 5AQBB 1B8RA 1CDNA 2KHNA 4R6DA 4J8AA 5AERA 3E5TA 3G9AA 3O6BA 4JPZB 3WHUB 1ODBA 1QVIZ 1NWDA 3FWBA 4A4BA 4NQGA 4PE0A 3ST0A 2LV7A 4B30A 1CDPA 3EVPA 3KCTA 4U2VA 1G33A 4W7RA 1Y0VH 3TUYC 5BPJA 4Z4KA 2HRSA 1K96A 3GOFA 5DPGA 2DUEA 1OMDA 4W6TA 3QRXA 1UURA 1U5IA 4W6KA 1FI6A 2LHIA 4GAOA 2OKWA 1QIVA 2GX2A 4OCIA 3SVRA 2Y0GA 3CS1A 1S3PA 3SRYA 4ZF5A 1CMGA 2DDCA 4W75A 3ZWHA 2KI6C 4H3MA 4GBAA 2NCPA 4RYWA 4GGFC 1WRZA 1JC1A 2KFGA 3BUWB 2A47A 1KYSA 2WURA 3MGFA 4CFRA 4R1EA 5EXCI 1JWDA 3A8RA 3BOWB 3H1OA 1XSSA 4B5YA 1CFCA 2EC6C 1NP8A 2IS9A 2K7DA 1OE9B 1YUUA 3P28A 1FPWA 1RWYA 4HRGA 1CLBA 3LVCA 3AKOA 2PXSA 2AWLA 2M3WA 2M97A 2KDHA 1JF2A 3DVKA 1DJXA 3JVTB 1EMMA 1ZUZA 2KAXA 4H3NA 2G6YA 2M8UA 5GQQC 2NCOA 1K95A 3WHTB 3CR2A 2FWQA 4IK1A 5DQBA 2A50B 4EN1A 5PALA 1EMEA 2A46A 4KF4A 3F45A 2LMTA 5H89A 1QATA 4YRUA 3CFAA 1AP4A 3PSRA 1S1EA 4DKNA 1Q73A 1FW4A 3CWGA 2JNXA 4P5OE 2H5OA 4GGNA 5T3IA 1CMFA 3ICBA 4NWSA 3EKHA 3DQEA 1MXEA 3D0YB 1W7JB 1EMGA 2JQ6A 4UPGA 3IP2A 2AWJA 2PASA 2A56B 2LCPA 3SSTA 2K7CA 3SSHA 1ZMZA 3DF0A 3KF9A 1RMOA 1LA0A 2WCFA 4YI8A 4GNKB 2C9JA 2G2SB 3O2PA 1AK8A 3RWTA 2I7AA 4AQIA 5DTZA 4W6AA 3PJ5A 3OX5A 2M9GA 4DUQA 4GPLB 3ZTFA 1ZACA 4BY5A 1XA5A 1SRAA 4PCWA 1FF1A 4ICBA 1Q4AA 4HSZA 1BG1A 2WORA 4M2QA 1K9KA 3JVTC 2KAVA 4YI9A 4W6LA 4IZNA 1X02A 1SCVA 1BT6A 4W6RA 2AWKA 2H8QA 2HQWA 1CDLA 1LKJA 4KGFA 2EMOA 1YR5A 3U8AA 1A2XA 3U8CA 1SCMC 2JRFA 1Y1UA 4DXIA 3I19A 2MAZA 3CR4X 4W7XA 4ZCVA 1KQMC 3DQJA 3VK1A 2DUFA 1GJYA 4N1GA 1C07A 2WCEA 5DRFA 2OGRA 4LJBA 5DKRA 1SKTA 3EVVA 3DVJA 2G6EA 4W7EA 2ZRSA 4MRXA 4GUKA 5DY6A 1KWOC 2L50A 1FI5A 1PK0D 3LF3A 4HREE 1Y1XA 1M31A 1XK4C 3DVMA 2KI4B 2YFPA 3SSPA 3A4UB 4HQ8A 4LJDC 4XOWA 2QLGB 1OQPA 4I2YA 4EMQA 1XQMA 1F55A 4PHNA 2Z1OA 1GFLA 3BXKA 2QLHA 2KSPA 1PSBA 2SCPA 1F54A 1D1OA 2PVBA 3UG0A 1SYMA 1KYPA 1NUBA 1EMAA 2ZRTA 2MRDA 4PHKA 1GGWA 1OXEA 3AI4A 1XK4A 3DQCA 4I5JA 3DQMA 1QYOA 1H6RA 1XO5A 2M0RA 5CSIA 4LW5A 1UHIA 1TTXA 3CR5X 4CLNA 1CTRA 3DQ6A 1AJ4A 4GF6B 1QASA 3I5FB 5HGEA 3OHMB 2DD9A 1R2UA 3PLFB 1YHHA 4TNCA 1MHOA 2ZN8A 4PALA 1F09A 2QLGA 2Z6YA 3BXBA 2LUXA 2RGIA 1J1DA 4OR9B 1SBJA 2OTBA 2KFFA 4KA9A 3KHEA 3TS5C 2POXA 2Q57A 4B30B 5J3XA 1KCYA 2CT9A 1F4QA 4YGCB 2OTEA 3FIAA 1TNQA 4TZGA 3DPZA 5DPIA 1QXPA 1IKUA 1J7PA 1JBAA 1WLZA 4YGDB 3I5HB 5G08A 1SW8A 3DPXA 1QV1A 3BXAA 2HQZA 4IL1A 3JTDC 1YZWA 1UHJA 2JNFA 2OTGC 2AWMA 1KSMA 1OOJA 2YE1A 3U0MA 2M49B 3LVAA 2BBNA 5DTLA 3SIAA 4W6DA 4YGEB 1NX2A 2A52B 1IQ5A 1XFYO 2FCDA 4KPIA 2Y1MA 2O24A 1K90D 5FYXA 4HQ9A 4KEXA 1RFJA 4E68A 1DVIA 1UWOA 1CLMA 4J88A 1A75B 1KYRA 4N3DA 1QLSA 3VRPA 1M39A 4A4CA 4MZJA 1Q4EA 5AFPA 4QJ3B 4AQJA 4WRIA 2BE6A 2JWWA 3DQUA 4IK9A 4H3LA 4UTSA 4OHSA 1MUXA 3SVSA 4JC2A 1DGUA 1PSRA 2G2BA 2WC8A 3SSLA 4XJKA 1EH2A 4Q9XA 3WCKA 4HE4A 4CIDA 2BKIB 1YJ2A 3DQ8A 3CD9A 2H2KA 4ETOA 4ZF4A 4PFEA 4JWQA 5HLOA 3LK0A 3IQQA 1NPQA 2E6WA 1DGVA 1QIWA 5F6TA 2ZMWA 3LK1A 4P2YB 1PRWA 3TUYB 4OV2A 1OSAA 4W6FA 4DCKA 1YRUB 1B7TZ 2ISDA 1QYFA 1ZOTB 2H5RA 3FS7A 3BQ3A 1WRKA 2L51A 2TN4A 1V1FA 2FJUB 5EBJA 4DIRA 3DQLA 4W73A 3I5HC 4Q7UA 5TNCA 1B8CA 2OS8B 4N5XA 3SVEA 1DJWA 1C7WA 1YJFA 1KK8B 2DUGA 5DQMA 3SVCA 1KSOA 3PALA 4Q9WA 1Y6WA 1NSHA 4MZKA 1KFUS 1CDMA 1Q4BA 2DUIA 1TRFA 5DTXA 3WLCA 2JXCA 3SVNA 2DD7A 1CFDA 3PATA 3EK8A 1YTZC 4N1FA 1RMMA 5I8NA 2A54B 1RM9A 4BY4A 2BL0C 3VHTB 3JTDB 3KPXA 4EULA 4DXQA 2K7BA 2M1UA 1RRXA 3CFFA 2ZFDA 4ORBB 4W69A 2GV5A 4FQOA 3DQ5A 3DQIA 3DQ7A 1CM4A 2WOSA 4MLWA 1U5IB 3SJSA 4IK5A 3I5GB 2LMVA 2H5PA 4GGFA 2KI4C 2LP2A 3IQOA 4OY4A 1EXRA 2LVKA 3PM8A 4RTCA 4W6BA 1N2DA 5DRGA 1BR4B 3EVRA 2V4EA 1TNPA 2O60A 2BL0B 1SMGA 1OMVA 3TZ1A 1ZGPA 3U0KA 1RROA 1EL4A 1LXFC 3ST3A 4NDCA 1DT7B 3D10A 3BUXB 3CZTX 2QLEA 3I5GC 1B8LA 4PPKA 1YUTA 3LLEA 3S05A 1QS7A 5CSJA 5LTQA 2OKYA 2OS8C 4KW9A 3BUMB 2WHSA 2LC5A 4Q7TA
chains in the Genus database with same CATH superfamily
1J1EA 3K1KA 1NX3A 3D75A 1TOPA 5CPVA 3SG5A 2COLB 1C3ZA 3PIBA 1JC2A 2GX0A 3DQ2A 2H9WA 1UP5A 2ZO7A 2F2OA 2H8VA 2Y1NA 1YVHA 2WSOA 3CYZA 3OSQA 5I2QA 3TMRA 2KI6D 5EB7A 2L5YA 3R1PA 3DQAA 4W7AA 1QWVA 2VAEA 4KF5C 1QTXA 3BX9A 2BTJA 1K8UA 1K94A 3CTNA 4YGAA 1VRKA 1NIWA 2V4EC 5BTTB 1OZSA 4PHMA 2A4JA 2HJOA 2JOJA 3SS0A 1QV0A 2HETA 1MOUA 3FWCA 3LCPC 1HT9A 2BNXA 1EMFA 1F70A 2O29A 2ZNEA 2G5ZB 3E5VA 1B7TY 3CABA 1K2HA 2Q6PA 2LVVA 1Z1QA 2L2EA 1PULA 3VRRA 3DQNA 2H5QA 1KK7Z 1L2OB 1F0BA 1GM0A 1QX7A 3B6XA 2P6BB 2Y4QA 1H8BA 1JBZA 2V4EB 4ZIOA 1F71A 2L2CA 1M45A 1K9UA 5J2OA 2CTNA 3TMTA 5FVIA 4XL5A 2LLTA 2K60A 3D76A 3S0AA 3O4XA 3CB9A 2AHAA 5FHVA 4OVNF 5LTRA 4JD9A 5I2OA 3OSRA 4J89A 1RECA 5H88A 2CBLA 3RLZA 1UHHA 4ZCUA 1UHKA 2MBXA 2QACA 1NCZA 1SNLA 3GJ2A 4MBEA 2MHHA 4OJ0A 3SVDA 3S0DA 2EC6B 4PDZA 2Q4UA 2QZ0A 4DXPA 1XVJA 2LLSA 3AKAA 1DJHA 4ORCB 1F4OA 2B3QA 4JEOA 3BJHA 1YFPA 4L1IA 3LL8B 3GJ1A 2HGDA 2JULA 1UISA 4PE4A 1M46A 3GB3A 1TN4A 3AAJA 4NDDA 4GFTA 3DD4A 2EGDA 4HVFA 4JRBA 3M22A 2Q91A 2G16B 3BFAA 4KW8A 1GGZA 3CBEA 4OZDA 3SV5A 3VHTA 2VADA 2QEHA 1BJFA 3K21A 2DUHA 1B9AA 2YGUA 1OMRA 3CDNA 1Q80A 4WQ2A 3GL4A 1QX2A 3VROA 3BFBA 4XVPA 2K61A 2IB6A 1YHGA 1XFWO 1ZFSA 1QY3A 1BLQA 1M63B 2WC5A 1SR6C 1EG3A 2H6VA 2G3OA 2QPTA 2MLEC 4QJ4B 3BUNB 4Z4MA 5CSNA 1IWQA 3PFVA 3LF4B 1KFUL 4XOVA 3EKJA 2JXLA 1BOCA 3D77A 2ICRA 2PALA 2AUCA 2HGYA 1NX0A 2KQYA 5HZUA 2O2BA 4IK8A 4OQWA 3H1RA 2A53B 4MSPA 3D73A 3NSIA 4YBHB 1P28A 1KFXS 1SR6B 1SL9A 4DXMA 3SG2A 3TDIA 4OGSA 3BUOB 4YGBB 4LJCA 4PPLA 3DQ3A 3TS5B 1SK6D 2KYFA 3LSAA 5DTYA 4DXOA 3LVDA 1GGXA 3CFHA 3DQ1A 3E5WA 2ZKMX 5ER5A 2M1KB 4R6BA 1JSAA 1B47A 4C0KA 3BOWA 5KTGA 2JTTA 4EDOA 4PE1A 3D78A 1SCMB 5HKZA 1CFFA 4ANJA 1J55A 4L9MA 2HFCA 2FL1A 4RYSA 2LNKA 3VRQA 1QYQA 2MA2A 2ZO6A 3O77A 4ZINA 1GQMA 2KBIA 2YE0A 2LUCA 2PSRA 2WISA 5HBDA 4HQCA 1AJ5A 1SPYA 3M0WA 3S0GA 5D7FA 1BFPA 1IRJA 1OXFA 2H61A 1S26D 4CPVA 2OPOA 2M7LA 4JF9A 3U8PA 4LJDA 3SG4A 1CB1A 1GL4A 4TZAA 1NCXA 2HQKA 2JU0A 1W7UA 3OB2B 5EJUA 3BFHA 2NLNA 5FVGA 1JFKA 2BBMA 4IK3A 2KAYA 1SL8A 2WSNA 2M7NA 3GK4X 2FZUA 1J7QA 1WDCC 1YX7A 2LAPA 4W6GA 3W1DA 1C4FA 5JOLA 2ZMUA 3SSKA 2WHTA 1G4YR 1KQVA 3L4LA 4W6UA 1G8IA 1QVIY 5JJGA 5F9GA 5IBWA 3R1OA 2BKHB 2GGZA 1IH0A 1RTP1 1LVCD 3SG7A 2MJWB 2WC6A 5FI7A 3NXAA 5HW9A 1YVLA 3NT9A 3SVUA 3E3RA 2GW3A 3DQKA 1AUIB 2WIQA 3VB1A 3I5FC 2DDDA 4WQ3A 1DMOA 1XA9A 4W6SA 5LTPA 3DVEA 2B1UA 5HZOA 3BYAA 2Y5IA 1L7ZA 1TIZA 5I2LA 4DKMA 2IB5A 2KLDA 1S6ZA 2VVIA 2K7OA 5EB6A 1SSEB 1OXDA 3OX6A 2LVJA 4JQ0D 3DQFA 1F8HA 3KCSA 3NSKA 2R2IA 1W7IB 2BECA 3TDZA 1DJGA 5HYDA 5EHUA 2BCAA 2JADA 1KQMB 4MZLA 2CNPA 2H61C 4KGEA 2KQ6A 3I5IB 1C7VA 3CGLA 3KEVA 2KBMA 4L12A 3D74A 4QJ5B 2P4MA 1MYWA 3NT3A 3SS5A 2Z6XA 1CV7A 4P76A 4MVFA 4DS7A 4W72A 1PALA 1ALWA 1Q4CA 1C3YA 1DTLA 3VGOA 1J7OA 1H4UA 2DOQA 3IR8A 1S5GY 3S0FA 2ARLA 1NX1A 3GEXA 3M24A 3NEZA 3U0LA 3KO0A 3ADFA 4JFGA 2CXJA 3BXCA 1S6JA 5BQLA 5HLVA 4USLA 3DF0B 1N65A 5AEQA 4W6NA 3HX4A 3UFZA 4ORNA 2B3PA 1JF0A 2KNEA 4EDSA 1WRLA 1LS8A 5AXIA 3DQ9A 4BDUA 1WY9A 3SSVA 1N0YA 2BCXA 3ZUJA 3RWAA 1PVBA 2EHBA 2IE2A 1KFXL 1JBYA 2HCGA 1KP5A 4AS8A 3R1VA 5KTYA 1MR8A 4W6MA 4XGYA 3SG3A 2L5XB 4W74A 4H47A 1KWOB 1YURA 4W77A 3P8UA 3WLDA 3RM1A 1FBVA 1LINA 2EMNA 2QT2A 2LVIA 4XYNA 2L98A 2MLFC 2GW4B 2IOVA 2F3YA 3NSLA 3I5IC 3EVUA 2L4HA 1TNXA 2VRGA 2G9BA 1QJTA 2F33A 3OP0A 2RH7A 4KW4A 1ZGOA 3ZUFA 4W6CA 2CCMA 2GGMA 1CNPA 4DRWA 2PMYA 3VRNA 4Q04A 3EK7A 1W7TA 3DQHA 1AHRA 1TWOA 1DJZA 1G7KA 1HCJA 4W6PA 2HPWA 3WNXB 1BF5A 3ST4A 2LM5A 2V53A 3U0NA 1A4PA 1A29A 1E8AA 2LLUA 5DU0A 1BU3A 1QLKA 1TUJA 4PHJA 2L4IA 2NXQA 3ED8A 3CLNA 1CLLA 4MEWA 4KAGA 3CGAA 2VZXA 1UHNA 1XFVO 2LMUA 3SVOA 5FVFA 4M2OA 2K8MB 2QEOA 2OJKA 4KYNA 2I18A 1MQ1A 3OB1B 1JC0A 3IVTA 3IF7A 2PXWA 1XMZA 1S5GZ 4F0ZB 3DY9A 3GK1A 5BTTA 4IK4A 3B7AA 5LK4A 2M29A 4ZF3A 5HKWA 1WDCB 1S36A 2QU1A 4ZFSA 1W7SA 3DQ4A 1EMKA 2A48A 4LQUA 2VVHA 1IGVA 1YX8A 4W7FA 1IJ5A 1IG5A 1OOGA 2YDZA 1TCFA 3SG6A 5KU1A 4FTGA 4U8DA 3LS3A 5HL1A 4P1QA 3DYEA 1EMBA 2F3ZA 2OTGB 2LHLA 3AI5A 2WCHA 4D1EA 5KSZA 1H4BA 4FQTA 4W6HA 2K2FA 1OOHA 1HQVA 2Z6ZA 1DJYA 1XYDA 2I94A 2O5GA 3O4YA 3PN7C 3V2LA 1QXTA 4LQTA 2ZNDA 1ZUXA 2G6XA 4H48A 5K89A 2PQLA 3NEDA 2KGBC 2JPOA 3SVBA 4JGEA 2EMDA 1J7RA 3WXAA 1CKKA 5HZSA 5DICA 2D8NA 2BCBA 1MOVA 2JTZA 2JT0A 2HQ8A 1AVSA 1JUOA 4M2PA 2NZ0A 1UUSA 2WHUA 2KFHA 1BMOA 2I2RE 2JZIA 3O78A 3PN7B 2QRFA 3EG5B 1HUYA 3R72A 4CFQA 4W6OA 2L0PA 2F2PA 4MRYA 1A03A 4DXNA 1SY9A 2AMIA 1TCOB 1Z1PA 2E30A 1Z4HA 2JT8A 4W7DA 3OGOA 1XFRA 2QLIA 2HF5A 4XJKB 2FOTA 1B4CA 5AANA 1DF0A 3MSEB 1RJVA 1XFUO 1MF8B 3AKBA 3ZULA 3CD1A 5HZTA 2WCBA 4NDBA 4HRHA 3SSYA 1EJ3A 1IJ6A 1KK8C 2KYCA 1EMLA 3EK4A 4AR7A 4ZBLA 2JPTA 1EMCA 1RMPA 3PJBA 1CM1A 2AAOA 1CFPA 1TUZA 4W6JA 3W1CA 1SL7A 5D69A 4PPJA 3VICA 3FE8A 1R6PA 1XFXO 1Y1AA 5DKQA 5EXUA 4C0JA 1OZOA 4GOBA 2LANA 4PE7A 1YRTB 2PRUA 2LE9B 1L2OC 2FCEA 5CSFA 3B88A 3SIBA 2KOTA 3V3DA 1MWNA 2HPSA 4Q7RA 1S6CA 5DKNA 1KK7Y 1MXLC 3ST2A 3ZNIA 2ZN9A 1K93D 1PVAA 1NCYA 1V1GA 1ALVA 1K9PA 1TNWA 1XFZO 1YHIA 2JC2A 3D0YA 3UO9A 3DPWA 4I5KA 2KPHA 1YUSA 1LA3A 4OKHA 4MN0A 1DC1A 4I5LB 4I5NB 1NYAA 5HKYA 1ZGQA 3DQOA 3GK2A 4W7CA 5BT0A 1WLMA 3HCMA 2G3DB 4W6IA 5B8IB 2LP3A 4ZB1A 1OOFA 1Q4DA 1BODA 2K2AA 1B1GA 4L13A 1B9CA 3NF0A 2BE4A 1EG4A 5ER4X 3AAKA 3C1VA 1JFJA 5I94A 3A8SA 4W76A 4IJ7A 1RK9A 3DQDA 2JT3A 4ORAB 5DPJA 2VVJA 1XAEA 2AH8A 3NSOA 3LA1A 2WNDA 2C9IA 2SASA 4AOMA 3PJ7A 1IQ3A 1BR1B 5EXBA 5H87A 1A75A 4C0LA 4KF5A 4INXA 2F8PA 1QX5B 5DPHA 2K0JA 3NGVA 3H4SE 4GESB 1DF0B 2PYQA 3DZTA 1DJIA 3TDUA 1S6IA 2KGRA 5AQBB 1B8RA 1CDNA 2KHNA 4R6DA 4J8AA 5AERA 3E5TA 3G9AA 3O6BA 4JPZB 3WHUB 1ODBA 1QVIZ 4JKTA 1NWDA 3FWBA 4A4BA 4NQGA 4PE0A 3ST0A 2LV7A 4B30A 4F7FA 1CDPA 3EVPA 3KCTA 4U2VA 1G33A 4W7RA 1Y0VH 3TUYC 5BPJA 4Z4KA 2HRSA 3S0EA 1K96A 3GOFA 3B87A 2DUEA 5DPGA 1OMDA 4W6TA 3QRXA 1UURA 1U5IA 4W6KA 1FI6A 2LHIA 4GAOA 2OKWA 1QIVA 2GX2A 4OCIA 3SVRA 2Y0GA 3CS1A 1S3PA 3SRYA 4ZF5A 2WCJA 1CMGA 2DDCA 4W75A 3ZWHA 4PT1A 3K1EA 2KI6C 4H3MA 4GBAA 2NCPA 4RYWA 4GGFC 1WRZA 1JC1A 2KFGA 3BUWB 2A47A 1KYSA 2WURA 3MGFA 4CFRA 4R1EA 5EXCI 1JWDA 3A8RA 3BOWB 3H1OA 1XSSA 4B5YA 1CFCA 2EC6C 1NP8A 2IS9A 2K7DA 1OE9B 2P71A 1YUUA 3P28A 1FPWA 1RWYA 4HRGA 1CLBA 3LVCA 3AKOA 2PXSA 2AWLA 2M3WA 2M97A 4INWA 2KDHA 1JF2A 3DVKA 3RZSA 1DJXA 3CZ1A 3JVTB 1EMMA 1W9ZA 1ZUZA 2KAXA 4H3NA 2G6YA 2M8UA 5GQQC 2WCLA 2NCOA 1K95A 3WHTB 3CR2A 2FWQA 4IK1A 3N7HA 5DQBA 2A50B 2KLEA 4EN1A 5PALA 1EMEA 2A46A 4KF4A 3F45A 2LMTA 3FE6A 5H89A 1QATA 4YRUA 3CFAA 1AP4A 3PSRA 1S1EA 4DKNA 1Q73A 1FW4A 3CWGA 2JNXA 4P5OE 2H5OA 4GGNA 3B86A 5T3IA 1CMFA 3ICBA 4NWSA 3EKHA 3DQEA 1MXEA 3D0YB 1W7JB 1EMGA 2JQ6A 4UPGA 3IP2A 2AWJA 2PASA 2A56B 2LCPA 3SSTA 2K7CA 3SSHA 1ZMZA 3DF0A 3DXLA 3KF9A 1RMOA 1LA0A 2WCFA 4YI8A 4GNKB 2C9JA 2QEBA 2BAPA 2G2SB 3O2PA 1AK8A 3RWTA 2FJYA 2I7AA 4AQIA 5DTZA 4W6AA 3PJ5A 3OX5A 2M9GA 4DUQA 4GPLB 3ZTFA 1ZACA 4BY5A 1XA5A 1SRAA 4PCWA 1FF1A 4ICBA 1Q4AA 4HSZA 1BG1A 2WORA 4M2QA 1K9KA 3JVTC 2KAVA 1DEKA 2QEVA 4YI9A 4W6LA 4IZNA 1X02A 1SCVA 1BT6A 4W6RA 2AWKA 3NHTA 2H8QA 1CDLA 2HQWA 1LKJA 4KGFA 2EMOA 1YR5A 3U8AA 1A2XA 3U8CA 1SCMC 2JRFA 1Y1UA 2P70A 4DXIA 3Q8IA 3I19A 2MAZA 3CR4X 4W7XA 4ZCVA 1KQMC 3DQJA 3VK1A 2DUFA 1GJYA 4N1GA 3OGNA 1C07A 2WCEA 3CZ0A 5DRFA 2OGRA 4LJBA 5DKRA 1SKTA 3EVVA 3DVJA 2G6EA 4W7EA 3L4AA 2ZRSA 4MRXA 1OW4A 4GUKA 5DY6A 1KWOC 1IIOA 2L50A 1FI5A 1PK0D 3LF3A 4HREE 1Y1XA 1M31A 1XK4C 3DVMA 2KI4B 2YFPA 3SSPA 3A4UB 4HQ8A 4LJDC 4XOWA 2QLGB 1OQPA 4I2YA 4EMQA 1XQMA 1F55A 4PHNA 2Z1OA 1GFLA 3BXKA 2QLHA 2KSPA 1PSBA 2SCPA 1F54A 3UNWA 1D1OA 2PVBA 3UG0A 1SYMA 1KYPA 1NUBA 1EMAA 2ZRTA 2MRDA 4PHKA 1GGWA 1OXEA 3QMEA 3AI4A 1XK4A 3NHIA 3DQCA 4I5JA 3DQMA 1QYOA 1H6RA 1XO5A 2M0RA 5CSIA 4LW5A 1UHIA 1TTXA 3CR5X 4CLNA 1CTRA 3DQ6A 1AJ4A 4GF6B 1QASA 3I5FB 5HGEA 3OHMB 2DD9A 1R2UA 3PLFB 2WCKA 1YHHA 4TNCA 1MHOA 2ZN8A 4PALA 1F09A 2QLGA 2Z6YA 3BXBA 2LUXA 2RGIA 1J1DA 4OR9B 2WCMA 1SBJA 2OTBA 2KFFA 4KA9A 1Z2CB 3KHEA 3TS5C 2POXA 2Q57A 4B30B 5J3XA 1KCYA 2CT9A 2OTEA 1F4QA 4YGCB 3FIAA 1DQEA 2GTEA 1TNQA 4TZGA 3DPZA 5DPIA 1QXPA 1IKUA 1J7PA 1JBAA 1WLZA 4YGDB 3I5HB 5G08A 1SW8A 3DPXA 1QV1A 3SS3A 3BXAA 2HQZA 4IL1A 3JTDC 1YZWA 1UHJA 2JNFA 2OTGC 2AWMA 1KSMA 1OOJA 3CZ2A 2YE1A 3U0MA 2M49B 3LVAA 2BBNA 5DTLA 3SIAA 4W6DA 4YGEB 1NX2A 2A52B 5D3OA 3OBVA 1IQ5A 1XFYO 2FCDA 4KPIA 2Y1MA 2O24A 1K90D 5FYXA 4HQ9A 4KEXA 1RFJA 4E68A 1DVIA 1UWOA 1CLMA 4J88A 1A75B 1KYRA 4N3DA 1QLSA 3VRPA 1M39A 4A4CA 4MZJA 1Q4EA 5AFPA 4QJ3B 4AQJA 4WRIA 2BE6A 2JWWA 3DQUA 4IK9A 4H3LA 4UTSA 1OOIX 4OHSA 1MUXA 3SVSA 4JC2A 1DGUA 1PSRA 2G2BA 2WC8A 3SSLA 4XJKA 1EH2A 5FI6A 4Q9XA 3WCKA 4HE4A 4CIDA 2BKIB 1YJ2A 3DQ8A 3CD9A 2H2KA 4ETOA 4ZF4A 4PFEA 4JWQA 5HLOA 1DELA 3LK0A 3IQQA 1NPQA 2E6WA 1DGVA 1QIWA 5F6TA 2ZMWA 3LK1A 4P2YB 1PRWA 3TUYB 4OV2A 1OSAA 4W6FA 4DCKA 1YRUB 1B7TZ 2ISDA 1QYFA 1ZOTB 2H5RA 2QDIA 3FS7A 3BQ3A 3FE9A 1WRKA 3L47A 2L51A 2TN4A 1V1FA 2FJUB 5EBJA 4DIRA 3DQLA 4W73A 3I5HC 4Q7UA 5TNCA 1B8CA 2OS8B 4N5XA 3SVEA 1DJWA 1C7WA 1YJFA 1KK8B 2DUGA 5DQMA 3SVCA 1KSOA 3PALA 4Q9WA 1Y6WA 1NSHA 5FI2A 4MZKA 1KFUS 1CDMA 1Q4BA 2DUIA 1TRFA 5DTXA 3WLCA 2JXCA 3SVNA 2DD7A 1CFDA 3PATA 3EK8A 1YTZC 4N1FA 1RMMA 5I8NA 2A54B 1RM9A 4BY4A 2BL0C 3VHTB 3JTDB 3KPXA 4EULA 4DXQA 2K7BA 2M1UA 1RRXA 3CFFA 2ZFDA 4ORBB 4W69A 2GV5A 4FQOA 3PJIA 3DQ5A 3DQIA 3DQ7A 1CM4A 2WOSA 4MLWA 1U5IB 3SJSA 4IK5A 3I5GB 2LMVA 2H5PA 4GGFA 2KI4C 2LP2A 3IQOA 4OY4A 1EXRA 1T14A 2LVKA 3PM8A 4RTCA 4W6BA 1N2DA 5DRGA 1BR4B 3EVRA 3S0BA 2V4EA 1TNPA 2O60A 2ERBA 2BL0B 1SMGA 1ORGA 1OMVA 3TZ1A 5EL2A 1ZGPA 3U0KA 1RROA 1EL4A 1LXFC 3ST3A 4NDCA 1DT7B 3D10A 3BUXB 3CZTX 2QLEA 3I5GC 1B8LA 3SS4A 4PPKA 1YUTA 3LLEA 3S05A 1QS7A 5CSJA 5LTQA 2OKYA 2OS8C 4KW9A 3BUMB 2WHSA 2LC5A 4Q7TA 3PM2A
chains in the Genus database with same CATH topology
1J1EA 3K1KA 1NX3A 1TOPA 5CPVA 3SG5A 2COLB 3PIBA 1JC2A 2GX0A 3DQ2A 2H9WA 1UP5A 2ZO7A 2F2OA 2Y1NA 1YVHA 2WSOA 3OSQA 5I2QA 3TMRA 2KI6D 5EB7A 3DQAA 4W7AA 2VAEA 4KF5C 1QTXA 3BX9A 2BTJA 1K8UA 1K94A 3CTNA 4YGAA 1VRKA 1NIWA 2V4EC 5BTTB 1OZSA 4PHMA 2A4JA 2HJOA 2JOJA 3SS0A 1QV0A 2HETA 1MOUA 3FWCA 3LCPC 1HT9A 1EMFA 1F70A 2O29A 2ZNEA 2G5ZB 3E5VA 1B7TY 2Q6PA 1K2HA 2LVVA 1Z1QA 2L2EA 1PULA 3VRRA 3DQNA 2H5QA 1KK7Z 1L2OB 1F0BA 1QX7A 2P6BB 2Y4QA 1H8BA 1JBZA 2V4EB 4ZIOA 1F71A 1M45A 1K9UA 5J2OA 2CTNA 3TMTA 5FVIA 4XL5A 2LLTA 3CB9A 2AHAA 5FHVA 4OVNF 5LTRA 5I2OA 3OSRA 4J89A 1RECA 5H88A 2CBLA 3RLZA 1UHHA 4ZCUA 1UHKA 2MBXA 2QACA 1NCZA 1SNLA 3GJ2A 4MBEA 2MHHA 4OJ0A 3SVDA 2EC6B 4PDZA 2Q4UA 2QZ0A 4DXPA 1XVJA 2LLSA 3AKAA 1DJHA 4ORCB 1F4OA 2B3QA 4JEOA 1YFPA 4L1IA 3LL8B 3GJ1A 2HGDA 2JULA 1UISA 4PE4A 1M46A 3GB3A 1TN4A 3AAJA 4NDDA 4GFTA 3DD4A 2EGDA 4HVFA 4JRBA 3M22A 2Q91A 2G16B 4KW8A 1GGZA 3CBEA 3SV5A 3VHTA 2VADA 1BJFA 3K21A 2DUHA 1B9AA 1OMRA 1Q80A 4WQ2A 3GL4A 1QX2A 3VROA 4XVPA 2K61A 2IB6A 1YHGA 1XFWO 1ZFSA 1QY3A 1BLQA 1M63B 1SR6C 1EG3A 2H6VA 2G3OA 2QPTA 2MLEC 4QJ4B 3BUNB 4Z4MA 5CSNA 1IWQA 3PFVA 3LF4B 1KFUL 4XOVA 3EKJA 2JXLA 1BOCA 2ICRA 2PALA 2AUCA 2HGYA 1NX0A 2KQYA 5HZUA 2O2BA 4IK8A 4OQWA 3H1RA 2A53B 4MSPA 3NSIA 4YBHB 1KFXS 1SR6B 1SL9A 4DXMA 3SG2A 3TDIA 4OGSA 3BUOB 4YGBB 4LJCA 4PPLA 3DQ3A 3TS5B 1SK6D 2KYFA 3LSAA 5DTYA 4DXOA 3LVDA 1GGXA 3CFHA 3DQ1A 3E5WA 2ZKMX 5ER5A 2M1KB 4R6BA 1JSAA 1B47A 4C0KA 3BOWA 5KTGA 2JTTA 4EDOA 4PE1A 1SCMB 5HKZA 1CFFA 4ANJA 1J55A 4L9MA 2HFCA 2FL1A 4RYSA 2LNKA 3VRQA 1QYQA 2MA2A 2ZO6A 3O77A 4ZINA 1GQMA 2KBIA 2YE0A 2LUCA 2PSRA 2WISA 5HBDA 4HQCA 1AJ5A 1SPYA 3M0WA 5D7FA 1BFPA 1IRJA 1OXFA 2H61A 1S26D 4CPVA 2OPOA 2M7LA 4JF9A 3U8PA 4LJDA 3SG4A 1CB1A 1GL4A 4TZAA 1NCXA 2HQKA 2JU0A 1W7UA 3OB2B 5EJUA 2NLNA 5FVGA 1JFKA 2BBMA 4IK3A 2KAYA 1SL8A 2WSNA 2M7NA 3GK4X 2FZUA 1J7QA 1WDCC 1YX7A 2LAPA 4W6GA 3W1DA 1C4FA 5JOLA 2ZMUA 3SSKA 2WHTA 1G4YR 1KQVA 4W6UA 1G8IA 1QVIY 5JJGA 5F9GA 5IBWA 2BKHB 2GGZA 1IH0A 1RTP1 1LVCD 3SG7A 2MJWB 3NXAA 5HW9A 1YVLA 3NT9A 3SVUA 3E3RA 2GW3A 3DQKA 1AUIB 2WIQA 2DDDA 3I5FC 4WQ3A 1DMOA 1XA9A 4W6SA 5LTPA 3DVEA 2B1UA 5HZOA 3BYAA 2Y5IA 1L7ZA 1TIZA 5I2LA 4DKMA 2IB5A 1S6ZA 2VVIA 2K7OA 5EB6A 1OXDA 3OX6A 2LVJA 4JQ0D 3DQFA 1F8HA 3KCSA 3NSKA 2R2IA 1W7IB 2BECA 3TDZA 1DJGA 5HYDA 5EHUA 2BCAA 2JADA 1KQMB 4MZLA 2CNPA 2H61C 4KGEA 2KQ6A 3I5IB 1C7VA 3CGLA 3KEVA 2KBMA 4L12A 4QJ5B 2P4MA 1MYWA 3NT3A 2Z6XA 1CV7A 4P76A 4MVFA 4DS7A 4W72A 1PALA 1ALWA 1Q4CA 1DTLA 3VGOA 1J7OA 1H4UA 2DOQA 3IR8A 1S5GY 2ARLA 1NX1A 3GEXA 3M24A 3NEZA 3U0LA 3KO0A 3ADFA 4JFGA 2CXJA 3BXCA 1S6JA 5BQLA 5HLVA 4USLA 3DF0B 1N65A 5AEQA 4W6NA 3HX4A 3UFZA 4ORNA 2B3PA 1JF0A 2KNEA 4EDSA 1WRLA 5AXIA 3DQ9A 4BDUA 1WY9A 3SSVA 1N0YA 2BCXA 3ZUJA 3RWAA 1PVBA 2EHBA 2IE2A 1KFXL 1JBYA 2HCGA 1KP5A 4AS8A 5KTYA 1MR8A 4W6MA 4XGYA 3SG3A 2L5XB 4W74A 4H47A 1KWOB 1YURA 4W77A 3P8UA 3WLDA 3RM1A 1FBVA 1LINA 2EMNA 2QT2A 2LVIA 4XYNA 2L98A 2MLFC 2GW4B 2IOVA 2F3YA 3NSLA 3I5IC 3EVUA 2L4HA 1TNXA 2VRGA 2G9BA 1QJTA 2F33A 3OP0A 2RH7A 4KW4A 1ZGOA 3ZUFA 4W6CA 2CCMA 2GGMA 1CNPA 4DRWA 2PMYA 3VRNA 4Q04A 3EK7A 1W7TA 3DQHA 1AHRA 1DJZA 1G7KA 1HCJA 4W6PA 2HPWA 3WNXB 1BF5A 3ST4A 2LM5A 2V53A 3U0NA 1A4PA 1A29A 1E8AA 2LLUA 5DU0A 1BU3A 1QLKA 4PHJA 2L4IA 2NXQA 3ED8A 3CLNA 1CLLA 4MEWA 4KAGA 3CGAA 2VZXA 1UHNA 1XFVO 2LMUA 3SVOA 5FVFA 4M2OA 2K8MB 2OJKA 2I18A 1MQ1A 3OB1B 1JC0A 3IF7A 2PXWA 1XMZA 1S5GZ 4F0ZB 3GK1A 5BTTA 4IK4A 5LK4A 2M29A 4ZF3A 5HKWA 1WDCB 1S36A 2QU1A 4ZFSA 1W7SA 3DQ4A 1EMKA 2A48A 4LQUA 2VVHA 1IGVA 1YX8A 4W7FA 1IJ5A 1IG5A 2YDZA 1TCFA 3SG6A 5KU1A 4FTGA 4U8DA 3LS3A 4P1QA 1EMBA 2F3ZA 2OTGB 2LHLA 3AI5A 4D1EA 5KSZA 1H4BA 4W6HA 2K2FA 1HQVA 2Z6ZA 1DJYA 1XYDA 2I94A 2O5GA 3O4YA 3PN7C 1QXTA 4LQTA 2ZNDA 1ZUXA 2G6XA 4H48A 5K89A 3NEDA 2KGBC 3SVBA 4JGEA 2EMDA 1J7RA 3WXAA 1CKKA 5HZSA 2D8NA 2BCBA 1MOVA 2JTZA 2JT0A 2HQ8A 1AVSA 1JUOA 4M2PA 2NZ0A 1UUSA 2WHUA 2KFHA 1BMOA 2I2RE 2JZIA 3O78A 3PN7B 2QRFA 1HUYA 4CFQA 4W6OA 2L0PA 2F2PA 4MRYA 1A03A 4DXNA 1SY9A 2AMIA 1TCOB 1Z1PA 2E30A 2JT8A 4W7DA 3OGOA 2QLIA 2HF5A 4XJKB 2FOTA 1B4CA 5AANA 1DF0A 3MSEB 1RJVA 1XFUO 1MF8B 3AKBA 3ZULA 3CD1A 5HZTA 2WCBA 4NDBA 4HRHA 3SSYA 1EJ3A 1IJ6A 1KK8C 2KYCA 1EMLA 3EK4A 4AR7A 4ZBLA 2JPTA 1EMCA 1RMPA 3PJBA 1CM1A 2AAOA 1CFPA 4W6JA 3W1CA 1SL7A 5D69A 4PPJA 3VICA 1R6PA 1XFXO 1Y1AA 5DKQA 5EXUA 4C0JA 1OZOA 4GOBA 2LANA 4PE7A 1YRTB 2PRUA 2LE9B 1L2OC 2FCEA 5CSFA 3SIBA 2KOTA 3V3DA 1MWNA 2HPSA 4Q7RA 1S6CA 5DKNA 1KK7Y 1MXLC 3ST2A 3ZNIA 2ZN9A 1K93D 1PVAA 1NCYA 1V1GA 1ALVA 1K9PA 1TNWA 1XFZO 1YHIA 2JC2A 3D0YA 3DPWA 4I5KA 1YUSA 1LA3A 4OKHA 4MN0A 4I5LB 4I5NB 1NYAA 5HKYA 1ZGQA 3DQOA 3GK2A 4W7CA 5BT0A 1WLMA 3HCMA 2G3DB 4W6IA 5B8IB 2LP3A 4ZB1A 1Q4DA 1BODA 2K2AA 1B1GA 4L13A 1B9CA 3NF0A 2BE4A 1EG4A 5ER4X 3AAKA 3C1VA 1JFJA 3A8SA 4W76A 1RK9A 3DQDA 2JT3A 4ORAB 5DPJA 2VVJA 1XAEA 2AH8A 3NSOA 3LA1A 2WNDA 2C9IA 2SASA 4AOMA 3PJ7A 1IQ3A 1BR1B 5EXBA 5H87A 1A75A 4C0LA 4KF5A 2F8PA 1QX5B 5DPHA 2K0JA 3H4SE 4GESB 1DF0B 1DJIA 3TDUA 1S6IA 2KGRA 5AQBB 1B8RA 1CDNA 2KHNA 4R6DA 4J8AA 5AERA 3E5TA 3G9AA 3O6BA 4JPZB 3WHUB 1ODBA 1QVIZ 1NWDA 3FWBA 4A4BA 4NQGA 4PE0A 3ST0A 2LV7A 4B30A 1CDPA 3EVPA 3KCTA 4U2VA 1G33A 4W7RA 1Y0VH 3TUYC 5BPJA 4Z4KA 2HRSA 1K96A 3GOFA 5DPGA 2DUEA 1OMDA 4W6TA 3QRXA 1UURA 1U5IA 4W6KA 1FI6A 2LHIA 4GAOA 2OKWA 1QIVA 2GX2A 4OCIA 3SVRA 2Y0GA 3CS1A 1S3PA 3SRYA 4ZF5A 1CMGA 2DDCA 4W75A 3ZWHA 2KI6C 4H3MA 4GBAA 2NCPA 4RYWA 4GGFC 1WRZA 1JC1A 2KFGA 3BUWB 2A47A 1KYSA 2WURA 3MGFA 4CFRA 4R1EA 5EXCI 1JWDA 3A8RA 3BOWB 3H1OA 1XSSA 4B5YA 1CFCA 2EC6C 1NP8A 2IS9A 2K7DA 1OE9B 1YUUA 3P28A 1FPWA 1RWYA 4HRGA 1CLBA 3LVCA 3AKOA 2PXSA 2AWLA 2M3WA 2M97A 2KDHA 1JF2A 3DVKA 1DJXA 3JVTB 1EMMA 1ZUZA 2KAXA 4H3NA 2G6YA 2M8UA 5GQQC 2NCOA 1K95A 3WHTB 3CR2A 2FWQA 4IK1A 5DQBA 2A50B 4EN1A 5PALA 1EMEA 2A46A 4KF4A 3F45A 2LMTA 5H89A 1QATA 4YRUA 3CFAA 1AP4A 3PSRA 1S1EA 4DKNA 1Q73A 1FW4A 3CWGA 2JNXA 4P5OE 2H5OA 4GGNA 5T3IA 1CMFA 3ICBA 4NWSA 3EKHA 3DQEA 1MXEA 3D0YB 1W7JB 1EMGA 2JQ6A 4UPGA 3IP2A 2AWJA 2PASA 2A56B 2LCPA 3SSTA 2K7CA 3SSHA 1ZMZA 3DF0A 3KF9A 1RMOA 1LA0A 2WCFA 4YI8A 4GNKB 2C9JA 2G2SB 3O2PA 1AK8A 3RWTA 2I7AA 4AQIA 5DTZA 4W6AA 3PJ5A 3OX5A 2M9GA 4DUQA 4GPLB 3ZTFA 1ZACA 4BY5A 1XA5A 1SRAA 4PCWA 1FF1A 4ICBA 1Q4AA 4HSZA 1BG1A 2WORA 4M2QA 1K9KA 3JVTC 2KAVA 4YI9A 4W6LA 4IZNA 1X02A 1SCVA 1BT6A 4W6RA 2AWKA 2H8QA 2HQWA 1CDLA 1LKJA 4KGFA 2EMOA 1YR5A 3U8AA 1A2XA 3U8CA 1SCMC 2JRFA 1Y1UA 4DXIA 3I19A 2MAZA 3CR4X 4W7XA 4ZCVA 1KQMC 3DQJA 3VK1A 2DUFA 1GJYA 4N1GA 1C07A 2WCEA 5DRFA 2OGRA 4LJBA 5DKRA 1SKTA 3EVVA 3DVJA 2G6EA 4W7EA 2ZRSA 4MRXA 4GUKA 5DY6A 1KWOC 2L50A 1FI5A 1PK0D 3LF3A 4HREE 1Y1XA 1M31A 1XK4C 3DVMA 2KI4B 2YFPA 3SSPA 3A4UB 4HQ8A 4LJDC 4XOWA 2QLGB 1OQPA 4I2YA 4EMQA 1XQMA 1F55A 4PHNA 2Z1OA 1GFLA 3BXKA 2QLHA 2KSPA 1PSBA 2SCPA 1F54A 1D1OA 2PVBA 3UG0A 1SYMA 1KYPA 1NUBA 1EMAA 2ZRTA 2MRDA 4PHKA 1GGWA 1OXEA 3AI4A 1XK4A 3DQCA 4I5JA 3DQMA 1QYOA 1H6RA 1XO5A 2M0RA 5CSIA 4LW5A 1UHIA 1TTXA 3CR5X 4CLNA 1CTRA 3DQ6A 1AJ4A 4GF6B 1QASA 3I5FB 5HGEA 3OHMB 2DD9A 1R2UA 3PLFB 1YHHA 4TNCA 1MHOA 2ZN8A 4PALA 1F09A 2QLGA 2Z6YA 3BXBA 2LUXA 2RGIA 1J1DA 4OR9B 1SBJA 2OTBA 2KFFA 4KA9A 3KHEA 3TS5C 2POXA 2Q57A 4B30B 5J3XA 1KCYA 2CT9A 1F4QA 4YGCB 2OTEA 3FIAA 1TNQA 4TZGA 3DPZA 5DPIA 1QXPA 1IKUA 1J7PA 1JBAA 1WLZA 4YGDB 3I5HB 5G08A 1SW8A 3DPXA 1QV1A 3BXAA 2HQZA 4IL1A 3JTDC 1YZWA 1UHJA 2JNFA 2OTGC 2AWMA 1KSMA 1OOJA 2YE1A 3U0MA 2M49B 3LVAA 2BBNA 5DTLA 3SIAA 4W6DA 4YGEB 1NX2A 2A52B 1IQ5A 1XFYO 2FCDA 4KPIA 2Y1MA 2O24A 1K90D 5FYXA 4HQ9A 4KEXA 1RFJA 4E68A 1DVIA 1UWOA 1CLMA 4J88A 1A75B 1KYRA 4N3DA 1QLSA 3VRPA 1M39A 4A4CA 4MZJA 1Q4EA 5AFPA 4QJ3B 4AQJA 4WRIA 2BE6A 2JWWA 3DQUA 4IK9A 4H3LA 4UTSA 4OHSA 1MUXA 3SVSA 4JC2A 1DGUA 1PSRA 2G2BA 2WC8A 3SSLA 4XJKA 1EH2A 4Q9XA 3WCKA 4HE4A 4CIDA 2BKIB 1YJ2A 3DQ8A 3CD9A 2H2KA 4ETOA 4ZF4A 4PFEA 4JWQA 5HLOA 3LK0A 3IQQA 1NPQA 2E6WA 1DGVA 1QIWA 5F6TA 2ZMWA 3LK1A 4P2YB 1PRWA 3TUYB 4OV2A 1OSAA 4W6FA 4DCKA 1YRUB 1B7TZ 2ISDA 1QYFA 1ZOTB 2H5RA 3FS7A 3BQ3A 1WRKA 2L51A 2TN4A 1V1FA 2FJUB 5EBJA 4DIRA 3DQLA 4W73A 3I5HC 4Q7UA 5TNCA 1B8CA 2OS8B 4N5XA 3SVEA 1DJWA 1C7WA 1YJFA 1KK8B 2DUGA 5DQMA 3SVCA 1KSOA 3PALA 4Q9WA 1Y6WA 1NSHA 4MZKA 1KFUS 1CDMA 1Q4BA 2DUIA 1TRFA 5DTXA 3WLCA 2JXCA 3SVNA 2DD7A 1CFDA 3PATA 3EK8A 1YTZC 4N1FA 1RMMA 5I8NA 2A54B 1RM9A 4BY4A 2BL0C 3VHTB 3JTDB 3KPXA 4EULA 4DXQA 2K7BA 2M1UA 1RRXA 3CFFA 2ZFDA 4ORBB 4W69A 2GV5A 4FQOA 3DQ5A 3DQIA 3DQ7A 1CM4A 2WOSA 4MLWA 1U5IB 3SJSA 4IK5A 3I5GB 2LMVA 2H5PA 4GGFA 2KI4C 2LP2A 3IQOA 4OY4A 1EXRA 2LVKA 3PM8A 4RTCA 4W6BA 1N2DA 5DRGA 1BR4B 3EVRA 2V4EA 1TNPA 2O60A 2BL0B 1SMGA 1OMVA 3TZ1A 1ZGPA 3U0KA 1RROA 1EL4A 1LXFC 3ST3A 4NDCA 1DT7B 3D10A 3BUXB 3CZTX 2QLEA 3I5GC 1B8LA 4PPKA 1YUTA 3LLEA 3S05A 1QS7A 5CSJA 5LTQA 2OKYA 2OS8C 4KW9A 3BUMB 2WHSA 2LC5A 4Q7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J1E A;  3K1K A;  1NX3 A;  1TOP A;  5CPV A;  3SG5 A;  2COL B;  3PIB A;  1JC2 A;  2GX0 A;  3DQ2 A;  2H9W A;  1UP5 A;  2ZO7 A;  2F2O A;  2Y1N A;  1YVH A;  2WSO A;  3OSQ A;  5I2Q A;  3TMR A;  2KI6 D;  5EB7 A;  3DQA A;  4W7A A;  2VAE A;  4KF5 C;  1QTX A;  3BX9 A;  2BTJ A;  1K8U A;  1K94 A;  3CTN A;  4YGA A;  1VRK A;  1NIW A;  2V4E C;  5BTT B;  1OZS A;  4PHM A;  2A4J A;  2HJO A;  2JOJ A;  3SS0 A;  1QV0 A;  2HET A;  1MOU A;  3FWC A;  3LCP C;  1HT9 A;  1EMF A;  1F70 A;  2O29 A;  2ZNE A;  2G5Z B;  3E5V A;  1B7T Y;  2Q6P A;  1K2H A;  2LVV A;  1Z1Q A;  2L2E A;  1PUL A;  3VRR A;  3DQN A;  2H5Q A;  1KK7 Z;  1L2O B;  1F0B A;  1QX7 A;  2P6B B;  2Y4Q A;  1H8B A;  1JBZ A;  2V4E B;  4ZIO A;  1F71 A;  1M45 A;  1K9U A;  5J2O A;  2CTN A;  3TMT A;  5FVI A;  4XL5 A;  2LLT A;  3CB9 A;  2AHA A;  5FHV A;  4OVN F;  5LTR A;  5I2O A;  3OSR A;  4J89 A;  1REC A;  5H88 A;  2CBL A;  3RLZ A;  1UHH A;  4ZCU A;  1UHK A;  2MBX A;  2QAC A;  1NCZ A;  1SNL A;  3GJ2 A;  4MBE A;  2MHH A;  4OJ0 A;  3SVD A;  2EC6 B;  4PDZ A;  2Q4U A;  2QZ0 A;  4DXP A;  1XVJ A;  2LLS A;  3AKA A;  1DJH A;  4ORC B;  1F4O A;  2B3Q A;  4JEO A;  1YFP A;  4L1I A;  3LL8 B;  3GJ1 A;  2HGD A;  2JUL A;  1UIS A;  4PE4 A;  1M46 A;  3GB3 A;  1TN4 A;  3AAJ A;  4NDD A;  4GFT A;  3DD4 A;  2EGD A;  4HVF A;  4JRB A;  3M22 A;  2Q91 A;  2G16 B;  4KW8 A;  1GGZ A;  3CBE A;  3SV5 A;  3VHT A;  2VAD A;  1BJF A;  3K21 A;  2DUH A;  1B9A A;  1OMR A;  1Q80 A;  4WQ2 A;  3GL4 A;  1QX2 A;  3VRO A;  4XVP A;  2K61 A;  2IB6 A;  1YHG A;  1XFW O;  1ZFS A;  1QY3 A;  1BLQ A;  1M63 B;  1SR6 C;  1EG3 A;  2H6V A;  2G3O A;  2QPT A;  2MLE C;  4QJ4 B;  3BUN B;  4Z4M A;  5CSN A;  1IWQ A;  3PFV A;  3LF4 B;  1KFU L;  4XOV A;  3EKJ A;  2JXL A;  1BOC A;  2ICR A;  2PAL A;  2AUC A;  2HGY A;  1NX0 A;  2KQY A;  5HZU A;  2O2B A;  4IK8 A;  4OQW A;  3H1R A;  2A53 B;  4MSP A;  3NSI A;  4YBH B;  1KFX S;  1SR6 B;  1SL9 A;  4DXM A;  3SG2 A;  3TDI A;  4OGS A;  3BUO B;  4YGB B;  4LJC A;  4PPL A;  3DQ3 A;  3TS5 B;  1SK6 D;  2KYF A;  3LSA A;  5DTY A;  4DXO A;  3LVD A;  1GGX A;  3CFH A;  3DQ1 A;  3E5W A;  2ZKM X;  5ER5 A;  2M1K B;  4R6B A;  1JSA A;  1B47 A;  4C0K A;  3BOW A;  5KTG A;  2JTT A;  4EDO A;  4PE1 A;  1SCM B;  5HKZ A;  1CFF A;  4ANJ A;  1J55 A;  4L9M A;  2HFC A;  2FL1 A;  4RYS A;  2LNK A;  3VRQ A;  1QYQ A;  2MA2 A;  2ZO6 A;  3O77 A;  4ZIN A;  1GQM A;  2KBI A;  2YE0 A;  2LUC A;  2PSR A;  2WIS A;  5HBD A;  4HQC A;  1AJ5 A;  1SPY A;  3M0W A;  5D7F A;  1BFP A;  1IRJ A;  1OXF A;  2H61 A;  1S26 D;  4CPV A;  2OPO A;  2M7L A;  4JF9 A;  3U8P A;  4LJD A;  3SG4 A;  1CB1 A;  1GL4 A;  4TZA A;  1NCX A;  2HQK A;  2JU0 A;  1W7U A;  3OB2 B;  5EJU A;  2NLN A;  5FVG A;  1JFK A;  2BBM A;  4IK3 A;  2KAY A;  1SL8 A;  2WSN A;  2M7N A;  3GK4 X;  2FZU A;  1J7Q A;  1WDC C;  1YX7 A;  2LAP A;  4W6G A;  3W1D A;  1C4F A;  5JOL A;  2ZMU A;  3SSK A;  2WHT A;  1G4Y R;  1KQV A;  4W6U A;  1G8I A;  1QVI Y;  5JJG A;  5F9G A;  5IBW A;  2BKH B;  2GGZ A;  1IH0 A;  1RTP 1;  1LVC D;  3SG7 A;  2MJW B;  3NXA A;  5HW9 A;  1YVL A;  3NT9 A;  3SVU A;  3E3R A;  2GW3 A;  3DQK A;  1AUI B;  2WIQ A;  2DDD A;  3I5F C;  4WQ3 A;  1DMO A;  1XA9 A;  4W6S A;  5LTP A;  3DVE A;  2B1U A;  5HZO A;  3BYA A;  2Y5I A;  1L7Z A;  1TIZ A;  5I2L A;  4DKM A;  2IB5 A;  1S6Z A;  2VVI A;  2K7O A;  5EB6 A;  1OXD A;  3OX6 A;  2LVJ A;  4JQ0 D;  3DQF A;  1F8H A;  3KCS A;  3NSK A;  2R2I A;  1W7I B;  2BEC A;  3TDZ A;  1DJG A;  5HYD A;  5EHU A;  2BCA A;  2JAD A;  1KQM B;  4MZL A;  2CNP A;  2H61 C;  4KGE A;  2KQ6 A;  3I5I B;  1C7V A;  3CGL A;  3KEV A;  2KBM A;  4L12 A;  4QJ5 B;  2P4M A;  1MYW A;  3NT3 A;  2Z6X A;  1CV7 A;  4P76 A;  4MVF A;  4DS7 A;  4W72 A;  1PAL A;  1ALW A;  1Q4C A;  1DTL A;  3VGO A;  1J7O A;  1H4U A;  2DOQ A;  3IR8 A;  1S5G Y;  2ARL A;  1NX1 A;  3GEX A;  3M24 A;  3NEZ A;  3U0L A;  3KO0 A;  3ADF A;  4JFG A;  2CXJ A;  3BXC A;  1S6J A;  5BQL A;  5HLV A;  4USL A;  3DF0 B;  1N65 A;  5AEQ A;  4W6N A;  3HX4 A;  3UFZ A;  4ORN A;  2B3P A;  1JF0 A;  2KNE A;  4EDS A;  1WRL A;  5AXI A;  3DQ9 A;  4BDU A;  1WY9 A;  3SSV A;  1N0Y A;  2BCX A;  3ZUJ A;  3RWA A;  1PVB A;  2EHB A;  2IE2 A;  1KFX L;  1JBY A;  2HCG A;  1KP5 A;  4AS8 A;  5KTY A;  1MR8 A;  4W6M A;  4XGY A;  3SG3 A;  2L5X B;  4W74 A;  4H47 A;  1KWO B;  1YUR A;  4W77 A;  3P8U A;  3WLD A;  3RM1 A;  1FBV A;  1LIN A;  2EMN A;  2QT2 A;  2LVI A;  4XYN A;  2L98 A;  2MLF C;  2GW4 B;  2IOV A;  2F3Y A;  3NSL A;  3I5I C;  3EVU A;  2L4H A;  1TNX A;  2VRG A;  2G9B A;  1QJT A;  2F33 A;  3OP0 A;  2RH7 A;  4KW4 A;  1ZGO A;  3ZUF A;  4W6C A;  2CCM A;  2GGM A;  1CNP A;  4DRW A;  2PMY A;  3VRN A;  4Q04 A;  3EK7 A;  1W7T A;  3DQH A;  1AHR A;  1DJZ A;  1G7K A;  1HCJ A;  4W6P A;  2HPW A;  3WNX B;  1BF5 A;  3ST4 A;  2LM5 A;  2V53 A;  3U0N A;  1A4P A;  1A29 A;  1E8A A;  2LLU A;  5DU0 A;  1BU3 A;  1QLK A;  4PHJ A;  2L4I A;  2NXQ A;  3ED8 A;  3CLN A;  1CLL A;  4MEW A;  4KAG A;  3CGA A;  2VZX A;  1UHN A;  1XFV O;  2LMU A;  3SVO A;  5FVF A;  4M2O A;  2K8M B;  2OJK A;  2I18 A;  1MQ1 A;  3OB1 B;  1JC0 A;  3IF7 A;  2PXW A;  1XMZ A;  1S5G Z;  4F0Z B;  3GK1 A;  5BTT A;  4IK4 A;  5LK4 A;  2M29 A;  4ZF3 A;  5HKW A;  1WDC B;  1S36 A;  2QU1 A;  4ZFS A;  1W7S A;  3DQ4 A;  1EMK A;  2A48 A;  4LQU A;  2VVH A;  1IGV A;  1YX8 A;  4W7F A;  1IJ5 A;  1IG5 A;  2YDZ A;  1TCF A;  3SG6 A;  5KU1 A;  4FTG A;  4U8D A;  3LS3 A;  4P1Q A;  1EMB A;  2F3Z A;  2OTG B;  2LHL A;  3AI5 A;  4D1E A;  5KSZ A;  1H4B A;  4W6H A;  2K2F A;  1HQV A;  2Z6Z A;  1DJY A;  1XYD A;  2I94 A;  2O5G A;  3O4Y A;  3PN7 C;  1QXT A;  4LQT A;  2ZND A;  1ZUX A;  2G6X A;  4H48 A;  5K89 A;  3NED A;  2KGB C;  3SVB A;  4JGE A;  2EMD A;  1J7R A;  3WXA A;  1CKK A;  5HZS A;  2D8N A;  2BCB A;  1MOV A;  2JTZ A;  2JT0 A;  2HQ8 A;  1AVS A;  1JUO A;  4M2P A;  2NZ0 A;  1UUS A;  2WHU A;  2KFH A;  1BMO A;  2I2R E;  2JZI A;  3O78 A;  3PN7 B;  2QRF A;  1HUY A;  4CFQ A;  4W6O A;  2L0P A;  2F2P A;  4MRY A;  1A03 A;  4DXN A;  1SY9 A;  2AMI A;  1TCO B;  1Z1P A;  2E30 A;  2JT8 A;  4W7D A;  3OGO A;  2QLI A;  2HF5 A;  4XJK B;  2FOT A;  1B4C A;  5AAN A;  1DF0 A;  3MSE B;  1RJV A;  1XFU O;  1MF8 B;  3AKB A;  3ZUL A;  3CD1 A;  5HZT A;  2WCB A;  4NDB A;  4HRH A;  3SSY A;  1EJ3 A;  1IJ6 A;  1KK8 C;  2KYC A;  1EML A;  3EK4 A;  4AR7 A;  4ZBL A;  2JPT A;  1EMC A;  1RMP A;  3PJB A;  1CM1 A;  2AAO A;  1CFP A;  4W6J A;  3W1C A;  1SL7 A;  5D69 A;  4PPJ A;  3VIC A;  1R6P A;  1XFX O;  1Y1A A;  5DKQ A;  5EXU A;  4C0J A;  1OZO A;  4GOB A;  2LAN A;  4PE7 A;  1YRT B;  2PRU A;  2LE9 B;  1L2O C;  2FCE A;  5CSF A;  3SIB A;  2KOT A;  3V3D A;  1MWN A;  2HPS A;  4Q7R A;  1S6C A;  5DKN A;  1KK7 Y;  1MXL C;  3ST2 A;  3ZNI A;  2ZN9 A;  1K93 D;  1PVA A;  1NCY A;  1V1G A;  1ALV A;  1K9P A;  1TNW A;  1XFZ O;  1YHI A;  2JC2 A;  3D0Y A;  3DPW A;  4I5K A;  1YUS A;  1LA3 A;  4OKH A;  4MN0 A;  4I5L B;  4I5N B;  1NYA A;  5HKY A;  1ZGQ A;  3DQO A;  3GK2 A;  4W7C A;  5BT0 A;  1WLM A;  3HCM A;  2G3D B;  4W6I A;  5B8I B;  2LP3 A;  4ZB1 A;  1Q4D A;  1BOD A;  2K2A A;  1B1G A;  4L13 A;  1B9C A;  3NF0 A;  2BE4 A;  1EG4 A;  5ER4 X;  3AAK A;  3C1V A;  1JFJ A;  3A8S A;  4W76 A;  1RK9 A;  3DQD A;  2JT3 A;  4ORA B;  5DPJ A;  2VVJ A;  1XAE A;  2AH8 A;  3NSO A;  3LA1 A;  2WND A;  2C9I A;  2SAS A;  4AOM A;  3PJ7 A;  1IQ3 A;  1BR1 B;  5EXB A;  5H87 A;  1A75 A;  4C0L A;  4KF5 A;  2F8P A;  1QX5 B;  5DPH A;  2K0J A;  3H4S E;  4GES B;  1DF0 B;  1DJI A;  3TDU A;  1S6I A;  2KGR A;  5AQB B;  1B8R A;  1CDN A;  2KHN A;  4R6D A;  4J8A A;  5AER A;  3E5T A;  3G9A A;  3O6B A;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  1NWD A;  3FWB A;  4A4B A;  4NQG A;  4PE0 A;  3ST0 A;  2LV7 A;  4B30 A;  1CDP A;  3EVP A;  3KCT A;  4U2V A;  1G33 A;  4W7R A;  1Y0V H;  3TUY C;  5BPJ A;  4Z4K A;  2HRS A;  1K96 A;  3GOF A;  5DPG A;  2DUE A;  1OMD A;  4W6T A;  3QRX A;  1UUR A;  1U5I A;  4W6K A;  1FI6 A;  2LHI A;  4GAO A;  2OKW A;  1QIV A;  2GX2 A;  4OCI A;  3SVR A;  2Y0G A;  3CS1 A;  1S3P A;  3SRY A;  4ZF5 A;  1CMG A;  2DDC A;  4W75 A;  3ZWH A;  2KI6 C;  4H3M A;  4GBA A;  2NCP A;  4RYW A;  4GGF C;  1WRZ A;  1JC1 A;  2KFG A;  3BUW B;  2A47 A;  1KYS A;  2WUR A;  3MGF A;  4CFR A;  4R1E A;  5EXC I;  1JWD A;  3A8R A;  3BOW B;  3H1O A;  1XSS A;  4B5Y A;  1CFC A;  2EC6 C;  1NP8 A;  2IS9 A;  2K7D A;  1OE9 B;  1YUU A;  3P28 A;  1FPW A;  1RWY A;  4HRG A;  1CLB A;  3LVC A;  3AKO A;  2PXS A;  2AWL A;  2M3W A;  2M97 A;  2KDH A;  1JF2 A;  3DVK A;  1DJX A;  3JVT B;  1EMM A;  1ZUZ A;  2KAX A;  4H3N A;  2G6Y A;  2M8U A;  5GQQ C;  2NCO A;  1K95 A;  3WHT B;  3CR2 A;  2FWQ A;  4IK1 A;  5DQB A;  2A50 B;  4EN1 A;  5PAL A;  1EME A;  2A46 A;  4KF4 A;  3F45 A;  2LMT A;  5H89 A;  1QAT A;  4YRU A;  3CFA A;  1AP4 A;  3PSR A;  1S1E A;  4DKN A;  1Q73 A;  1FW4 A;  3CWG A;  2JNX A;  4P5O E;  2H5O A;  4GGN A;  5T3I A;  1CMF A;  3ICB A;  4NWS A;  3EKH A;  3DQE A;  1MXE A;  3D0Y B;  1W7J B;  1EMG A;  2JQ6 A;  4UPG A;  3IP2 A;  2AWJ A;  2PAS A;  2A56 B;  2LCP A;  3SST A;  2K7C A;  3SSH A;  1ZMZ A;  3DF0 A;  3KF9 A;  1RMO A;  1LA0 A;  2WCF A;  4YI8 A;  4GNK B;  2C9J A;  2G2S B;  3O2P A;  1AK8 A;  3RWT A;  2I7A A;  4AQI A;  5DTZ A;  4W6A A;  3PJ5 A;  3OX5 A;  2M9G A;  4DUQ A;  4GPL B;  3ZTF A;  1ZAC A;  4BY5 A;  1XA5 A;  1SRA A;  4PCW A;  1FF1 A;  4ICB A;  1Q4A A;  4HSZ A;  1BG1 A;  2WOR A;  4M2Q A;  1K9K A;  3JVT C;  2KAV A;  4YI9 A;  4W6L A;  4IZN A;  1X02 A;  1SCV A;  1BT6 A;  4W6R A;  2AWK A;  2H8Q A;  2HQW A;  1CDL A;  1LKJ A;  4KGF A;  2EMO A;  1YR5 A;  3U8A A;  1A2X A;  3U8C A;  1SCM C;  2JRF A;  1Y1U A;  4DXI A;  3I19 A;  2MAZ A;  3CR4 X;  4W7X A;  4ZCV A;  1KQM C;  3DQJ A;  3VK1 A;  2DUF A;  1GJY A;  4N1G A;  1C07 A;  2WCE A;  5DRF A;  2OGR A;  4LJB A;  5DKR A;  1SKT A;  3EVV A;  3DVJ A;  2G6E A;  4W7E A;  2ZRS A;  4MRX A;  4GUK A;  5DY6 A;  1KWO C;  2L50 A;  1FI5 A;  1PK0 D;  3LF3 A;  4HRE E;  1Y1X A;  1M31 A;  1XK4 C;  3DVM A;  2KI4 B;  2YFP A;  3SSP A;  3A4U B;  4HQ8 A;  4LJD C;  4XOW A;  2QLG B;  1OQP A;  4I2Y A;  4EMQ A;  1XQM A;  1F55 A;  4PHN A;  2Z1O A;  1GFL A;  3BXK A;  2QLH A;  2KSP A;  1PSB A;  2SCP A;  1F54 A;  1D1O A;  2PVB A;  3UG0 A;  1SYM A;  1KYP A;  1NUB A;  1EMA A;  2ZRT A;  2MRD A;  4PHK A;  1GGW A;  1OXE A;  3AI4 A;  1XK4 A;  3DQC A;  4I5J A;  3DQM A;  1QYO A;  1H6R A;  1XO5 A;  2M0R A;  5CSI A;  4LW5 A;  1UHI A;  1TTX A;  3CR5 X;  4CLN A;  1CTR A;  3DQ6 A;  1AJ4 A;  4GF6 B;  1QAS A;  3I5F B;  5HGE A;  3OHM B;  2DD9 A;  1R2U A;  3PLF B;  1YHH A;  4TNC A;  1MHO A;  2ZN8 A;  4PAL A;  1F09 A;  2QLG A;  2Z6Y A;  3BXB A;  2LUX A;  2RGI A;  1J1D A;  4OR9 B;  1SBJ A;  2OTB A;  2KFF A;  4KA9 A;  3KHE A;  3TS5 C;  2POX A;  2Q57 A;  4B30 B;  5J3X A;  1KCY A;  2CT9 A;  1F4Q A;  4YGC B;  2OTE A;  3FIA A;  1TNQ A;  4TZG A;  3DPZ A;  5DPI A;  1QXP A;  1IKU A;  1J7P A;  1JBA A;  1WLZ A;  4YGD B;  3I5H B;  5G08 A;  1SW8 A;  3DPX A;  1QV1 A;  3BXA A;  2HQZ A;  4IL1 A;  3JTD C;  1YZW A;  1UHJ A;  2JNF A;  2OTG C;  2AWM A;  1KSM A;  1OOJ A;  2YE1 A;  3U0M A;  2M49 B;  3LVA A;  2BBN A;  5DTL A;  3SIA A;  4W6D A;  4YGE B;  1NX2 A;  2A52 B;  1IQ5 A;  1XFY O;  2FCD A;  4KPI A;  2Y1M A;  2O24 A;  1K90 D;  5FYX A;  4HQ9 A;  4KEX A;  1RFJ A;  4E68 A;  1DVI A;  1UWO A;  1CLM A;  4J88 A;  1A75 B;  1KYR A;  4N3D A;  1QLS A;  3VRP A;  1M39 A;  4A4C A;  4MZJ A;  1Q4E A;  5AFP A;  4QJ3 B;  4AQJ A;  4WRI A;  2BE6 A;  2JWW A;  3DQU A;  4IK9 A;  4H3L A;  4UTS A;  4OHS A;  1MUX A;  3SVS A;  4JC2 A;  1DGU A;  1PSR A;  2G2B A;  2WC8 A;  3SSL A;  4XJK A;  1EH2 A;  4Q9X A;  3WCK A;  4HE4 A;  4CID A;  2BKI B;  1YJ2 A;  3DQ8 A;  3CD9 A;  2H2K A;  4ETO A;  4ZF4 A;  4PFE A;  4JWQ A;  5HLO A;  3LK0 A;  3IQQ A;  1NPQ A;  2E6W A;  1DGV A;  1QIW A;  5F6T A;  2ZMW A;  3LK1 A;  4P2Y B;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  4W6F A;  4DCK A;  1YRU B;  1B7T Z;  2ISD A;  1QYF A;  1ZOT B;  2H5R A;  3FS7 A;  3BQ3 A;  1WRK A;  2L51 A;  2TN4 A;  1V1F A;  2FJU B;  5EBJ A;  4DIR A;  3DQL A;  4W73 A;  3I5H C;  4Q7U A;  5TNC A;  1B8C A;  2OS8 B;  4N5X A;  3SVE A;  1DJW A;  1C7W A;  1YJF A;  1KK8 B;  2DUG A;  5DQM A;  3SVC A;  1KSO A;  3PAL A;  4Q9W A;  1Y6W A;  1NSH A;  4MZK A;  1KFU S;  1CDM A;  1Q4B A;  2DUI A;  1TRF A;  5DTX A;  3WLC A;  2JXC A;  3SVN A;  2DD7 A;  1CFD A;  3PAT A;  3EK8 A;  1YTZ C;  4N1F A;  1RMM A;  5I8N A;  2A54 B;  1RM9 A;  4BY4 A;  2BL0 C;  3VHT B;  3JTD B;  3KPX A;  4EUL A;  4DXQ A;  2K7B A;  2M1U A;  1RRX A;  3CFF A;  2ZFD A;  4ORB B;  4W69 A;  2GV5 A;  4FQO A;  3DQ5 A;  3DQI A;  3DQ7 A;  1CM4 A;  2WOS A;  4MLW A;  1U5I B;  3SJS A;  4IK5 A;  3I5G B;  2LMV A;  2H5P A;  4GGF A;  2KI4 C;  2LP2 A;  3IQO A;  4OY4 A;  1EXR A;  2LVK A;  3PM8 A;  4RTC A;  4W6B A;  1N2D A;  5DRG A;  1BR4 B;  3EVR A;  2V4E A;  1TNP A;  2O60 A;  2BL0 B;  1SMG A;  1OMV A;  3TZ1 A;  1ZGP A;  3U0K A;  1RRO A;  1EL4 A;  1LXF C;  3ST3 A;  4NDC A;  1DT7 B;  3D10 A;  3BUX B;  3CZT X;  2QLE A;  3I5G C;  1B8L A;  4PPK A;  1YUT A;  3LLE A;  3S05 A;  1QS7 A;  5CSJ A;  5LTQ A;  2OKY A;  2OS8 C;  4KW9 A;  3BUM B;  2WHS A;  2LC5 A;  4Q7T A; 
#chains in the Genus database with same CATH topology
 1J1E A;  3K1K A;  1NX3 A;  3D75 A;  1TOP A;  5CPV A;  3SG5 A;  2COL B;  1C3Z A;  3PIB A;  1JC2 A;  2GX0 A;  3DQ2 A;  2H9W A;  1UP5 A;  2ZO7 A;  2F2O A;  2H8V A;  2Y1N A;  1YVH A;  2WSO A;  3CYZ A;  3OSQ A;  5I2Q A;  3TMR A;  2KI6 D;  5EB7 A;  2L5Y A;  3R1P A;  3DQA A;  4W7A A;  1QWV A;  2VAE A;  4KF5 C;  1QTX A;  3BX9 A;  2BTJ A;  1K8U A;  1K94 A;  3CTN A;  4YGA A;  1VRK A;  1NIW A;  2V4E C;  5BTT B;  1OZS A;  4PHM A;  2A4J A;  2HJO A;  2JOJ A;  3SS0 A;  1QV0 A;  2HET A;  1MOU A;  3FWC A;  3LCP C;  1HT9 A;  2BNX A;  1EMF A;  1F70 A;  2O29 A;  2ZNE A;  2G5Z B;  3E5V A;  1B7T Y;  3CAB A;  1K2H A;  2Q6P A;  2LVV A;  1Z1Q A;  2L2E A;  1PUL A;  3VRR A;  3DQN A;  2H5Q A;  1KK7 Z;  1L2O B;  1F0B A;  1GM0 A;  1QX7 A;  3B6X A;  2P6B B;  2Y4Q A;  1H8B A;  1JBZ A;  2V4E B;  4ZIO A;  1F71 A;  2L2C A;  1M45 A;  1K9U A;  5J2O A;  2CTN A;  3TMT A;  5FVI A;  4XL5 A;  2LLT A;  2K60 A;  3D76 A;  3S0A A;  3O4X A;  3CB9 A;  2AHA A;  5FHV A;  4OVN F;  5LTR A;  4JD9 A;  5I2O A;  3OSR A;  4J89 A;  1REC A;  5H88 A;  2CBL A;  3RLZ A;  1UHH A;  4ZCU A;  1UHK A;  2MBX A;  2QAC A;  1NCZ A;  1SNL A;  3GJ2 A;  4MBE A;  2MHH A;  4OJ0 A;  3SVD A;  3S0D A;  2EC6 B;  4PDZ A;  2Q4U A;  2QZ0 A;  4DXP A;  1XVJ A;  2LLS A;  3AKA A;  1DJH A;  4ORC B;  1F4O A;  2B3Q A;  4JEO A;  3BJH A;  1YFP A;  4L1I A;  3LL8 B;  3GJ1 A;  2HGD A;  2JUL A;  1UIS A;  4PE4 A;  1M46 A;  3GB3 A;  1TN4 A;  3AAJ A;  4NDD A;  4GFT A;  3DD4 A;  2EGD A;  4HVF A;  4JRB A;  3M22 A;  2Q91 A;  2G16 B;  3BFA A;  4KW8 A;  1GGZ A;  3CBE A;  4OZD A;  3SV5 A;  3VHT A;  2VAD A;  2QEH A;  1BJF A;  3K21 A;  2DUH A;  1B9A A;  2YGU A;  1OMR A;  3CDN A;  1Q80 A;  4WQ2 A;  3GL4 A;  1QX2 A;  3VRO A;  3BFB A;  4XVP A;  2K61 A;  2IB6 A;  1YHG A;  1XFW O;  1ZFS A;  1QY3 A;  1BLQ A;  1M63 B;  2WC5 A;  1SR6 C;  1EG3 A;  2H6V A;  2G3O A;  2QPT A;  2MLE C;  4QJ4 B;  3BUN B;  4Z4M A;  5CSN A;  1IWQ A;  3PFV A;  3LF4 B;  1KFU L;  4XOV A;  3EKJ A;  2JXL A;  1BOC A;  3D77 A;  2ICR A;  2PAL A;  2AUC A;  2HGY A;  1NX0 A;  2KQY A;  5HZU A;  2O2B A;  4IK8 A;  4OQW A;  3H1R A;  2A53 B;  4MSP A;  3D73 A;  3NSI A;  4YBH B;  1P28 A;  1KFX S;  1SR6 B;  1SL9 A;  4DXM A;  3SG2 A;  3TDI A;  4OGS A;  3BUO B;  4YGB B;  4LJC A;  4PPL A;  3DQ3 A;  3TS5 B;  1SK6 D;  2KYF A;  3LSA A;  5DTY A;  4DXO A;  3LVD A;  1GGX A;  3CFH A;  3DQ1 A;  3E5W A;  2ZKM X;  5ER5 A;  2M1K B;  4R6B A;  1JSA A;  1B47 A;  4C0K A;  3BOW A;  5KTG A;  2JTT A;  4EDO A;  4PE1 A;  3D78 A;  1SCM B;  5HKZ A;  1CFF A;  4ANJ A;  1J55 A;  4L9M A;  2HFC A;  2FL1 A;  4RYS A;  2LNK A;  3VRQ A;  1QYQ A;  2MA2 A;  2ZO6 A;  3O77 A;  4ZIN A;  1GQM A;  2KBI A;  2YE0 A;  2LUC A;  2PSR A;  2WIS A;  5HBD A;  4HQC A;  1AJ5 A;  1SPY A;  3M0W A;  3S0G A;  5D7F A;  1BFP A;  1IRJ A;  1OXF A;  2H61 A;  1S26 D;  4CPV A;  2OPO A;  2M7L A;  4JF9 A;  3U8P A;  4LJD A;  3SG4 A;  1CB1 A;  1GL4 A;  4TZA A;  1NCX A;  2HQK A;  2JU0 A;  1W7U A;  3OB2 B;  5EJU A;  3BFH A;  2NLN A;  5FVG A;  1JFK A;  2BBM A;  4IK3 A;  2KAY A;  1SL8 A;  2WSN A;  2M7N A;  3GK4 X;  2FZU A;  1J7Q A;  1WDC C;  1YX7 A;  2LAP A;  4W6G A;  3W1D A;  1C4F A;  5JOL A;  2ZMU A;  3SSK A;  2WHT A;  1G4Y R;  1KQV A;  3L4L A;  4W6U A;  1G8I A;  1QVI Y;  5JJG A;  5F9G A;  5IBW A;  3R1O A;  2BKH B;  2GGZ A;  1IH0 A;  1RTP 1;  1LVC D;  3SG7 A;  2MJW B;  2WC6 A;  5FI7 A;  3NXA A;  5HW9 A;  1YVL A;  3NT9 A;  3SVU A;  3E3R A;  2GW3 A;  3DQK A;  1AUI B;  2WIQ A;  3VB1 A;  3I5F C;  2DDD A;  4WQ3 A;  1DMO A;  1XA9 A;  4W6S A;  5LTP A;  3DVE A;  2B1U A;  5HZO A;  3BYA A;  2Y5I A;  1L7Z A;  1TIZ A;  5I2L A;  4DKM A;  2IB5 A;  2KLD A;  1S6Z A;  2VVI A;  2K7O A;  5EB6 A;  1SSE B;  1OXD A;  3OX6 A;  2LVJ A;  4JQ0 D;  3DQF A;  1F8H A;  3KCS A;  3NSK A;  2R2I A;  1W7I B;  2BEC A;  3TDZ A;  1DJG A;  5HYD A;  5EHU A;  2BCA A;  2JAD A;  1KQM B;  4MZL A;  2CNP A;  2H61 C;  4KGE A;  2KQ6 A;  3I5I B;  1C7V A;  3CGL A;  3KEV A;  2KBM A;  4L12 A;  3D74 A;  4QJ5 B;  2P4M A;  1MYW A;  3NT3 A;  3SS5 A;  2Z6X A;  1CV7 A;  4P76 A;  4MVF A;  4DS7 A;  4W72 A;  1PAL A;  1ALW A;  1Q4C A;  1C3Y A;  1DTL A;  3VGO A;  1J7O A;  1H4U A;  2DOQ A;  3IR8 A;  1S5G Y;  3S0F A;  2ARL A;  1NX1 A;  3GEX A;  3M24 A;  3NEZ A;  3U0L A;  3KO0 A;  3ADF A;  4JFG A;  2CXJ A;  3BXC A;  1S6J A;  5BQL A;  5HLV A;  4USL A;  3DF0 B;  1N65 A;  5AEQ A;  4W6N A;  3HX4 A;  3UFZ A;  4ORN A;  2B3P A;  1JF0 A;  2KNE A;  4EDS A;  1WRL A;  1LS8 A;  5AXI A;  3DQ9 A;  4BDU A;  1WY9 A;  3SSV A;  1N0Y A;  2BCX A;  3ZUJ A;  3RWA A;  1PVB A;  2EHB A;  2IE2 A;  1KFX L;  1JBY A;  2HCG A;  1KP5 A;  4AS8 A;  3R1V A;  5KTY A;  1MR8 A;  4W6M A;  4XGY A;  3SG3 A;  2L5X B;  4W74 A;  4H47 A;  1KWO B;  1YUR A;  4W77 A;  3P8U A;  3WLD A;  3RM1 A;  1FBV A;  1LIN A;  2EMN A;  2QT2 A;  2LVI A;  4XYN A;  2L98 A;  2MLF C;  2GW4 B;  2IOV A;  2F3Y A;  3NSL A;  3I5I C;  3EVU A;  2L4H A;  1TNX A;  2VRG A;  2G9B A;  1QJT A;  2F33 A;  3OP0 A;  2RH7 A;  4KW4 A;  1ZGO A;  3ZUF A;  4W6C A;  2CCM A;  2GGM A;  1CNP A;  4DRW A;  2PMY A;  3VRN A;  4Q04 A;  3EK7 A;  1W7T A;  3DQH A;  1AHR A;  1TWO A;  1DJZ A;  1G7K A;  1HCJ A;  4W6P A;  2HPW A;  3WNX B;  1BF5 A;  3ST4 A;  2LM5 A;  2V53 A;  3U0N A;  1A4P A;  1A29 A;  1E8A A;  2LLU A;  5DU0 A;  1BU3 A;  1QLK A;  1TUJ A;  4PHJ A;  2L4I A;  2NXQ A;  3ED8 A;  3CLN A;  1CLL A;  4MEW A;  4KAG A;  3CGA A;  2VZX A;  1UHN A;  1XFV O;  2LMU A;  3SVO A;  5FVF A;  4M2O A;  2K8M B;  2QEO A;  2OJK A;  4KYN A;  2I18 A;  1MQ1 A;  3OB1 B;  1JC0 A;  3IVT A;  3IF7 A;  2PXW A;  1XMZ A;  1S5G Z;  4F0Z B;  3DY9 A;  3GK1 A;  5BTT A;  4IK4 A;  3B7A A;  5LK4 A;  2M29 A;  4ZF3 A;  5HKW A;  1WDC B;  1S36 A;  2QU1 A;  4ZFS A;  1W7S A;  3DQ4 A;  1EMK A;  2A48 A;  4LQU A;  2VVH A;  1IGV A;  1YX8 A;  4W7F A;  1IJ5 A;  1IG5 A;  1OOG A;  2YDZ A;  1TCF A;  3SG6 A;  5KU1 A;  4FTG A;  4U8D A;  3LS3 A;  5HL1 A;  4P1Q A;  3DYE A;  1EMB A;  2F3Z A;  2OTG B;  2LHL A;  3AI5 A;  2WCH A;  4D1E A;  5KSZ A;  1H4B A;  4FQT A;  4W6H A;  2K2F A;  1OOH A;  1HQV A;  2Z6Z A;  1DJY A;  1XYD A;  2I94 A;  2O5G A;  3O4Y A;  3PN7 C;  3V2L A;  1QXT A;  4LQT A;  2ZND A;  1ZUX A;  2G6X A;  4H48 A;  5K89 A;  2PQL A;  3NED A;  2KGB C;  2JPO A;  3SVB A;  4JGE A;  2EMD A;  1J7R A;  3WXA A;  1CKK A;  5HZS A;  5DIC A;  2D8N A;  2BCB A;  1MOV A;  2JTZ A;  2JT0 A;  2HQ8 A;  1AVS A;  1JUO A;  4M2P A;  2NZ0 A;  1UUS A;  2WHU A;  2KFH A;  1BMO A;  2I2R E;  2JZI A;  3O78 A;  3PN7 B;  2QRF A;  3EG5 B;  1HUY A;  3R72 A;  4CFQ A;  4W6O A;  2L0P A;  2F2P A;  4MRY A;  1A03 A;  4DXN A;  1SY9 A;  2AMI A;  1TCO B;  1Z1P A;  2E30 A;  1Z4H A;  2JT8 A;  4W7D A;  3OGO A;  1XFR A;  2QLI A;  2HF5 A;  4XJK B;  2FOT A;  1B4C A;  5AAN A;  1DF0 A;  3MSE B;  1RJV A;  1XFU O;  1MF8 B;  3AKB A;  3ZUL A;  3CD1 A;  5HZT A;  2WCB A;  4NDB A;  4HRH A;  3SSY A;  1EJ3 A;  1IJ6 A;  1KK8 C;  2KYC A;  1EML A;  3EK4 A;  4AR7 A;  4ZBL A;  2JPT A;  1EMC A;  1RMP A;  3PJB A;  1CM1 A;  2AAO A;  1CFP A;  1TUZ A;  4W6J A;  3W1C A;  1SL7 A;  5D69 A;  4PPJ A;  3VIC A;  3FE8 A;  1R6P A;  1XFX O;  1Y1A A;  5DKQ A;  5EXU A;  4C0J A;  1OZO A;  4GOB A;  2LAN A;  4PE7 A;  1YRT B;  2PRU A;  2LE9 B;  1L2O C;  2FCE A;  5CSF A;  3B88 A;  3SIB A;  2KOT A;  3V3D A;  1MWN A;  2HPS A;  4Q7R A;  1S6C A;  5DKN A;  1KK7 Y;  1MXL C;  3ST2 A;  3ZNI A;  2ZN9 A;  1K93 D;  1PVA A;  1NCY A;  1V1G A;  1ALV A;  1K9P A;  1TNW A;  1XFZ O;  1YHI A;  2JC2 A;  3D0Y A;  3UO9 A;  3DPW A;  4I5K A;  2KPH A;  1YUS A;  1LA3 A;  4OKH A;  4MN0 A;  1DC1 A;  4I5L B;  4I5N B;  1NYA A;  5HKY A;  1ZGQ A;  3DQO A;  3GK2 A;  4W7C A;  5BT0 A;  1WLM A;  3HCM A;  2G3D B;  4W6I A;  5B8I B;  2LP3 A;  4ZB1 A;  1OOF A;  1Q4D A;  1BOD A;  2K2A A;  1B1G A;  4L13 A;  1B9C A;  3NF0 A;  2BE4 A;  1EG4 A;  5ER4 X;  3AAK A;  3C1V A;  1JFJ A;  5I94 A;  3A8S A;  4W76 A;  4IJ7 A;  1RK9 A;  3DQD A;  2JT3 A;  4ORA B;  5DPJ A;  2VVJ A;  1XAE A;  2AH8 A;  3NSO A;  3LA1 A;  2WND A;  2C9I A;  2SAS A;  4AOM A;  3PJ7 A;  1IQ3 A;  1BR1 B;  5EXB A;  5H87 A;  1A75 A;  4C0L A;  4KF5 A;  4INX A;  2F8P A;  1QX5 B;  5DPH A;  2K0J A;  3NGV A;  3H4S E;  4GES B;  1DF0 B;  2PYQ A;  3DZT A;  1DJI A;  3TDU A;  1S6I A;  2KGR A;  5AQB B;  1B8R A;  1CDN A;  2KHN A;  4R6D A;  4J8A A;  5AER A;  3E5T A;  3G9A A;  3O6B A;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  4JKT A;  1NWD A;  3FWB A;  4A4B A;  4NQG A;  4PE0 A;  3ST0 A;  2LV7 A;  4B30 A;  4F7F A;  1CDP A;  3EVP A;  3KCT A;  4U2V A;  1G33 A;  4W7R A;  1Y0V H;  3TUY C;  5BPJ A;  4Z4K A;  2HRS A;  3S0E A;  1K96 A;  3GOF A;  3B87 A;  2DUE A;  5DPG A;  1OMD A;  4W6T A;  3QRX A;  1UUR A;  1U5I A;  4W6K A;  1FI6 A;  2LHI A;  4GAO A;  2OKW A;  1QIV A;  2GX2 A;  4OCI A;  3SVR A;  2Y0G A;  3CS1 A;  1S3P A;  3SRY A;  4ZF5 A;  2WCJ A;  1CMG A;  2DDC A;  4W75 A;  3ZWH A;  4PT1 A;  3K1E A;  2KI6 C;  4H3M A;  4GBA A;  2NCP A;  4RYW A;  4GGF C;  1WRZ A;  1JC1 A;  2KFG A;  3BUW B;  2A47 A;  1KYS A;  2WUR A;  3MGF A;  4CFR A;  4R1E A;  5EXC I;  1JWD A;  3A8R A;  3BOW B;  3H1O A;  1XSS A;  4B5Y A;  1CFC A;  2EC6 C;  1NP8 A;  2IS9 A;  2K7D A;  1OE9 B;  2P71 A;  1YUU A;  3P28 A;  1FPW A;  1RWY A;  4HRG A;  1CLB A;  3LVC A;  3AKO A;  2PXS A;  2AWL A;  2M3W A;  2M97 A;  4INW A;  2KDH A;  1JF2 A;  3DVK A;  3RZS A;  1DJX A;  3CZ1 A;  3JVT B;  1EMM A;  1W9Z A;  1ZUZ A;  2KAX A;  4H3N A;  2G6Y A;  2M8U A;  5GQQ C;  2WCL A;  2NCO A;  1K95 A;  3WHT B;  3CR2 A;  2FWQ A;  4IK1 A;  3N7H A;  5DQB A;  2A50 B;  2KLE A;  4EN1 A;  5PAL A;  1EME A;  2A46 A;  4KF4 A;  3F45 A;  2LMT A;  3FE6 A;  5H89 A;  1QAT A;  4YRU A;  3CFA A;  1AP4 A;  3PSR A;  1S1E A;  4DKN A;  1Q73 A;  1FW4 A;  3CWG A;  2JNX A;  4P5O E;  2H5O A;  4GGN A;  3B86 A;  5T3I A;  1CMF A;  3ICB A;  4NWS A;  3EKH A;  3DQE A;  1MXE A;  3D0Y B;  1W7J B;  1EMG A;  2JQ6 A;  4UPG A;  3IP2 A;  2AWJ A;  2PAS A;  2A56 B;  2LCP A;  3SST A;  2K7C A;  3SSH A;  1ZMZ A;  3DF0 A;  3DXL A;  3KF9 A;  1RMO A;  1LA0 A;  2WCF A;  4YI8 A;  4GNK B;  2C9J A;  2QEB A;  2BAP A;  2G2S B;  3O2P A;  1AK8 A;  3RWT A;  2FJY A;  2I7A A;  4AQI A;  5DTZ A;  4W6A A;  3PJ5 A;  3OX5 A;  2M9G A;  4DUQ A;  4GPL B;  3ZTF A;  1ZAC A;  4BY5 A;  1XA5 A;  1SRA A;  4PCW A;  1FF1 A;  4ICB A;  1Q4A A;  4HSZ A;  1BG1 A;  2WOR A;  4M2Q A;  1K9K A;  3JVT C;  2KAV A;  1DEK A;  2QEV A;  4YI9 A;  4W6L A;  4IZN A;  1X02 A;  1SCV A;  1BT6 A;  4W6R A;  2AWK A;  3NHT A;  2H8Q A;  1CDL A;  2HQW A;  1LKJ A;  4KGF A;  2EMO A;  1YR5 A;  3U8A A;  1A2X A;  3U8C A;  1SCM C;  2JRF A;  1Y1U A;  2P70 A;  4DXI A;  3Q8I A;  3I19 A;  2MAZ A;  3CR4 X;  4W7X A;  4ZCV A;  1KQM C;  3DQJ A;  3VK1 A;  2DUF A;  1GJY A;  4N1G A;  3OGN A;  1C07 A;  2WCE A;  3CZ0 A;  5DRF A;  2OGR A;  4LJB A;  5DKR A;  1SKT A;  3EVV A;  3DVJ A;  2G6E A;  4W7E A;  3L4A A;  2ZRS A;  4MRX A;  1OW4 A;  4GUK A;  5DY6 A;  1KWO C;  1IIO A;  2L50 A;  1FI5 A;  1PK0 D;  3LF3 A;  4HRE E;  1Y1X A;  1M31 A;  1XK4 C;  3DVM A;  2KI4 B;  2YFP A;  3SSP A;  3A4U B;  4HQ8 A;  4LJD C;  4XOW A;  2QLG B;  1OQP A;  4I2Y A;  4EMQ A;  1XQM A;  1F55 A;  4PHN A;  2Z1O A;  1GFL A;  3BXK A;  2QLH A;  2KSP A;  1PSB A;  2SCP A;  1F54 A;  3UNW A;  1D1O A;  2PVB A;  3UG0 A;  1SYM A;  1KYP A;  1NUB A;  1EMA A;  2ZRT A;  2MRD A;  4PHK A;  1GGW A;  1OXE A;  3QME A;  3AI4 A;  1XK4 A;  3NHI A;  3DQC A;  4I5J A;  3DQM A;  1QYO A;  1H6R A;  1XO5 A;  2M0R A;  5CSI A;  4LW5 A;  1UHI A;  1TTX A;  3CR5 X;  4CLN A;  1CTR A;  3DQ6 A;  1AJ4 A;  4GF6 B;  1QAS A;  3I5F B;  5HGE A;  3OHM B;  2DD9 A;  1R2U A;  3PLF B;  2WCK A;  1YHH A;  4TNC A;  1MHO A;  2ZN8 A;  4PAL A;  1F09 A;  2QLG A;  2Z6Y A;  3BXB A;  2LUX A;  2RGI A;  1J1D A;  4OR9 B;  2WCM A;  1SBJ A;  2OTB A;  2KFF A;  4KA9 A;  1Z2C B;  3KHE A;  3TS5 C;  2POX A;  2Q57 A;  4B30 B;  5J3X A;  1KCY A;  2CT9 A;  2OTE A;  1F4Q A;  4YGC B;  3FIA A;  1DQE A;  2GTE A;  1TNQ A;  4TZG A;  3DPZ A;  5DPI A;  1QXP A;  1IKU A;  1J7P A;  1JBA A;  1WLZ A;  4YGD B;  3I5H B;  5G08 A;  1SW8 A;  3DPX A;  1QV1 A;  3SS3 A;  3BXA A;  2HQZ A;  4IL1 A;  3JTD C;  1YZW A;  1UHJ A;  2JNF A;  2OTG C;  2AWM A;  1KSM A;  1OOJ A;  3CZ2 A;  2YE1 A;  3U0M A;  2M49 B;  3LVA A;  2BBN A;  5DTL A;  3SIA A;  4W6D A;  4YGE B;  1NX2 A;  2A52 B;  5D3O A;  3OBV A;  1IQ5 A;  1XFY O;  2FCD A;  4KPI A;  2Y1M A;  2O24 A;  1K90 D;  5FYX A;  4HQ9 A;  4KEX A;  1RFJ A;  4E68 A;  1DVI A;  1UWO A;  1CLM A;  4J88 A;  1A75 B;  1KYR A;  4N3D A;  1QLS A;  3VRP A;  1M39 A;  4A4C A;  4MZJ A;  1Q4E A;  5AFP A;  4QJ3 B;  4AQJ A;  4WRI A;  2BE6 A;  2JWW A;  3DQU A;  4IK9 A;  4H3L A;  4UTS A;  1OOI X;  4OHS A;  1MUX A;  3SVS A;  4JC2 A;  1DGU A;  1PSR A;  2G2B A;  2WC8 A;  3SSL A;  4XJK A;  1EH2 A;  5FI6 A;  4Q9X A;  3WCK A;  4HE4 A;  4CID A;  2BKI B;  1YJ2 A;  3DQ8 A;  3CD9 A;  2H2K A;  4ETO A;  4ZF4 A;  4PFE A;  4JWQ A;  5HLO A;  1DEL A;  3LK0 A;  3IQQ A;  1NPQ A;  2E6W A;  1DGV A;  1QIW A;  5F6T A;  2ZMW A;  3LK1 A;  4P2Y B;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  4W6F A;  4DCK A;  1YRU B;  1B7T Z;  2ISD A;  1QYF A;  1ZOT B;  2H5R A;  2QDI A;  3FS7 A;  3BQ3 A;  3FE9 A;  1WRK A;  3L47 A;  2L51 A;  2TN4 A;  1V1F A;  2FJU B;  5EBJ A;  4DIR A;  3DQL A;  4W73 A;  3I5H C;  4Q7U A;  5TNC A;  1B8C A;  2OS8 B;  4N5X A;  3SVE A;  1DJW A;  1C7W A;  1YJF A;  1KK8 B;  2DUG A;  5DQM A;  3SVC A;  1KSO A;  3PAL A;  4Q9W A;  1Y6W A;  1NSH A;  5FI2 A;  4MZK A;  1KFU S;  1CDM A;  1Q4B A;  2DUI A;  1TRF A;  5DTX A;  3WLC A;  2JXC A;  3SVN A;  2DD7 A;  1CFD A;  3PAT A;  3EK8 A;  1YTZ C;  4N1F A;  1RMM A;  5I8N A;  2A54 B;  1RM9 A;  4BY4 A;  2BL0 C;  3VHT B;  3JTD B;  3KPX A;  4EUL A;  4DXQ A;  2K7B A;  2M1U A;  1RRX A;  3CFF A;  2ZFD A;  4ORB B;  4W69 A;  2GV5 A;  4FQO A;  3PJI A;  3DQ5 A;  3DQI A;  3DQ7 A;  1CM4 A;  2WOS A;  4MLW A;  1U5I B;  3SJS A;  4IK5 A;  3I5G B;  2LMV A;  2H5P A;  4GGF A;  2KI4 C;  2LP2 A;  3IQO A;  4OY4 A;  1EXR A;  1T14 A;  2LVK A;  3PM8 A;  4RTC A;  4W6B A;  1N2D A;  5DRG A;  1BR4 B;  3EVR A;  3S0B A;  2V4E A;  1TNP A;  2O60 A;  2ERB A;  2BL0 B;  1SMG A;  1ORG A;  1OMV A;  3TZ1 A;  5EL2 A;  1ZGP A;  3U0K A;  1RRO A;  1EL4 A;  1LXF C;  3ST3 A;  4NDC A;  1DT7 B;  3D10 A;  3BUX B;  3CZT X;  2QLE A;  3I5G C;  1B8L A;  3SS4 A;  4PPK A;  1YUT A;  3LLE A;  3S05 A;  1QS7 A;  5CSJ A;  5LTQ A;  2OKY A;  2OS8 C;  4KW9 A;  3BUM B;  2WHS A;  2LC5 A;  4Q7T A;  3PM2 A; 
#chains in the Genus database with same CATH homology
 1J1E A;  3K1K A;  1NX3 A;  1TOP A;  5CPV A;  3SG5 A;  2COL B;  3PIB A;  1JC2 A;  2GX0 A;  3DQ2 A;  2H9W A;  1UP5 A;  2ZO7 A;  2F2O A;  2Y1N A;  1YVH A;  2WSO A;  3OSQ A;  5I2Q A;  3TMR A;  2KI6 D;  5EB7 A;  3DQA A;  4W7A A;  2VAE A;  4KF5 C;  1QTX A;  3BX9 A;  2BTJ A;  1K8U A;  1K94 A;  3CTN A;  4YGA A;  1VRK A;  1NIW A;  2V4E C;  5BTT B;  1OZS A;  4PHM A;  2A4J A;  2HJO A;  2JOJ A;  3SS0 A;  1QV0 A;  2HET A;  1MOU A;  3FWC A;  3LCP C;  1HT9 A;  1EMF A;  1F70 A;  2O29 A;  2ZNE A;  2G5Z B;  3E5V A;  1B7T Y;  2Q6P A;  1K2H A;  2LVV A;  1Z1Q A;  2L2E A;  1PUL A;  3VRR A;  3DQN A;  2H5Q A;  1KK7 Z;  1L2O B;  1F0B A;  1QX7 A;  2P6B B;  2Y4Q A;  1H8B A;  1JBZ A;  2V4E B;  4ZIO A;  1F71 A;  1M45 A;  1K9U A;  5J2O A;  2CTN A;  3TMT A;  5FVI A;  4XL5 A;  2LLT A;  3CB9 A;  2AHA A;  5FHV A;  4OVN F;  5LTR A;  5I2O A;  3OSR A;  4J89 A;  1REC A;  5H88 A;  2CBL A;  3RLZ A;  1UHH A;  4ZCU A;  1UHK A;  2MBX A;  2QAC A;  1NCZ A;  1SNL A;  3GJ2 A;  4MBE A;  2MHH A;  4OJ0 A;  3SVD A;  2EC6 B;  4PDZ A;  2Q4U A;  2QZ0 A;  4DXP A;  1XVJ A;  2LLS A;  3AKA A;  1DJH A;  4ORC B;  1F4O A;  2B3Q A;  4JEO A;  1YFP A;  4L1I A;  3LL8 B;  3GJ1 A;  2HGD A;  2JUL A;  1UIS A;  4PE4 A;  1M46 A;  3GB3 A;  1TN4 A;  3AAJ A;  4NDD A;  4GFT A;  3DD4 A;  2EGD A;  4HVF A;  4JRB A;  3M22 A;  2Q91 A;  2G16 B;  4KW8 A;  1GGZ A;  3CBE A;  3SV5 A;  3VHT A;  2VAD A;  1BJF A;  3K21 A;  2DUH A;  1B9A A;  1OMR A;  1Q80 A;  4WQ2 A;  3GL4 A;  1QX2 A;  3VRO A;  4XVP A;  2K61 A;  2IB6 A;  1YHG A;  1XFW O;  1ZFS A;  1QY3 A;  1BLQ A;  1M63 B;  1SR6 C;  1EG3 A;  2H6V A;  2G3O A;  2QPT A;  2MLE C;  4QJ4 B;  3BUN B;  4Z4M A;  5CSN A;  1IWQ A;  3PFV A;  3LF4 B;  1KFU L;  4XOV A;  3EKJ A;  2JXL A;  1BOC A;  2ICR A;  2PAL A;  2AUC A;  2HGY A;  1NX0 A;  2KQY A;  5HZU A;  2O2B A;  4IK8 A;  4OQW A;  3H1R A;  2A53 B;  4MSP A;  3NSI A;  4YBH B;  1KFX S;  1SR6 B;  1SL9 A;  4DXM A;  3SG2 A;  3TDI A;  4OGS A;  3BUO B;  4YGB B;  4LJC A;  4PPL A;  3DQ3 A;  3TS5 B;  1SK6 D;  2KYF A;  3LSA A;  5DTY A;  4DXO A;  3LVD A;  1GGX A;  3CFH A;  3DQ1 A;  3E5W A;  2ZKM X;  5ER5 A;  2M1K B;  4R6B A;  1JSA A;  1B47 A;  4C0K A;  3BOW A;  5KTG A;  2JTT A;  4EDO A;  4PE1 A;  1SCM B;  5HKZ A;  1CFF A;  4ANJ A;  1J55 A;  4L9M A;  2HFC A;  2FL1 A;  4RYS A;  2LNK A;  3VRQ A;  1QYQ A;  2MA2 A;  2ZO6 A;  3O77 A;  4ZIN A;  1GQM A;  2KBI A;  2YE0 A;  2LUC A;  2PSR A;  2WIS A;  5HBD A;  4HQC A;  1AJ5 A;  1SPY A;  3M0W A;  5D7F A;  1BFP A;  1IRJ A;  1OXF A;  2H61 A;  1S26 D;  4CPV A;  2OPO A;  2M7L A;  4JF9 A;  3U8P A;  4LJD A;  3SG4 A;  1CB1 A;  1GL4 A;  4TZA A;  1NCX A;  2HQK A;  2JU0 A;  1W7U A;  3OB2 B;  5EJU A;  2NLN A;  5FVG A;  1JFK A;  2BBM A;  4IK3 A;  2KAY A;  1SL8 A;  2WSN A;  2M7N A;  3GK4 X;  2FZU A;  1J7Q A;  1WDC C;  1YX7 A;  2LAP A;  4W6G A;  3W1D A;  1C4F A;  5JOL A;  2ZMU A;  3SSK A;  2WHT A;  1G4Y R;  1KQV A;  4W6U A;  1G8I A;  1QVI Y;  5JJG A;  5F9G A;  5IBW A;  2BKH B;  2GGZ A;  1IH0 A;  1RTP 1;  1LVC D;  3SG7 A;  2MJW B;  3NXA A;  5HW9 A;  1YVL A;  3NT9 A;  3SVU A;  3E3R A;  2GW3 A;  3DQK A;  1AUI B;  2WIQ A;  2DDD A;  3I5F C;  4WQ3 A;  1DMO A;  1XA9 A;  4W6S A;  5LTP A;  3DVE A;  2B1U A;  5HZO A;  3BYA A;  2Y5I A;  1L7Z A;  1TIZ A;  5I2L A;  4DKM A;  2IB5 A;  1S6Z A;  2VVI A;  2K7O A;  5EB6 A;  1OXD A;  3OX6 A;  2LVJ A;  4JQ0 D;  3DQF A;  1F8H A;  3KCS A;  3NSK A;  2R2I A;  1W7I B;  2BEC A;  3TDZ A;  1DJG A;  5HYD A;  5EHU A;  2BCA A;  2JAD A;  1KQM B;  4MZL A;  2CNP A;  2H61 C;  4KGE A;  2KQ6 A;  3I5I B;  1C7V A;  3CGL A;  3KEV A;  2KBM A;  4L12 A;  4QJ5 B;  2P4M A;  1MYW A;  3NT3 A;  2Z6X A;  1CV7 A;  4P76 A;  4MVF A;  4DS7 A;  4W72 A;  1PAL A;  1ALW A;  1Q4C A;  1DTL A;  3VGO A;  1J7O A;  1H4U A;  2DOQ A;  3IR8 A;  1S5G Y;  2ARL A;  1NX1 A;  3GEX A;  3M24 A;  3NEZ A;  3U0L A;  3KO0 A;  3ADF A;  4JFG A;  2CXJ A;  3BXC A;  1S6J A;  5BQL A;  5HLV A;  4USL A;  3DF0 B;  1N65 A;  5AEQ A;  4W6N A;  3HX4 A;  3UFZ A;  4ORN A;  2B3P A;  1JF0 A;  2KNE A;  4EDS A;  1WRL A;  5AXI A;  3DQ9 A;  4BDU A;  1WY9 A;  3SSV A;  1N0Y A;  2BCX A;  3ZUJ A;  3RWA A;  1PVB A;  2EHB A;  2IE2 A;  1KFX L;  1JBY A;  2HCG A;  1KP5 A;  4AS8 A;  5KTY A;  1MR8 A;  4W6M A;  4XGY A;  3SG3 A;  2L5X B;  4W74 A;  4H47 A;  1KWO B;  1YUR A;  4W77 A;  3P8U A;  3WLD A;  3RM1 A;  1FBV A;  1LIN A;  2EMN A;  2QT2 A;  2LVI A;  4XYN A;  2L98 A;  2MLF C;  2GW4 B;  2IOV A;  2F3Y A;  3NSL A;  3I5I C;  3EVU A;  2L4H A;  1TNX A;  2VRG A;  2G9B A;  1QJT A;  2F33 A;  3OP0 A;  2RH7 A;  4KW4 A;  1ZGO A;  3ZUF A;  4W6C A;  2CCM A;  2GGM A;  1CNP A;  4DRW A;  2PMY A;  3VRN A;  4Q04 A;  3EK7 A;  1W7T A;  3DQH A;  1AHR A;  1DJZ A;  1G7K A;  1HCJ A;  4W6P A;  2HPW A;  3WNX B;  1BF5 A;  3ST4 A;  2LM5 A;  2V53 A;  3U0N A;  1A4P A;  1A29 A;  1E8A A;  2LLU A;  5DU0 A;  1BU3 A;  1QLK A;  4PHJ A;  2L4I A;  2NXQ A;  3ED8 A;  3CLN A;  1CLL A;  4MEW A;  4KAG A;  3CGA A;  2VZX A;  1UHN A;  1XFV O;  2LMU A;  3SVO A;  5FVF A;  4M2O A;  2K8M B;  2OJK A;  2I18 A;  1MQ1 A;  3OB1 B;  1JC0 A;  3IF7 A;  2PXW A;  1XMZ A;  1S5G Z;  4F0Z B;  3GK1 A;  5BTT A;  4IK4 A;  5LK4 A;  2M29 A;  4ZF3 A;  5HKW A;  1WDC B;  1S36 A;  2QU1 A;  4ZFS A;  1W7S A;  3DQ4 A;  1EMK A;  2A48 A;  4LQU A;  2VVH A;  1IGV A;  1YX8 A;  4W7F A;  1IJ5 A;  1IG5 A;  2YDZ A;  1TCF A;  3SG6 A;  5KU1 A;  4FTG A;  4U8D A;  3LS3 A;  4P1Q A;  1EMB A;  2F3Z A;  2OTG B;  2LHL A;  3AI5 A;  4D1E A;  5KSZ A;  1H4B A;  4W6H A;  2K2F A;  1HQV A;  2Z6Z A;  1DJY A;  1XYD A;  2I94 A;  2O5G A;  3O4Y A;  3PN7 C;  1QXT A;  4LQT A;  2ZND A;  1ZUX A;  2G6X A;  4H48 A;  5K89 A;  3NED A;  2KGB C;  3SVB A;  4JGE A;  2EMD A;  1J7R A;  3WXA A;  1CKK A;  5HZS A;  2D8N A;  2BCB A;  1MOV A;  2JTZ A;  2JT0 A;  2HQ8 A;  1AVS A;  1JUO A;  4M2P A;  2NZ0 A;  1UUS A;  2WHU A;  2KFH A;  1BMO A;  2I2R E;  2JZI A;  3O78 A;  3PN7 B;  2QRF A;  1HUY A;  4CFQ A;  4W6O A;  2L0P A;  2F2P A;  4MRY A;  1A03 A;  4DXN A;  1SY9 A;  2AMI A;  1TCO B;  1Z1P A;  2E30 A;  2JT8 A;  4W7D A;  3OGO A;  2QLI A;  2HF5 A;  4XJK B;  2FOT A;  1B4C A;  5AAN A;  1DF0 A;  3MSE B;  1RJV A;  1XFU O;  1MF8 B;  3AKB A;  3ZUL A;  3CD1 A;  5HZT A;  2WCB A;  4NDB A;  4HRH A;  3SSY A;  1EJ3 A;  1IJ6 A;  1KK8 C;  2KYC A;  1EML A;  3EK4 A;  4AR7 A;  4ZBL A;  2JPT A;  1EMC A;  1RMP A;  3PJB A;  1CM1 A;  2AAO A;  1CFP A;  4W6J A;  3W1C A;  1SL7 A;  5D69 A;  4PPJ A;  3VIC A;  1R6P A;  1XFX O;  1Y1A A;  5DKQ A;  5EXU A;  4C0J A;  1OZO A;  4GOB A;  2LAN A;  4PE7 A;  1YRT B;  2PRU A;  2LE9 B;  1L2O C;  2FCE A;  5CSF A;  3SIB A;  2KOT A;  3V3D A;  1MWN A;  2HPS A;  4Q7R A;  1S6C A;  5DKN A;  1KK7 Y;  1MXL C;  3ST2 A;  3ZNI A;  2ZN9 A;  1K93 D;  1PVA A;  1NCY A;  1V1G A;  1ALV A;  1K9P A;  1TNW A;  1XFZ O;  1YHI A;  2JC2 A;  3D0Y A;  3DPW A;  4I5K A;  1YUS A;  1LA3 A;  4OKH A;  4MN0 A;  4I5L B;  4I5N B;  1NYA A;  5HKY A;  1ZGQ A;  3DQO A;  3GK2 A;  4W7C A;  5BT0 A;  1WLM A;  3HCM A;  2G3D B;  4W6I A;  5B8I B;  2LP3 A;  4ZB1 A;  1Q4D A;  1BOD A;  2K2A A;  1B1G A;  4L13 A;  1B9C A;  3NF0 A;  2BE4 A;  1EG4 A;  5ER4 X;  3AAK A;  3C1V A;  1JFJ A;  3A8S A;  4W76 A;  1RK9 A;  3DQD A;  2JT3 A;  4ORA B;  5DPJ A;  2VVJ A;  1XAE A;  2AH8 A;  3NSO A;  3LA1 A;  2WND A;  2C9I A;  2SAS A;  4AOM A;  3PJ7 A;  1IQ3 A;  1BR1 B;  5EXB A;  5H87 A;  1A75 A;  4C0L A;  4KF5 A;  2F8P A;  1QX5 B;  5DPH A;  2K0J A;  3H4S E;  4GES B;  1DF0 B;  1DJI A;  3TDU A;  1S6I A;  2KGR A;  5AQB B;  1B8R A;  1CDN A;  2KHN A;  4R6D A;  4J8A A;  5AER A;  3E5T A;  3G9A A;  3O6B A;  4JPZ B;  3WHU B;  1ODB A;  1QVI Z;  1NWD A;  3FWB A;  4A4B A;  4NQG A;  4PE0 A;  3ST0 A;  2LV7 A;  4B30 A;  1CDP A;  3EVP A;  3KCT A;  4U2V A;  1G33 A;  4W7R A;  1Y0V H;  3TUY C;  5BPJ A;  4Z4K A;  2HRS A;  1K96 A;  3GOF A;  5DPG A;  2DUE A;  1OMD A;  4W6T A;  3QRX A;  1UUR A;  1U5I A;  4W6K A;  1FI6 A;  2LHI A;  4GAO A;  2OKW A;  1QIV A;  2GX2 A;  4OCI A;  3SVR A;  2Y0G A;  3CS1 A;  1S3P A;  3SRY A;  4ZF5 A;  1CMG A;  2DDC A;  4W75 A;  3ZWH A;  2KI6 C;  4H3M A;  4GBA A;  2NCP A;  4RYW A;  4GGF C;  1WRZ A;  1JC1 A;  2KFG A;  3BUW B;  2A47 A;  1KYS A;  2WUR A;  3MGF A;  4CFR A;  4R1E A;  5EXC I;  1JWD A;  3A8R A;  3BOW B;  3H1O A;  1XSS A;  4B5Y A;  1CFC A;  2EC6 C;  1NP8 A;  2IS9 A;  2K7D A;  1OE9 B;  1YUU A;  3P28 A;  1FPW A;  1RWY A;  4HRG A;  1CLB A;  3LVC A;  3AKO A;  2PXS A;  2AWL A;  2M3W A;  2M97 A;  2KDH A;  1JF2 A;  3DVK A;  1DJX A;  3JVT B;  1EMM A;  1ZUZ A;  2KAX A;  4H3N A;  2G6Y A;  2M8U A;  5GQQ C;  2NCO A;  1K95 A;  3WHT B;  3CR2 A;  2FWQ A;  4IK1 A;  5DQB A;  2A50 B;  4EN1 A;  5PAL A;  1EME A;  2A46 A;  4KF4 A;  3F45 A;  2LMT A;  5H89 A;  1QAT A;  4YRU A;  3CFA A;  1AP4 A;  3PSR A;  1S1E A;  4DKN A;  1Q73 A;  1FW4 A;  3CWG A;  2JNX A;  4P5O E;  2H5O A;  4GGN A;  5T3I A;  1CMF A;  3ICB A;  4NWS A;  3EKH A;  3DQE A;  1MXE A;  3D0Y B;  1W7J B;  1EMG A;  2JQ6 A;  4UPG A;  3IP2 A;  2AWJ A;  2PAS A;  2A56 B;  2LCP A;  3SST A;  2K7C A;  3SSH A;  1ZMZ A;  3DF0 A;  3KF9 A;  1RMO A;  1LA0 A;  2WCF A;  4YI8 A;  4GNK B;  2C9J A;  2G2S B;  3O2P A;  1AK8 A;  3RWT A;  2I7A A;  4AQI A;  5DTZ A;  4W6A A;  3PJ5 A;  3OX5 A;  2M9G A;  4DUQ A;  4GPL B;  3ZTF A;  1ZAC A;  4BY5 A;  1XA5 A;  1SRA A;  4PCW A;  1FF1 A;  4ICB A;  1Q4A A;  4HSZ A;  1BG1 A;  2WOR A;  4M2Q A;  1K9K A;  3JVT C;  2KAV A;  4YI9 A;  4W6L A;  4IZN A;  1X02 A;  1SCV A;  1BT6 A;  4W6R A;  2AWK A;  2H8Q A;  2HQW A;  1CDL A;  1LKJ A;  4KGF A;  2EMO A;  1YR5 A;  3U8A A;  1A2X A;  3U8C A;  1SCM C;  2JRF A;  1Y1U A;  4DXI A;  3I19 A;  2MAZ A;  3CR4 X;  4W7X A;  4ZCV A;  1KQM C;  3DQJ A;  3VK1 A;  2DUF A;  1GJY A;  4N1G A;  1C07 A;  2WCE A;  5DRF A;  2OGR A;  4LJB A;  5DKR A;  1SKT A;  3EVV A;  3DVJ A;  2G6E A;  4W7E A;  2ZRS A;  4MRX A;  4GUK A;  5DY6 A;  1KWO C;  2L50 A;  1FI5 A;  1PK0 D;  3LF3 A;  4HRE E;  1Y1X A;  1M31 A;  1XK4 C;  3DVM A;  2KI4 B;  2YFP A;  3SSP A;  3A4U B;  4HQ8 A;  4LJD C;  4XOW A;  2QLG B;  1OQP A;  4I2Y A;  4EMQ A;  1XQM A;  1F55 A;  4PHN A;  2Z1O A;  1GFL A;  3BXK A;  2QLH A;  2KSP A;  1PSB A;  2SCP A;  1F54 A;  1D1O A;  2PVB A;  3UG0 A;  1SYM A;  1KYP A;  1NUB A;  1EMA A;  2ZRT A;  2MRD A;  4PHK A;  1GGW A;  1OXE A;  3AI4 A;  1XK4 A;  3DQC A;  4I5J A;  3DQM A;  1QYO A;  1H6R A;  1XO5 A;  2M0R A;  5CSI A;  4LW5 A;  1UHI A;  1TTX A;  3CR5 X;  4CLN A;  1CTR A;  3DQ6 A;  1AJ4 A;  4GF6 B;  1QAS A;  3I5F B;  5HGE A;  3OHM B;  2DD9 A;  1R2U A;  3PLF B;  1YHH A;  4TNC A;  1MHO A;  2ZN8 A;  4PAL A;  1F09 A;  2QLG A;  2Z6Y A;  3BXB A;  2LUX A;  2RGI A;  1J1D A;  4OR9 B;  1SBJ A;  2OTB A;  2KFF A;  4KA9 A;  3KHE A;  3TS5 C;  2POX A;  2Q57 A;  4B30 B;  5J3X A;  1KCY A;  2CT9 A;  1F4Q A;  4YGC B;  2OTE A;  3FIA A;  1TNQ A;  4TZG A;  3DPZ A;  5DPI A;  1QXP A;  1IKU A;  1J7P A;  1JBA A;  1WLZ A;  4YGD B;  3I5H B;  5G08 A;  1SW8 A;  3DPX A;  1QV1 A;  3BXA A;  2HQZ A;  4IL1 A;  3JTD C;  1YZW A;  1UHJ A;  2JNF A;  2OTG C;  2AWM A;  1KSM A;  1OOJ A;  2YE1 A;  3U0M A;  2M49 B;  3LVA A;  2BBN A;  5DTL A;  3SIA A;  4W6D A;  4YGE B;  1NX2 A;  2A52 B;  1IQ5 A;  1XFY O;  2FCD A;  4KPI A;  2Y1M A;  2O24 A;  1K90 D;  5FYX A;  4HQ9 A;  4KEX A;  1RFJ A;  4E68 A;  1DVI A;  1UWO A;  1CLM A;  4J88 A;  1A75 B;  1KYR A;  4N3D A;  1QLS A;  3VRP A;  1M39 A;  4A4C A;  4MZJ A;  1Q4E A;  5AFP A;  4QJ3 B;  4AQJ A;  4WRI A;  2BE6 A;  2JWW A;  3DQU A;  4IK9 A;  4H3L A;  4UTS A;  4OHS A;  1MUX A;  3SVS A;  4JC2 A;  1DGU A;  1PSR A;  2G2B A;  2WC8 A;  3SSL A;  4XJK A;  1EH2 A;  4Q9X A;  3WCK A;  4HE4 A;  4CID A;  2BKI B;  1YJ2 A;  3DQ8 A;  3CD9 A;  2H2K A;  4ETO A;  4ZF4 A;  4PFE A;  4JWQ A;  5HLO A;  3LK0 A;  3IQQ A;  1NPQ A;  2E6W A;  1DGV A;  1QIW A;  5F6T A;  2ZMW A;  3LK1 A;  4P2Y B;  1PRW A;  3TUY B;  4OV2 A;  1OSA A;  4W6F A;  4DCK A;  1YRU B;  1B7T Z;  2ISD A;  1QYF A;  1ZOT B;  2H5R A;  3FS7 A;  3BQ3 A;  1WRK A;  2L51 A;  2TN4 A;  1V1F A;  2FJU B;  5EBJ A;  4DIR A;  3DQL A;  4W73 A;  3I5H C;  4Q7U A;  5TNC A;  1B8C A;  2OS8 B;  4N5X A;  3SVE A;  1DJW A;  1C7W A;  1YJF A;  1KK8 B;  2DUG A;  5DQM A;  3SVC A;  1KSO A;  3PAL A;  4Q9W A;  1Y6W A;  1NSH A;  4MZK A;  1KFU S;  1CDM A;  1Q4B A;  2DUI A;  1TRF A;  5DTX A;  3WLC A;  2JXC A;  3SVN A;  2DD7 A;  1CFD A;  3PAT A;  3EK8 A;  1YTZ C;  4N1F A;  1RMM A;  5I8N A;  2A54 B;  1RM9 A;  4BY4 A;  2BL0 C;  3VHT B;  3JTD B;  3KPX A;  4EUL A;  4DXQ A;  2K7B A;  2M1U A;  1RRX A;  3CFF A;  2ZFD A;  4ORB B;  4W69 A;  2GV5 A;  4FQO A;  3DQ5 A;  3DQI A;  3DQ7 A;  1CM4 A;  2WOS A;  4MLW A;  1U5I B;  3SJS A;  4IK5 A;  3I5G B;  2LMV A;  2H5P A;  4GGF A;  2KI4 C;  2LP2 A;  3IQO A;  4OY4 A;  1EXR A;  2LVK A;  3PM8 A;  4RTC A;  4W6B A;  1N2D A;  5DRG A;  1BR4 B;  3EVR A;  2V4E A;  1TNP A;  2O60 A;  2BL0 B;  1SMG A;  1OMV A;  3TZ1 A;  1ZGP A;  3U0K A;  1RRO A;  1EL4 A;  1LXF C;  3ST3 A;  4NDC A;  1DT7 B;  3D10 A;  3BUX B;  3CZT X;  2QLE A;  3I5G C;  1B8L A;  4PPK A;  1YUT A;  3LLE A;  3S05 A;  1QS7 A;  5CSJ A;  5LTQ A;  2OKY A;  2OS8 C;  4KW9 A;  3BUM B;  2WHS A;  2LC5 A;  4Q7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...