3EK4A

Calcium-saturated gcamp2 monomer
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
348
Chain Sequence
KTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 111
structure length 348
sequence length 367
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek4A02
2ZFDA 1OE9B 3SSLA 1WRZA 2QRFA 3WLDA 3SVRA 4M2OA 5IBWA 1RJVA 2BKIB 1DJWA 4OY4A 4QJ5B 4OR9B 4WRIA 5DU0A 1DF0B 2DUIA 4DKMA 2G6EA 2KYCA 2G3DB 2IOVA 1TRFA 2KSPA 1UWOA 4CIDA 4W6KA 5TNCA 3TS5B 2Z6ZA 1XO5A 4N5XA 1Y1UA 3DQ1A 4WQ2A 1QTXA 3JTDB 2JXCA 1KK8B 2JT8A 1F09A 2DOQA 1MOUA 2H61A 4DXOA 3EVRA 1NUBA 3OX5A 3I5FB 2FJUB 4LQUA 1CFPA 1OXDA 2NLNA 5DKRA 1Q4CA 1MR8A 1B4CA 1KYPA 4YI9A 2ZMUA 1QYFA 1ZOTB 5JOLA 1L2OB 2LVVA 3FS7A 1H4BA 4KGEA 3EVPA 5DPGA 4W6LA 2C9JA 3SSKA 1FI6A 5LTQA 3OGOA 5H89A 1J7QA 4ZINA 4MN0A 2VVIA 5HYDA 1TNPA 5F6TA 2WC8A 5EB7A 4NWSA 3TDUA 2M1KB 1PVAA 1NCXA 4I5JA 1U5IA 4IK9A 2QLHA 4MVFA 3SVBA 2VRGA 3BUMB 3SSPA 4AOMA 1MF8B 3U8CA 4YGCB 3PALA 1SCMC 4LJCA 2L51A 1SR6C 1YURA 3LS3A 1IJ5A 1K9PA 2MA2A 1LINA 2A54B 2LVKA 4NDBA 1KFXS 4KW4A 2KFFA 1KCYA 3A4UB 2BTJA 3SVCA 1SR6B 3F45A 4ORAB 3PIBA 4H3MA 3CFFA 1GQMA 1KFXL 1SCVA 1LKJA 5DKNA 2VVHA 1EMCA 4W73A 4E68A 2OJKA 2KAVA 2YE0A 4MZJA 1SL9A 4KW9A 2IB5A 2OKYA 1A2XA 1MOVA 2LNKA 3O78A 1SRAA 3SVEA 2PXWA 4W6CA 2KQYA 1TNWA 5DQBA 1PK0D 3TZ1A 2AHAA 3DQ7A 1PULA 1QV1A 3GEXA 2DUEA 2WORA 1JSAA 3SG7A 4C0JA 4MRYA 1XMZA 1U5IB 4KAGA 4PFEA 2ZO7A 2KBMA 4JF9A 3BXKA 1Y1AA 4DUQA 3WCKA 3DF0B 1DTLA 1NX0A 1KFUL 2B3PA 3VRRA 3NT9A 1SKTA 1MYWA 3SSYA 1BG1A 5AQBB 4Q9XA 1W7JB 2JZIA 4JWQA 2FL1A 4KF5A 2V4EC 3FIAA 5HBDA 2G2SB 4TZGA 3BUOB 1FF1A 3LL8B 1TN4A 1UHHA 2DD9A 3FWCA 2H9WA 2V4EB 2Y5IA 4LJDC 1EMAA 4M2PA 2AWLA 3I19A 1S26D 3SG5A 1F8HA 4MLWA 2A52B 1ZGPA 1OXFA 1OZOA 4L9MA 4PDZA 4R6DA 4W6AA 2M29A 2Q4UA 3D10A 4H48A 3EKJA 1S5GY 3I5IC 3U8AA 1BR1B 2WIQA 2CTNA 3AKAA 1IJ6A 5J2OA 1OSAA 2Y1NA 4RYWA 2KDHA 4KF5C 3BOWA 1K2HA 2JQ6A 3I5IB 4W6FA 1S3PA 3OSQA 2JT3A 2K8MB 3KF9A 2KGRA 3DQIA 2IS9A 1QXTA 2HPSA 3DQMA 1Z1PA 3GJ2A 2Q57A 4DKNA 2LMVA 1BFPA 2LHIA 1QXPA 4DXIA 3CR4X 1QV0A 5HKWA 1IG5A 1NCZA 5T3IA 1W7TA 3TDIA 2JC2A 3JVTC 1AJ5A 4IK1A 2ZO6A 4W6NA 3AI5A 1SBJA 3JVTB 1QIVA 4DIRA 3CZTX 5DTLA 1NP8A 2ZN8A 2H8QA 2OS8C 1DVIA 2DDCA 5FVGA 5HLOA 4HSZA 1TCOB 4AS8A 3NEZA 1DJZA 1KP5A 3EK8A 2KI4C 5HKYA 2Y1MA 3U0NA 1KQVA 5EXCI 2BKHB 2PVBA 1LA3A 1UHKA 2G9BA 4BDUA 4W72A 2K2AA 1CMFA 2ZRSA 1ALVA 3DQ2A 3S05A 1GGXA 2ZN9A 4GPLB 1BF5A 1XK4A 2I18A 3HX4A 1CDNA 4PPKA 2K0JA 3V3DA 2PALA 1MUXA 1NX3A 3SSVA 2EMOA 2K7DA 2KI6D 5BPJA 3AKOA 1EMEA 3E5WA 4W6IA 2GGZA 3EKHA 1MQ1A 3VRQA 2L5XB 4JGEA 1Y6WA 4U8DA 1SL7A 1ZGQA 4D1EA 3I5HC 4HQ8A 1C7WA 2HGYA 1OQPA 4PHMA 1BOCA 1L7ZA 3W1DA 1IGVA 2KI6C 2M0RA 1DT7B 1N2DA 2SASA 3I5HB 2WCFA 4C0KA 4JEOA 3DQHA 1RM9A 3DVJA 4PALA 3WHUB 3IF7A 3LSAA 4IK8A 4W6DA 2K61A 1QX2A 2Y4QA 2OGRA 3CS1A 1JBAA 4YBHB 2KAXA 4PPLA 4MBEA 1B8RA 1C4FA 1BR4B 5GQQC 4W6JA 2JADA 3WHTB 4W74A 4GAOA 4W76A 2IB6A 2ZRTA 1EG3A 1ODBA 1DJGA 2GW3A 5BQLA 1NSHA 1W7SA 2JXLA 2GX2A 3DPZA 3ZWHA 2VVJA 3A8RA 4GNKB 1F55A 1S5GZ 3PATA 3DPXA 4OVNF 3KCSA 1XFVO 4EDOA 4EMQA 1YVHA 1J7OA 3PM8A 3ADFA 2QZ0A 3KHEA 1MXEA 2I2RE 1EH2A 2AWJA 2LUCA 4XYNA 1N65A 4AQIA 4ZIOA 1CB1A 1JFKA 2Z6YA 3U0KA 5CSJA 3M22A 2HRSA 2MJWB 4YRUA 3ST3A 4ORBB 4JC2A 2B3QA 1S36A 2KFHA 1H8BA 1PRWA 3PLFB 1SNLA 2F2PA 4QJ4B 4IK4A 4W6BA 3K21A 2A47A 2WSNA 3TS5C 4MRXA 1NX1A 4UTSA 5CSIA 4W6UA 2PRUA 2L0PA 4GESB 3KPXA 3JTDC 4W6OA 2JNFA 4P1QA 2GW4B 1KK8C 1K9UA 4CFQA 3DQJA 2KNEA 2JULA 3DQ3A 3CD9A 1CNPA 3TDZA 2A53B 2AWKA 3AAJA 3I5FC 1QX7A 1GGZA 2ZNEA 1KYRA 3QRXA 2O60A 2Z1OA 3P28A 2R2IA 1JFJA 2JRFA 4BY4A 2JTZA 1QS7A 4ZF3A 3GJ1A 4N1GA 4R1EA 1YX7A 1L2OC 4DXPA 1W7UA 2HFCA 3HCMA 3DQ8A 3OB1B 3MGFA 5I2LA 5I2OA 3GB3A 5HLVA 4KF4A 4JQ0D 1SL8A 3NXAA 5EHUA 3GK1A 2M1UA 3O6BA 1RRXA 4XOWA 1LXFC 5KTGA 3IR8A 4FTGA 2JT0A 1RECA 3IQOA 4GBAA 5I8NA 3WXAA 2COLB 2BBMA 1CM4A 4L1IA 2L98A 1XYDA 1JBYA 1ZFSA 1OZSA 1F70A 2AUCA 3ICBA 4OV2A 5LTPA 4CFRA 4L12A 1A4PA 1NX2A 1SW8A 3DQ4A 2H61C 2M8UA 1AUIB 1XVJA 2MHHA 3DVEA 4W7DA 3SV5A 2DDDA 2LLSA 3W1CA 1CFDA 1A29A 2QLIA 1MXLC 2H5QA 3SG6A 4ZB1A 1BT6A 5HZOA 4W6MA 1TNQA 1XFXO 4OHSA 4C0LA 3EK4A 4LW5A 3IQQA 2DUFA 2O24A 1YZWA 3K1KA 3CGLA 1F0BA 2LANA 4W7AA 3NT3A 1SYMA 1XA5A 5KU1A 3E5TA 5DPIA 2EMDA 2H5RA 5CPVA 1ZUXA 3CBEA 1ZGOA 1YHHA 4YGAA 1SK6D 1IH0A 1A75A 3LF3A 4Q7UA 4H47A 4YGDB 2VADA 2TN4A 1KFUS 2CT9A 4KEXA 1UP5A 3ZNIA 3SS0A 4N1FA 4IL1A 2AAOA 5ER5A 3PN7C 3SIAA 1CLBA 2KGBC 5DRFA 5KTYA 1QLSA 5FVFA 3PN7B 2BECA 3NSKA 4GGFA 3KCTA 1XFUO 1DJHA 2LUXA 3EVUA 1MHOA 4ZBLA 2FZUA 4PCWA 1M39A 2OTGC 4W69A 3CD1A 4JPZB 3GL4A 2QLGA 3PJBA 1G4YR 1XFWO 2BL0C 2OTGB 1GFLA 1IQ3A 2ZMWA 4W6RA 2WOSA 2KBIA 5EJUA 3RWAA 5D69A 5LK4A 5KSZA 4JRBA 2BL0B 1A75B 3SIBA 5JJGA 3PJ7A 1DJXA 1CLMA 1B47A 3U8PA 3CWGA 5DTYA 4PE1A 2K7OA 2LMUA 1M45A 2B1UA 1OMRA 2HQ8A 2LV7A 2MBXA 1TOPA 3NEDA 3LVDA 2IE2A 1F54A 1XSSA 1OXEA 5J3XA 1Q73A 4HREE 1AVSA 2DD7A 4N3DA 3SVSA 4J8AA 5AERA 1DJIA 1G7KA 2HF5A 2WCEA 4A4CA 1DGUA 1CM1A 1QX5B 3ED8A 3DQLA 1ZACA 1UHNA 5DPHA 4TZAA 4RTCA 1WRKA 4Q9WA 4W7XA 2CBLA 1YX8A 4QJ3B 2G3OA 2RGIA 4TNCA 2YDZA 3VROA 2KAYA 3U0MA 1B9CA 1H6RA 4PE7A 4RYSA 3SVNA 3OP0A 4EN1A 2G2BA 4DXNA 1JF2A 2L4HA 1Q80A 5H87A 1NWDA 4HQ9A 3C1VA 3PFVA 5DRGA 4GGNA 3KO0A 4ZF4A 3CR5X 2K7CA 2M49B 4NDCA 4EDSA 5B8IB 2DUHA 5HGEA 1YRUB 3BOWB 2PASA 2M97A 2LC5A 3U0LA 1YUTA 4DCKA 2SCPA 2JTTA 1MWNA 5HZUA 4P76A 1F4QA 3ZUJA 4P2YB 4J89A 2PSRA 3DQFA 3KEVA 3UG0A 1UISA 5CSNA 1QATA 2V53A 4B5YA 2F33A 1TIZA 5I2QA 2H5OA 1H4UA 1HUYA 1KWOB 2ISDA 5DTZA 4IK5A 1NCYA 2LLUA 2ZKMX 1J1EA 5K89A 2KQ6A 4HRHA 4DS7A 1F4OA 1M63B 3DQCA 3DD4A 2GV5A 2F3YA 1Q4EA 1XAEA 3UFZA 2QACA 1BJFA 4KPIA 3SG4A 1K9KA 4CLNA 1BU3A 4GF6B 1CTRA 2NZ0A 3ZULA 3DQNA 1KQMC 1A03A 3NSIA 1B1GA 1YHGA 2AH8A 3CFHA 1IQ5A 5EXBA 4R6BA 2K2FA 3PSRA 4B30A 1AP4A 1KQMB 1YVLA 2I7AA 3BUNB 2G6XA 2O2BA 2HETA 1XK4C 1J1DA 3E5VA 2NCOA 3LVAA 3CLNA 2M9GA 1XFZO 3CR2A 4DXMA 5FHVA 2O5GA 2WHUA 2LLTA 4PE0A 1D1OA 3SRYA 1QIWA 5EXUA 2CNPA 2BCXA 2HCGA 1QYQA 1R6PA 2BE4A 1CLLA 4ETOA 5LTRA 4W77A 4YGBB 3AI4A 4GFTA 2ZNDA 3ZTFA 1HQVA 1JBZA 2A56B 3IP2A 3G9AA 3H1RA 2BCAA 1K90D 1EMBA 1YUUA 2E30A 1S6IA 5HW9A 4GUKA 5AANA 1S6CA 2KYFA 1K8UA 4UPGA 4OGSA 3DVKA 2OPOA 4H3LA 3BYAA 1IWQA 3VRPA 4B30B 2OTBA 2QU1A 1WLMA 4W7CA 1KSOA 1XFYO 2EMNA 3DQKA 1B8CA 3DQUA 3ST0A 1YHIA 4W6PA 1BODA 4IK3A 4I2YA 4OQWA 3TMRA 2P4MA 2O29A 4W6GA 4HRGA 2PXSA 1XA9A 2BE6A 5ER4X 1C7VA 1UHJA 2WURA 5DTXA 2F8PA 1ZMZA 2WISA 1AHRA 1QYOA 4XL5A 4KA9A 1GL4A 4DRWA 2HPWA 2HGDA 1Q4BA 4Z4KA 2YFPA 2L50A 3RM1A 1TNXA 1V1GA 3O77A 1KK7Y 1B8LA 2YE1A 1BLQA 1IKUA 1RMOA 2A4JA 4ZF5A 3CTNA 1FI5A 2JNXA 2E6WA 2LCPA 3SJSA 5EB6A 3SSTA 4A4BA 4DXQA 1G8IA 3LK1A 3DQAA 1DJYA 1Y1XA 1UUSA 1R2UA 4GOBA 2LP2A 1LVCD 1CFFA 3AKBA 2I94A 4NDDA 3SVDA 3DQ9A 4W6TA 2QLEA 1J7PA 2C9IA 5D7FA 4XGYA 1EL4A 3RLZA 3VK1A 4ANJA 1F71A 4BY5A 2F3ZA 4HVFA 2MAZA 5CSFA 1YR5A 4PHNA 4PHJA 1JC2A 1EJ3A 1BMOA 2EGDA 1N0YA 2M7NA 3SVUA 3VICA 4FQOA 2H6VA 1OMVA 3ST2A 1JC0A 1B9AA 3DF0A 2OTEA 4XJKA 1HT9A 4P5OE 3NSOA 2G5ZB 1ZUZA 2WHSA 1ALWA 5FYXA 2A46A 4U2VA 4F0ZB 2JPTA 1XQMA 4W7FA 1K96A 1M31A 1CKKA 4LQTA 1AJ4A 2LVIA 1WY9A 4I5NB 1SCMB 3DQDA 1S6JA 1DMOA 2HQZA 3SSHA 1YTZC 3DQ5A 2Y0GA 1QVIY 2V4EA 1RROA 1EMLA 4ZFSA 2GGMA 3O2PA 4USLA 2HQKA 2HQWA 4LJDA 1B7TY 1RMPA 1PALA 5PALA 2WCBA 3BQ3A 5DKQA 2BBNA 1YRTB 2RH7A 2H2KA 2H5PA 3I5GC 4Q04A 3SG2A 4AQJA 3M24A 4JFGA 1RTP1 5F9GA 3M0WA 4ZCUA 4IZNA 1CMGA 3NSLA 3DVMA 3I5GB 4I5KA 3BUXB 3RWTA 1PSRA 1JF0A 1YJFA 4XJKB 3BXBA 3DQ6A 1JC1A 4ZCVA 3VGOA 1CV7A 1QLKA 3SG3A 2DUGA 1YUSA 1EG4A 1KSMA 3H1OA 1GGWA 4ICBA 2FOTA 1K94A 1CDLA 2A50B 1JUOA 1FPWA 3ST4A 2HJOA 1WLZA 1FW4A 3EK7A 5HZSA 2K7BA 3AAKA 5FVIA 3LA1A 3OX6A 5AXIA 4NQGA 4LJBA 1VRKA 1OOJA 2MRDA 4KGFA 1K95A 4KW8A 1Q4AA 1RK9A 1WRLA 2AMIA 2F2OA 4W75A 3DQOA 3FWBA 1KK7Z 3TUYC 4GGFC 1C07A 2QT2A 3ZUFA 2LP3A 4ORNA 3TUYB 1CDMA 1PSBA 1Z1QA 2JU0A 5EBJA 3GOFA 1QASA 2KOTA 1PVBA 3WLCA 5DY6A 1WDCC 1J7RA 1G33A 2GX0A 5BT0A 2Z6XA 2QLGB 2ICRA 4W7RA 2NCPA 1WDCB 1V1FA 3D0YA 2LVJA 1RMMA 4MEWA 2NXQA 5AEQA 1UURA 2QPTA 2JOJA 3CB9A 3BXAA 4MZLA 3BXCA 1YJ2A 3LF4B 1X02A 2CXJA 2KHNA 3LK0A 2WHTA 1RFJA 2KFGA 3GK4X 1K93D 3MSEB 4MSPA 5HKZA 4OJ0A 2OS8B 1Q4DA 1FBVA 4WQ3A 1KWOC 3PJ5A 1IRJA 3VHTA 2JWWA 3P8UA 1QVIZ 2WSOA 2L2EA 3H4SE 4M2QA 3TMTA 1QJTA 2D8NA 1NYAA 2KI4B 3OHMB 1QY3A 1SMGA 4Q7TA 3WNXB 4W7EA 1YFPA 2MLEC 2PMYA 3DPWA 1J55A 3D0YB 1B7TZ 4AR7A 5H88A 3BUWB 4YI8A 2G16B 1E8AA 3LLEA 5BTTA 2POXA 2ARLA 3GK2A 4I5LB 1M46A 1NPQA 1CDPA 1LA0A 1EXRA 3DQEA 2Q91A 4YGEB 2AWMA 1W7IB 3VRNA 3CGAA 2MLFC 1EMKA 4HE4A 4Q7RA 1RWYA 1JWDA 3OB2B 1UHIA 4PPJA 2VZXA 3E3RA 3EVVA 2LE9B 1TTXA 2LHLA 3VHTB 2EHBA 4EULA 4XVPA 4CPVA 5DQMA 2WNDA 1NIWA 2L4IA 2FCEA 3BX9A 1SY9A 1CFCA 2G6YA 5DPJA 3OSRA 5G08A 1Y0VH 4XOVA 1EMFA 3SVOA 1DF0A 4OCIA 4H3NA 4J88A 5AFPA 4W6HA 4PHKA 2OKWA 2LMTA 4OKHA 2BCBA 3CFAA 5BTTB 2CCMA 1DGVA 2FCDA 2A48A 3A8SA 4HQCA 2VAEA 1TCFA 1EMGA 1AK8A 1GJYA 2EC6C 4PE4A 4MZKA 5HZTA 2Q6PA 4ORCB 1KYSA 2FWQA 1S6ZA 1SPYA 2EC6B 1OMDA 4L13A 3O4YA 3NF0A 1HCJA 3LVCA 3LCPC 2LAPA 2P6BB 2M7LA 4Z4MA 1EMMA 4W6SA 1S1EA 2LM5A 2M3WA
chains in the Genus database with same CATH superfamily
2ZFDA 1OE9B 3SSLA 1WRZA 2QRFA 3WLDA 3SVRA 4M2OA 5IBWA 1RJVA 5I94A 2BKIB 1DJWA 4OY4A 4QJ5B 5HL1A 4OR9B 4WRIA 5DU0A 1DF0B 2DUIA 4DKMA 2G6EA 2KYCA 3DZTA 2G3DB 2IOVA 1TRFA 2KSPA 1UWOA 4CIDA 2BAPA 3B88A 4W6KA 5TNCA 3TS5B 2Z6ZA 1XO5A 4N5XA 1Y1UA 3DQ1A 4WQ2A 1QTXA 3JTDB 2JXCA 1KK8B 2JT8A 3D75A 1F09A 2DOQA 1MOUA 2H61A 4DXOA 3EVRA 1NUBA 3OX5A 3I5FB 2FJUB 4LQUA 1CFPA 1OXDA 2NLNA 5DKRA 1Q4CA 1MR8A 1B4CA 1KYPA 4YI9A 2ZMUA 1QYFA 1ZOTB 5JOLA 1L2OB 2LVVA 3FS7A 3DYEA 1H4BA 4KGEA 3EVPA 5DPGA 4W6LA 2C9JA 3SSKA 1FI6A 5LTQA 3OGOA 5H89A 1J7QA 4ZINA 4MN0A 2VVIA 5HYDA 1TNPA 5F6TA 2WC8A 1QWVA 5EB7A 4NWSA 3TDUA 2M1KB 1PVAA 1NCXA 4I5JA 1U5IA 4IK9A 2QLHA 4MVFA 3SVBA 2VRGA 3BUMB 3SSPA 4AOMA 1MF8B 3U8CA 4YGCB 3PALA 1SCMC 4LJCA 2L51A 1SR6C 1YURA 3LS3A 1IJ5A 1K9PA 2MA2A 1LINA 2A54B 1SSEB 2LVKA 3D77A 4NDBA 1KFXS 3D76A 4KW4A 2KFFA 1KCYA 3A4UB 2BTJA 2WCJA 3SVCA 1SR6B 3Q8IA 3F45A 4ORAB 3PIBA 4H3MA 3CFFA 1GQMA 1KFXL 1SCVA 1LKJA 5DKNA 2VVHA 1EMCA 4W73A 4E68A 2OJKA 2KAVA 2YE0A 4MZJA 1SL9A 4KW9A 2IB5A 2OKYA 1A2XA 1MOVA 3S0BA 2LNKA 3O78A 1SRAA 3SVEA 2PXWA 4W6CA 2P71A 2KQYA 1TNWA 5DQBA 1PK0D 3TZ1A 2AHAA 3DQ7A 1PULA 1QV1A 3DXLA 3GEXA 2DUEA 2WORA 1JSAA 3SG7A 4C0JA 4MRYA 1XMZA 1U5IB 4KAGA 2KLEA 4PFEA 2ZO7A 2KBMA 4JF9A 3BXKA 1Y1AA 4DUQA 3WCKA 3DF0B 1DTLA 1NX0A 1KFUL 2B3PA 1DEKA 3VRRA 3NT9A 1SKTA 3UNWA 1MYWA 3SSYA 1BG1A 2KPHA 5AQBB 4Q9XA 1W7JB 2JZIA 4JWQA 2FL1A 4KF5A 2V4EC 3CZ0A 3FIAA 5HBDA 2G2SB 3UO9A 4TZGA 3BUOB 1FF1A 3LL8B 1TN4A 1UHHA 3FE9A 2DD9A 3FWCA 2H9WA 2V4EB 2Y5IA 4LJDC 3S0EA 4PT1A 3S0AA 1EMAA 4M2PA 3B6XA 3I19A 2AWLA 1S26D 3SG5A 1F8HA 4MLWA 2A52B 1ZGPA 1OXFA 1OZOA 4L9MA 4PDZA 4R6DA 4W6AA 2M29A 2Q4UA 3SS3A 3D10A 4H48A 3EKJA 3B86A 1S5GY 3I5IC 3U8AA 1BR1B 2WIQA 2CTNA 3AKAA 1IJ6A 5J2OA 1OSAA 2Y1NA 4RYWA 2KDHA 4KF5C 3BOWA 1TWOA 2JQ6A 3I5IB 1K2HA 4W6FA 1S3PA 3OSQA 2JT3A 2K8MB 3KF9A 3D78A 2KGRA 3DQIA 2IS9A 1QXTA 2HPSA 3SS5A 3DQMA 1Z1PA 3GJ2A 2Q57A 4DKNA 2LMVA 1BFPA 3RZSA 2LHIA 1QXPA 4DXIA 3CR4X 1QV0A 5HKWA 1IG5A 1NCZA 1P28A 5T3IA 1W7TA 3TDIA 2JC2A 3JVTC 1AJ5A 4IK1A 2ZO6A 4W6NA 3AI5A 1SBJA 3JVTB 3EG5B 1QIVA 4DIRA 3CZTX 5DTLA 1NP8A 3NHIA 2ZN8A 2H8QA 2OS8C 1DVIA 2DDCA 5FVGA 5HLOA 4HSZA 1TCOB 4AS8A 3NEZA 1DJZA 1KP5A 2L5YA 3EK8A 2KI4C 5HKYA 2Y1MA 2ERBA 3BFAA 3U0NA 1KQVA 5EXCI 2BKHB 2PVBA 1LA3A 1UHKA 2G9BA 4BDUA 4W72A 2K2AA 1CMFA 1OOGA 2ZRSA 3DQ2A 1ALVA 3S05A 3FE8A 1GGXA 2ZN9A 3L4LA 4GPLB 3K1EA 1BF5A 1XK4A 2I18A 3HX4A 5FI2A 1Z2CB 1CDNA 4PPKA 2K0JA 3V3DA 2PALA 1MUXA 1NX3A 3SSVA 1W9ZA 2EMOA 2K7DA 2KI6D 5BPJA 3AKOA 1EMEA 3E5WA 4W6IA 2GGZA 3EKHA 1MQ1A 3VRQA 2L5XB 3R1PA 4JGEA 1Y6WA 4U8DA 1LS8A 1SL7A 1ZGQA 4D1EA 3I5HC 1Z4HA 4HQ8A 1C7WA 2HGYA 1OQPA 4PHMA 1BOCA 1L7ZA 3W1DA 1IGVA 2KI6C 4FQTA 2M0RA 1DT7B 1N2DA 2SASA 3I5HB 2WCFA 4C0KA 4JEOA 3DQHA 1RM9A 3DVJA 4PALA 3WHUB 3IF7A 3LSAA 4IK8A 4W6DA 2K61A 1QX2A 2Y4QA 3OBVA 2OGRA 3CS1A 1JBAA 4YBHB 2KAXA 4PPLA 4MBEA 1B8RA 1C4FA 1BR4B 5GQQC 4W6JA 2JADA 3WHTB 4W74A 4GAOA 4W76A 4KYNA 2IB6A 2ZRTA 1EG3A 1ODBA 1DJGA 2GW3A 5BQLA 1NSHA 1W7SA 2JXLA 2GX2A 3DPZA 3ZWHA 2VVJA 3A8RA 4GNKB 1F55A 1S5GZ 3PATA 3DPXA 4OVNF 3KCSA 1XFVO 4EDOA 4EMQA 1YVHA 3NGVA 1J7OA 3PM8A 3ADFA 3N7HA 2QZ0A 3KHEA 1MXEA 2I2RE 2K60A 1EH2A 2AWJA 2LUCA 4XYNA 1N65A 4AQIA 4ZIOA 1CB1A 1JFKA 2Z6YA 3U0KA 5CSJA 3M22A 2HRSA 2QDIA 2MJWB 4YRUA 3ST3A 4ORBB 4JC2A 2B3QA 1S36A 2KFHA 1H8BA 1PRWA 3PLFB 1SNLA 3R1OA 2F2PA 4QJ4B 4IK4A 4W6BA 3K21A 2A47A 2WSNA 3TS5C 4MRXA 3IVTA 1NX1A 4UTSA 5CSIA 4W6UA 2PRUA 2L0PA 4GESB 3KPXA 3R72A 3JTDC 4W6OA 2JNFA 4P1QA 2GW4B 1KK8C 1K9UA 4CFQA 3DQJA 2KNEA 2JULA 2QEOA 3DQ3A 1TUJA 3CD9A 3PM2A 1CNPA 3TDZA 2A53B 2AWKA 3AAJA 3I5FC 1QX7A 1GGZA 3NHTA 2ZNEA 1KYRA 3QRXA 2O60A 2Z1OA 3P28A 2R2IA 1JFJA 2JRFA 4BY4A 2JTZA 5FI6A 1QS7A 4ZF3A 3GJ1A 2QEBA 5FI7A 4N1GA 4R1EA 1YX7A 1L2OC 4DXPA 1W7UA 2HFCA 3HCMA 3DQ8A 3OB1B 3MGFA 5I2LA 2GTEA 5I2OA 3D74A 3GB3A 5HLVA 3FE6A 3B87A 2WC6A 4JQ0D 4KF4A 1SL8A 3NXAA 5EHUA 3GK1A 2M1UA 3O6BA 1RRXA 4XOWA 1LXFC 5KTGA 3IR8A 4FTGA 2JT0A 1RECA 3IQOA 4GBAA 5I8NA 3WXAA 2COLB 2BBMA 1CM4A 2L98A 4L1IA 2WCKA 1XYDA 1JBYA 1ZFSA 1OZSA 1F70A 2AUCA 3ICBA 4OV2A 5LTPA 4CFRA 4L12A 1A4PA 1NX2A 1SW8A 3DQ4A 2H61C 2M8UA 1AUIB 1XVJA 2MHHA 3DVEA 4W7DA 3SV5A 2DDDA 3CDNA 2LLSA 3W1CA 1CFDA 3B7AA 1A29A 2QLIA 1MXLC 2H5QA 3SG6A 4ZB1A 1BT6A 5HZOA 4W6MA 1TNQA 1XFXO 4OHSA 4C0LA 2H8VA 3EK4A 4LW5A 3IQQA 2DUFA 2O24A 1YZWA 3K1KA 3CGLA 1F0BA 2LANA 4IJ7A 4W7AA 3NT3A 1SYMA 1XA5A 5KU1A 3E5TA 5DPIA 2EMDA 2H5RA 5CPVA 1ZUXA 3CBEA 1ZGOA 3VB1A 1YHHA 4YGAA 1SK6D 1IH0A 1A75A 3LF3A 4Q7UA 4H47A 4YGDB 2VADA 2KLDA 2TN4A 1KFUS 2CT9A 4KEXA 1UP5A 3ZNIA 3SS0A 4N1FA 4IL1A 2AAOA 5ER5A 3PN7C 3SIAA 1CLBA 2KGBC 5DRFA 5KTYA 1QLSA 5FVFA 2YGUA 1XFRA 3PN7B 2BECA 3NSKA 4GGFA 3KCTA 1XFUO 1DJHA 2LUXA 3EVUA 1MHOA 4ZBLA 2FZUA 4PCWA 1M39A 2OTGC 4W69A 3CD1A 4JPZB 3GL4A 2QLGA 3PJBA 1G4YR 1XFWO 3SS4A 3CYZA 3S0GA 2BL0C 2OTGB 1C3YA 4INXA 1GFLA 1IQ3A 2ZMWA 4W6RA 2WOSA 2KBIA 3BFBA 5EJUA 3RWAA 5D69A 5LK4A 5KSZA 4JRBA 2BL0B 1A75B 3SIBA 5JJGA 3PJ7A 1DJXA 1CLMA 1B47A 3U8PA 3CWGA 5DTYA 4PE1A 2K7OA 2LMUA 1M45A 2B1UA 4JD9A 1OMRA 2HQ8A 2LV7A 2MBXA 1TOPA 2BNXA 3CABA 3NEDA 3LVDA 2IE2A 1F54A 1XSSA 1OXEA 5J3XA 1Q73A 4HREE 1AVSA 2DD7A 4N3DA 3SVSA 4J8AA 5AERA 1DJIA 1G7KA 2HF5A 2JPOA 2WCEA 1DGUA 1CM1A 1QX5B 4A4CA 3ED8A 3DQLA 1ZACA 3DY9A 1UHNA 5DPHA 4TZAA 4RTCA 1WRKA 4Q9WA 4W7XA 2CBLA 1YX8A 4QJ3B 2G3OA 2RGIA 1DELA 4TNCA 2YDZA 3VROA 3QMEA 2KAYA 3U0MA 1B9CA 1H6RA 4PE7A 4RYSA 3SVNA 3OP0A 4EN1A 2G2BA 4DXNA 1JF2A 1ORGA 2L4HA 1Q80A 5H87A 1NWDA 4HQ9A 3C1VA 3PFVA 5DRGA 4GGNA 3KO0A 4ZF4A 3CR5X 2K7CA 2M49B 4NDCA 4JKTA 4EDSA 5B8IB 2DUHA 5HGEA 1YRUB 3BOWB 2PASA 2M97A 2LC5A 3U0LA 1YUTA 4DCKA 2SCPA 2JTTA 1MWNA 5HZUA 4P76A 1F4QA 3ZUJA 4P2YB 4J89A 2PSRA 3DQFA 3KEVA 3UG0A 1UISA 5CSNA 1QATA 2V53A 4B5YA 2F33A 1TIZA 5I2QA 2H5OA 1H4UA 1HUYA 1KWOB 2ISDA 5DTZA 4IK5A 1NCYA 2LLUA 2ZKMX 1J1EA 5K89A 2KQ6A 1OOHA 4HRHA 4DS7A 1F4OA 1M63B 3DQCA 3DD4A 2GV5A 2F3YA 1Q4EA 3PJIA 1XAEA 2WCLA 3UFZA 2QACA 1BJFA 4KPIA 3SG4A 1K9KA 4CLNA 1BU3A 3R1VA 4GF6B 1CTRA 2NZ0A 3ZULA 3DQNA 1KQMC 1A03A 3NSIA 1B1GA 1YHGA 2AH8A 3CFHA 1IQ5A 5EXBA 4R6BA 2K2FA 3PSRA 4B30A 1AP4A 1KQMB 1YVLA 2I7AA 3BUNB 2G6XA 2O2BA 2HETA 1XK4C 1J1DA 3E5VA 2NCOA 3LVAA 3CLNA 2M9GA 1XFZO 3CR2A 4DXMA 5FHVA 2O5GA 2WHUA 2LLTA 4PE0A 1D1OA 3SRYA 1QIWA 5EXUA 2CNPA 2BCXA 2HCGA 3CZ1A 1QYQA 1R6PA 2BE4A 1CLLA 4ETOA 5LTRA 4W77A 4YGBB 3AI4A 4GFTA 2ZNDA 3ZTFA 1HQVA 1JBZA 2A56B 2PQLA 3IP2A 3G9AA 3H1RA 2BCAA 1K90D 1EMBA 1YUUA 2E30A 1S6IA 5HW9A 4GUKA 5AANA 1S6CA 2KYFA 1K8UA 4UPGA 4OGSA 3DVKA 4F7FA 2OPOA 3BYAA 4H3LA 1IWQA 1IIOA 3VRPA 4B30B 2OTBA 2QU1A 1WLMA 4W7CA 1KSOA 1XFYO 2EMNA 3DQKA 1B8CA 3DQUA 3ST0A 1YHIA 4W6PA 1BODA 4IK3A 4I2YA 4OQWA 3TMRA 2P4MA 2O29A 4W6GA 4HRGA 2PXSA 1XA9A 2BE6A 5ER4X 1C7VA 1UHJA 2WURA 5DTXA 2F8PA 1ZMZA 2WISA 1AHRA 1QYOA 4XL5A 4KA9A 1GL4A 4DRWA 2HPWA 2HGDA 1Q4BA 4Z4KA 2YFPA 2L50A 3RM1A 1TNXA 1V1GA 3O77A 1KK7Y 1B8LA 2YE1A 1BLQA 1IKUA 1RMOA 2A4JA 4ZF5A 3CTNA 1FI5A 2JNXA 2E6WA 2LCPA 3SJSA 5EB6A 3SSTA 4A4BA 4DXQA 1G8IA 3LK1A 3DQAA 1DJYA 1Y1XA 1UUSA 1R2UA 4GOBA 2LP2A 1LVCD 1CFFA 3AKBA 2I94A 4NDDA 3SVDA 3DQ9A 4W6TA 2QLEA 1J7PA 2C9IA 5D7FA 4XGYA 1EL4A 3RLZA 5EL2A 3VK1A 4ANJA 1F71A 4BY5A 2F3ZA 4HVFA 2MAZA 2FJYA 2QEHA 5CSFA 1YR5A 4PHNA 4PHJA 1JC2A 1EJ3A 1BMOA 2EGDA 1N0YA 2M7NA 3SVUA 3VICA 4FQOA 2H6VA 1OMVA 3ST2A 1JC0A 1B9AA 3DF0A 2OTEA 4XJKA 1HT9A 4P5OE 3NSOA 2G5ZB 1ZUZA 2WHSA 1ALWA 5FYXA 2A46A 4U2VA 4F0ZB 2JPTA 1XQMA 4W7FA 1K96A 1M31A 1CKKA 4LQTA 1AJ4A 2LVIA 1WY9A 4I5NB 1SCMB 3DQDA 1S6JA 1DMOA 2HQZA 3SSHA 1YTZC 3DQ5A 2Y0GA 1QVIY 2V4EA 1RROA 1EMLA 1DC1A 1T14A 4ZFSA 2GGMA 3O2PA 4USLA 2HQKA 2HQWA 4LJDA 1B7TY 1RMPA 1PALA 5PALA 2WCBA 3BQ3A 5DKQA 2BBNA 1YRTB 2RH7A 2H2KA 2H5PA 3I5GC 4Q04A 3SG2A 4AQJA 3M24A 4JFGA 1RTP1 5F9GA 3M0WA 4ZCUA 4IZNA 1CMGA 3NSLA 3DVMA 3I5GB 4I5KA 3BUXB 3RWTA 1PSRA 3L4AA 1JF0A 1YJFA 4XJKB 3BXBA 3DQ6A 1JC1A 4ZCVA 3VGOA 1CV7A 1QLKA 3SG3A 2DUGA 1YUSA 1EG4A 1KSMA 3H1OA 1GGWA 4ICBA 2FOTA 1K94A 1CDLA 2A50B 1JUOA 1FPWA 3ST4A 2HJOA 3S0FA 1WLZA 1FW4A 3EK7A 5HZSA 2K7BA 3AAKA 5FVIA 3LA1A 3OX6A 5AXIA 4NQGA 4LJBA 1VRKA 2PYQA 1OOJA 2MRDA 4KGFA 1K95A 4KW8A 1OOIX 2WCMA 1Q4AA 1TUZA 1RK9A 1WRLA 2AMIA 2F2OA 4W75A 3DQOA 3FWBA 1KK7Z 3TUYC 4GGFC 1C07A 2QT2A 3ZUFA 2LP3A 4ORNA 3TUYB 1CDMA 1PSBA 1Z1QA 2JU0A 5EBJA 3GOFA 1QASA 2KOTA 1PVBA 3WLCA 5DY6A 1WDCC 1J7RA 1G33A 2GX0A 5BT0A 3BFHA 2Z6XA 2QLGB 2ICRA 4W7RA 2NCPA 1WDCB 1V1FA 3D0YA 2LVJA 1RMMA 4MEWA 2NXQA 5AEQA 1UURA 2QPTA 2JOJA 3CB9A 3BXAA 4MZLA 3O4XA 3BXCA 1YJ2A 3LF4B 1X02A 3D73A 2CXJA 3OGNA 2KHNA 3LK0A 2QEVA 2WHTA 1RFJA 2KFGA 3GK4X 1K93D 3MSEB 4MSPA 5HKZA 1OOFA 4OJ0A 2OS8B 1Q4DA 4INWA 1FBVA 4WQ3A 1KWOC 1IRJA 3PJ5A 2WCHA 3VHTA 2JWWA 3P8UA 1QVIZ 2WSOA 2L2EA 3H4SE 4M2QA 3TMTA 3CZ2A 3V2LA 1QJTA 2D8NA 1NYAA 2KI4B 3OHMB 1QY3A 1SMGA 4Q7TA 3WNXB 4W7EA 1YFPA 2P70A 2MLEC 5D3OA 2PMYA 3DPWA 1J55A 3D0YB 1B7TZ 4AR7A 5H88A 3BUWB 4YI8A 2G16B 1E8AA 2L2CA 3LLEA 5BTTA 2POXA 2ARLA 1DQEA 3GK2A 4I5LB 1M46A 1NPQA 1CDPA 1LA0A 1EXRA 3DQEA 2Q91A 4YGEB 2AWMA 1W7IB 3VRNA 3CGAA 2MLFC 1EMKA 4HE4A 4Q7RA 1RWYA 1JWDA 3OB2B 1UHIA 4PPJA 2VZXA 3E3RA 3EVVA 2LE9B 1TTXA 2LHLA 3VHTB 1C3ZA 2EHBA 4EULA 4XVPA 4CPVA 5DICA 5DQMA 2WNDA 2WC5A 1NIWA 2L4IA 2FCEA 4OZDA 3BX9A 1SY9A 3L47A 1CFCA 2G6YA 5DPJA 3OSRA 5G08A 1Y0VH 4XOVA 1EMFA 3SVOA 1DF0A 4OCIA 4H3NA 3BJHA 1GM0A 4J88A 5AFPA 1OW4A 4W6HA 4PHKA 2OKWA 2LMTA 4OKHA 2BCBA 3CFAA 5BTTB 2CCMA 1DGVA 2FCDA 2A48A 3A8SA 4HQCA 2VAEA 1TCFA 1EMGA 1AK8A 1GJYA 2EC6C 4PE4A 4MZKA 5HZTA 2Q6PA 4ORCB 1KYSA 2FWQA 1S6ZA 1SPYA 2EC6B 1OMDA 4L13A 3O4YA 3NF0A 1HCJA 3LVCA 3LCPC 2LAPA 2P6BB 2M7LA 4Z4MA 1EMMA 4W6SA 1S1EA 2LM5A 3S0DA 2M3WA
chains in the Genus database with same CATH topology
2ZFDA 1OE9B 3SSLA 1WRZA 2QRFA 3WLDA 3SVRA 4M2OA 5IBWA 1RJVA 2BKIB 1DJWA 4OY4A 4QJ5B 4OR9B 4WRIA 5DU0A 1DF0B 2DUIA 4DKMA 2G6EA 2KYCA 2G3DB 2IOVA 1TRFA 2KSPA 1UWOA 4CIDA 4W6KA 5TNCA 3TS5B 2Z6ZA 1XO5A 4N5XA 1Y1UA 3DQ1A 4WQ2A 1QTXA 3JTDB 2JXCA 1KK8B 2JT8A 1F09A 2DOQA 1MOUA 2H61A 4DXOA 3EVRA 1NUBA 3OX5A 3I5FB 2FJUB 4LQUA 1CFPA 1OXDA 2NLNA 5DKRA 1Q4CA 1MR8A 1B4CA 1KYPA 4YI9A 2ZMUA 1QYFA 1ZOTB 5JOLA 1L2OB 2LVVA 3FS7A 1H4BA 4KGEA 3EVPA 5DPGA 4W6LA 2C9JA 3SSKA 1FI6A 5LTQA 3OGOA 5H89A 1J7QA 4ZINA 4MN0A 2VVIA 5HYDA 1TNPA 5F6TA 2WC8A 5EB7A 4NWSA 3TDUA 2M1KB 1PVAA 1NCXA 4I5JA 1U5IA 4IK9A 2QLHA 4MVFA 3SVBA 2VRGA 3BUMB 3SSPA 4AOMA 1MF8B 3U8CA 4YGCB 3PALA 1SCMC 4LJCA 2L51A 1SR6C 1YURA 3LS3A 1IJ5A 1K9PA 2MA2A 1LINA 2A54B 2LVKA 4NDBA 1KFXS 4KW4A 2KFFA 1KCYA 3A4UB 2BTJA 3SVCA 1SR6B 3F45A 4ORAB 3PIBA 4H3MA 3CFFA 1GQMA 1KFXL 1SCVA 1LKJA 5DKNA 2VVHA 1EMCA 4W73A 4E68A 2OJKA 2KAVA 2YE0A 4MZJA 1SL9A 4KW9A 2IB5A 2OKYA 1A2XA 1MOVA 2LNKA 3O78A 1SRAA 3SVEA 2PXWA 4W6CA 2KQYA 1TNWA 5DQBA 1PK0D 3TZ1A 2AHAA 3DQ7A 1PULA 1QV1A 3GEXA 2DUEA 2WORA 1JSAA 3SG7A 4C0JA 4MRYA 1XMZA 1U5IB 4KAGA 4PFEA 2ZO7A 2KBMA 4JF9A 3BXKA 1Y1AA 4DUQA 3WCKA 3DF0B 1DTLA 1NX0A 1KFUL 2B3PA 3VRRA 3NT9A 1SKTA 1MYWA 3SSYA 1BG1A 5AQBB 4Q9XA 1W7JB 2JZIA 4JWQA 2FL1A 4KF5A 2V4EC 3FIAA 5HBDA 2G2SB 4TZGA 3BUOB 1FF1A 3LL8B 1TN4A 1UHHA 2DD9A 3FWCA 2H9WA 2V4EB 2Y5IA 4LJDC 1EMAA 4M2PA 2AWLA 3I19A 1S26D 3SG5A 1F8HA 4MLWA 2A52B 1ZGPA 1OXFA 1OZOA 4L9MA 4PDZA 4R6DA 4W6AA 2M29A 2Q4UA 3D10A 4H48A 3EKJA 1S5GY 3I5IC 3U8AA 1BR1B 2WIQA 2CTNA 3AKAA 1IJ6A 5J2OA 1OSAA 2Y1NA 4RYWA 2KDHA 4KF5C 3BOWA 1K2HA 2JQ6A 3I5IB 4W6FA 1S3PA 3OSQA 2JT3A 2K8MB 3KF9A 2KGRA 3DQIA 2IS9A 1QXTA 2HPSA 3DQMA 1Z1PA 3GJ2A 2Q57A 4DKNA 2LMVA 1BFPA 2LHIA 1QXPA 4DXIA 3CR4X 1QV0A 5HKWA 1IG5A 1NCZA 5T3IA 1W7TA 3TDIA 2JC2A 3JVTC 1AJ5A 4IK1A 2ZO6A 4W6NA 3AI5A 1SBJA 3JVTB 1QIVA 4DIRA 3CZTX 5DTLA 1NP8A 2ZN8A 2H8QA 2OS8C 1DVIA 2DDCA 5FVGA 5HLOA 4HSZA 1TCOB 4AS8A 3NEZA 1DJZA 1KP5A 3EK8A 2KI4C 5HKYA 2Y1MA 3U0NA 1KQVA 5EXCI 2BKHB 2PVBA 1LA3A 1UHKA 2G9BA 4BDUA 4W72A 2K2AA 1CMFA 2ZRSA 1ALVA 3DQ2A 3S05A 1GGXA 2ZN9A 4GPLB 1BF5A 1XK4A 2I18A 3HX4A 1CDNA 4PPKA 2K0JA 3V3DA 2PALA 1MUXA 1NX3A 3SSVA 2EMOA 2K7DA 2KI6D 5BPJA 3AKOA 1EMEA 3E5WA 4W6IA 2GGZA 3EKHA 1MQ1A 3VRQA 2L5XB 4JGEA 1Y6WA 4U8DA 1SL7A 1ZGQA 4D1EA 3I5HC 4HQ8A 1C7WA 2HGYA 1OQPA 4PHMA 1BOCA 1L7ZA 3W1DA 1IGVA 2KI6C 2M0RA 1DT7B 1N2DA 2SASA 3I5HB 2WCFA 4C0KA 4JEOA 3DQHA 1RM9A 3DVJA 4PALA 3WHUB 3IF7A 3LSAA 4IK8A 4W6DA 2K61A 1QX2A 2Y4QA 2OGRA 3CS1A 1JBAA 4YBHB 2KAXA 4PPLA 4MBEA 1B8RA 1C4FA 1BR4B 5GQQC 4W6JA 2JADA 3WHTB 4W74A 4GAOA 4W76A 2IB6A 2ZRTA 1EG3A 1ODBA 1DJGA 2GW3A 5BQLA 1NSHA 1W7SA 2JXLA 2GX2A 3DPZA 3ZWHA 2VVJA 3A8RA 4GNKB 1F55A 1S5GZ 3PATA 3DPXA 4OVNF 3KCSA 1XFVO 4EDOA 4EMQA 1YVHA 1J7OA 3PM8A 3ADFA 2QZ0A 3KHEA 1MXEA 2I2RE 1EH2A 2AWJA 2LUCA 4XYNA 1N65A 4AQIA 4ZIOA 1CB1A 1JFKA 2Z6YA 3U0KA 5CSJA 3M22A 2HRSA 2MJWB 4YRUA 3ST3A 4ORBB 4JC2A 2B3QA 1S36A 2KFHA 1H8BA 1PRWA 3PLFB 1SNLA 2F2PA 4QJ4B 4IK4A 4W6BA 3K21A 2A47A 2WSNA 3TS5C 4MRXA 1NX1A 4UTSA 5CSIA 4W6UA 2PRUA 2L0PA 4GESB 3KPXA 3JTDC 4W6OA 2JNFA 4P1QA 2GW4B 1KK8C 1K9UA 4CFQA 3DQJA 2KNEA 2JULA 3DQ3A 3CD9A 1CNPA 3TDZA 2A53B 2AWKA 3AAJA 3I5FC 1QX7A 1GGZA 2ZNEA 1KYRA 3QRXA 2O60A 2Z1OA 3P28A 2R2IA 1JFJA 2JRFA 4BY4A 2JTZA 1QS7A 4ZF3A 3GJ1A 4N1GA 4R1EA 1YX7A 1L2OC 4DXPA 1W7UA 2HFCA 3HCMA 3DQ8A 3OB1B 3MGFA 5I2LA 5I2OA 3GB3A 5HLVA 4KF4A 4JQ0D 1SL8A 3NXAA 5EHUA 3GK1A 2M1UA 3O6BA 1RRXA 4XOWA 1LXFC 5KTGA 3IR8A 4FTGA 2JT0A 1RECA 3IQOA 4GBAA 5I8NA 3WXAA 2COLB 2BBMA 1CM4A 4L1IA 2L98A 1XYDA 1JBYA 1ZFSA 1OZSA 1F70A 2AUCA 3ICBA 4OV2A 5LTPA 4CFRA 4L12A 1A4PA 1NX2A 1SW8A 3DQ4A 2H61C 2M8UA 1AUIB 1XVJA 2MHHA 3DVEA 4W7DA 3SV5A 2DDDA 2LLSA 3W1CA 1CFDA 1A29A 2QLIA 1MXLC 2H5QA 3SG6A 4ZB1A 1BT6A 5HZOA 4W6MA 1TNQA 1XFXO 4OHSA 4C0LA 3EK4A 4LW5A 3IQQA 2DUFA 2O24A 1YZWA 3K1KA 3CGLA 1F0BA 2LANA 4W7AA 3NT3A 1SYMA 1XA5A 5KU1A 3E5TA 5DPIA 2EMDA 2H5RA 5CPVA 1ZUXA 3CBEA 1ZGOA 1YHHA 4YGAA 1SK6D 1IH0A 1A75A 3LF3A 4Q7UA 4H47A 4YGDB 2VADA 2TN4A 1KFUS 2CT9A 4KEXA 1UP5A 3ZNIA 3SS0A 4N1FA 4IL1A 2AAOA 5ER5A 3PN7C 3SIAA 1CLBA 2KGBC 5DRFA 5KTYA 1QLSA 5FVFA 3PN7B 2BECA 3NSKA 4GGFA 3KCTA 1XFUO 1DJHA 2LUXA 3EVUA 1MHOA 4ZBLA 2FZUA 4PCWA 1M39A 2OTGC 4W69A 3CD1A 4JPZB 3GL4A 2QLGA 3PJBA 1G4YR 1XFWO 2BL0C 2OTGB 1GFLA 1IQ3A 2ZMWA 4W6RA 2WOSA 2KBIA 5EJUA 3RWAA 5D69A 5LK4A 5KSZA 4JRBA 2BL0B 1A75B 3SIBA 5JJGA 3PJ7A 1DJXA 1CLMA 1B47A 3U8PA 3CWGA 5DTYA 4PE1A 2K7OA 2LMUA 1M45A 2B1UA 1OMRA 2HQ8A 2LV7A 2MBXA 1TOPA 3NEDA 3LVDA 2IE2A 1F54A 1XSSA 1OXEA 5J3XA 1Q73A 4HREE 1AVSA 2DD7A 4N3DA 3SVSA 4J8AA 5AERA 1DJIA 1G7KA 2HF5A 2WCEA 4A4CA 1DGUA 1CM1A 1QX5B 3ED8A 3DQLA 1ZACA 1UHNA 5DPHA 4TZAA 4RTCA 1WRKA 4Q9WA 4W7XA 2CBLA 1YX8A 4QJ3B 2G3OA 2RGIA 4TNCA 2YDZA 3VROA 2KAYA 3U0MA 1B9CA 1H6RA 4PE7A 4RYSA 3SVNA 3OP0A 4EN1A 2G2BA 4DXNA 1JF2A 2L4HA 1Q80A 5H87A 1NWDA 4HQ9A 3C1VA 3PFVA 5DRGA 4GGNA 3KO0A 4ZF4A 3CR5X 2K7CA 2M49B 4NDCA 4EDSA 5B8IB 2DUHA 5HGEA 1YRUB 3BOWB 2PASA 2M97A 2LC5A 3U0LA 1YUTA 4DCKA 2SCPA 2JTTA 1MWNA 5HZUA 4P76A 1F4QA 3ZUJA 4P2YB 4J89A 2PSRA 3DQFA 3KEVA 3UG0A 1UISA 5CSNA 1QATA 2V53A 4B5YA 2F33A 1TIZA 5I2QA 2H5OA 1H4UA 1HUYA 1KWOB 2ISDA 5DTZA 4IK5A 1NCYA 2LLUA 2ZKMX 1J1EA 5K89A 2KQ6A 4HRHA 4DS7A 1F4OA 1M63B 3DQCA 3DD4A 2GV5A 2F3YA 1Q4EA 1XAEA 3UFZA 2QACA 1BJFA 4KPIA 3SG4A 1K9KA 4CLNA 1BU3A 4GF6B 1CTRA 2NZ0A 3ZULA 3DQNA 1KQMC 1A03A 3NSIA 1B1GA 1YHGA 2AH8A 3CFHA 1IQ5A 5EXBA 4R6BA 2K2FA 3PSRA 4B30A 1AP4A 1KQMB 1YVLA 2I7AA 3BUNB 2G6XA 2O2BA 2HETA 1XK4C 1J1DA 3E5VA 2NCOA 3LVAA 3CLNA 2M9GA 1XFZO 3CR2A 4DXMA 5FHVA 2O5GA 2WHUA 2LLTA 4PE0A 1D1OA 3SRYA 1QIWA 5EXUA 2CNPA 2BCXA 2HCGA 1QYQA 1R6PA 2BE4A 1CLLA 4ETOA 5LTRA 4W77A 4YGBB 3AI4A 4GFTA 2ZNDA 3ZTFA 1HQVA 1JBZA 2A56B 3IP2A 3G9AA 3H1RA 2BCAA 1K90D 1EMBA 1YUUA 2E30A 1S6IA 5HW9A 4GUKA 5AANA 1S6CA 2KYFA 1K8UA 4UPGA 4OGSA 3DVKA 2OPOA 4H3LA 3BYAA 1IWQA 3VRPA 4B30B 2OTBA 2QU1A 1WLMA 4W7CA 1KSOA 1XFYO 2EMNA 3DQKA 1B8CA 3DQUA 3ST0A 1YHIA 4W6PA 1BODA 4IK3A 4I2YA 4OQWA 3TMRA 2P4MA 2O29A 4W6GA 4HRGA 2PXSA 1XA9A 2BE6A 5ER4X 1C7VA 1UHJA 2WURA 5DTXA 2F8PA 1ZMZA 2WISA 1AHRA 1QYOA 4XL5A 4KA9A 1GL4A 4DRWA 2HPWA 2HGDA 1Q4BA 4Z4KA 2YFPA 2L50A 3RM1A 1TNXA 1V1GA 3O77A 1KK7Y 1B8LA 2YE1A 1BLQA 1IKUA 1RMOA 2A4JA 4ZF5A 3CTNA 1FI5A 2JNXA 2E6WA 2LCPA 3SJSA 5EB6A 3SSTA 4A4BA 4DXQA 1G8IA 3LK1A 3DQAA 1DJYA 1Y1XA 1UUSA 1R2UA 4GOBA 2LP2A 1LVCD 1CFFA 3AKBA 2I94A 4NDDA 3SVDA 3DQ9A 4W6TA 2QLEA 1J7PA 2C9IA 5D7FA 4XGYA 1EL4A 3RLZA 3VK1A 4ANJA 1F71A 4BY5A 2F3ZA 4HVFA 2MAZA 5CSFA 1YR5A 4PHNA 4PHJA 1JC2A 1EJ3A 1BMOA 2EGDA 1N0YA 2M7NA 3SVUA 3VICA 4FQOA 2H6VA 1OMVA 3ST2A 1JC0A 1B9AA 3DF0A 2OTEA 4XJKA 1HT9A 4P5OE 3NSOA 2G5ZB 1ZUZA 2WHSA 1ALWA 5FYXA 2A46A 4U2VA 4F0ZB 2JPTA 1XQMA 4W7FA 1K96A 1M31A 1CKKA 4LQTA 1AJ4A 2LVIA 1WY9A 4I5NB 1SCMB 3DQDA 1S6JA 1DMOA 2HQZA 3SSHA 1YTZC 3DQ5A 2Y0GA 1QVIY 2V4EA 1RROA 1EMLA 4ZFSA 2GGMA 3O2PA 4USLA 2HQKA 2HQWA 4LJDA 1B7TY 1RMPA 1PALA 5PALA 2WCBA 3BQ3A 5DKQA 2BBNA 1YRTB 2RH7A 2H2KA 2H5PA 3I5GC 4Q04A 3SG2A 4AQJA 3M24A 4JFGA 1RTP1 5F9GA 3M0WA 4ZCUA 4IZNA 1CMGA 3NSLA 3DVMA 3I5GB 4I5KA 3BUXB 3RWTA 1PSRA 1JF0A 1YJFA 4XJKB 3BXBA 3DQ6A 1JC1A 4ZCVA 3VGOA 1CV7A 1QLKA 3SG3A 2DUGA 1YUSA 1EG4A 1KSMA 3H1OA 1GGWA 4ICBA 2FOTA 1K94A 1CDLA 2A50B 1JUOA 1FPWA 3ST4A 2HJOA 1WLZA 1FW4A 3EK7A 5HZSA 2K7BA 3AAKA 5FVIA 3LA1A 3OX6A 5AXIA 4NQGA 4LJBA 1VRKA 1OOJA 2MRDA 4KGFA 1K95A 4KW8A 1Q4AA 1RK9A 1WRLA 2AMIA 2F2OA 4W75A 3DQOA 3FWBA 1KK7Z 3TUYC 4GGFC 1C07A 2QT2A 3ZUFA 2LP3A 4ORNA 3TUYB 1CDMA 1PSBA 1Z1QA 2JU0A 5EBJA 3GOFA 1QASA 2KOTA 1PVBA 3WLCA 5DY6A 1WDCC 1J7RA 1G33A 2GX0A 5BT0A 2Z6XA 2QLGB 2ICRA 4W7RA 2NCPA 1WDCB 1V1FA 3D0YA 2LVJA 1RMMA 4MEWA 2NXQA 5AEQA 1UURA 2QPTA 2JOJA 3CB9A 3BXAA 4MZLA 3BXCA 1YJ2A 3LF4B 1X02A 2CXJA 2KHNA 3LK0A 2WHTA 1RFJA 2KFGA 3GK4X 1K93D 3MSEB 4MSPA 5HKZA 4OJ0A 2OS8B 1Q4DA 1FBVA 4WQ3A 1KWOC 3PJ5A 1IRJA 3VHTA 2JWWA 3P8UA 1QVIZ 2WSOA 2L2EA 3H4SE 4M2QA 3TMTA 1QJTA 2D8NA 1NYAA 2KI4B 3OHMB 1QY3A 1SMGA 4Q7TA 3WNXB 4W7EA 1YFPA 2MLEC 2PMYA 3DPWA 1J55A 3D0YB 1B7TZ 4AR7A 5H88A 3BUWB 4YI8A 2G16B 1E8AA 3LLEA 5BTTA 2POXA 2ARLA 3GK2A 4I5LB 1M46A 1NPQA 1CDPA 1LA0A 1EXRA 3DQEA 2Q91A 4YGEB 2AWMA 1W7IB 3VRNA 3CGAA 2MLFC 1EMKA 4HE4A 4Q7RA 1RWYA 1JWDA 3OB2B 1UHIA 4PPJA 2VZXA 3E3RA 3EVVA 2LE9B 1TTXA 2LHLA 3VHTB 2EHBA 4EULA 4XVPA 4CPVA 5DQMA 2WNDA 1NIWA 2L4IA 2FCEA 3BX9A 1SY9A 1CFCA 2G6YA 5DPJA 3OSRA 5G08A 1Y0VH 4XOVA 1EMFA 3SVOA 1DF0A 4OCIA 4H3NA 4J88A 5AFPA 4W6HA 4PHKA 2OKWA 2LMTA 4OKHA 2BCBA 3CFAA 5BTTB 2CCMA 1DGVA 2FCDA 2A48A 3A8SA 4HQCA 2VAEA 1TCFA 1EMGA 1AK8A 1GJYA 2EC6C 4PE4A 4MZKA 5HZTA 2Q6PA 4ORCB 1KYSA 2FWQA 1S6ZA 1SPYA 2EC6B 1OMDA 4L13A 3O4YA 3NF0A 1HCJA 3LVCA 3LCPC 2LAPA 2P6BB 2M7LA 4Z4MA 1EMMA 4W6SA 1S1EA 2LM5A 2M3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFD A;  1OE9 B;  3SSL A;  1WRZ A;  2QRF A;  3WLD A;  3SVR A;  4M2O A;  5IBW A;  1RJV A;  2BKI B;  1DJW A;  4OY4 A;  4QJ5 B;  4OR9 B;  4WRI A;  5DU0 A;  1DF0 B;  2DUI A;  4DKM A;  2G6E A;  2KYC A;  2G3D B;  2IOV A;  1TRF A;  2KSP A;  1UWO A;  4CID A;  4W6K A;  5TNC A;  3TS5 B;  2Z6Z A;  1XO5 A;  4N5X A;  1Y1U A;  3DQ1 A;  4WQ2 A;  1QTX A;  3JTD B;  2JXC A;  1KK8 B;  2JT8 A;  1F09 A;  2DOQ A;  1MOU A;  2H61 A;  4DXO A;  3EVR A;  1NUB A;  3OX5 A;  3I5F B;  2FJU B;  4LQU A;  1CFP A;  1OXD A;  2NLN A;  5DKR A;  1Q4C A;  1MR8 A;  1B4C A;  1KYP A;  4YI9 A;  2ZMU A;  1QYF A;  1ZOT B;  5JOL A;  1L2O B;  2LVV A;  3FS7 A;  1H4B A;  4KGE A;  3EVP A;  5DPG A;  4W6L A;  2C9J A;  3SSK A;  1FI6 A;  5LTQ A;  3OGO A;  5H89 A;  1J7Q A;  4ZIN A;  4MN0 A;  2VVI A;  5HYD A;  1TNP A;  5F6T A;  2WC8 A;  5EB7 A;  4NWS A;  3TDU A;  2M1K B;  1PVA A;  1NCX A;  4I5J A;  1U5I A;  4IK9 A;  2QLH A;  4MVF A;  3SVB A;  2VRG A;  3BUM B;  3SSP A;  4AOM A;  1MF8 B;  3U8C A;  4YGC B;  3PAL A;  1SCM C;  4LJC A;  2L51 A;  1SR6 C;  1YUR A;  3LS3 A;  1IJ5 A;  1K9P A;  2MA2 A;  1LIN A;  2A54 B;  2LVK A;  4NDB A;  1KFX S;  4KW4 A;  2KFF A;  1KCY A;  3A4U B;  2BTJ A;  3SVC A;  1SR6 B;  3F45 A;  4ORA B;  3PIB A;  4H3M A;  3CFF A;  1GQM A;  1KFX L;  1SCV A;  1LKJ A;  5DKN A;  2VVH A;  1EMC A;  4W73 A;  4E68 A;  2OJK A;  2KAV A;  2YE0 A;  4MZJ A;  1SL9 A;  4KW9 A;  2IB5 A;  2OKY A;  1A2X A;  1MOV A;  2LNK A;  3O78 A;  1SRA A;  3SVE A;  2PXW A;  4W6C A;  2KQY A;  1TNW A;  5DQB A;  1PK0 D;  3TZ1 A;  2AHA A;  3DQ7 A;  1PUL A;  1QV1 A;  3GEX A;  2DUE A;  2WOR A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1XMZ A;  1U5I B;  4KAG A;  4PFE A;  2ZO7 A;  2KBM A;  4JF9 A;  3BXK A;  1Y1A A;  4DUQ A;  3WCK A;  3DF0 B;  1DTL A;  1NX0 A;  1KFU L;  2B3P A;  3VRR A;  3NT9 A;  1SKT A;  1MYW A;  3SSY A;  1BG1 A;  5AQB B;  4Q9X A;  1W7J B;  2JZI A;  4JWQ A;  2FL1 A;  4KF5 A;  2V4E C;  3FIA A;  5HBD A;  2G2S B;  4TZG A;  3BUO B;  1FF1 A;  3LL8 B;  1TN4 A;  1UHH A;  2DD9 A;  3FWC A;  2H9W A;  2V4E B;  2Y5I A;  4LJD C;  1EMA A;  4M2P A;  2AWL A;  3I19 A;  1S26 D;  3SG5 A;  1F8H A;  4MLW A;  2A52 B;  1ZGP A;  1OXF A;  1OZO A;  4L9M A;  4PDZ A;  4R6D A;  4W6A A;  2M29 A;  2Q4U A;  3D10 A;  4H48 A;  3EKJ A;  1S5G Y;  3I5I C;  3U8A A;  1BR1 B;  2WIQ A;  2CTN A;  3AKA A;  1IJ6 A;  5J2O A;  1OSA A;  2Y1N A;  4RYW A;  2KDH A;  4KF5 C;  3BOW A;  1K2H A;  2JQ6 A;  3I5I B;  4W6F A;  1S3P A;  3OSQ A;  2JT3 A;  2K8M B;  3KF9 A;  2KGR A;  3DQI A;  2IS9 A;  1QXT A;  2HPS A;  3DQM A;  1Z1P A;  3GJ2 A;  2Q57 A;  4DKN A;  2LMV A;  1BFP A;  2LHI A;  1QXP A;  4DXI A;  3CR4 X;  1QV0 A;  5HKW A;  1IG5 A;  1NCZ A;  5T3I A;  1W7T A;  3TDI A;  2JC2 A;  3JVT C;  1AJ5 A;  4IK1 A;  2ZO6 A;  4W6N A;  3AI5 A;  1SBJ A;  3JVT B;  1QIV A;  4DIR A;  3CZT X;  5DTL A;  1NP8 A;  2ZN8 A;  2H8Q A;  2OS8 C;  1DVI A;  2DDC A;  5FVG A;  5HLO A;  4HSZ A;  1TCO B;  4AS8 A;  3NEZ A;  1DJZ A;  1KP5 A;  3EK8 A;  2KI4 C;  5HKY A;  2Y1M A;  3U0N A;  1KQV A;  5EXC I;  2BKH B;  2PVB A;  1LA3 A;  1UHK A;  2G9B A;  4BDU A;  4W72 A;  2K2A A;  1CMF A;  2ZRS A;  1ALV A;  3DQ2 A;  3S05 A;  1GGX A;  2ZN9 A;  4GPL B;  1BF5 A;  1XK4 A;  2I18 A;  3HX4 A;  1CDN A;  4PPK A;  2K0J A;  3V3D A;  2PAL A;  1MUX A;  1NX3 A;  3SSV A;  2EMO A;  2K7D A;  2KI6 D;  5BPJ A;  3AKO A;  1EME A;  3E5W A;  4W6I A;  2GGZ A;  3EKH A;  1MQ1 A;  3VRQ A;  2L5X B;  4JGE A;  1Y6W A;  4U8D A;  1SL7 A;  1ZGQ A;  4D1E A;  3I5H C;  4HQ8 A;  1C7W A;  2HGY A;  1OQP A;  4PHM A;  1BOC A;  1L7Z A;  3W1D A;  1IGV A;  2KI6 C;  2M0R A;  1DT7 B;  1N2D A;  2SAS A;  3I5H B;  2WCF A;  4C0K A;  4JEO A;  3DQH A;  1RM9 A;  3DVJ A;  4PAL A;  3WHU B;  3IF7 A;  3LSA A;  4IK8 A;  4W6D A;  2K61 A;  1QX2 A;  2Y4Q A;  2OGR A;  3CS1 A;  1JBA A;  4YBH B;  2KAX A;  4PPL A;  4MBE A;  1B8R A;  1C4F A;  1BR4 B;  5GQQ C;  4W6J A;  2JAD A;  3WHT B;  4W74 A;  4GAO A;  4W76 A;  2IB6 A;  2ZRT A;  1EG3 A;  1ODB A;  1DJG A;  2GW3 A;  5BQL A;  1NSH A;  1W7S A;  2JXL A;  2GX2 A;  3DPZ A;  3ZWH A;  2VVJ A;  3A8R A;  4GNK B;  1F55 A;  1S5G Z;  3PAT A;  3DPX A;  4OVN F;  3KCS A;  1XFV O;  4EDO A;  4EMQ A;  1YVH A;  1J7O A;  3PM8 A;  3ADF A;  2QZ0 A;  3KHE A;  1MXE A;  2I2R E;  1EH2 A;  2AWJ A;  2LUC A;  4XYN A;  1N65 A;  4AQI A;  4ZIO A;  1CB1 A;  1JFK A;  2Z6Y A;  3U0K A;  5CSJ A;  3M22 A;  2HRS A;  2MJW B;  4YRU A;  3ST3 A;  4ORB B;  4JC2 A;  2B3Q A;  1S36 A;  2KFH A;  1H8B A;  1PRW A;  3PLF B;  1SNL A;  2F2P A;  4QJ4 B;  4IK4 A;  4W6B A;  3K21 A;  2A47 A;  2WSN A;  3TS5 C;  4MRX A;  1NX1 A;  4UTS A;  5CSI A;  4W6U A;  2PRU A;  2L0P A;  4GES B;  3KPX A;  3JTD C;  4W6O A;  2JNF A;  4P1Q A;  2GW4 B;  1KK8 C;  1K9U A;  4CFQ A;  3DQJ A;  2KNE A;  2JUL A;  3DQ3 A;  3CD9 A;  1CNP A;  3TDZ A;  2A53 B;  2AWK A;  3AAJ A;  3I5F C;  1QX7 A;  1GGZ A;  2ZNE A;  1KYR A;  3QRX A;  2O60 A;  2Z1O A;  3P28 A;  2R2I A;  1JFJ A;  2JRF A;  4BY4 A;  2JTZ A;  1QS7 A;  4ZF3 A;  3GJ1 A;  4N1G A;  4R1E A;  1YX7 A;  1L2O C;  4DXP A;  1W7U A;  2HFC A;  3HCM A;  3DQ8 A;  3OB1 B;  3MGF A;  5I2L A;  5I2O A;  3GB3 A;  5HLV A;  4KF4 A;  4JQ0 D;  1SL8 A;  3NXA A;  5EHU A;  3GK1 A;  2M1U A;  3O6B A;  1RRX A;  4XOW A;  1LXF C;  5KTG A;  3IR8 A;  4FTG A;  2JT0 A;  1REC A;  3IQO A;  4GBA A;  5I8N A;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  4L1I A;  2L98 A;  1XYD A;  1JBY A;  1ZFS A;  1OZS A;  1F70 A;  2AUC A;  3ICB A;  4OV2 A;  5LTP A;  4CFR A;  4L12 A;  1A4P A;  1NX2 A;  1SW8 A;  3DQ4 A;  2H61 C;  2M8U A;  1AUI B;  1XVJ A;  2MHH A;  3DVE A;  4W7D A;  3SV5 A;  2DDD A;  2LLS A;  3W1C A;  1CFD A;  1A29 A;  2QLI A;  1MXL C;  2H5Q A;  3SG6 A;  4ZB1 A;  1BT6 A;  5HZO A;  4W6M A;  1TNQ A;  1XFX O;  4OHS A;  4C0L A;  3EK4 A;  4LW5 A;  3IQQ A;  2DUF A;  2O24 A;  1YZW A;  3K1K A;  3CGL A;  1F0B A;  2LAN A;  4W7A A;  3NT3 A;  1SYM A;  1XA5 A;  5KU1 A;  3E5T A;  5DPI A;  2EMD A;  2H5R A;  5CPV A;  1ZUX A;  3CBE A;  1ZGO A;  1YHH A;  4YGA A;  1SK6 D;  1IH0 A;  1A75 A;  3LF3 A;  4Q7U A;  4H47 A;  4YGD B;  2VAD A;  2TN4 A;  1KFU S;  2CT9 A;  4KEX A;  1UP5 A;  3ZNI A;  3SS0 A;  4N1F A;  4IL1 A;  2AAO A;  5ER5 A;  3PN7 C;  3SIA A;  1CLB A;  2KGB C;  5DRF A;  5KTY A;  1QLS A;  5FVF A;  3PN7 B;  2BEC A;  3NSK A;  4GGF A;  3KCT A;  1XFU O;  1DJH A;  2LUX A;  3EVU A;  1MHO A;  4ZBL A;  2FZU A;  4PCW A;  1M39 A;  2OTG C;  4W69 A;  3CD1 A;  4JPZ B;  3GL4 A;  2QLG A;  3PJB A;  1G4Y R;  1XFW O;  2BL0 C;  2OTG B;  1GFL A;  1IQ3 A;  2ZMW A;  4W6R A;  2WOS A;  2KBI A;  5EJU A;  3RWA A;  5D69 A;  5LK4 A;  5KSZ A;  4JRB A;  2BL0 B;  1A75 B;  3SIB A;  5JJG A;  3PJ7 A;  1DJX A;  1CLM A;  1B47 A;  3U8P A;  3CWG A;  5DTY A;  4PE1 A;  2K7O A;  2LMU A;  1M45 A;  2B1U A;  1OMR A;  2HQ8 A;  2LV7 A;  2MBX A;  1TOP A;  3NED A;  3LVD A;  2IE2 A;  1F54 A;  1XSS A;  1OXE A;  5J3X A;  1Q73 A;  4HRE E;  1AVS A;  2DD7 A;  4N3D A;  3SVS A;  4J8A A;  5AER A;  1DJI A;  1G7K A;  2HF5 A;  2WCE A;  4A4C A;  1DGU A;  1CM1 A;  1QX5 B;  3ED8 A;  3DQL A;  1ZAC A;  1UHN A;  5DPH A;  4TZA A;  4RTC A;  1WRK A;  4Q9W A;  4W7X A;  2CBL A;  1YX8 A;  4QJ3 B;  2G3O A;  2RGI A;  4TNC A;  2YDZ A;  3VRO A;  2KAY A;  3U0M A;  1B9C A;  1H6R A;  4PE7 A;  4RYS A;  3SVN A;  3OP0 A;  4EN1 A;  2G2B A;  4DXN A;  1JF2 A;  2L4H A;  1Q80 A;  5H87 A;  1NWD A;  4HQ9 A;  3C1V A;  3PFV A;  5DRG A;  4GGN A;  3KO0 A;  4ZF4 A;  3CR5 X;  2K7C A;  2M49 B;  4NDC A;  4EDS A;  5B8I B;  2DUH A;  5HGE A;  1YRU B;  3BOW B;  2PAS A;  2M97 A;  2LC5 A;  3U0L A;  1YUT A;  4DCK A;  2SCP A;  2JTT A;  1MWN A;  5HZU A;  4P76 A;  1F4Q A;  3ZUJ A;  4P2Y B;  4J89 A;  2PSR A;  3DQF A;  3KEV A;  3UG0 A;  1UIS A;  5CSN A;  1QAT A;  2V53 A;  4B5Y A;  2F33 A;  1TIZ A;  5I2Q A;  2H5O A;  1H4U A;  1HUY A;  1KWO B;  2ISD A;  5DTZ A;  4IK5 A;  1NCY A;  2LLU A;  2ZKM X;  1J1E A;  5K89 A;  2KQ6 A;  4HRH A;  4DS7 A;  1F4O A;  1M63 B;  3DQC A;  3DD4 A;  2GV5 A;  2F3Y A;  1Q4E A;  1XAE A;  3UFZ A;  2QAC A;  1BJF A;  4KPI A;  3SG4 A;  1K9K A;  4CLN A;  1BU3 A;  4GF6 B;  1CTR A;  2NZ0 A;  3ZUL A;  3DQN A;  1KQM C;  1A03 A;  3NSI A;  1B1G A;  1YHG A;  2AH8 A;  3CFH A;  1IQ5 A;  5EXB A;  4R6B A;  2K2F A;  3PSR A;  4B30 A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  3BUN B;  2G6X A;  2O2B A;  2HET A;  1XK4 C;  1J1D A;  3E5V A;  2NCO A;  3LVA A;  3CLN A;  2M9G A;  1XFZ O;  3CR2 A;  4DXM A;  5FHV A;  2O5G A;  2WHU A;  2LLT A;  4PE0 A;  1D1O A;  3SRY A;  1QIW A;  5EXU A;  2CNP A;  2BCX A;  2HCG A;  1QYQ A;  1R6P A;  2BE4 A;  1CLL A;  4ETO A;  5LTR A;  4W77 A;  4YGB B;  3AI4 A;  4GFT A;  2ZND A;  3ZTF A;  1HQV A;  1JBZ A;  2A56 B;  3IP2 A;  3G9A A;  3H1R A;  2BCA A;  1K90 D;  1EMB A;  1YUU A;  2E30 A;  1S6I A;  5HW9 A;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  1K8U A;  4UPG A;  4OGS A;  3DVK A;  2OPO A;  4H3L A;  3BYA A;  1IWQ A;  3VRP A;  4B30 B;  2OTB A;  2QU1 A;  1WLM A;  4W7C A;  1KSO A;  1XFY O;  2EMN A;  3DQK A;  1B8C A;  3DQU A;  3ST0 A;  1YHI A;  4W6P A;  1BOD A;  4IK3 A;  4I2Y A;  4OQW A;  3TMR A;  2P4M A;  2O29 A;  4W6G A;  4HRG A;  2PXS A;  1XA9 A;  2BE6 A;  5ER4 X;  1C7V A;  1UHJ A;  2WUR A;  5DTX A;  2F8P A;  1ZMZ A;  2WIS A;  1AHR A;  1QYO A;  4XL5 A;  4KA9 A;  1GL4 A;  4DRW A;  2HPW A;  2HGD A;  1Q4B A;  4Z4K A;  2YFP A;  2L50 A;  3RM1 A;  1TNX A;  1V1G A;  3O77 A;  1KK7 Y;  1B8L A;  2YE1 A;  1BLQ A;  1IKU A;  1RMO A;  2A4J A;  4ZF5 A;  3CTN A;  1FI5 A;  2JNX A;  2E6W A;  2LCP A;  3SJS A;  5EB6 A;  3SST A;  4A4B A;  4DXQ A;  1G8I A;  3LK1 A;  3DQA A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  4GOB A;  2LP2 A;  1LVC D;  1CFF A;  3AKB A;  2I94 A;  4NDD A;  3SVD A;  3DQ9 A;  4W6T A;  2QLE A;  1J7P A;  2C9I A;  5D7F A;  4XGY A;  1EL4 A;  3RLZ A;  3VK1 A;  4ANJ A;  1F71 A;  4BY5 A;  2F3Z A;  4HVF A;  2MAZ A;  5CSF A;  1YR5 A;  4PHN A;  4PHJ A;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  1N0Y A;  2M7N A;  3SVU A;  3VIC A;  4FQO A;  2H6V A;  1OMV A;  3ST2 A;  1JC0 A;  1B9A A;  3DF0 A;  2OTE A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  2G5Z B;  1ZUZ A;  2WHS A;  1ALW A;  5FYX A;  2A46 A;  4U2V A;  4F0Z B;  2JPT A;  1XQM A;  4W7F A;  1K96 A;  1M31 A;  1CKK A;  4LQT A;  1AJ4 A;  2LVI A;  1WY9 A;  4I5N B;  1SCM B;  3DQD A;  1S6J A;  1DMO A;  2HQZ A;  3SSH A;  1YTZ C;  3DQ5 A;  2Y0G A;  1QVI Y;  2V4E A;  1RRO A;  1EML A;  4ZFS A;  2GGM A;  3O2P A;  4USL A;  2HQK A;  2HQW A;  4LJD A;  1B7T Y;  1RMP A;  1PAL A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2BBN A;  1YRT B;  2RH7 A;  2H2K A;  2H5P A;  3I5G C;  4Q04 A;  3SG2 A;  4AQJ A;  3M24 A;  4JFG A;  1RTP 1;  5F9G A;  3M0W A;  4ZCU A;  4IZN A;  1CMG A;  3NSL A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  3RWT A;  1PSR A;  1JF0 A;  1YJF A;  4XJK B;  3BXB A;  3DQ6 A;  1JC1 A;  4ZCV A;  3VGO A;  1CV7 A;  1QLK A;  3SG3 A;  2DUG A;  1YUS A;  1EG4 A;  1KSM A;  3H1O A;  1GGW A;  4ICB A;  2FOT A;  1K94 A;  1CDL A;  2A50 B;  1JUO A;  1FPW A;  3ST4 A;  2HJO A;  1WLZ A;  1FW4 A;  3EK7 A;  5HZS A;  2K7B A;  3AAK A;  5FVI A;  3LA1 A;  3OX6 A;  5AXI A;  4NQG A;  4LJB A;  1VRK A;  1OOJ A;  2MRD A;  4KGF A;  1K95 A;  4KW8 A;  1Q4A A;  1RK9 A;  1WRL A;  2AMI A;  2F2O A;  4W75 A;  3DQO A;  3FWB A;  1KK7 Z;  3TUY C;  4GGF C;  1C07 A;  2QT2 A;  3ZUF A;  2LP3 A;  4ORN A;  3TUY B;  1CDM A;  1PSB A;  1Z1Q A;  2JU0 A;  5EBJ A;  3GOF A;  1QAS A;  2KOT A;  1PVB A;  3WLC A;  5DY6 A;  1WDC C;  1J7R A;  1G33 A;  2GX0 A;  5BT0 A;  2Z6X A;  2QLG B;  2ICR A;  4W7R A;  2NCP A;  1WDC B;  1V1F A;  3D0Y A;  2LVJ A;  1RMM A;  4MEW A;  2NXQ A;  5AEQ A;  1UUR A;  2QPT A;  2JOJ A;  3CB9 A;  3BXA A;  4MZL A;  3BXC A;  1YJ2 A;  3LF4 B;  1X02 A;  2CXJ A;  2KHN A;  3LK0 A;  2WHT A;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3MSE B;  4MSP A;  5HKZ A;  4OJ0 A;  2OS8 B;  1Q4D A;  1FBV A;  4WQ3 A;  1KWO C;  3PJ5 A;  1IRJ A;  3VHT A;  2JWW A;  3P8U A;  1QVI Z;  2WSO A;  2L2E A;  3H4S E;  4M2Q A;  3TMT A;  1QJT A;  2D8N A;  1NYA A;  2KI4 B;  3OHM B;  1QY3 A;  1SMG A;  4Q7T A;  3WNX B;  4W7E A;  1YFP A;  2MLE C;  2PMY A;  3DPW A;  1J55 A;  3D0Y B;  1B7T Z;  4AR7 A;  5H88 A;  3BUW B;  4YI8 A;  2G16 B;  1E8A A;  3LLE A;  5BTT A;  2POX A;  2ARL A;  3GK2 A;  4I5L B;  1M46 A;  1NPQ A;  1CDP A;  1LA0 A;  1EXR A;  3DQE A;  2Q91 A;  4YGE B;  2AWM A;  1W7I B;  3VRN A;  3CGA A;  2MLF C;  1EMK A;  4HE4 A;  4Q7R A;  1RWY A;  1JWD A;  3OB2 B;  1UHI A;  4PPJ A;  2VZX A;  3E3R A;  3EVV A;  2LE9 B;  1TTX A;  2LHL A;  3VHT B;  2EHB A;  4EUL A;  4XVP A;  4CPV A;  5DQM A;  2WND A;  1NIW A;  2L4I A;  2FCE A;  3BX9 A;  1SY9 A;  1CFC A;  2G6Y A;  5DPJ A;  3OSR A;  5G08 A;  1Y0V H;  4XOV A;  1EMF A;  3SVO A;  1DF0 A;  4OCI A;  4H3N A;  4J88 A;  5AFP A;  4W6H A;  4PHK A;  2OKW A;  2LMT A;  4OKH A;  2BCB A;  3CFA A;  5BTT B;  2CCM A;  1DGV A;  2FCD A;  2A48 A;  3A8S A;  4HQC A;  2VAE A;  1TCF A;  1EMG A;  1AK8 A;  1GJY A;  2EC6 C;  4PE4 A;  4MZK A;  5HZT A;  2Q6P A;  4ORC B;  1KYS A;  2FWQ A;  1S6Z A;  1SPY A;  2EC6 B;  1OMD A;  4L13 A;  3O4Y A;  3NF0 A;  1HCJ A;  3LVC A;  3LCP C;  2LAP A;  2P6B B;  2M7L A;  4Z4M A;  1EMM A;  4W6S A;  1S1E A;  2LM5 A;  2M3W A; 
#chains in the Genus database with same CATH topology
 2ZFD A;  1OE9 B;  3SSL A;  1WRZ A;  2QRF A;  3WLD A;  3SVR A;  4M2O A;  5IBW A;  1RJV A;  5I94 A;  2BKI B;  1DJW A;  4OY4 A;  4QJ5 B;  5HL1 A;  4OR9 B;  4WRI A;  5DU0 A;  1DF0 B;  2DUI A;  4DKM A;  2G6E A;  2KYC A;  3DZT A;  2G3D B;  2IOV A;  1TRF A;  2KSP A;  1UWO A;  4CID A;  2BAP A;  3B88 A;  4W6K A;  5TNC A;  3TS5 B;  2Z6Z A;  1XO5 A;  4N5X A;  1Y1U A;  3DQ1 A;  4WQ2 A;  1QTX A;  3JTD B;  2JXC A;  1KK8 B;  2JT8 A;  3D75 A;  1F09 A;  2DOQ A;  1MOU A;  2H61 A;  4DXO A;  3EVR A;  1NUB A;  3OX5 A;  3I5F B;  2FJU B;  4LQU A;  1CFP A;  1OXD A;  2NLN A;  5DKR A;  1Q4C A;  1MR8 A;  1B4C A;  1KYP A;  4YI9 A;  2ZMU A;  1QYF A;  1ZOT B;  5JOL A;  1L2O B;  2LVV A;  3FS7 A;  3DYE A;  1H4B A;  4KGE A;  3EVP A;  5DPG A;  4W6L A;  2C9J A;  3SSK A;  1FI6 A;  5LTQ A;  3OGO A;  5H89 A;  1J7Q A;  4ZIN A;  4MN0 A;  2VVI A;  5HYD A;  1TNP A;  5F6T A;  2WC8 A;  1QWV A;  5EB7 A;  4NWS A;  3TDU A;  2M1K B;  1PVA A;  1NCX A;  4I5J A;  1U5I A;  4IK9 A;  2QLH A;  4MVF A;  3SVB A;  2VRG A;  3BUM B;  3SSP A;  4AOM A;  1MF8 B;  3U8C A;  4YGC B;  3PAL A;  1SCM C;  4LJC A;  2L51 A;  1SR6 C;  1YUR A;  3LS3 A;  1IJ5 A;  1K9P A;  2MA2 A;  1LIN A;  2A54 B;  1SSE B;  2LVK A;  3D77 A;  4NDB A;  1KFX S;  3D76 A;  4KW4 A;  2KFF A;  1KCY A;  3A4U B;  2BTJ A;  2WCJ A;  3SVC A;  1SR6 B;  3Q8I A;  3F45 A;  4ORA B;  3PIB A;  4H3M A;  3CFF A;  1GQM A;  1KFX L;  1SCV A;  1LKJ A;  5DKN A;  2VVH A;  1EMC A;  4W73 A;  4E68 A;  2OJK A;  2KAV A;  2YE0 A;  4MZJ A;  1SL9 A;  4KW9 A;  2IB5 A;  2OKY A;  1A2X A;  1MOV A;  3S0B A;  2LNK A;  3O78 A;  1SRA A;  3SVE A;  2PXW A;  4W6C A;  2P71 A;  2KQY A;  1TNW A;  5DQB A;  1PK0 D;  3TZ1 A;  2AHA A;  3DQ7 A;  1PUL A;  1QV1 A;  3DXL A;  3GEX A;  2DUE A;  2WOR A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1XMZ A;  1U5I B;  4KAG A;  2KLE A;  4PFE A;  2ZO7 A;  2KBM A;  4JF9 A;  3BXK A;  1Y1A A;  4DUQ A;  3WCK A;  3DF0 B;  1DTL A;  1NX0 A;  1KFU L;  2B3P A;  1DEK A;  3VRR A;  3NT9 A;  1SKT A;  3UNW A;  1MYW A;  3SSY A;  1BG1 A;  2KPH A;  5AQB B;  4Q9X A;  1W7J B;  2JZI A;  4JWQ A;  2FL1 A;  4KF5 A;  2V4E C;  3CZ0 A;  3FIA A;  5HBD A;  2G2S B;  3UO9 A;  4TZG A;  3BUO B;  1FF1 A;  3LL8 B;  1TN4 A;  1UHH A;  3FE9 A;  2DD9 A;  3FWC A;  2H9W A;  2V4E B;  2Y5I A;  4LJD C;  3S0E A;  4PT1 A;  3S0A A;  1EMA A;  4M2P A;  3B6X A;  3I19 A;  2AWL A;  1S26 D;  3SG5 A;  1F8H A;  4MLW A;  2A52 B;  1ZGP A;  1OXF A;  1OZO A;  4L9M A;  4PDZ A;  4R6D A;  4W6A A;  2M29 A;  2Q4U A;  3SS3 A;  3D10 A;  4H48 A;  3EKJ A;  3B86 A;  1S5G Y;  3I5I C;  3U8A A;  1BR1 B;  2WIQ A;  2CTN A;  3AKA A;  1IJ6 A;  5J2O A;  1OSA A;  2Y1N A;  4RYW A;  2KDH A;  4KF5 C;  3BOW A;  1TWO A;  2JQ6 A;  3I5I B;  1K2H A;  4W6F A;  1S3P A;  3OSQ A;  2JT3 A;  2K8M B;  3KF9 A;  3D78 A;  2KGR A;  3DQI A;  2IS9 A;  1QXT A;  2HPS A;  3SS5 A;  3DQM A;  1Z1P A;  3GJ2 A;  2Q57 A;  4DKN A;  2LMV A;  1BFP A;  3RZS A;  2LHI A;  1QXP A;  4DXI A;  3CR4 X;  1QV0 A;  5HKW A;  1IG5 A;  1NCZ A;  1P28 A;  5T3I A;  1W7T A;  3TDI A;  2JC2 A;  3JVT C;  1AJ5 A;  4IK1 A;  2ZO6 A;  4W6N A;  3AI5 A;  1SBJ A;  3JVT B;  3EG5 B;  1QIV A;  4DIR A;  3CZT X;  5DTL A;  1NP8 A;  3NHI A;  2ZN8 A;  2H8Q A;  2OS8 C;  1DVI A;  2DDC A;  5FVG A;  5HLO A;  4HSZ A;  1TCO B;  4AS8 A;  3NEZ A;  1DJZ A;  1KP5 A;  2L5Y A;  3EK8 A;  2KI4 C;  5HKY A;  2Y1M A;  2ERB A;  3BFA A;  3U0N A;  1KQV A;  5EXC I;  2BKH B;  2PVB A;  1LA3 A;  1UHK A;  2G9B A;  4BDU A;  4W72 A;  2K2A A;  1CMF A;  1OOG A;  2ZRS A;  3DQ2 A;  1ALV A;  3S05 A;  3FE8 A;  1GGX A;  2ZN9 A;  3L4L A;  4GPL B;  3K1E A;  1BF5 A;  1XK4 A;  2I18 A;  3HX4 A;  5FI2 A;  1Z2C B;  1CDN A;  4PPK A;  2K0J A;  3V3D A;  2PAL A;  1MUX A;  1NX3 A;  3SSV A;  1W9Z A;  2EMO A;  2K7D A;  2KI6 D;  5BPJ A;  3AKO A;  1EME A;  3E5W A;  4W6I A;  2GGZ A;  3EKH A;  1MQ1 A;  3VRQ A;  2L5X B;  3R1P A;  4JGE A;  1Y6W A;  4U8D A;  1LS8 A;  1SL7 A;  1ZGQ A;  4D1E A;  3I5H C;  1Z4H A;  4HQ8 A;  1C7W A;  2HGY A;  1OQP A;  4PHM A;  1BOC A;  1L7Z A;  3W1D A;  1IGV A;  2KI6 C;  4FQT A;  2M0R A;  1DT7 B;  1N2D A;  2SAS A;  3I5H B;  2WCF A;  4C0K A;  4JEO A;  3DQH A;  1RM9 A;  3DVJ A;  4PAL A;  3WHU B;  3IF7 A;  3LSA A;  4IK8 A;  4W6D A;  2K61 A;  1QX2 A;  2Y4Q A;  3OBV A;  2OGR A;  3CS1 A;  1JBA A;  4YBH B;  2KAX A;  4PPL A;  4MBE A;  1B8R A;  1C4F A;  1BR4 B;  5GQQ C;  4W6J A;  2JAD A;  3WHT B;  4W74 A;  4GAO A;  4W76 A;  4KYN A;  2IB6 A;  2ZRT A;  1EG3 A;  1ODB A;  1DJG A;  2GW3 A;  5BQL A;  1NSH A;  1W7S A;  2JXL A;  2GX2 A;  3DPZ A;  3ZWH A;  2VVJ A;  3A8R A;  4GNK B;  1F55 A;  1S5G Z;  3PAT A;  3DPX A;  4OVN F;  3KCS A;  1XFV O;  4EDO A;  4EMQ A;  1YVH A;  3NGV A;  1J7O A;  3PM8 A;  3ADF A;  3N7H A;  2QZ0 A;  3KHE A;  1MXE A;  2I2R E;  2K60 A;  1EH2 A;  2AWJ A;  2LUC A;  4XYN A;  1N65 A;  4AQI A;  4ZIO A;  1CB1 A;  1JFK A;  2Z6Y A;  3U0K A;  5CSJ A;  3M22 A;  2HRS A;  2QDI A;  2MJW B;  4YRU A;  3ST3 A;  4ORB B;  4JC2 A;  2B3Q A;  1S36 A;  2KFH A;  1H8B A;  1PRW A;  3PLF B;  1SNL A;  3R1O A;  2F2P A;  4QJ4 B;  4IK4 A;  4W6B A;  3K21 A;  2A47 A;  2WSN A;  3TS5 C;  4MRX A;  3IVT A;  1NX1 A;  4UTS A;  5CSI A;  4W6U A;  2PRU A;  2L0P A;  4GES B;  3KPX A;  3R72 A;  3JTD C;  4W6O A;  2JNF A;  4P1Q A;  2GW4 B;  1KK8 C;  1K9U A;  4CFQ A;  3DQJ A;  2KNE A;  2JUL A;  2QEO A;  3DQ3 A;  1TUJ A;  3CD9 A;  3PM2 A;  1CNP A;  3TDZ A;  2A53 B;  2AWK A;  3AAJ A;  3I5F C;  1QX7 A;  1GGZ A;  3NHT A;  2ZNE A;  1KYR A;  3QRX A;  2O60 A;  2Z1O A;  3P28 A;  2R2I A;  1JFJ A;  2JRF A;  4BY4 A;  2JTZ A;  5FI6 A;  1QS7 A;  4ZF3 A;  3GJ1 A;  2QEB A;  5FI7 A;  4N1G A;  4R1E A;  1YX7 A;  1L2O C;  4DXP A;  1W7U A;  2HFC A;  3HCM A;  3DQ8 A;  3OB1 B;  3MGF A;  5I2L A;  2GTE A;  5I2O A;  3D74 A;  3GB3 A;  5HLV A;  3FE6 A;  3B87 A;  2WC6 A;  4JQ0 D;  4KF4 A;  1SL8 A;  3NXA A;  5EHU A;  3GK1 A;  2M1U A;  3O6B A;  1RRX A;  4XOW A;  1LXF C;  5KTG A;  3IR8 A;  4FTG A;  2JT0 A;  1REC A;  3IQO A;  4GBA A;  5I8N A;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  2L98 A;  4L1I A;  2WCK A;  1XYD A;  1JBY A;  1ZFS A;  1OZS A;  1F70 A;  2AUC A;  3ICB A;  4OV2 A;  5LTP A;  4CFR A;  4L12 A;  1A4P A;  1NX2 A;  1SW8 A;  3DQ4 A;  2H61 C;  2M8U A;  1AUI B;  1XVJ A;  2MHH A;  3DVE A;  4W7D A;  3SV5 A;  2DDD A;  3CDN A;  2LLS A;  3W1C A;  1CFD A;  3B7A A;  1A29 A;  2QLI A;  1MXL C;  2H5Q A;  3SG6 A;  4ZB1 A;  1BT6 A;  5HZO A;  4W6M A;  1TNQ A;  1XFX O;  4OHS A;  4C0L A;  2H8V A;  3EK4 A;  4LW5 A;  3IQQ A;  2DUF A;  2O24 A;  1YZW A;  3K1K A;  3CGL A;  1F0B A;  2LAN A;  4IJ7 A;  4W7A A;  3NT3 A;  1SYM A;  1XA5 A;  5KU1 A;  3E5T A;  5DPI A;  2EMD A;  2H5R A;  5CPV A;  1ZUX A;  3CBE A;  1ZGO A;  3VB1 A;  1YHH A;  4YGA A;  1SK6 D;  1IH0 A;  1A75 A;  3LF3 A;  4Q7U A;  4H47 A;  4YGD B;  2VAD A;  2KLD A;  2TN4 A;  1KFU S;  2CT9 A;  4KEX A;  1UP5 A;  3ZNI A;  3SS0 A;  4N1F A;  4IL1 A;  2AAO A;  5ER5 A;  3PN7 C;  3SIA A;  1CLB A;  2KGB C;  5DRF A;  5KTY A;  1QLS A;  5FVF A;  2YGU A;  1XFR A;  3PN7 B;  2BEC A;  3NSK A;  4GGF A;  3KCT A;  1XFU O;  1DJH A;  2LUX A;  3EVU A;  1MHO A;  4ZBL A;  2FZU A;  4PCW A;  1M39 A;  2OTG C;  4W69 A;  3CD1 A;  4JPZ B;  3GL4 A;  2QLG A;  3PJB A;  1G4Y R;  1XFW O;  3SS4 A;  3CYZ A;  3S0G A;  2BL0 C;  2OTG B;  1C3Y A;  4INX A;  1GFL A;  1IQ3 A;  2ZMW A;  4W6R A;  2WOS A;  2KBI A;  3BFB A;  5EJU A;  3RWA A;  5D69 A;  5LK4 A;  5KSZ A;  4JRB A;  2BL0 B;  1A75 B;  3SIB A;  5JJG A;  3PJ7 A;  1DJX A;  1CLM A;  1B47 A;  3U8P A;  3CWG A;  5DTY A;  4PE1 A;  2K7O A;  2LMU A;  1M45 A;  2B1U A;  4JD9 A;  1OMR A;  2HQ8 A;  2LV7 A;  2MBX A;  1TOP A;  2BNX A;  3CAB A;  3NED A;  3LVD A;  2IE2 A;  1F54 A;  1XSS A;  1OXE A;  5J3X A;  1Q73 A;  4HRE E;  1AVS A;  2DD7 A;  4N3D A;  3SVS A;  4J8A A;  5AER A;  1DJI A;  1G7K A;  2HF5 A;  2JPO A;  2WCE A;  1DGU A;  1CM1 A;  1QX5 B;  4A4C A;  3ED8 A;  3DQL A;  1ZAC A;  3DY9 A;  1UHN A;  5DPH A;  4TZA A;  4RTC A;  1WRK A;  4Q9W A;  4W7X A;  2CBL A;  1YX8 A;  4QJ3 B;  2G3O A;  2RGI A;  1DEL A;  4TNC A;  2YDZ A;  3VRO A;  3QME A;  2KAY A;  3U0M A;  1B9C A;  1H6R A;  4PE7 A;  4RYS A;  3SVN A;  3OP0 A;  4EN1 A;  2G2B A;  4DXN A;  1JF2 A;  1ORG A;  2L4H A;  1Q80 A;  5H87 A;  1NWD A;  4HQ9 A;  3C1V A;  3PFV A;  5DRG A;  4GGN A;  3KO0 A;  4ZF4 A;  3CR5 X;  2K7C A;  2M49 B;  4NDC A;  4JKT A;  4EDS A;  5B8I B;  2DUH A;  5HGE A;  1YRU B;  3BOW B;  2PAS A;  2M97 A;  2LC5 A;  3U0L A;  1YUT A;  4DCK A;  2SCP A;  2JTT A;  1MWN A;  5HZU A;  4P76 A;  1F4Q A;  3ZUJ A;  4P2Y B;  4J89 A;  2PSR A;  3DQF A;  3KEV A;  3UG0 A;  1UIS A;  5CSN A;  1QAT A;  2V53 A;  4B5Y A;  2F33 A;  1TIZ A;  5I2Q A;  2H5O A;  1H4U A;  1HUY A;  1KWO B;  2ISD A;  5DTZ A;  4IK5 A;  1NCY A;  2LLU A;  2ZKM X;  1J1E A;  5K89 A;  2KQ6 A;  1OOH A;  4HRH A;  4DS7 A;  1F4O A;  1M63 B;  3DQC A;  3DD4 A;  2GV5 A;  2F3Y A;  1Q4E A;  3PJI A;  1XAE A;  2WCL A;  3UFZ A;  2QAC A;  1BJF A;  4KPI A;  3SG4 A;  1K9K A;  4CLN A;  1BU3 A;  3R1V A;  4GF6 B;  1CTR A;  2NZ0 A;  3ZUL A;  3DQN A;  1KQM C;  1A03 A;  3NSI A;  1B1G A;  1YHG A;  2AH8 A;  3CFH A;  1IQ5 A;  5EXB A;  4R6B A;  2K2F A;  3PSR A;  4B30 A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  3BUN B;  2G6X A;  2O2B A;  2HET A;  1XK4 C;  1J1D A;  3E5V A;  2NCO A;  3LVA A;  3CLN A;  2M9G A;  1XFZ O;  3CR2 A;  4DXM A;  5FHV A;  2O5G A;  2WHU A;  2LLT A;  4PE0 A;  1D1O A;  3SRY A;  1QIW A;  5EXU A;  2CNP A;  2BCX A;  2HCG A;  3CZ1 A;  1QYQ A;  1R6P A;  2BE4 A;  1CLL A;  4ETO A;  5LTR A;  4W77 A;  4YGB B;  3AI4 A;  4GFT A;  2ZND A;  3ZTF A;  1HQV A;  1JBZ A;  2A56 B;  2PQL A;  3IP2 A;  3G9A A;  3H1R A;  2BCA A;  1K90 D;  1EMB A;  1YUU A;  2E30 A;  1S6I A;  5HW9 A;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  1K8U A;  4UPG A;  4OGS A;  3DVK A;  4F7F A;  2OPO A;  3BYA A;  4H3L A;  1IWQ A;  1IIO A;  3VRP A;  4B30 B;  2OTB A;  2QU1 A;  1WLM A;  4W7C A;  1KSO A;  1XFY O;  2EMN A;  3DQK A;  1B8C A;  3DQU A;  3ST0 A;  1YHI A;  4W6P A;  1BOD A;  4IK3 A;  4I2Y A;  4OQW A;  3TMR A;  2P4M A;  2O29 A;  4W6G A;  4HRG A;  2PXS A;  1XA9 A;  2BE6 A;  5ER4 X;  1C7V A;  1UHJ A;  2WUR A;  5DTX A;  2F8P A;  1ZMZ A;  2WIS A;  1AHR A;  1QYO A;  4XL5 A;  4KA9 A;  1GL4 A;  4DRW A;  2HPW A;  2HGD A;  1Q4B A;  4Z4K A;  2YFP A;  2L50 A;  3RM1 A;  1TNX A;  1V1G A;  3O77 A;  1KK7 Y;  1B8L A;  2YE1 A;  1BLQ A;  1IKU A;  1RMO A;  2A4J A;  4ZF5 A;  3CTN A;  1FI5 A;  2JNX A;  2E6W A;  2LCP A;  3SJS A;  5EB6 A;  3SST A;  4A4B A;  4DXQ A;  1G8I A;  3LK1 A;  3DQA A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  4GOB A;  2LP2 A;  1LVC D;  1CFF A;  3AKB A;  2I94 A;  4NDD A;  3SVD A;  3DQ9 A;  4W6T A;  2QLE A;  1J7P A;  2C9I A;  5D7F A;  4XGY A;  1EL4 A;  3RLZ A;  5EL2 A;  3VK1 A;  4ANJ A;  1F71 A;  4BY5 A;  2F3Z A;  4HVF A;  2MAZ A;  2FJY A;  2QEH A;  5CSF A;  1YR5 A;  4PHN A;  4PHJ A;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  1N0Y A;  2M7N A;  3SVU A;  3VIC A;  4FQO A;  2H6V A;  1OMV A;  3ST2 A;  1JC0 A;  1B9A A;  3DF0 A;  2OTE A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  2G5Z B;  1ZUZ A;  2WHS A;  1ALW A;  5FYX A;  2A46 A;  4U2V A;  4F0Z B;  2JPT A;  1XQM A;  4W7F A;  1K96 A;  1M31 A;  1CKK A;  4LQT A;  1AJ4 A;  2LVI A;  1WY9 A;  4I5N B;  1SCM B;  3DQD A;  1S6J A;  1DMO A;  2HQZ A;  3SSH A;  1YTZ C;  3DQ5 A;  2Y0G A;  1QVI Y;  2V4E A;  1RRO A;  1EML A;  1DC1 A;  1T14 A;  4ZFS A;  2GGM A;  3O2P A;  4USL A;  2HQK A;  2HQW A;  4LJD A;  1B7T Y;  1RMP A;  1PAL A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2BBN A;  1YRT B;  2RH7 A;  2H2K A;  2H5P A;  3I5G C;  4Q04 A;  3SG2 A;  4AQJ A;  3M24 A;  4JFG A;  1RTP 1;  5F9G A;  3M0W A;  4ZCU A;  4IZN A;  1CMG A;  3NSL A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  3RWT A;  1PSR A;  3L4A A;  1JF0 A;  1YJF A;  4XJK B;  3BXB A;  3DQ6 A;  1JC1 A;  4ZCV A;  3VGO A;  1CV7 A;  1QLK A;  3SG3 A;  2DUG A;  1YUS A;  1EG4 A;  1KSM A;  3H1O A;  1GGW A;  4ICB A;  2FOT A;  1K94 A;  1CDL A;  2A50 B;  1JUO A;  1FPW A;  3ST4 A;  2HJO A;  3S0F A;  1WLZ A;  1FW4 A;  3EK7 A;  5HZS A;  2K7B A;  3AAK A;  5FVI A;  3LA1 A;  3OX6 A;  5AXI A;  4NQG A;  4LJB A;  1VRK A;  2PYQ A;  1OOJ A;  2MRD A;  4KGF A;  1K95 A;  4KW8 A;  1OOI X;  2WCM A;  1Q4A A;  1TUZ A;  1RK9 A;  1WRL A;  2AMI A;  2F2O A;  4W75 A;  3DQO A;  3FWB A;  1KK7 Z;  3TUY C;  4GGF C;  1C07 A;  2QT2 A;  3ZUF A;  2LP3 A;  4ORN A;  3TUY B;  1CDM A;  1PSB A;  1Z1Q A;  2JU0 A;  5EBJ A;  3GOF A;  1QAS A;  2KOT A;  1PVB A;  3WLC A;  5DY6 A;  1WDC C;  1J7R A;  1G33 A;  2GX0 A;  5BT0 A;  3BFH A;  2Z6X A;  2QLG B;  2ICR A;  4W7R A;  2NCP A;  1WDC B;  1V1F A;  3D0Y A;  2LVJ A;  1RMM A;  4MEW A;  2NXQ A;  5AEQ A;  1UUR A;  2QPT A;  2JOJ A;  3CB9 A;  3BXA A;  4MZL A;  3O4X A;  3BXC A;  1YJ2 A;  3LF4 B;  1X02 A;  3D73 A;  2CXJ A;  3OGN A;  2KHN A;  3LK0 A;  2QEV A;  2WHT A;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3MSE B;  4MSP A;  5HKZ A;  1OOF A;  4OJ0 A;  2OS8 B;  1Q4D A;  4INW A;  1FBV A;  4WQ3 A;  1KWO C;  1IRJ A;  3PJ5 A;  2WCH A;  3VHT A;  2JWW A;  3P8U A;  1QVI Z;  2WSO A;  2L2E A;  3H4S E;  4M2Q A;  3TMT A;  3CZ2 A;  3V2L A;  1QJT A;  2D8N A;  1NYA A;  2KI4 B;  3OHM B;  1QY3 A;  1SMG A;  4Q7T A;  3WNX B;  4W7E A;  1YFP A;  2P70 A;  2MLE C;  5D3O A;  2PMY A;  3DPW A;  1J55 A;  3D0Y B;  1B7T Z;  4AR7 A;  5H88 A;  3BUW B;  4YI8 A;  2G16 B;  1E8A A;  2L2C A;  3LLE A;  5BTT A;  2POX A;  2ARL A;  1DQE A;  3GK2 A;  4I5L B;  1M46 A;  1NPQ A;  1CDP A;  1LA0 A;  1EXR A;  3DQE A;  2Q91 A;  4YGE B;  2AWM A;  1W7I B;  3VRN A;  3CGA A;  2MLF C;  1EMK A;  4HE4 A;  4Q7R A;  1RWY A;  1JWD A;  3OB2 B;  1UHI A;  4PPJ A;  2VZX A;  3E3R A;  3EVV A;  2LE9 B;  1TTX A;  2LHL A;  3VHT B;  1C3Z A;  2EHB A;  4EUL A;  4XVP A;  4CPV A;  5DIC A;  5DQM A;  2WND A;  2WC5 A;  1NIW A;  2L4I A;  2FCE A;  4OZD A;  3BX9 A;  1SY9 A;  3L47 A;  1CFC A;  2G6Y A;  5DPJ A;  3OSR A;  5G08 A;  1Y0V H;  4XOV A;  1EMF A;  3SVO A;  1DF0 A;  4OCI A;  4H3N A;  3BJH A;  1GM0 A;  4J88 A;  5AFP A;  1OW4 A;  4W6H A;  4PHK A;  2OKW A;  2LMT A;  4OKH A;  2BCB A;  3CFA A;  5BTT B;  2CCM A;  1DGV A;  2FCD A;  2A48 A;  3A8S A;  4HQC A;  2VAE A;  1TCF A;  1EMG A;  1AK8 A;  1GJY A;  2EC6 C;  4PE4 A;  4MZK A;  5HZT A;  2Q6P A;  4ORC B;  1KYS A;  2FWQ A;  1S6Z A;  1SPY A;  2EC6 B;  1OMD A;  4L13 A;  3O4Y A;  3NF0 A;  1HCJ A;  3LVC A;  3LCP C;  2LAP A;  2P6B B;  2M7L A;  4Z4M A;  1EMM A;  4W6S A;  1S1E A;  2LM5 A;  3S0D A;  2M3W A; 
#chains in the Genus database with same CATH homology
 2ZFD A;  1OE9 B;  3SSL A;  1WRZ A;  2QRF A;  3WLD A;  3SVR A;  4M2O A;  5IBW A;  1RJV A;  2BKI B;  1DJW A;  4OY4 A;  4QJ5 B;  4OR9 B;  4WRI A;  5DU0 A;  1DF0 B;  2DUI A;  4DKM A;  2G6E A;  2KYC A;  2G3D B;  2IOV A;  1TRF A;  2KSP A;  1UWO A;  4CID A;  4W6K A;  5TNC A;  3TS5 B;  2Z6Z A;  1XO5 A;  4N5X A;  1Y1U A;  3DQ1 A;  4WQ2 A;  1QTX A;  3JTD B;  2JXC A;  1KK8 B;  2JT8 A;  1F09 A;  2DOQ A;  1MOU A;  2H61 A;  4DXO A;  3EVR A;  1NUB A;  3OX5 A;  3I5F B;  2FJU B;  4LQU A;  1CFP A;  1OXD A;  2NLN A;  5DKR A;  1Q4C A;  1MR8 A;  1B4C A;  1KYP A;  4YI9 A;  2ZMU A;  1QYF A;  1ZOT B;  5JOL A;  1L2O B;  2LVV A;  3FS7 A;  1H4B A;  4KGE A;  3EVP A;  5DPG A;  4W6L A;  2C9J A;  3SSK A;  1FI6 A;  5LTQ A;  3OGO A;  5H89 A;  1J7Q A;  4ZIN A;  4MN0 A;  2VVI A;  5HYD A;  1TNP A;  5F6T A;  2WC8 A;  5EB7 A;  4NWS A;  3TDU A;  2M1K B;  1PVA A;  1NCX A;  4I5J A;  1U5I A;  4IK9 A;  2QLH A;  4MVF A;  3SVB A;  2VRG A;  3BUM B;  3SSP A;  4AOM A;  1MF8 B;  3U8C A;  4YGC B;  3PAL A;  1SCM C;  4LJC A;  2L51 A;  1SR6 C;  1YUR A;  3LS3 A;  1IJ5 A;  1K9P A;  2MA2 A;  1LIN A;  2A54 B;  2LVK A;  4NDB A;  1KFX S;  4KW4 A;  2KFF A;  1KCY A;  3A4U B;  2BTJ A;  3SVC A;  1SR6 B;  3F45 A;  4ORA B;  3PIB A;  4H3M A;  3CFF A;  1GQM A;  1KFX L;  1SCV A;  1LKJ A;  5DKN A;  2VVH A;  1EMC A;  4W73 A;  4E68 A;  2OJK A;  2KAV A;  2YE0 A;  4MZJ A;  1SL9 A;  4KW9 A;  2IB5 A;  2OKY A;  1A2X A;  1MOV A;  2LNK A;  3O78 A;  1SRA A;  3SVE A;  2PXW A;  4W6C A;  2KQY A;  1TNW A;  5DQB A;  1PK0 D;  3TZ1 A;  2AHA A;  3DQ7 A;  1PUL A;  1QV1 A;  3GEX A;  2DUE A;  2WOR A;  1JSA A;  3SG7 A;  4C0J A;  4MRY A;  1XMZ A;  1U5I B;  4KAG A;  4PFE A;  2ZO7 A;  2KBM A;  4JF9 A;  3BXK A;  1Y1A A;  4DUQ A;  3WCK A;  3DF0 B;  1DTL A;  1NX0 A;  1KFU L;  2B3P A;  3VRR A;  3NT9 A;  1SKT A;  1MYW A;  3SSY A;  1BG1 A;  5AQB B;  4Q9X A;  1W7J B;  2JZI A;  4JWQ A;  2FL1 A;  4KF5 A;  2V4E C;  3FIA A;  5HBD A;  2G2S B;  4TZG A;  3BUO B;  1FF1 A;  3LL8 B;  1TN4 A;  1UHH A;  2DD9 A;  3FWC A;  2H9W A;  2V4E B;  2Y5I A;  4LJD C;  1EMA A;  4M2P A;  2AWL A;  3I19 A;  1S26 D;  3SG5 A;  1F8H A;  4MLW A;  2A52 B;  1ZGP A;  1OXF A;  1OZO A;  4L9M A;  4PDZ A;  4R6D A;  4W6A A;  2M29 A;  2Q4U A;  3D10 A;  4H48 A;  3EKJ A;  1S5G Y;  3I5I C;  3U8A A;  1BR1 B;  2WIQ A;  2CTN A;  3AKA A;  1IJ6 A;  5J2O A;  1OSA A;  2Y1N A;  4RYW A;  2KDH A;  4KF5 C;  3BOW A;  1K2H A;  2JQ6 A;  3I5I B;  4W6F A;  1S3P A;  3OSQ A;  2JT3 A;  2K8M B;  3KF9 A;  2KGR A;  3DQI A;  2IS9 A;  1QXT A;  2HPS A;  3DQM A;  1Z1P A;  3GJ2 A;  2Q57 A;  4DKN A;  2LMV A;  1BFP A;  2LHI A;  1QXP A;  4DXI A;  3CR4 X;  1QV0 A;  5HKW A;  1IG5 A;  1NCZ A;  5T3I A;  1W7T A;  3TDI A;  2JC2 A;  3JVT C;  1AJ5 A;  4IK1 A;  2ZO6 A;  4W6N A;  3AI5 A;  1SBJ A;  3JVT B;  1QIV A;  4DIR A;  3CZT X;  5DTL A;  1NP8 A;  2ZN8 A;  2H8Q A;  2OS8 C;  1DVI A;  2DDC A;  5FVG A;  5HLO A;  4HSZ A;  1TCO B;  4AS8 A;  3NEZ A;  1DJZ A;  1KP5 A;  3EK8 A;  2KI4 C;  5HKY A;  2Y1M A;  3U0N A;  1KQV A;  5EXC I;  2BKH B;  2PVB A;  1LA3 A;  1UHK A;  2G9B A;  4BDU A;  4W72 A;  2K2A A;  1CMF A;  2ZRS A;  1ALV A;  3DQ2 A;  3S05 A;  1GGX A;  2ZN9 A;  4GPL B;  1BF5 A;  1XK4 A;  2I18 A;  3HX4 A;  1CDN A;  4PPK A;  2K0J A;  3V3D A;  2PAL A;  1MUX A;  1NX3 A;  3SSV A;  2EMO A;  2K7D A;  2KI6 D;  5BPJ A;  3AKO A;  1EME A;  3E5W A;  4W6I A;  2GGZ A;  3EKH A;  1MQ1 A;  3VRQ A;  2L5X B;  4JGE A;  1Y6W A;  4U8D A;  1SL7 A;  1ZGQ A;  4D1E A;  3I5H C;  4HQ8 A;  1C7W A;  2HGY A;  1OQP A;  4PHM A;  1BOC A;  1L7Z A;  3W1D A;  1IGV A;  2KI6 C;  2M0R A;  1DT7 B;  1N2D A;  2SAS A;  3I5H B;  2WCF A;  4C0K A;  4JEO A;  3DQH A;  1RM9 A;  3DVJ A;  4PAL A;  3WHU B;  3IF7 A;  3LSA A;  4IK8 A;  4W6D A;  2K61 A;  1QX2 A;  2Y4Q A;  2OGR A;  3CS1 A;  1JBA A;  4YBH B;  2KAX A;  4PPL A;  4MBE A;  1B8R A;  1C4F A;  1BR4 B;  5GQQ C;  4W6J A;  2JAD A;  3WHT B;  4W74 A;  4GAO A;  4W76 A;  2IB6 A;  2ZRT A;  1EG3 A;  1ODB A;  1DJG A;  2GW3 A;  5BQL A;  1NSH A;  1W7S A;  2JXL A;  2GX2 A;  3DPZ A;  3ZWH A;  2VVJ A;  3A8R A;  4GNK B;  1F55 A;  1S5G Z;  3PAT A;  3DPX A;  4OVN F;  3KCS A;  1XFV O;  4EDO A;  4EMQ A;  1YVH A;  1J7O A;  3PM8 A;  3ADF A;  2QZ0 A;  3KHE A;  1MXE A;  2I2R E;  1EH2 A;  2AWJ A;  2LUC A;  4XYN A;  1N65 A;  4AQI A;  4ZIO A;  1CB1 A;  1JFK A;  2Z6Y A;  3U0K A;  5CSJ A;  3M22 A;  2HRS A;  2MJW B;  4YRU A;  3ST3 A;  4ORB B;  4JC2 A;  2B3Q A;  1S36 A;  2KFH A;  1H8B A;  1PRW A;  3PLF B;  1SNL A;  2F2P A;  4QJ4 B;  4IK4 A;  4W6B A;  3K21 A;  2A47 A;  2WSN A;  3TS5 C;  4MRX A;  1NX1 A;  4UTS A;  5CSI A;  4W6U A;  2PRU A;  2L0P A;  4GES B;  3KPX A;  3JTD C;  4W6O A;  2JNF A;  4P1Q A;  2GW4 B;  1KK8 C;  1K9U A;  4CFQ A;  3DQJ A;  2KNE A;  2JUL A;  3DQ3 A;  3CD9 A;  1CNP A;  3TDZ A;  2A53 B;  2AWK A;  3AAJ A;  3I5F C;  1QX7 A;  1GGZ A;  2ZNE A;  1KYR A;  3QRX A;  2O60 A;  2Z1O A;  3P28 A;  2R2I A;  1JFJ A;  2JRF A;  4BY4 A;  2JTZ A;  1QS7 A;  4ZF3 A;  3GJ1 A;  4N1G A;  4R1E A;  1YX7 A;  1L2O C;  4DXP A;  1W7U A;  2HFC A;  3HCM A;  3DQ8 A;  3OB1 B;  3MGF A;  5I2L A;  5I2O A;  3GB3 A;  5HLV A;  4KF4 A;  4JQ0 D;  1SL8 A;  3NXA A;  5EHU A;  3GK1 A;  2M1U A;  3O6B A;  1RRX A;  4XOW A;  1LXF C;  5KTG A;  3IR8 A;  4FTG A;  2JT0 A;  1REC A;  3IQO A;  4GBA A;  5I8N A;  3WXA A;  2COL B;  2BBM A;  1CM4 A;  4L1I A;  2L98 A;  1XYD A;  1JBY A;  1ZFS A;  1OZS A;  1F70 A;  2AUC A;  3ICB A;  4OV2 A;  5LTP A;  4CFR A;  4L12 A;  1A4P A;  1NX2 A;  1SW8 A;  3DQ4 A;  2H61 C;  2M8U A;  1AUI B;  1XVJ A;  2MHH A;  3DVE A;  4W7D A;  3SV5 A;  2DDD A;  2LLS A;  3W1C A;  1CFD A;  1A29 A;  2QLI A;  1MXL C;  2H5Q A;  3SG6 A;  4ZB1 A;  1BT6 A;  5HZO A;  4W6M A;  1TNQ A;  1XFX O;  4OHS A;  4C0L A;  3EK4 A;  4LW5 A;  3IQQ A;  2DUF A;  2O24 A;  1YZW A;  3K1K A;  3CGL A;  1F0B A;  2LAN A;  4W7A A;  3NT3 A;  1SYM A;  1XA5 A;  5KU1 A;  3E5T A;  5DPI A;  2EMD A;  2H5R A;  5CPV A;  1ZUX A;  3CBE A;  1ZGO A;  1YHH A;  4YGA A;  1SK6 D;  1IH0 A;  1A75 A;  3LF3 A;  4Q7U A;  4H47 A;  4YGD B;  2VAD A;  2TN4 A;  1KFU S;  2CT9 A;  4KEX A;  1UP5 A;  3ZNI A;  3SS0 A;  4N1F A;  4IL1 A;  2AAO A;  5ER5 A;  3PN7 C;  3SIA A;  1CLB A;  2KGB C;  5DRF A;  5KTY A;  1QLS A;  5FVF A;  3PN7 B;  2BEC A;  3NSK A;  4GGF A;  3KCT A;  1XFU O;  1DJH A;  2LUX A;  3EVU A;  1MHO A;  4ZBL A;  2FZU A;  4PCW A;  1M39 A;  2OTG C;  4W69 A;  3CD1 A;  4JPZ B;  3GL4 A;  2QLG A;  3PJB A;  1G4Y R;  1XFW O;  2BL0 C;  2OTG B;  1GFL A;  1IQ3 A;  2ZMW A;  4W6R A;  2WOS A;  2KBI A;  5EJU A;  3RWA A;  5D69 A;  5LK4 A;  5KSZ A;  4JRB A;  2BL0 B;  1A75 B;  3SIB A;  5JJG A;  3PJ7 A;  1DJX A;  1CLM A;  1B47 A;  3U8P A;  3CWG A;  5DTY A;  4PE1 A;  2K7O A;  2LMU A;  1M45 A;  2B1U A;  1OMR A;  2HQ8 A;  2LV7 A;  2MBX A;  1TOP A;  3NED A;  3LVD A;  2IE2 A;  1F54 A;  1XSS A;  1OXE A;  5J3X A;  1Q73 A;  4HRE E;  1AVS A;  2DD7 A;  4N3D A;  3SVS A;  4J8A A;  5AER A;  1DJI A;  1G7K A;  2HF5 A;  2WCE A;  4A4C A;  1DGU A;  1CM1 A;  1QX5 B;  3ED8 A;  3DQL A;  1ZAC A;  1UHN A;  5DPH A;  4TZA A;  4RTC A;  1WRK A;  4Q9W A;  4W7X A;  2CBL A;  1YX8 A;  4QJ3 B;  2G3O A;  2RGI A;  4TNC A;  2YDZ A;  3VRO A;  2KAY A;  3U0M A;  1B9C A;  1H6R A;  4PE7 A;  4RYS A;  3SVN A;  3OP0 A;  4EN1 A;  2G2B A;  4DXN A;  1JF2 A;  2L4H A;  1Q80 A;  5H87 A;  1NWD A;  4HQ9 A;  3C1V A;  3PFV A;  5DRG A;  4GGN A;  3KO0 A;  4ZF4 A;  3CR5 X;  2K7C A;  2M49 B;  4NDC A;  4EDS A;  5B8I B;  2DUH A;  5HGE A;  1YRU B;  3BOW B;  2PAS A;  2M97 A;  2LC5 A;  3U0L A;  1YUT A;  4DCK A;  2SCP A;  2JTT A;  1MWN A;  5HZU A;  4P76 A;  1F4Q A;  3ZUJ A;  4P2Y B;  4J89 A;  2PSR A;  3DQF A;  3KEV A;  3UG0 A;  1UIS A;  5CSN A;  1QAT A;  2V53 A;  4B5Y A;  2F33 A;  1TIZ A;  5I2Q A;  2H5O A;  1H4U A;  1HUY A;  1KWO B;  2ISD A;  5DTZ A;  4IK5 A;  1NCY A;  2LLU A;  2ZKM X;  1J1E A;  5K89 A;  2KQ6 A;  4HRH A;  4DS7 A;  1F4O A;  1M63 B;  3DQC A;  3DD4 A;  2GV5 A;  2F3Y A;  1Q4E A;  1XAE A;  3UFZ A;  2QAC A;  1BJF A;  4KPI A;  3SG4 A;  1K9K A;  4CLN A;  1BU3 A;  4GF6 B;  1CTR A;  2NZ0 A;  3ZUL A;  3DQN A;  1KQM C;  1A03 A;  3NSI A;  1B1G A;  1YHG A;  2AH8 A;  3CFH A;  1IQ5 A;  5EXB A;  4R6B A;  2K2F A;  3PSR A;  4B30 A;  1AP4 A;  1KQM B;  1YVL A;  2I7A A;  3BUN B;  2G6X A;  2O2B A;  2HET A;  1XK4 C;  1J1D A;  3E5V A;  2NCO A;  3LVA A;  3CLN A;  2M9G A;  1XFZ O;  3CR2 A;  4DXM A;  5FHV A;  2O5G A;  2WHU A;  2LLT A;  4PE0 A;  1D1O A;  3SRY A;  1QIW A;  5EXU A;  2CNP A;  2BCX A;  2HCG A;  1QYQ A;  1R6P A;  2BE4 A;  1CLL A;  4ETO A;  5LTR A;  4W77 A;  4YGB B;  3AI4 A;  4GFT A;  2ZND A;  3ZTF A;  1HQV A;  1JBZ A;  2A56 B;  3IP2 A;  3G9A A;  3H1R A;  2BCA A;  1K90 D;  1EMB A;  1YUU A;  2E30 A;  1S6I A;  5HW9 A;  4GUK A;  5AAN A;  1S6C A;  2KYF A;  1K8U A;  4UPG A;  4OGS A;  3DVK A;  2OPO A;  4H3L A;  3BYA A;  1IWQ A;  3VRP A;  4B30 B;  2OTB A;  2QU1 A;  1WLM A;  4W7C A;  1KSO A;  1XFY O;  2EMN A;  3DQK A;  1B8C A;  3DQU A;  3ST0 A;  1YHI A;  4W6P A;  1BOD A;  4IK3 A;  4I2Y A;  4OQW A;  3TMR A;  2P4M A;  2O29 A;  4W6G A;  4HRG A;  2PXS A;  1XA9 A;  2BE6 A;  5ER4 X;  1C7V A;  1UHJ A;  2WUR A;  5DTX A;  2F8P A;  1ZMZ A;  2WIS A;  1AHR A;  1QYO A;  4XL5 A;  4KA9 A;  1GL4 A;  4DRW A;  2HPW A;  2HGD A;  1Q4B A;  4Z4K A;  2YFP A;  2L50 A;  3RM1 A;  1TNX A;  1V1G A;  3O77 A;  1KK7 Y;  1B8L A;  2YE1 A;  1BLQ A;  1IKU A;  1RMO A;  2A4J A;  4ZF5 A;  3CTN A;  1FI5 A;  2JNX A;  2E6W A;  2LCP A;  3SJS A;  5EB6 A;  3SST A;  4A4B A;  4DXQ A;  1G8I A;  3LK1 A;  3DQA A;  1DJY A;  1Y1X A;  1UUS A;  1R2U A;  4GOB A;  2LP2 A;  1LVC D;  1CFF A;  3AKB A;  2I94 A;  4NDD A;  3SVD A;  3DQ9 A;  4W6T A;  2QLE A;  1J7P A;  2C9I A;  5D7F A;  4XGY A;  1EL4 A;  3RLZ A;  3VK1 A;  4ANJ A;  1F71 A;  4BY5 A;  2F3Z A;  4HVF A;  2MAZ A;  5CSF A;  1YR5 A;  4PHN A;  4PHJ A;  1JC2 A;  1EJ3 A;  1BMO A;  2EGD A;  1N0Y A;  2M7N A;  3SVU A;  3VIC A;  4FQO A;  2H6V A;  1OMV A;  3ST2 A;  1JC0 A;  1B9A A;  3DF0 A;  2OTE A;  4XJK A;  1HT9 A;  4P5O E;  3NSO A;  2G5Z B;  1ZUZ A;  2WHS A;  1ALW A;  5FYX A;  2A46 A;  4U2V A;  4F0Z B;  2JPT A;  1XQM A;  4W7F A;  1K96 A;  1M31 A;  1CKK A;  4LQT A;  1AJ4 A;  2LVI A;  1WY9 A;  4I5N B;  1SCM B;  3DQD A;  1S6J A;  1DMO A;  2HQZ A;  3SSH A;  1YTZ C;  3DQ5 A;  2Y0G A;  1QVI Y;  2V4E A;  1RRO A;  1EML A;  4ZFS A;  2GGM A;  3O2P A;  4USL A;  2HQK A;  2HQW A;  4LJD A;  1B7T Y;  1RMP A;  1PAL A;  5PAL A;  2WCB A;  3BQ3 A;  5DKQ A;  2BBN A;  1YRT B;  2RH7 A;  2H2K A;  2H5P A;  3I5G C;  4Q04 A;  3SG2 A;  4AQJ A;  3M24 A;  4JFG A;  1RTP 1;  5F9G A;  3M0W A;  4ZCU A;  4IZN A;  1CMG A;  3NSL A;  3DVM A;  3I5G B;  4I5K A;  3BUX B;  3RWT A;  1PSR A;  1JF0 A;  1YJF A;  4XJK B;  3BXB A;  3DQ6 A;  1JC1 A;  4ZCV A;  3VGO A;  1CV7 A;  1QLK A;  3SG3 A;  2DUG A;  1YUS A;  1EG4 A;  1KSM A;  3H1O A;  1GGW A;  4ICB A;  2FOT A;  1K94 A;  1CDL A;  2A50 B;  1JUO A;  1FPW A;  3ST4 A;  2HJO A;  1WLZ A;  1FW4 A;  3EK7 A;  5HZS A;  2K7B A;  3AAK A;  5FVI A;  3LA1 A;  3OX6 A;  5AXI A;  4NQG A;  4LJB A;  1VRK A;  1OOJ A;  2MRD A;  4KGF A;  1K95 A;  4KW8 A;  1Q4A A;  1RK9 A;  1WRL A;  2AMI A;  2F2O A;  4W75 A;  3DQO A;  3FWB A;  1KK7 Z;  3TUY C;  4GGF C;  1C07 A;  2QT2 A;  3ZUF A;  2LP3 A;  4ORN A;  3TUY B;  1CDM A;  1PSB A;  1Z1Q A;  2JU0 A;  5EBJ A;  3GOF A;  1QAS A;  2KOT A;  1PVB A;  3WLC A;  5DY6 A;  1WDC C;  1J7R A;  1G33 A;  2GX0 A;  5BT0 A;  2Z6X A;  2QLG B;  2ICR A;  4W7R A;  2NCP A;  1WDC B;  1V1F A;  3D0Y A;  2LVJ A;  1RMM A;  4MEW A;  2NXQ A;  5AEQ A;  1UUR A;  2QPT A;  2JOJ A;  3CB9 A;  3BXA A;  4MZL A;  3BXC A;  1YJ2 A;  3LF4 B;  1X02 A;  2CXJ A;  2KHN A;  3LK0 A;  2WHT A;  1RFJ A;  2KFG A;  3GK4 X;  1K93 D;  3MSE B;  4MSP A;  5HKZ A;  4OJ0 A;  2OS8 B;  1Q4D A;  1FBV A;  4WQ3 A;  1KWO C;  3PJ5 A;  1IRJ A;  3VHT A;  2JWW A;  3P8U A;  1QVI Z;  2WSO A;  2L2E A;  3H4S E;  4M2Q A;  3TMT A;  1QJT A;  2D8N A;  1NYA A;  2KI4 B;  3OHM B;  1QY3 A;  1SMG A;  4Q7T A;  3WNX B;  4W7E A;  1YFP A;  2MLE C;  2PMY A;  3DPW A;  1J55 A;  3D0Y B;  1B7T Z;  4AR7 A;  5H88 A;  3BUW B;  4YI8 A;  2G16 B;  1E8A A;  3LLE A;  5BTT A;  2POX A;  2ARL A;  3GK2 A;  4I5L B;  1M46 A;  1NPQ A;  1CDP A;  1LA0 A;  1EXR A;  3DQE A;  2Q91 A;  4YGE B;  2AWM A;  1W7I B;  3VRN A;  3CGA A;  2MLF C;  1EMK A;  4HE4 A;  4Q7R A;  1RWY A;  1JWD A;  3OB2 B;  1UHI A;  4PPJ A;  2VZX A;  3E3R A;  3EVV A;  2LE9 B;  1TTX A;  2LHL A;  3VHT B;  2EHB A;  4EUL A;  4XVP A;  4CPV A;  5DQM A;  2WND A;  1NIW A;  2L4I A;  2FCE A;  3BX9 A;  1SY9 A;  1CFC A;  2G6Y A;  5DPJ A;  3OSR A;  5G08 A;  1Y0V H;  4XOV A;  1EMF A;  3SVO A;  1DF0 A;  4OCI A;  4H3N A;  4J88 A;  5AFP A;  4W6H A;  4PHK A;  2OKW A;  2LMT A;  4OKH A;  2BCB A;  3CFA A;  5BTT B;  2CCM A;  1DGV A;  2FCD A;  2A48 A;  3A8S A;  4HQC A;  2VAE A;  1TCF A;  1EMG A;  1AK8 A;  1GJY A;  2EC6 C;  4PE4 A;  4MZK A;  5HZT A;  2Q6P A;  4ORC B;  1KYS A;  2FWQ A;  1S6Z A;  1SPY A;  2EC6 B;  1OMD A;  4L13 A;  3O4Y A;  3NF0 A;  1HCJ A;  3LVC A;  3LCP C;  2LAP A;  2P6B B;  2M7L A;  4Z4M A;  1EMM A;  4W6S A;  1S1E A;  2LM5 A;  2M3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...