3EK4A

Calcium-saturated gcamp2 monomer
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
348
Chain Sequence
KTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
total genus 111
structure length 348
sequence length 367
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek4A02
4MSPA 1KSMA 4DXMA 1ODBA 3JTDB 3A4UB 1S6IA 5HLOA 2HJOA 2Q4UA 1LINA 3BUOB 3VRNA 1Q80A 1JBZA 4DXQA 4ETOA 2PMYA 2AWLA 5F6TA 2A47A 5BTTA 2COLB 4W6LA 4MZKA 3U8AA 3EK8A 3DF0B 4W6FA 2K7BA 1Q73A 4KGEA 4IK1A 1F55A 2HGYA 4HRGA 1MOVA 3DQUA 3E5VA 1XAEA 2QT2A 4PDZA 1SBJA 4OCIA 1W7UA 4Q7RA 4W6RA 4GF6B 2LAPA 3DQJA 1NX3A 4H3NA 5LTPA 2LVJA 2WSNA 3SG2A 4GESB 3CR4X 4W6NA 3ICBA 5HZUA 3KO0A 1FBVA 1CMFA 1KK8C 2RH7A 4W7CA 2MLFC 4ZF3A 3LL8B 4Q9WA 4QJ3B 1W7JB 1WDCC 2LE9B 1YVHA 3GOFA 1XQMA 1UHJA 1B8LA 1SY9A 5DQBA 4W73A 3GK1A 4ZB1A 2Y5IA 4KPIA 2EC6B 4W6JA 2D8NA 2MA2A 4YGEB 1QX5B 4OV2A 5K89A 2VZXA 1RMPA 1CDNA 2KQYA 1F09A 2K2AA 3O4YA 2QLGA 4ZINA 4W6BA 1IJ6A 5DTXA 1E8AA 1BJFA 2WCEA 1TIZA 4OR9B 4EDOA 2KBMA 1F8HA 1CV7A 1BG1A 4M2OA 4MN0A 3SRYA 5DU0A 1JBYA 3PSRA 3ZNIA 1K94A 5HKYA 2BL0B 2L4IA 4J89A 3NT3A 3NSKA 1ZGQA 4W7FA 4P2YB 1DJWA 2IB6A 2HQ8A 2A56B 4PE0A 1DGUA 1CFDA 1KFXL 3OHMB 4R6BA 1HUYA 3PIBA 4BY4A 4KW8A 2ZN8A 3ZUJA 3EVVA 3W1DA 3EKHA 1KWOB 3SVNA 1KK7Y 4GNKB 3U0MA 2JTZA 3I5GB 4DS7A 3CGLA 1EG4A 4MRXA 2O60A 4ORBB 4NDBA 3RLZA 4MVFA 1UWOA 5HKWA 1MXEA 2L4HA 2HQZA 2JQ6A 4HSZA 1MHOA 3OB1B 2MBXA 2DDCA 3VRRA 2OTEA 4YRUA 1EL4A 1WLMA 5HKZA 3TUYB 5JOLA 1L7ZA 1QIWA 1DJGA 2PALA 1QJTA 4XJKB 3WCKA 2M9GA 1D1OA 1OXEA 2BKIB 4KW9A 1K90D 4HQ8A 3D0YA 5T3IA 1R6PA 1TRFA 1SR6B 3PJ5A 2VVJA 1TCOB 1Q4AA 2OTGB 3M22A 2G6YA 1U5IA 3VK1A 3UG0A 3DQ1A 4H48A 2QACA 4ICBA 4J88A 2JT8A 2L50A 2WIQA 3I5HC 2P6BB 4W6GA 4W72A 1FI6A 3NEZA 1KYRA 3BQ3A 2L98A 2O5GA 5ER5A 5D69A 3P28A 1J7RA 5HLVA 1FW4A 1EMBA 1KFUS 1EH2A 1ALWA 1OMVA 1G7KA 1OSAA 3BUMB 1JFJA 3SIAA 3E5WA 1X02A 2H2KA 1PULA 1S5GZ 4JC2A 5FHVA 1UHKA 2KYCA 3ST3A 4W6CA 1DF0A 1M39A 5IBWA 5I8NA 4W7AA 3H1RA 5CSIA 2KSPA 4PPLA 1HCJA 2DUIA 3PM8A 1XK4C 1M31A 5DKQA 4CLNA 2F33A 5BT0A 1RECA 1WRZA 1KP5A 3GK4X 4L9MA 2I18A 2OTBA 4MEWA 2KFFA 2EMOA 1G8IA 1YUUA 1QYFA 4XOWA 5EXUA 4B5YA 2IOVA 2K7CA 3ADFA 3FWCA 1L2OC 3SVBA 3EVUA 2MAZA 4W69A 2JC2A 5D7FA 1NCZA 3TS5C 2BECA 3AI4A 3K21A 2JT0A 3SG5A 1S6JA 2HCGA 1K9KA 3CD9A 3K1KA 3SSPA 2K7DA 1H4UA 4EMQA 3TZ1A 4DUQA 3BOWA 4OKHA 5HBDA 2CBLA 1NIWA 4GPLB 1UP5A 1EJ3A 3NF0A 4YGBB 4XGYA 1QVIY 2LVKA 1OZOA 5FVGA 3DQMA 1SPYA 1WRKA 3C1VA 2KOTA 5BPJA 3H4SE 1A75A 4YGCB 2DUHA 4YI8A 4PFEA 1YRUB 4JGEA 1YVLA 1CKKA 2B1UA 1OMDA 2LNKA 4NDCA 3CR5X 3UFZA 4PPJA 1NP8A 1TNXA 5DY6A 1TOPA 3IF7A 4Q7UA 3EVRA 2HF5A 2Q6PA 5TNCA 3SSYA 2BL0C 4IK3A 1A4PA 1B47A 2BE4A 5AEQA 1XO5A 4KAGA 1NPQA 2LP3A 1NCYA 2JWWA 4L13A 1WRLA 4WQ3A 1CFPA 1YHHA 4IK4A 2OGRA 1N2DA 1JWDA 4N5XA 2SASA 1CTRA 1AUIB 3I5FB 3AKBA 1BMOA 4LQUA 3DVEA 3DQFA 3JVTC 2ZN9A 2ZMUA 5H88A 4ZF5A 2I7AA 1GGZA 4L12A 4W6PA 1EMFA 3DVJA 3DVKA 2TN4A 4C0JA 4U2VA 2BCAA 2MJWB 3MGFA 3I5GC 3SG7A 1KYPA 5DPIA 1Y1AA 2C9JA 4RTCA 3PN7B 1DJIA 4HQ9A 4Q7TA 3KEVA 3G9AA 1MWNA 4MBEA 4WRIA 5DQMA 2Z1OA 4JFGA 3SSKA 1EMEA 4KW4A 4B30B 5EBJA 2EGDA 4IL1A 4PHNA 1BODA 2KGBC 3BXBA 5CSFA 3TUYC 4CFQA 2KHNA 2YFPA 3AAJA 2ZRSA 4CPVA 4KA9A 1ZACA 1SL7A 3LF4B 1NX0A 1KCYA 3VGOA 2GGZA 1C7VA 1XK4A 4W74A 1RM9A 2M7NA 3ZWHA 2SCPA 5J3XA 2G3OA 1NUBA 4W7DA 1F4OA 2M0RA 4GOBA 2V4EB 3TDUA 2IS9A 3FIAA 2K0JA 3OB2B 2M1UA 1J55A 4DRWA 3EK7A 4ORAB 2ICRA 1QS7A 4I5LB 1S6ZA 4AOMA 2POXA 4PE4A 1W7SA 2OJKA 1S6CA 4D1EA 2WOSA 5F9GA 3I5IB 2M7LA 3SVDA 3QRXA 3O6BA 4LJDC 4MZLA 1AVSA 5DRGA 5BTTB 4PHJA 4OY4A 2AH8A 2WSOA 4PHKA 4W6KA 1KYSA 3FS7A 1IQ3A 2FCEA 2G2SB 2JULA 1RMMA 4W6DA 2A46A 1KQVA 3TMRA 3IQOA 3O77A 5B8IB 3HX4A 1J7OA 4JF9A 2MHHA 1S1EA 4JQ0D 2KDHA 2OKYA 3EKJA 2KQ6A 1K9PA 2G6XA 3CS1A 3LCPC 1EMLA 2YE0A 1NCXA 1WLZA 5DTZA 2GX0A 1CDPA 3SVUA 3LLEA 1CLLA 2FWQA 2K61A 2LLTA 1KQMC 1Y6WA 2A52B 2WURA 4HE4A 5FVIA 1RK9A 2NXQA 2HETA 3OSRA 3ST2A 1QY3A 4UTSA 2L5XB 3U0NA 3U8PA 3DQHA 2QRFA 2BCBA 3DQCA 3AKAA 1J1DA 4OQWA 1YRTB 4ZFSA 3LK1A 1IKUA 3DQDA 1EMKA 4WQ2A 4KGFA 2FOTA 1A29A 4DKNA 2QLGB 1AJ5A 3GL4A 1YZWA 5HW9A 1KFXS 3VRPA 2GW4B 3LVDA 4W76A 4XVPA 4GAOA 3PATA 2ZNEA 4A4CA 2O29A 4W77A 1QIVA 1QYOA 2QZ0A 2YE1A 1S26D 2YDZA 4DKMA 1OXDA 2M1KB 4PALA 1F54A 2G16B 2GV5A 3EVPA 1S36A 4RYWA 4W6MA 4W6IA 5CSJA 3IQQA 1EMAA 2BBMA 1J1EA 4NQGA 1YX8A 2F3ZA 2AWJA 4W6OA 5AERA 2A53B 2WHUA 2EHBA 1B1GA 1K96A 2ZRTA 2H5RA 1UHNA 5DTYA 2KI4B 3LVCA 3E5TA 1QLSA 1QV0A 2M49B 3CR2A 3SJSA 1N65A 4XYNA 1DTLA 2WCFA 1K95A 5JJGA 4DIRA 5LTQA 1GGWA 2BE6A 4ZCVA 2G6EA 3I19A 1SCMC 5H89A 1ZFSA 4ANJA 1CB1A 2DD7A 2BBNA 2H5QA 3O78A 4JPZB 1IRJA 2GW3A 4GUKA 4HVFA 4LJDA 1SK6D 1Q4CA 3SG6A 2B3PA 1SKTA 1ZUXA 4GGFC 1JFKA 1YURA 2JPTA 3GK2A 3ED8A 2BKHB 2Q57A 4UPGA 1HQVA 3GB3A 3SIBA 3KHEA 4W7RA 1IG5A 1LKJA 2Y1MA 5LTRA 3D0YB 1ZGOA 1HT9A 1FI5A 1F0BA 3LK0A 3JTDC 1B8RA 1NWDA 3DD4A 5AFPA 4R6DA 1U5IB 1S3PA 5EB7A 4W6SA 1ALVA 2A48A 1KK8B 1ZUZA 1KFUL 2DUFA 1WDCB 4HREE 1JUOA 4W6AA 4FQOA 1BU3A 1UHIA 2PVBA 4J8AA 2A4JA 3SVOA 3WNXB 4M2QA 3NXAA 1JBAA 1BR4B 1A2XA 4IK9A 2CCMA 2G5ZB 2HGDA 3ST4A 3U0KA 1MF8B 2JNXA 2HRSA 2AMIA 4TZGA 2QU1A 1XVJA 3OX6A 1QX2A 3CFHA 3S05A 4Z4KA 2ZO6A 4YBHB 3VICA 2Z6XA 1XYDA 1B7TY 4OVNF 2K2FA 1DF0B 1Z1PA 2LUCA 1CFFA 2LANA 2VVHA 2LMUA 2M29A 2JADA 4OGSA 5I2OA 2EC6C 2AAOA 2M97A 1CMGA 3SVEA 3AI5A 2LCPA 2LLSA 4CFRA 1QXPA 2HPWA 1PVAA 1PVBA 1F70A 1CFCA 3OSQA 2LV7A 1SL9A 4PPKA 4AS8A 3VHTA 3TDZA 3CD1A 3CBEA 1XSSA 1EXRA 1V1FA 2GX2A 3SSVA 2BTJA 1DGVA 2RGIA 1IQ5A 3BOWB 1DJZA 3OGOA 1K8UA 2Y0GA 5DPJA 2ZFDA 2JRFA 2WHTA 2P4MA 3DQIA 1PRWA 2DDDA 1SNLA 2WC8A 5EXBA 1YJFA 3RM1A 1H4BA 2DOQA 5AXIA 2JXLA 2LUXA 4Q9XA 1DJHA 1KK7Z 2DD9A 2AUCA 4NWSA 2F3YA 1AK8A 3ST0A 1A75B 2HPSA 2WISA 3U8CA 4YGAA 5EXCI 1GQMA 2VVIA 1EG3A 2NLNA 3TDIA 2ZKMX 4GGFA 3KF9A 5KTGA 5HZSA 1KWOC 1LA3A 2PRUA 1F4QA 3CLNA 3E3RA 2KI6C 1DMOA 4PE7A 2FCDA 3NSLA 2BCXA 1FF1A 1OOJA 3BYAA 2LVVA 1DJYA 1OMRA 3BUWB 2PXSA 3WXAA 1TNPA 2JOJA 2LLUA 4KF4A 1QATA 2ISDA 2K8MB 1M63B 1TNQA 2F2PA 3GJ1A 2KI6D 1C4FA 4H47A 5DPGA 2IE2A 1K2HA 2FL1A 1IJ5A 4MRYA 3IR8A 4JEOA 3GEXA 4CIDA 2CNPA 4KF5C 1YFPA 1XFYO 1F71A 1EMGA 1VRKA 4HQCA 4ORCB 3DF0A 3HCMA 3LF3A 1Y1XA 1SYMA 1QX7A 3RWTA 2OS8B 1BFPA 1TN4A 5KU1A 2Y1NA 4IK5A 1SR6C 2KAVA 1UHHA 4LQTA 2M8UA 4E68A 5DRFA 3VRQA 2OTGC 1N0YA 3DQ6A 5KTYA 4AQIA 4XOVA 5ER4X 4MLWA 3WLCA 1BLQA 2WNDA 1CM1A 4GBAA 4BDUA 4LJCA 1TCFA 4YGDB 3PFVA 3CGAA 1DT7B 4TZAA 4IK8A 3D10A 4L1IA 4PE1A 2MLEC 3SS0A 1SL8A 1QYQA 1K9UA 1CNPA 1S5GY 4GFTA 4Z4MA 1CLBA 1YR5A 1RWYA 3M0WA 2WCBA 4BY5A 2CT9A 3SVSA 1XA5A 3DQNA 1L2OB 3WHUB 1B8CA 2JNFA 3KPXA 4FTGA 1RJVA 2G3DB 3DQ8A 1LVCD 3TS5B 3DQ2A 2NCPA 3DQ5A 4W75A 1RFJA 1RROA 3DVMA 4AR7A 3NSIA 4R1EA 3DPXA 4EULA 3OX5A 1LXFC 1MR8A 3CTNA 4JRBA 1WY9A 1B7TZ 4ZCUA 3DPZA 3NEDA 3U0LA 1EMCA 1Q4DA 3F45A 2E30A 4YI9A 2QPTA 4M2PA 2H6VA 2H61C 1BR1B 2H8QA 2CXJA 5LK4A 4XL5A 1SRAA 3CWGA 1MOUA 1YHGA 2L2EA 3LVAA 1AJ4A 2KYFA 3SSLA 1QVIZ 3CFFA 4W7XA 1QTXA 1B4CA 4I2YA 3W1CA 5H87A 1QASA 4RYSA 2VADA 1GL4A 3P8UA 4OHSA 2QLEA 4LJBA 3IP2A 1JSAA 2PSRA 2I94A 2IB5A 3SSTA 3DQKA 1CM4A 4I5KA 1QXTA 3PALA 2EMNA 1Q4EA 4Q04A 3LA1A 2M3WA 5EHUA 4IZNA 1UUSA 5DKNA 4H3MA 1AHRA 1XFZO 4C0KA 2KFGA 4NDDA 4KF5A 4LW5A 1MUXA 1DJXA 4DCKA 4DXOA 1Y0VH 2PASA 3BXKA 3JVTB 3O2PA 1RRXA 4XJKA 4HRHA 2AWKA 4H3LA 3DQ7A 1GGXA 1J7QA 3SVCA 3BUXB 2LMVA 2NZ0A 1SCVA 1IWQA 5FYXA 2B3QA 4ZF4A 1CDLA 1PALA 1OQPA 1UURA 1R2UA 5EJUA 2HFCA 4ZIOA 3I5FC 2AWMA 3PJBA 1J7PA 3PJ7A 3LS3A 1Y1UA 4U8DA 3CFAA 3EK4A 5I2LA 2KGRA 4DXNA 1YUTA 2H9WA 5DTLA 3VROA 2WHSA 3LSAA 1MXLC 1XFUO 4W6HA 2LP2A 5EB6A 3ZTFA 1SMGA 3PN7C 1OE9B 4EDSA 1NX2A 5KSZA 3AKOA 1QV1A 1A03A 2KAYA 3KCSA 2FZUA 1XFWO 1JF0A 3DQAA 2DUGA 3A8SA 3MSEB 1RTP1 3NT9A 3V3DA 1GJYA 4QJ4B 3WHTB 1BT6A 1CDMA 5J2OA 1ZGPA 2OS8C 1W7IB 4P1QA 5BQLA 4PCWA 2ARLA 4W7EA 1YUSA 2Q91A 5PALA 4MZJA 3DQOA 1M46A 2VAEA 1B9CA 2A50B 2V4EC 2H61A 3SVRA 5DPHA 2L51A 3FWBA 4GGNA 3RWAA 2HQWA 2JT3A 1FPWA 1PK0D 5GQQC 2V53A 5I2QA 4PHMA 5HZOA 1ZMZA 1M45A 2ZNDA 4I5NB 1XFVO 1C07A 4AQJA 1V1GA 2Y4QA 3M24A 2LHLA 3I5IC 1NYAA 3ZUFA 2AHAA 3TMTA 2OKWA 1JC1A 1XMZA 1JF2A 4QJ5B 2ZO7A 1KQMB 2A54B 1BOCA 3H1OA 2LHIA 1BF5A 3BUNB 1W7TA 4DXIA 2H5OA 4W6UA 1TNWA 1IGVA 4USLA 2KBIA 1IH0A 5G08A 2C9IA 2PXWA 2I2RE 2R2IA 4DXPA 4JWQA 2Z6YA 4I5JA 5HYDA 2LMTA 1YX7A 1OXFA 3GJ2A 3ZULA 1XFXO 2LC5A 1C7WA 2HQKA 1H8BA 5AANA 3SG3A 3CZTX 1NX1A 1K93D 3DQ9A 2L0PA 5HZTA 1LA0A 1PSBA 2CTNA 1SW8A 3AAKA 4EN1A 1OZSA 1CLMA 4N1GA 2QLIA 2Z6ZA 4W6TA 2KFHA 3DQ3A 3OP0A 1AP4A 1JC0A 4P76A 2NCOA 2H5PA 5AQBB 4P5OE 3KCTA 3DQLA 3SG4A 3BXAA 4ORNA 3VHTB 2O24A 4ZBLA 1G4YR 2JZIA 2JXCA 2K7OA 4A4BA 2JU0A 2EMDA 2G9BA 3NSOA 4OJ0A 4KEXA 1XA9A 2GGMA 3BX9A 1H6RA 1NSHA 5CPVA 3SV5A 1QLKA 1TTXA 1KSOA 3DQ4A 2G2BA 3WLDA 2JTTA 4N3DA 4B30A 2MRDA 5FVFA 2OPOA 4F0ZB 1DVIA 1MYWA 5HGEA 2KAXA 2KNEA 2ZMWA 3CB9A 1Z1QA 1Q4BA 2F2OA 1PSRA 1RMOA 1YJ2A 1UISA 2LM5A 1SCMB 2E6WA 3PLFB 3DPWA 1YHIA 3BXCA 1G33A 3SSHA 2WORA 4N1FA 1B9AA 5DKRA 1EMMA 2FJUB 1YTZC 2LVIA 2DUEA 2F8PA 4TNCA 1ZOTB 2KI4C 2VRGA 2QLHA 4C0LA 3I5HB 2V4EA 1JC2A 1MQ1A 3A8RA 3DQEA 2O2BA 1GFLA 5CSNA
chains in the Genus database with same CATH superfamily
4MSPA 1KSMA 4DXMA 1ODBA 3JTDB 3A4UB 1S6IA 5HLOA 2HJOA 2Q4UA 1LINA 3BUOB 3VRNA 1Q80A 1JBZA 4DXQA 4ETOA 2PMYA 2AWLA 5F6TA 2A47A 5BTTA 2COLB 4W6LA 4MZKA 3U8AA 3EK8A 3DF0B 4W6FA 2K7BA 1Q73A 4KGEA 4IK1A 1F55A 2HGYA 3S0AA 4HRGA 1MOVA 3DQUA 3E5VA 1XAEA 2QEOA 2QT2A 4PDZA 1SBJA 4OCIA 1W7UA 4Q7RA 4W6RA 4GF6B 2LAPA 3DQJA 1NX3A 4H3NA 5LTPA 2LVJA 2WSNA 3SG2A 4GESB 3CR4X 4W6NA 3ICBA 5HZUA 3KO0A 1FBVA 5D3OA 1CMFA 1KK8C 2PYQA 2RH7A 4W7CA 2MLFC 4ZF3A 3LL8B 4Q9WA 4QJ3B 1W7JB 1WDCC 2LE9B 1YVHA 3GOFA 1XQMA 1UHJA 1B8LA 1SY9A 5DQBA 4W73A 3GK1A 4ZB1A 2Y5IA 4KPIA 2EC6B 4W6JA 3EG5B 2D8NA 2MA2A 4YGEB 1OW4A 3BFAA 1QX5B 4OV2A 5K89A 2VZXA 1RMPA 1CDNA 2JPOA 2KQYA 1F09A 2K2AA 3O4YA 2QLGA 4ZINA 4W6BA 1IJ6A 5DTXA 1E8AA 1BJFA 2WCEA 1TIZA 3CDNA 4OR9B 4EDOA 2KBMA 1F8HA 1CV7A 1BG1A 4M2OA 4MN0A 3SRYA 3B88A 5DU0A 1JBYA 3PSRA 3CZ2A 3ZNIA 1K94A 5HKYA 2BL0B 2L4IA 4J89A 3NT3A 3NSKA 1ZGQA 4W7FA 4P2YB 1DJWA 2IB6A 1Z2CB 2HQ8A 2A56B 4PE0A 1DGUA 1CFDA 1KFXL 3OHMB 4R6BA 1HUYA 3PIBA 4BY4A 4KW8A 2ZN8A 3ZUJA 3EVVA 3W1DA 3EKHA 1KWOB 5FI6A 3SVNA 1KK7Y 4GNKB 5I94A 2KLEA 3U0MA 2JTZA 3I5GB 4DS7A 3CGLA 1EG4A 3L4AA 4MRXA 2O60A 4ORBB 4NDBA 3RLZA 2QEBA 4MVFA 1UWOA 5HKWA 1MXEA 2L4HA 2HQZA 2JQ6A 4HSZA 1MHOA 1QWVA 1TUJA 3OB1B 5FI7A 2MBXA 2DDCA 3VRRA 2OTEA 4YRUA 1EL4A 1WLMA 5HKZA 3TUYB 5JOLA 1L7ZA 1QIWA 1DJGA 1OOHA 2PALA 3R1VA 1QJTA 4XJKB 3WCKA 2M9GA 1D1OA 1OXEA 1OOFA 2BKIB 4KW9A 1K90D 4HQ8A 3D0YA 5T3IA 1R6PA 1TRFA 1SR6B 3PJ5A 2VVJA 1TCOB 1Q4AA 2OTGB 3M22A 2G6YA 1GM0A 1U5IA 3VK1A 3D73A 3UG0A 3DQ1A 4H48A 2P71A 2QACA 4ICBA 4J88A 2JT8A 2L50A 2WIQA 3I5HC 2P6BB 4JKTA 4W6GA 4W72A 1FI6A 3NEZA 1KYRA 3BQ3A 2L98A 2O5GA 5ER5A 3VB1A 5D69A 3P28A 1J7RA 5HLVA 1FW4A 1EMBA 1KFUS 1EH2A 1ALWA 1OMVA 1G7KA 1OSAA 3BUMB 1JFJA 3SIAA 3E5WA 1X02A 2H2KA 1PULA 1S5GZ 4JC2A 5FHVA 1UHKA 2KYCA 3ST3A 3B86A 4W6CA 1DF0A 1M39A 5IBWA 5I8NA 4W7AA 3H1RA 5CSIA 2KSPA 4PPLA 1HCJA 2DUIA 3PM8A 1XK4C 3NHIA 1M31A 5DKQA 4CLNA 2F33A 5BT0A 1RECA 1WRZA 1KP5A 3GK4X 4L9MA 2I18A 2OTBA 4MEWA 2KFFA 2EMOA 1G8IA 1YUUA 1QYFA 4XOWA 5EXUA 4B5YA 2IOVA 2K7CA 3ADFA 3FWCA 1L2OC 3SVBA 3EVUA 2MAZA 4W69A 2JC2A 5D7FA 1NCZA 3TS5C 2BECA 3AI4A 3K21A 2JT0A 3SG5A 1S6JA 2HCGA 1K9KA 3CD9A 3K1KA 3SSPA 2K7DA 1H4UA 4EMQA 3TZ1A 4DUQA 3BOWA 4OKHA 5HBDA 2CBLA 4KYNA 1NIWA 3QMEA 4GPLB 1UP5A 3S0FA 1EJ3A 4YGBB 3NF0A 4XGYA 1QVIY 2LVKA 1OZOA 5FVGA 3DQMA 1SPYA 1WRKA 3C1VA 2KOTA 5BPJA 3H4SE 3FE6A 1A75A 4YGCB 2DUHA 4YI8A 4PFEA 1YRUB 4JGEA 1YVLA 1CKKA 2B1UA 1OMDA 2LNKA 4NDCA 3CR5X 3UFZA 4PPJA 1NP8A 1TNXA 5DY6A 1TOPA 3DY9A 3IF7A 4Q7UA 3EVRA 2HF5A 2Q6PA 5TNCA 3SSYA 2BL0C 4IK3A 1A4PA 1B47A 2BE4A 5AEQA 1XO5A 4KAGA 1NPQA 2LP3A 1NCYA 2H8VA 2JWWA 2WC6A 4L13A 1WRLA 4WQ3A 1CFPA 1YHHA 4IK4A 2OGRA 1N2DA 1JWDA 3OBVA 4N5XA 2SASA 1CTRA 1AUIB 3I5FB 3AKBA 1BMOA 4LQUA 3DVEA 3DQFA 3JVTC 1DELA 2ZN9A 2ZMUA 5H88A 4ZF5A 2I7AA 1GGZA 4L12A 4W6PA 1EMFA 3DVJA 3DVKA 2TN4A 4C0JA 4U2VA 2BCAA 4PT1A 2MJWB 3MGFA 3I5GC 3SG7A 1KYPA 5DPIA 1Y1AA 2C9JA 4RTCA 3PN7B 1DJIA 4HQ9A 4Q7TA 3KEVA 3G9AA 1MWNA 4MBEA 4WRIA 5DQMA 2Z1OA 4JFGA 3D78A 3SSKA 1EMEA 4KW4A 4B30B 2L5YA 5EBJA 2EGDA 1P28A 2FJYA 3D74A 4IL1A 4PHNA 1BODA 2KGBC 3BXBA 5CSFA 3TUYC 4CFQA 2KHNA 2YFPA 3AAJA 2ZRSA 4CPVA 4KA9A 1ZACA 1SL7A 3LF4B 1NX0A 1KCYA 3VGOA 2GGZA 1C7VA 1XK4A 4W74A 1RM9A 2M7NA 3ZWHA 2SCPA 5J3XA 2G3OA 1NUBA 4W7DA 1F4OA 2M0RA 4GOBA 2V4EB 3TDUA 2IS9A 3D75A 2K0JA 3FIAA 2K60A 3DXLA 3OB2B 2M1UA 1J55A 4DRWA 3EK7A 4ORAB 2ICRA 1Z4HA 1QS7A 4I5LB 1S6ZA 4AOMA 2POXA 4PE4A 1W7SA 2OJKA 1S6CA 4D1EA 2WOSA 5F9GA 3I5IB 2M7LA 3SVDA 3QRXA 3O6BA 4LJDC 4MZLA 2KPHA 1AVSA 5DRGA 5BTTB 4PHJA 4OY4A 2AH8A 2WSOA 1W9ZA 4PHKA 4W6KA 1KYSA 3FS7A 1IQ3A 2FCEA 2G2SB 2JULA 1RMMA 3PM2A 4W6DA 2A46A 2WC5A 1KQVA 3TMRA 3IQOA 3O77A 5B8IB 3R1OA 3D76A 3HX4A 1J7OA 4JF9A 2MHHA 1S1EA 4JQ0D 2KDHA 2OKYA 3EKJA 2KQ6A 1K9PA 2G6XA 3CS1A 3LCPC 1EMLA 2YE0A 1NCXA 1WLZA 5DTZA 3L47A 2GX0A 1CDPA 3SVUA 3LLEA 1CLLA 2FWQA 2K61A 2LLTA 1KQMC 1Y6WA 2A52B 2WURA 4HE4A 5FVIA 1RK9A 2NXQA 4FQTA 3SS4A 2HETA 3OSRA 3ST2A 1QY3A 4UTSA 2L5XB 3U0NA 3U8PA 3DQHA 2QRFA 2BCBA 3DQCA 3AKAA 4IJ7A 1J1DA 4OQWA 1YRTB 4ZFSA 3N7HA 3LK1A 1IKUA 5HL1A 3DQDA 1EMKA 4WQ2A 4KGFA 2FOTA 2GTEA 1A29A 4DKNA 2QLGB 1AJ5A 3GL4A 1YZWA 5HW9A 1KFXS 3VRPA 2GW4B 3LVDA 4W76A 4XVPA 4GAOA 3PATA 3S0EA 2ZNEA 4A4CA 2O29A 3IVTA 4W77A 1QIVA 1QYOA 2QZ0A 2YE1A 1S26D 2YDZA 4DKMA 1OXDA 2M1KB 4PALA 1F54A 3EVPA 2GV5A 2G16B 1S36A 4RYWA 4W6MA 4W6IA 5CSJA 3IQQA 4INXA 1EMAA 2BBMA 1J1EA 4NQGA 1YX8A 3BFHA 2F3ZA 3V2LA 2AWJA 4W6OA 5AERA 2A53B 2WHUA 2EHBA 1B1GA 1K96A 2ZRTA 2H5RA 1UHNA 5DTYA 2KI4B 3LVCA 3E5TA 1QLSA 1QV0A 2M49B 3CR2A 3SJSA 1N65A 3SS5A 3FE9A 4XYNA 1DTLA 2WCFA 1K95A 5JJGA 4DIRA 5LTQA 1GGWA 2BE6A 4ZCVA 1DEKA 2G6EA 3I19A 2QDIA 1SCMC 5H89A 1ZFSA 4ANJA 1CB1A 2DD7A 2BBNA 2H5QA 3O78A 4JPZB 1IRJA 2GW3A 4GUKA 4HVFA 4LJDA 1SK6D 1Q4CA 3SG6A 2B3PA 1SKTA 1ZUXA 4GGFC 1JFKA 1YURA 2JPTA 3GK2A 3ED8A 2BKHB 2Q57A 4UPGA 1HQVA 3GB3A 3SIBA 3KHEA 4W7RA 1IG5A 1LKJA 2Y1MA 5LTRA 3D0YB 1ZGOA 1HT9A 1FI5A 1F0BA 3LK0A 3JTDC 1C3YA 1B8RA 1NWDA 3DD4A 5AFPA 2WCKA 4R6DA 1U5IB 1S3PA 5EB7A 4W6SA 1ALVA 2A48A 1KK8B 1ZUZA 1KFUL 2DUFA 1WDCB 4HREE 1JUOA 4W6AA 4FQOA 1BU3A 1UHIA 2PVBA 4J8AA 2A4JA 3SVOA 3WNXB 5DICA 4M2QA 3NXAA 1JBAA 1BR4B 1A2XA 4IK9A 2CCMA 2G5ZB 2HGDA 3ST4A 3U0KA 1MF8B 2JNXA 2HRSA 2AMIA 1IIOA 1OOGA 4TZGA 2QU1A 1XVJA 3OX6A 1QX2A 3CFHA 3L4LA 2ERBA 3S05A 4Z4KA 2ZO6A 4YBHB 3VICA 2Z6XA 1XYDA 1B7TY 4OVNF 2K2FA 1DF0B 1Z1PA 2LUCA 1CFFA 2LANA 2VVHA 2LMUA 2M29A 2JADA 4OGSA 5I2OA 2WCHA 2EC6C 2AAOA 2M97A 1CMGA 3SVEA 3AI5A 2LCPA 2LLSA 4CFRA 1QXPA 2HPWA 1PVAA 1PVBA 1F70A 1CFCA 3OSQA 2LV7A 3S0DA 1SL9A 1TWOA 4PPKA 3S0BA 4AS8A 3VHTA 3TDZA 3CD1A 3CBEA 1XSSA 1EXRA 1V1FA 5FI2A 2GX2A 3SSVA 2BTJA 1DGVA 2RGIA 1IQ5A 3BOWB 1DJZA 3OGOA 1K8UA 2Y0GA 5DPJA 2ZFDA 2JRFA 2WHTA 2P4MA 3DQIA 1PRWA 2DDDA 1SNLA 2WC8A 5EXBA 1YJFA 3RM1A 1H4BA 2DOQA 5AXIA 2JXLA 2LUXA 4Q9XA 1DJHA 1KK7Z 2DD9A 4INWA 2AUCA 4NWSA 2F3YA 1AK8A 3ST0A 4F7FA 3CYZA 1A75B 2HPSA 2WISA 3U8CA 4YGAA 5EXCI 1GQMA 2VVIA 1EG3A 2NLNA 3TDIA 2ZKMX 4GGFA 3KF9A 5KTGA 5HZSA 1KWOC 1LA3A 2PRUA 1F4QA 3CLNA 3E3RA 2KI6C 1DMOA 4PE7A 2FCDA 3NSLA 2BCXA 1FF1A 1OOJA 3BYAA 2LVVA 1DJYA 1OMRA 3BUWB 2PXSA 3WXAA 2WCJA 1TNPA 2JOJA 2LLUA 4KF4A 1QATA 2ISDA 2K8MB 1M63B 3UO9A 1TNQA 2F2PA 3GJ1A 2KI6D 1C4FA 4H47A 3BJHA 5DPGA 2IE2A 1K2HA 2FL1A 1IJ5A 4MRYA 3IR8A 4JEOA 3GEXA 3B7AA 4CIDA 2CNPA 4KF5C 1YFPA 1XFYO 1F71A 1EMGA 1VRKA 4HQCA 4ORCB 3DF0A 1DQEA 3HCMA 3LF3A 1Y1XA 1SYMA 1QX7A 3RWTA 2OS8B 1BFPA 1TUZA 1TN4A 5KU1A 2Y1NA 4IK5A 1SR6C 2KAVA 1UHHA 4LQTA 2M8UA 4E68A 5DRFA 3VRQA 2OTGC 1N0YA 3DQ6A 5KTYA 4AQIA 2KLDA 4XOVA 5ER4X 4MLWA 3WLCA 1BLQA 2WNDA 1CM1A 4GBAA 4BDUA 4LJCA 1TCFA 3Q8IA 4YGDB 2YGUA 3PFVA 3CGAA 1DT7B 4TZAA 4IK8A 3D10A 3R1PA 4L1IA 4PE1A 2MLEC 3SS0A 1SL8A 1QYQA 1K9UA 1CNPA 1S5GY 4GFTA 4Z4MA 1CLBA 1YR5A 1RWYA 3M0WA 2WCBA 4BY5A 2CT9A 3SVSA 1XA5A 3DQNA 1L2OB 3WHUB 1B8CA 2JNFA 3KPXA 4FTGA 1RJVA 2G3DB 2L2CA 3DQ8A 1LVCD 3TS5B 3DQ2A 2NCPA 3DQ5A 4W75A 1RFJA 1RROA 3D77A 3DVMA 4AR7A 3NSIA 4R1EA 3DPXA 4EULA 3OX5A 1LXFC 1MR8A 3CTNA 4JRBA 1WY9A 1B7TZ 4ZCUA 3DPZA 3NEDA 2BAPA 3U0LA 1EMCA 1Q4DA 2WCLA 3F45A 2E30A 4YI9A 2QPTA 4M2PA 4OZDA 2H6VA 2H61C 1BR1B 2H8QA 2CXJA 5LK4A 4XL5A 1SRAA 3CWGA 1MOUA 1YHGA 3CZ1A 2L2EA 3LVAA 1AJ4A 2KYFA 3SSLA 1QVIZ 3CFFA 4W7XA 1DC1A 1QTXA 1B4CA 4I2YA 3W1CA 5H87A 1QASA 4RYSA 2VADA 1GL4A 3P8UA 4OHSA 2QLEA 4LJBA 3IP2A 1JSAA 2PSRA 2I94A 2IB5A 3SSTA 3DQKA 1CM4A 4I5KA 1QXTA 3PALA 2EMNA 1Q4EA 4Q04A 1C3ZA 3LA1A 2M3WA 5EHUA 4IZNA 1UUSA 1OOIX 1T14A 5DKNA 4H3MA 1AHRA 3OGNA 1XFZO 4C0KA 3B6XA 2KFGA 4NDDA 4KF5A 4LW5A 2QEHA 1MUXA 1DJXA 4DCKA 4DXOA 1Y0VH 2PASA 3BXKA 3RZSA 3JVTB 3O2PA 1RRXA 4XJKA 4HRHA 2AWKA 4H3LA 3DQ7A 1GGXA 1J7QA 3SVCA 3BUXB 2LMVA 2NZ0A 1SCVA 1IWQA 5FYXA 2B3QA 4ZF4A 1CDLA 1PALA 1OQPA 1UURA 1R2UA 5EJUA 2HFCA 4ZIOA 2BNXA 3I5FC 2AWMA 3PJBA 3BFBA 1J7PA 3PJ7A 3LS3A 1Y1UA 4U8DA 3CFAA 3EK4A 5I2LA 2KGRA 4DXNA 1YUTA 2H9WA 5DTLA 3VROA 2WHSA 3LSAA 1MXLC 1XFUO 4W6HA 2LP2A 5EB6A 4JD9A 3ZTFA 1SMGA 3PN7C 1OE9B 4EDSA 1NX2A 3PJIA 5KSZA 3AKOA 1QV1A 1A03A 2KAYA 2P70A 2WCMA 3KCSA 2FZUA 1XFWO 1JF0A 3DQAA 2DUGA 3A8SA 3MSEB 1RTP1 3NT9A 3V3DA 1GJYA 4QJ4B 3WHTB 1BT6A 1CDMA 2QEVA 5J2OA 1ZGPA 2OS8C 1XFRA 1W7IB 4P1QA 5BQLA 4PCWA 2ARLA 4W7EA 1YUSA 2Q91A 5PALA 4MZJA 3DQOA 1M46A 2VAEA 1B9CA 2A50B 2V4EC 2H61A 3SVRA 5DPHA 2L51A 3FWBA 4GGNA 3RWAA 2HQWA 2JT3A 1FPWA 1PK0D 5GQQC 1SSEB 3NGVA 2V53A 5I2QA 4PHMA 5HZOA 1ZMZA 1M45A 2ZNDA 4I5NB 1XFVO 3O4XA 1C07A 4AQJA 1V1GA 2Y4QA 3M24A 2LHLA 3I5IC 1NYAA 3ZUFA 2AHAA 3TMTA 2OKWA 1JC1A 1XMZA 1JF2A 4QJ5B 2ZO7A 1KQMB 2A54B 1BOCA 3H1OA 2LHIA 3K1EA 1BF5A 3BUNB 1W7TA 4DXIA 2H5OA 4W6UA 1TNWA 1IGVA 4USLA 2KBIA 1IH0A 5G08A 2C9IA 2PXWA 2I2RE 2R2IA 3CABA 4DXPA 4JWQA 2Z6YA 4I5JA 5HYDA 2LMTA 1YX7A 1OXFA 3GJ2A 3ZULA 1XFXO 2LC5A 1C7WA 2HQKA 1H8BA 5AANA 3SG3A 3CZTX 1NX1A 1K93D 3DQ9A 2PQLA 2L0PA 3SS3A 5EL2A 5HZTA 3NHTA 1LA0A 1PSBA 2CTNA 1SW8A 3AAKA 4EN1A 1OZSA 1CLMA 3DYEA 4N1GA 2QLIA 2Z6ZA 4W6TA 2KFHA 3DQ3A 3OP0A 1AP4A 3FE8A 1JC0A 4P76A 2NCOA 2H5PA 5AQBB 4P5OE 3KCTA 3DQLA 3SG4A 3BXAA 3DZTA 4ORNA 3VHTB 2O24A 4ZBLA 1G4YR 2JZIA 2JXCA 2K7OA 4A4BA 1LS8A 2JU0A 2EMDA 2G9BA 3NSOA 4OJ0A 4KEXA 1XA9A 2GGMA 3BX9A 1H6RA 1NSHA 5CPVA 3SV5A 1QLKA 1TTXA 1KSOA 3DQ4A 2G2BA 1ORGA 3WLDA 2JTTA 4N3DA 4B30A 2MRDA 5FVFA 3UNWA 2OPOA 4F0ZB 1DVIA 1MYWA 5HGEA 2KAXA 2KNEA 2ZMWA 3CB9A 1Z1QA 1Q4BA 2F2OA 1PSRA 1RMOA 1YJ2A 3CZ0A 1UISA 2LM5A 1SCMB 2E6WA 3PLFB 3DPWA 1YHIA 3BXCA 1G33A 3SSHA 2WORA 4N1FA 1B9AA 5DKRA 1EMMA 2FJUB 1YTZC 2LVIA 2DUEA 2F8PA 4TNCA 1ZOTB 2KI4C 2VRGA 3B87A 3R72A 2QLHA 4C0LA 3I5HB 2V4EA 3S0GA 1JC2A 1MQ1A 3A8RA 3DQEA 2O2BA 1GFLA 5CSNA
chains in the Genus database with same CATH topology
4MSPA 1KSMA 4DXMA 1ODBA 3JTDB 3A4UB 1S6IA 5HLOA 2HJOA 2Q4UA 1LINA 3BUOB 3VRNA 1Q80A 1JBZA 4DXQA 4ETOA 2PMYA 2AWLA 5F6TA 2A47A 5BTTA 2COLB 4W6LA 4MZKA 3U8AA 3EK8A 3DF0B 4W6FA 2K7BA 1Q73A 4KGEA 4IK1A 1F55A 2HGYA 4HRGA 1MOVA 3DQUA 3E5VA 1XAEA 2QT2A 4PDZA 1SBJA 4OCIA 1W7UA 4Q7RA 4W6RA 4GF6B 2LAPA 3DQJA 1NX3A 4H3NA 5LTPA 2LVJA 2WSNA 3SG2A 4GESB 3CR4X 4W6NA 3ICBA 5HZUA 3KO0A 1FBVA 1CMFA 1KK8C 2RH7A 4W7CA 2MLFC 4ZF3A 3LL8B 4Q9WA 4QJ3B 1W7JB 1WDCC 2LE9B 1YVHA 3GOFA 1XQMA 1UHJA 1B8LA 1SY9A 5DQBA 4W73A 3GK1A 4ZB1A 2Y5IA 4KPIA 2EC6B 4W6JA 2D8NA 2MA2A 4YGEB 1QX5B 4OV2A 5K89A 2VZXA 1RMPA 1CDNA 2KQYA 1F09A 2K2AA 3O4YA 2QLGA 4ZINA 4W6BA 1IJ6A 5DTXA 1E8AA 1BJFA 2WCEA 1TIZA 4OR9B 4EDOA 2KBMA 1F8HA 1CV7A 1BG1A 4M2OA 4MN0A 3SRYA 5DU0A 1JBYA 3PSRA 3ZNIA 1K94A 5HKYA 2BL0B 2L4IA 4J89A 3NT3A 3NSKA 1ZGQA 4W7FA 4P2YB 1DJWA 2IB6A 2HQ8A 2A56B 4PE0A 1DGUA 1CFDA 1KFXL 3OHMB 4R6BA 1HUYA 3PIBA 4BY4A 4KW8A 2ZN8A 3ZUJA 3EVVA 3W1DA 3EKHA 1KWOB 3SVNA 1KK7Y 4GNKB 3U0MA 2JTZA 3I5GB 4DS7A 3CGLA 1EG4A 4MRXA 2O60A 4ORBB 4NDBA 3RLZA 4MVFA 1UWOA 5HKWA 1MXEA 2L4HA 2HQZA 2JQ6A 4HSZA 1MHOA 3OB1B 2MBXA 2DDCA 3VRRA 2OTEA 4YRUA 1EL4A 1WLMA 5HKZA 3TUYB 5JOLA 1L7ZA 1QIWA 1DJGA 2PALA 1QJTA 4XJKB 3WCKA 2M9GA 1D1OA 1OXEA 2BKIB 4KW9A 1K90D 4HQ8A 3D0YA 5T3IA 1R6PA 1TRFA 1SR6B 3PJ5A 2VVJA 1TCOB 1Q4AA 2OTGB 3M22A 2G6YA 1U5IA 3VK1A 3UG0A 3DQ1A 4H48A 2QACA 4ICBA 4J88A 2JT8A 2L50A 2WIQA 3I5HC 2P6BB 4W6GA 4W72A 1FI6A 3NEZA 1KYRA 3BQ3A 2L98A 2O5GA 5ER5A 5D69A 3P28A 1J7RA 5HLVA 1FW4A 1EMBA 1KFUS 1EH2A 1ALWA 1OMVA 1G7KA 1OSAA 3BUMB 1JFJA 3SIAA 3E5WA 1X02A 2H2KA 1PULA 1S5GZ 4JC2A 5FHVA 1UHKA 2KYCA 3ST3A 4W6CA 1DF0A 1M39A 5IBWA 5I8NA 4W7AA 3H1RA 5CSIA 2KSPA 4PPLA 1HCJA 2DUIA 3PM8A 1XK4C 1M31A 5DKQA 4CLNA 2F33A 5BT0A 1RECA 1WRZA 1KP5A 3GK4X 4L9MA 2I18A 2OTBA 4MEWA 2KFFA 2EMOA 1G8IA 1YUUA 1QYFA 4XOWA 5EXUA 4B5YA 2IOVA 2K7CA 3ADFA 3FWCA 1L2OC 3SVBA 3EVUA 2MAZA 4W69A 2JC2A 5D7FA 1NCZA 3TS5C 2BECA 3AI4A 3K21A 2JT0A 3SG5A 1S6JA 2HCGA 1K9KA 3CD9A 3K1KA 3SSPA 2K7DA 1H4UA 4EMQA 3TZ1A 4DUQA 3BOWA 4OKHA 5HBDA 2CBLA 1NIWA 4GPLB 1UP5A 1EJ3A 3NF0A 4YGBB 4XGYA 1QVIY 2LVKA 1OZOA 5FVGA 3DQMA 1SPYA 1WRKA 3C1VA 2KOTA 5BPJA 3H4SE 1A75A 4YGCB 2DUHA 4YI8A 4PFEA 1YRUB 4JGEA 1YVLA 1CKKA 2B1UA 1OMDA 2LNKA 4NDCA 3CR5X 3UFZA 4PPJA 1NP8A 1TNXA 5DY6A 1TOPA 3IF7A 4Q7UA 3EVRA 2HF5A 2Q6PA 5TNCA 3SSYA 2BL0C 4IK3A 1A4PA 1B47A 2BE4A 5AEQA 1XO5A 4KAGA 1NPQA 2LP3A 1NCYA 2JWWA 4L13A 1WRLA 4WQ3A 1CFPA 1YHHA 4IK4A 2OGRA 1N2DA 1JWDA 4N5XA 2SASA 1CTRA 1AUIB 3I5FB 3AKBA 1BMOA 4LQUA 3DVEA 3DQFA 3JVTC 2ZN9A 2ZMUA 5H88A 4ZF5A 2I7AA 1GGZA 4L12A 4W6PA 1EMFA 3DVJA 3DVKA 2TN4A 4C0JA 4U2VA 2BCAA 2MJWB 3MGFA 3I5GC 3SG7A 1KYPA 5DPIA 1Y1AA 2C9JA 4RTCA 3PN7B 1DJIA 4HQ9A 4Q7TA 3KEVA 3G9AA 1MWNA 4MBEA 4WRIA 5DQMA 2Z1OA 4JFGA 3SSKA 1EMEA 4KW4A 4B30B 5EBJA 2EGDA 4IL1A 4PHNA 1BODA 2KGBC 3BXBA 5CSFA 3TUYC 4CFQA 2KHNA 2YFPA 3AAJA 2ZRSA 4CPVA 4KA9A 1ZACA 1SL7A 3LF4B 1NX0A 1KCYA 3VGOA 2GGZA 1C7VA 1XK4A 4W74A 1RM9A 2M7NA 3ZWHA 2SCPA 5J3XA 2G3OA 1NUBA 4W7DA 1F4OA 2M0RA 4GOBA 2V4EB 3TDUA 2IS9A 3FIAA 2K0JA 3OB2B 2M1UA 1J55A 4DRWA 3EK7A 4ORAB 2ICRA 1QS7A 4I5LB 1S6ZA 4AOMA 2POXA 4PE4A 1W7SA 2OJKA 1S6CA 4D1EA 2WOSA 5F9GA 3I5IB 2M7LA 3SVDA 3QRXA 3O6BA 4LJDC 4MZLA 1AVSA 5DRGA 5BTTB 4PHJA 4OY4A 2AH8A 2WSOA 4PHKA 4W6KA 1KYSA 3FS7A 1IQ3A 2FCEA 2G2SB 2JULA 1RMMA 4W6DA 2A46A 1KQVA 3TMRA 3IQOA 3O77A 5B8IB 3HX4A 1J7OA 4JF9A 2MHHA 1S1EA 4JQ0D 2KDHA 2OKYA 3EKJA 2KQ6A 1K9PA 2G6XA 3CS1A 3LCPC 1EMLA 2YE0A 1NCXA 1WLZA 5DTZA 2GX0A 1CDPA 3SVUA 3LLEA 1CLLA 2FWQA 2K61A 2LLTA 1KQMC 1Y6WA 2A52B 2WURA 4HE4A 5FVIA 1RK9A 2NXQA 2HETA 3OSRA 3ST2A 1QY3A 4UTSA 2L5XB 3U0NA 3U8PA 3DQHA 2QRFA 2BCBA 3DQCA 3AKAA 1J1DA 4OQWA 1YRTB 4ZFSA 3LK1A 1IKUA 3DQDA 1EMKA 4WQ2A 4KGFA 2FOTA 1A29A 4DKNA 2QLGB 1AJ5A 3GL4A 1YZWA 5HW9A 1KFXS 3VRPA 2GW4B 3LVDA 4W76A 4XVPA 4GAOA 3PATA 2ZNEA 4A4CA 2O29A 4W77A 1QIVA 1QYOA 2QZ0A 2YE1A 1S26D 2YDZA 4DKMA 1OXDA 2M1KB 4PALA 1F54A 2G16B 2GV5A 3EVPA 1S36A 4RYWA 4W6MA 4W6IA 5CSJA 3IQQA 1EMAA 2BBMA 1J1EA 4NQGA 1YX8A 2F3ZA 2AWJA 4W6OA 5AERA 2A53B 2WHUA 2EHBA 1B1GA 1K96A 2ZRTA 2H5RA 1UHNA 5DTYA 2KI4B 3LVCA 3E5TA 1QLSA 1QV0A 2M49B 3CR2A 3SJSA 1N65A 4XYNA 1DTLA 2WCFA 1K95A 5JJGA 4DIRA 5LTQA 1GGWA 2BE6A 4ZCVA 2G6EA 3I19A 1SCMC 5H89A 1ZFSA 4ANJA 1CB1A 2DD7A 2BBNA 2H5QA 3O78A 4JPZB 1IRJA 2GW3A 4GUKA 4HVFA 4LJDA 1SK6D 1Q4CA 3SG6A 2B3PA 1SKTA 1ZUXA 4GGFC 1JFKA 1YURA 2JPTA 3GK2A 3ED8A 2BKHB 2Q57A 4UPGA 1HQVA 3GB3A 3SIBA 3KHEA 4W7RA 1IG5A 1LKJA 2Y1MA 5LTRA 3D0YB 1ZGOA 1HT9A 1FI5A 1F0BA 3LK0A 3JTDC 1B8RA 1NWDA 3DD4A 5AFPA 4R6DA 1U5IB 1S3PA 5EB7A 4W6SA 1ALVA 2A48A 1KK8B 1ZUZA 1KFUL 2DUFA 1WDCB 4HREE 1JUOA 4W6AA 4FQOA 1BU3A 1UHIA 2PVBA 4J8AA 2A4JA 3SVOA 3WNXB 4M2QA 3NXAA 1JBAA 1BR4B 1A2XA 4IK9A 2CCMA 2G5ZB 2HGDA 3ST4A 3U0KA 1MF8B 2JNXA 2HRSA 2AMIA 4TZGA 2QU1A 1XVJA 3OX6A 1QX2A 3CFHA 3S05A 4Z4KA 2ZO6A 4YBHB 3VICA 2Z6XA 1XYDA 1B7TY 4OVNF 2K2FA 1DF0B 1Z1PA 2LUCA 1CFFA 2LANA 2VVHA 2LMUA 2M29A 2JADA 4OGSA 5I2OA 2EC6C 2AAOA 2M97A 1CMGA 3SVEA 3AI5A 2LCPA 2LLSA 4CFRA 1QXPA 2HPWA 1PVAA 1PVBA 1F70A 1CFCA 3OSQA 2LV7A 1SL9A 4PPKA 4AS8A 3VHTA 3TDZA 3CD1A 3CBEA 1XSSA 1EXRA 1V1FA 2GX2A 3SSVA 2BTJA 1DGVA 2RGIA 1IQ5A 3BOWB 1DJZA 3OGOA 1K8UA 2Y0GA 5DPJA 2ZFDA 2JRFA 2WHTA 2P4MA 3DQIA 1PRWA 2DDDA 1SNLA 2WC8A 5EXBA 1YJFA 3RM1A 1H4BA 2DOQA 5AXIA 2JXLA 2LUXA 4Q9XA 1DJHA 1KK7Z 2DD9A 2AUCA 4NWSA 2F3YA 1AK8A 3ST0A 1A75B 2HPSA 2WISA 3U8CA 4YGAA 5EXCI 1GQMA 2VVIA 1EG3A 2NLNA 3TDIA 2ZKMX 4GGFA 3KF9A 5KTGA 5HZSA 1KWOC 1LA3A 2PRUA 1F4QA 3CLNA 3E3RA 2KI6C 1DMOA 4PE7A 2FCDA 3NSLA 2BCXA 1FF1A 1OOJA 3BYAA 2LVVA 1DJYA 1OMRA 3BUWB 2PXSA 3WXAA 1TNPA 2JOJA 2LLUA 4KF4A 1QATA 2ISDA 2K8MB 1M63B 1TNQA 2F2PA 3GJ1A 2KI6D 1C4FA 4H47A 5DPGA 2IE2A 1K2HA 2FL1A 1IJ5A 4MRYA 3IR8A 4JEOA 3GEXA 4CIDA 2CNPA 4KF5C 1YFPA 1XFYO 1F71A 1EMGA 1VRKA 4HQCA 4ORCB 3DF0A 3HCMA 3LF3A 1Y1XA 1SYMA 1QX7A 3RWTA 2OS8B 1BFPA 1TN4A 5KU1A 2Y1NA 4IK5A 1SR6C 2KAVA 1UHHA 4LQTA 2M8UA 4E68A 5DRFA 3VRQA 2OTGC 1N0YA 3DQ6A 5KTYA 4AQIA 4XOVA 5ER4X 4MLWA 3WLCA 1BLQA 2WNDA 1CM1A 4GBAA 4BDUA 4LJCA 1TCFA 4YGDB 3PFVA 3CGAA 1DT7B 4TZAA 4IK8A 3D10A 4L1IA 4PE1A 2MLEC 3SS0A 1SL8A 1QYQA 1K9UA 1CNPA 1S5GY 4GFTA 4Z4MA 1CLBA 1YR5A 1RWYA 3M0WA 2WCBA 4BY5A 2CT9A 3SVSA 1XA5A 3DQNA 1L2OB 3WHUB 1B8CA 2JNFA 3KPXA 4FTGA 1RJVA 2G3DB 3DQ8A 1LVCD 3TS5B 3DQ2A 2NCPA 3DQ5A 4W75A 1RFJA 1RROA 3DVMA 4AR7A 3NSIA 4R1EA 3DPXA 4EULA 3OX5A 1LXFC 1MR8A 3CTNA 4JRBA 1WY9A 1B7TZ 4ZCUA 3DPZA 3NEDA 3U0LA 1EMCA 1Q4DA 3F45A 2E30A 4YI9A 2QPTA 4M2PA 2H6VA 2H61C 1BR1B 2H8QA 2CXJA 5LK4A 4XL5A 1SRAA 3CWGA 1MOUA 1YHGA 2L2EA 3LVAA 1AJ4A 2KYFA 3SSLA 1QVIZ 3CFFA 4W7XA 1QTXA 1B4CA 4I2YA 3W1CA 5H87A 1QASA 4RYSA 2VADA 1GL4A 3P8UA 4OHSA 2QLEA 4LJBA 3IP2A 1JSAA 2PSRA 2I94A 2IB5A 3SSTA 3DQKA 1CM4A 4I5KA 1QXTA 3PALA 2EMNA 1Q4EA 4Q04A 3LA1A 2M3WA 5EHUA 4IZNA 1UUSA 5DKNA 4H3MA 1AHRA 1XFZO 4C0KA 2KFGA 4NDDA 4KF5A 4LW5A 1MUXA 1DJXA 4DCKA 4DXOA 1Y0VH 2PASA 3BXKA 3JVTB 3O2PA 1RRXA 4XJKA 4HRHA 2AWKA 4H3LA 3DQ7A 1GGXA 1J7QA 3SVCA 3BUXB 2LMVA 2NZ0A 1SCVA 1IWQA 5FYXA 2B3QA 4ZF4A 1CDLA 1PALA 1OQPA 1UURA 1R2UA 5EJUA 2HFCA 4ZIOA 3I5FC 2AWMA 3PJBA 1J7PA 3PJ7A 3LS3A 1Y1UA 4U8DA 3CFAA 3EK4A 5I2LA 2KGRA 4DXNA 1YUTA 2H9WA 5DTLA 3VROA 2WHSA 3LSAA 1MXLC 1XFUO 4W6HA 2LP2A 5EB6A 3ZTFA 1SMGA 3PN7C 1OE9B 4EDSA 1NX2A 5KSZA 3AKOA 1QV1A 1A03A 2KAYA 3KCSA 2FZUA 1XFWO 1JF0A 3DQAA 2DUGA 3A8SA 3MSEB 1RTP1 3NT9A 3V3DA 1GJYA 4QJ4B 3WHTB 1BT6A 1CDMA 5J2OA 1ZGPA 2OS8C 1W7IB 4P1QA 5BQLA 4PCWA 2ARLA 4W7EA 1YUSA 2Q91A 5PALA 4MZJA 3DQOA 1M46A 2VAEA 1B9CA 2A50B 2V4EC 2H61A 3SVRA 5DPHA 2L51A 3FWBA 4GGNA 3RWAA 2HQWA 2JT3A 1FPWA 1PK0D 5GQQC 2V53A 5I2QA 4PHMA 5HZOA 1ZMZA 1M45A 2ZNDA 4I5NB 1XFVO 1C07A 4AQJA 1V1GA 2Y4QA 3M24A 2LHLA 3I5IC 1NYAA 3ZUFA 2AHAA 3TMTA 2OKWA 1JC1A 1XMZA 1JF2A 4QJ5B 2ZO7A 1KQMB 2A54B 1BOCA 3H1OA 2LHIA 1BF5A 3BUNB 1W7TA 4DXIA 2H5OA 4W6UA 1TNWA 1IGVA 4USLA 2KBIA 1IH0A 5G08A 2C9IA 2PXWA 2I2RE 2R2IA 4DXPA 4JWQA 2Z6YA 4I5JA 5HYDA 2LMTA 1YX7A 1OXFA 3GJ2A 3ZULA 1XFXO 2LC5A 1C7WA 2HQKA 1H8BA 5AANA 3SG3A 3CZTX 1NX1A 1K93D 3DQ9A 2L0PA 5HZTA 1LA0A 1PSBA 2CTNA 1SW8A 3AAKA 4EN1A 1OZSA 1CLMA 4N1GA 2QLIA 2Z6ZA 4W6TA 2KFHA 3DQ3A 3OP0A 1AP4A 1JC0A 4P76A 2NCOA 2H5PA 5AQBB 4P5OE 3KCTA 3DQLA 3SG4A 3BXAA 4ORNA 3VHTB 2O24A 4ZBLA 1G4YR 2JZIA 2JXCA 2K7OA 4A4BA 2JU0A 2EMDA 2G9BA 3NSOA 4OJ0A 4KEXA 1XA9A 2GGMA 3BX9A 1H6RA 1NSHA 5CPVA 3SV5A 1QLKA 1TTXA 1KSOA 3DQ4A 2G2BA 3WLDA 2JTTA 4N3DA 4B30A 2MRDA 5FVFA 2OPOA 4F0ZB 1DVIA 1MYWA 5HGEA 2KAXA 2KNEA 2ZMWA 3CB9A 1Z1QA 1Q4BA 2F2OA 1PSRA 1RMOA 1YJ2A 1UISA 2LM5A 1SCMB 2E6WA 3PLFB 3DPWA 1YHIA 3BXCA 1G33A 3SSHA 2WORA 4N1FA 1B9AA 5DKRA 1EMMA 2FJUB 1YTZC 2LVIA 2DUEA 2F8PA 4TNCA 1ZOTB 2KI4C 2VRGA 2QLHA 4C0LA 3I5HB 2V4EA 1JC2A 1MQ1A 3A8RA 3DQEA 2O2BA 1GFLA 5CSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSP A;  1KSM A;  4DXM A;  1ODB A;  3JTD B;  3A4U B;  1S6I A;  5HLO A;  2HJO A;  2Q4U A;  1LIN A;  3BUO B;  3VRN A;  1Q80 A;  1JBZ A;  4DXQ A;  4ETO A;  2PMY A;  2AWL A;  5F6T A;  2A47 A;  5BTT A;  2COL B;  4W6L A;  4MZK A;  3U8A A;  3EK8 A;  3DF0 B;  4W6F A;  2K7B A;  1Q73 A;  4KGE A;  4IK1 A;  1F55 A;  2HGY A;  4HRG A;  1MOV A;  3DQU A;  3E5V A;  1XAE A;  2QT2 A;  4PDZ A;  1SBJ A;  4OCI A;  1W7U A;  4Q7R A;  4W6R A;  4GF6 B;  2LAP A;  3DQJ A;  1NX3 A;  4H3N A;  5LTP A;  2LVJ A;  2WSN A;  3SG2 A;  4GES B;  3CR4 X;  4W6N A;  3ICB A;  5HZU A;  3KO0 A;  1FBV A;  1CMF A;  1KK8 C;  2RH7 A;  4W7C A;  2MLF C;  4ZF3 A;  3LL8 B;  4Q9W A;  4QJ3 B;  1W7J B;  1WDC C;  2LE9 B;  1YVH A;  3GOF A;  1XQM A;  1UHJ A;  1B8L A;  1SY9 A;  5DQB A;  4W73 A;  3GK1 A;  4ZB1 A;  2Y5I A;  4KPI A;  2EC6 B;  4W6J A;  2D8N A;  2MA2 A;  4YGE B;  1QX5 B;  4OV2 A;  5K89 A;  2VZX A;  1RMP A;  1CDN A;  2KQY A;  1F09 A;  2K2A A;  3O4Y A;  2QLG A;  4ZIN A;  4W6B A;  1IJ6 A;  5DTX A;  1E8A A;  1BJF A;  2WCE A;  1TIZ A;  4OR9 B;  4EDO A;  2KBM A;  1F8H A;  1CV7 A;  1BG1 A;  4M2O A;  4MN0 A;  3SRY A;  5DU0 A;  1JBY A;  3PSR A;  3ZNI A;  1K94 A;  5HKY A;  2BL0 B;  2L4I A;  4J89 A;  3NT3 A;  3NSK A;  1ZGQ A;  4W7F A;  4P2Y B;  1DJW A;  2IB6 A;  2HQ8 A;  2A56 B;  4PE0 A;  1DGU A;  1CFD A;  1KFX L;  3OHM B;  4R6B A;  1HUY A;  3PIB A;  4BY4 A;  4KW8 A;  2ZN8 A;  3ZUJ A;  3EVV A;  3W1D A;  3EKH A;  1KWO B;  3SVN A;  1KK7 Y;  4GNK B;  3U0M A;  2JTZ A;  3I5G B;  4DS7 A;  3CGL A;  1EG4 A;  4MRX A;  2O60 A;  4ORB B;  4NDB A;  3RLZ A;  4MVF A;  1UWO A;  5HKW A;  1MXE A;  2L4H A;  2HQZ A;  2JQ6 A;  4HSZ A;  1MHO A;  3OB1 B;  2MBX A;  2DDC A;  3VRR A;  2OTE A;  4YRU A;  1EL4 A;  1WLM A;  5HKZ A;  3TUY B;  5JOL A;  1L7Z A;  1QIW A;  1DJG A;  2PAL A;  1QJT A;  4XJK B;  3WCK A;  2M9G A;  1D1O A;  1OXE A;  2BKI B;  4KW9 A;  1K90 D;  4HQ8 A;  3D0Y A;  5T3I A;  1R6P A;  1TRF A;  1SR6 B;  3PJ5 A;  2VVJ A;  1TCO B;  1Q4A A;  2OTG B;  3M22 A;  2G6Y A;  1U5I A;  3VK1 A;  3UG0 A;  3DQ1 A;  4H48 A;  2QAC A;  4ICB A;  4J88 A;  2JT8 A;  2L50 A;  2WIQ A;  3I5H C;  2P6B B;  4W6G A;  4W72 A;  1FI6 A;  3NEZ A;  1KYR A;  3BQ3 A;  2L98 A;  2O5G A;  5ER5 A;  5D69 A;  3P28 A;  1J7R A;  5HLV A;  1FW4 A;  1EMB A;  1KFU S;  1EH2 A;  1ALW A;  1OMV A;  1G7K A;  1OSA A;  3BUM B;  1JFJ A;  3SIA A;  3E5W A;  1X02 A;  2H2K A;  1PUL A;  1S5G Z;  4JC2 A;  5FHV A;  1UHK A;  2KYC A;  3ST3 A;  4W6C A;  1DF0 A;  1M39 A;  5IBW A;  5I8N A;  4W7A A;  3H1R A;  5CSI A;  2KSP A;  4PPL A;  1HCJ A;  2DUI A;  3PM8 A;  1XK4 C;  1M31 A;  5DKQ A;  4CLN A;  2F33 A;  5BT0 A;  1REC A;  1WRZ A;  1KP5 A;  3GK4 X;  4L9M A;  2I18 A;  2OTB A;  4MEW A;  2KFF A;  2EMO A;  1G8I A;  1YUU A;  1QYF A;  4XOW A;  5EXU A;  4B5Y A;  2IOV A;  2K7C A;  3ADF A;  3FWC A;  1L2O C;  3SVB A;  3EVU A;  2MAZ A;  4W69 A;  2JC2 A;  5D7F A;  1NCZ A;  3TS5 C;  2BEC A;  3AI4 A;  3K21 A;  2JT0 A;  3SG5 A;  1S6J A;  2HCG A;  1K9K A;  3CD9 A;  3K1K A;  3SSP A;  2K7D A;  1H4U A;  4EMQ A;  3TZ1 A;  4DUQ A;  3BOW A;  4OKH A;  5HBD A;  2CBL A;  1NIW A;  4GPL B;  1UP5 A;  1EJ3 A;  3NF0 A;  4YGB B;  4XGY A;  1QVI Y;  2LVK A;  1OZO A;  5FVG A;  3DQM A;  1SPY A;  1WRK A;  3C1V A;  2KOT A;  5BPJ A;  3H4S E;  1A75 A;  4YGC B;  2DUH A;  4YI8 A;  4PFE A;  1YRU B;  4JGE A;  1YVL A;  1CKK A;  2B1U A;  1OMD A;  2LNK A;  4NDC A;  3CR5 X;  3UFZ A;  4PPJ A;  1NP8 A;  1TNX A;  5DY6 A;  1TOP A;  3IF7 A;  4Q7U A;  3EVR A;  2HF5 A;  2Q6P A;  5TNC A;  3SSY A;  2BL0 C;  4IK3 A;  1A4P A;  1B47 A;  2BE4 A;  5AEQ A;  1XO5 A;  4KAG A;  1NPQ A;  2LP3 A;  1NCY A;  2JWW A;  4L13 A;  1WRL A;  4WQ3 A;  1CFP A;  1YHH A;  4IK4 A;  2OGR A;  1N2D A;  1JWD A;  4N5X A;  2SAS A;  1CTR A;  1AUI B;  3I5F B;  3AKB A;  1BMO A;  4LQU A;  3DVE A;  3DQF A;  3JVT C;  2ZN9 A;  2ZMU A;  5H88 A;  4ZF5 A;  2I7A A;  1GGZ A;  4L12 A;  4W6P A;  1EMF A;  3DVJ A;  3DVK A;  2TN4 A;  4C0J A;  4U2V A;  2BCA A;  2MJW B;  3MGF A;  3I5G C;  3SG7 A;  1KYP A;  5DPI A;  1Y1A A;  2C9J A;  4RTC A;  3PN7 B;  1DJI A;  4HQ9 A;  4Q7T A;  3KEV A;  3G9A A;  1MWN A;  4MBE A;  4WRI A;  5DQM A;  2Z1O A;  4JFG A;  3SSK A;  1EME A;  4KW4 A;  4B30 B;  5EBJ A;  2EGD A;  4IL1 A;  4PHN A;  1BOD A;  2KGB C;  3BXB A;  5CSF A;  3TUY C;  4CFQ A;  2KHN A;  2YFP A;  3AAJ A;  2ZRS A;  4CPV A;  4KA9 A;  1ZAC A;  1SL7 A;  3LF4 B;  1NX0 A;  1KCY A;  3VGO A;  2GGZ A;  1C7V A;  1XK4 A;  4W74 A;  1RM9 A;  2M7N A;  3ZWH A;  2SCP A;  5J3X A;  2G3O A;  1NUB A;  4W7D A;  1F4O A;  2M0R A;  4GOB A;  2V4E B;  3TDU A;  2IS9 A;  3FIA A;  2K0J A;  3OB2 B;  2M1U A;  1J55 A;  4DRW A;  3EK7 A;  4ORA B;  2ICR A;  1QS7 A;  4I5L B;  1S6Z A;  4AOM A;  2POX A;  4PE4 A;  1W7S A;  2OJK A;  1S6C A;  4D1E A;  2WOS A;  5F9G A;  3I5I B;  2M7L A;  3SVD A;  3QRX A;  3O6B A;  4LJD C;  4MZL A;  1AVS A;  5DRG A;  5BTT B;  4PHJ A;  4OY4 A;  2AH8 A;  2WSO A;  4PHK A;  4W6K A;  1KYS A;  3FS7 A;  1IQ3 A;  2FCE A;  2G2S B;  2JUL A;  1RMM A;  4W6D A;  2A46 A;  1KQV A;  3TMR A;  3IQO A;  3O77 A;  5B8I B;  3HX4 A;  1J7O A;  4JF9 A;  2MHH A;  1S1E A;  4JQ0 D;  2KDH A;  2OKY A;  3EKJ A;  2KQ6 A;  1K9P A;  2G6X A;  3CS1 A;  3LCP C;  1EML A;  2YE0 A;  1NCX A;  1WLZ A;  5DTZ A;  2GX0 A;  1CDP A;  3SVU A;  3LLE A;  1CLL A;  2FWQ A;  2K61 A;  2LLT A;  1KQM C;  1Y6W A;  2A52 B;  2WUR A;  4HE4 A;  5FVI A;  1RK9 A;  2NXQ A;  2HET A;  3OSR A;  3ST2 A;  1QY3 A;  4UTS A;  2L5X B;  3U0N A;  3U8P A;  3DQH A;  2QRF A;  2BCB A;  3DQC A;  3AKA A;  1J1D A;  4OQW A;  1YRT B;  4ZFS A;  3LK1 A;  1IKU A;  3DQD A;  1EMK A;  4WQ2 A;  4KGF A;  2FOT A;  1A29 A;  4DKN A;  2QLG B;  1AJ5 A;  3GL4 A;  1YZW A;  5HW9 A;  1KFX S;  3VRP A;  2GW4 B;  3LVD A;  4W76 A;  4XVP A;  4GAO A;  3PAT A;  2ZNE A;  4A4C A;  2O29 A;  4W77 A;  1QIV A;  1QYO A;  2QZ0 A;  2YE1 A;  1S26 D;  2YDZ A;  4DKM A;  1OXD A;  2M1K B;  4PAL A;  1F54 A;  2G16 B;  2GV5 A;  3EVP A;  1S36 A;  4RYW A;  4W6M A;  4W6I A;  5CSJ A;  3IQQ A;  1EMA A;  2BBM A;  1J1E A;  4NQG A;  1YX8 A;  2F3Z A;  2AWJ A;  4W6O A;  5AER A;  2A53 B;  2WHU A;  2EHB A;  1B1G A;  1K96 A;  2ZRT A;  2H5R A;  1UHN A;  5DTY A;  2KI4 B;  3LVC A;  3E5T A;  1QLS A;  1QV0 A;  2M49 B;  3CR2 A;  3SJS A;  1N65 A;  4XYN A;  1DTL A;  2WCF A;  1K95 A;  5JJG A;  4DIR A;  5LTQ A;  1GGW A;  2BE6 A;  4ZCV A;  2G6E A;  3I19 A;  1SCM C;  5H89 A;  1ZFS A;  4ANJ A;  1CB1 A;  2DD7 A;  2BBN A;  2H5Q A;  3O78 A;  4JPZ B;  1IRJ A;  2GW3 A;  4GUK A;  4HVF A;  4LJD A;  1SK6 D;  1Q4C A;  3SG6 A;  2B3P A;  1SKT A;  1ZUX A;  4GGF C;  1JFK A;  1YUR A;  2JPT A;  3GK2 A;  3ED8 A;  2BKH B;  2Q57 A;  4UPG A;  1HQV A;  3GB3 A;  3SIB A;  3KHE A;  4W7R A;  1IG5 A;  1LKJ A;  2Y1M A;  5LTR A;  3D0Y B;  1ZGO A;  1HT9 A;  1FI5 A;  1F0B A;  3LK0 A;  3JTD C;  1B8R A;  1NWD A;  3DD4 A;  5AFP A;  4R6D A;  1U5I B;  1S3P A;  5EB7 A;  4W6S A;  1ALV A;  2A48 A;  1KK8 B;  1ZUZ A;  1KFU L;  2DUF A;  1WDC B;  4HRE E;  1JUO A;  4W6A A;  4FQO A;  1BU3 A;  1UHI A;  2PVB A;  4J8A A;  2A4J A;  3SVO A;  3WNX B;  4M2Q A;  3NXA A;  1JBA A;  1BR4 B;  1A2X A;  4IK9 A;  2CCM A;  2G5Z B;  2HGD A;  3ST4 A;  3U0K A;  1MF8 B;  2JNX A;  2HRS A;  2AMI A;  4TZG A;  2QU1 A;  1XVJ A;  3OX6 A;  1QX2 A;  3CFH A;  3S05 A;  4Z4K A;  2ZO6 A;  4YBH B;  3VIC A;  2Z6X A;  1XYD A;  1B7T Y;  4OVN F;  2K2F A;  1DF0 B;  1Z1P A;  2LUC A;  1CFF A;  2LAN A;  2VVH A;  2LMU A;  2M29 A;  2JAD A;  4OGS A;  5I2O A;  2EC6 C;  2AAO A;  2M97 A;  1CMG A;  3SVE A;  3AI5 A;  2LCP A;  2LLS A;  4CFR A;  1QXP A;  2HPW A;  1PVA A;  1PVB A;  1F70 A;  1CFC A;  3OSQ A;  2LV7 A;  1SL9 A;  4PPK A;  4AS8 A;  3VHT A;  3TDZ A;  3CD1 A;  3CBE A;  1XSS A;  1EXR A;  1V1F A;  2GX2 A;  3SSV A;  2BTJ A;  1DGV A;  2RGI A;  1IQ5 A;  3BOW B;  1DJZ A;  3OGO A;  1K8U A;  2Y0G A;  5DPJ A;  2ZFD A;  2JRF A;  2WHT A;  2P4M A;  3DQI A;  1PRW A;  2DDD A;  1SNL A;  2WC8 A;  5EXB A;  1YJF A;  3RM1 A;  1H4B A;  2DOQ A;  5AXI A;  2JXL A;  2LUX A;  4Q9X A;  1DJH A;  1KK7 Z;  2DD9 A;  2AUC A;  4NWS A;  2F3Y A;  1AK8 A;  3ST0 A;  1A75 B;  2HPS A;  2WIS A;  3U8C A;  4YGA A;  5EXC I;  1GQM A;  2VVI A;  1EG3 A;  2NLN A;  3TDI A;  2ZKM X;  4GGF A;  3KF9 A;  5KTG A;  5HZS A;  1KWO C;  1LA3 A;  2PRU A;  1F4Q A;  3CLN A;  3E3R A;  2KI6 C;  1DMO A;  4PE7 A;  2FCD A;  3NSL A;  2BCX A;  1FF1 A;  1OOJ A;  3BYA A;  2LVV A;  1DJY A;  1OMR A;  3BUW B;  2PXS A;  3WXA A;  1TNP A;  2JOJ A;  2LLU A;  4KF4 A;  1QAT A;  2ISD A;  2K8M B;  1M63 B;  1TNQ A;  2F2P A;  3GJ1 A;  2KI6 D;  1C4F A;  4H47 A;  5DPG A;  2IE2 A;  1K2H A;  2FL1 A;  1IJ5 A;  4MRY A;  3IR8 A;  4JEO A;  3GEX A;  4CID A;  2CNP A;  4KF5 C;  1YFP A;  1XFY O;  1F71 A;  1EMG A;  1VRK A;  4HQC A;  4ORC B;  3DF0 A;  3HCM A;  3LF3 A;  1Y1X A;  1SYM A;  1QX7 A;  3RWT A;  2OS8 B;  1BFP A;  1TN4 A;  5KU1 A;  2Y1N A;  4IK5 A;  1SR6 C;  2KAV A;  1UHH A;  4LQT A;  2M8U A;  4E68 A;  5DRF A;  3VRQ A;  2OTG C;  1N0Y A;  3DQ6 A;  5KTY A;  4AQI A;  4XOV A;  5ER4 X;  4MLW A;  3WLC A;  1BLQ A;  2WND A;  1CM1 A;  4GBA A;  4BDU A;  4LJC A;  1TCF A;  4YGD B;  3PFV A;  3CGA A;  1DT7 B;  4TZA A;  4IK8 A;  3D10 A;  4L1I A;  4PE1 A;  2MLE C;  3SS0 A;  1SL8 A;  1QYQ A;  1K9U A;  1CNP A;  1S5G Y;  4GFT A;  4Z4M A;  1CLB A;  1YR5 A;  1RWY A;  3M0W A;  2WCB A;  4BY5 A;  2CT9 A;  3SVS A;  1XA5 A;  3DQN A;  1L2O B;  3WHU B;  1B8C A;  2JNF A;  3KPX A;  4FTG A;  1RJV A;  2G3D B;  3DQ8 A;  1LVC D;  3TS5 B;  3DQ2 A;  2NCP A;  3DQ5 A;  4W75 A;  1RFJ A;  1RRO A;  3DVM A;  4AR7 A;  3NSI A;  4R1E A;  3DPX A;  4EUL A;  3OX5 A;  1LXF C;  1MR8 A;  3CTN A;  4JRB A;  1WY9 A;  1B7T Z;  4ZCU A;  3DPZ A;  3NED A;  3U0L A;  1EMC A;  1Q4D A;  3F45 A;  2E30 A;  4YI9 A;  2QPT A;  4M2P A;  2H6V A;  2H61 C;  1BR1 B;  2H8Q A;  2CXJ A;  5LK4 A;  4XL5 A;  1SRA A;  3CWG A;  1MOU A;  1YHG A;  2L2E A;  3LVA A;  1AJ4 A;  2KYF A;  3SSL A;  1QVI Z;  3CFF A;  4W7X A;  1QTX A;  1B4C A;  4I2Y A;  3W1C A;  5H87 A;  1QAS A;  4RYS A;  2VAD A;  1GL4 A;  3P8U A;  4OHS A;  2QLE A;  4LJB A;  3IP2 A;  1JSA A;  2PSR A;  2I94 A;  2IB5 A;  3SST A;  3DQK A;  1CM4 A;  4I5K A;  1QXT A;  3PAL A;  2EMN A;  1Q4E A;  4Q04 A;  3LA1 A;  2M3W A;  5EHU A;  4IZN A;  1UUS A;  5DKN A;  4H3M A;  1AHR A;  1XFZ O;  4C0K A;  2KFG A;  4NDD A;  4KF5 A;  4LW5 A;  1MUX A;  1DJX A;  4DCK A;  4DXO A;  1Y0V H;  2PAS A;  3BXK A;  3JVT B;  3O2P A;  1RRX A;  4XJK A;  4HRH A;  2AWK A;  4H3L A;  3DQ7 A;  1GGX A;  1J7Q A;  3SVC A;  3BUX B;  2LMV A;  2NZ0 A;  1SCV A;  1IWQ A;  5FYX A;  2B3Q A;  4ZF4 A;  1CDL A;  1PAL A;  1OQP A;  1UUR A;  1R2U A;  5EJU A;  2HFC A;  4ZIO A;  3I5F C;  2AWM A;  3PJB A;  1J7P A;  3PJ7 A;  3LS3 A;  1Y1U A;  4U8D A;  3CFA A;  3EK4 A;  5I2L A;  2KGR A;  4DXN A;  1YUT A;  2H9W A;  5DTL A;  3VRO A;  2WHS A;  3LSA A;  1MXL C;  1XFU O;  4W6H A;  2LP2 A;  5EB6 A;  3ZTF A;  1SMG A;  3PN7 C;  1OE9 B;  4EDS A;  1NX2 A;  5KSZ A;  3AKO A;  1QV1 A;  1A03 A;  2KAY A;  3KCS A;  2FZU A;  1XFW O;  1JF0 A;  3DQA A;  2DUG A;  3A8S A;  3MSE B;  1RTP 1;  3NT9 A;  3V3D A;  1GJY A;  4QJ4 B;  3WHT B;  1BT6 A;  1CDM A;  5J2O A;  1ZGP A;  2OS8 C;  1W7I B;  4P1Q A;  5BQL A;  4PCW A;  2ARL A;  4W7E A;  1YUS A;  2Q91 A;  5PAL A;  4MZJ A;  3DQO A;  1M46 A;  2VAE A;  1B9C A;  2A50 B;  2V4E C;  2H61 A;  3SVR A;  5DPH A;  2L51 A;  3FWB A;  4GGN A;  3RWA A;  2HQW A;  2JT3 A;  1FPW A;  1PK0 D;  5GQQ C;  2V53 A;  5I2Q A;  4PHM A;  5HZO A;  1ZMZ A;  1M45 A;  2ZND A;  4I5N B;  1XFV O;  1C07 A;  4AQJ A;  1V1G A;  2Y4Q A;  3M24 A;  2LHL A;  3I5I C;  1NYA A;  3ZUF A;  2AHA A;  3TMT A;  2OKW A;  1JC1 A;  1XMZ A;  1JF2 A;  4QJ5 B;  2ZO7 A;  1KQM B;  2A54 B;  1BOC A;  3H1O A;  2LHI A;  1BF5 A;  3BUN B;  1W7T A;  4DXI A;  2H5O A;  4W6U A;  1TNW A;  1IGV A;  4USL A;  2KBI A;  1IH0 A;  5G08 A;  2C9I A;  2PXW A;  2I2R E;  2R2I A;  4DXP A;  4JWQ A;  2Z6Y A;  4I5J A;  5HYD A;  2LMT A;  1YX7 A;  1OXF A;  3GJ2 A;  3ZUL A;  1XFX O;  2LC5 A;  1C7W A;  2HQK A;  1H8B A;  5AAN A;  3SG3 A;  3CZT X;  1NX1 A;  1K93 D;  3DQ9 A;  2L0P A;  5HZT A;  1LA0 A;  1PSB A;  2CTN A;  1SW8 A;  3AAK A;  4EN1 A;  1OZS A;  1CLM A;  4N1G A;  2QLI A;  2Z6Z A;  4W6T A;  2KFH A;  3DQ3 A;  3OP0 A;  1AP4 A;  1JC0 A;  4P76 A;  2NCO A;  2H5P A;  5AQB B;  4P5O E;  3KCT A;  3DQL A;  3SG4 A;  3BXA A;  4ORN A;  3VHT B;  2O24 A;  4ZBL A;  1G4Y R;  2JZI A;  2JXC A;  2K7O A;  4A4B A;  2JU0 A;  2EMD A;  2G9B A;  3NSO A;  4OJ0 A;  4KEX A;  1XA9 A;  2GGM A;  3BX9 A;  1H6R A;  1NSH A;  5CPV A;  3SV5 A;  1QLK A;  1TTX A;  1KSO A;  3DQ4 A;  2G2B A;  3WLD A;  2JTT A;  4N3D A;  4B30 A;  2MRD A;  5FVF A;  2OPO A;  4F0Z B;  1DVI A;  1MYW A;  5HGE A;  2KAX A;  2KNE A;  2ZMW A;  3CB9 A;  1Z1Q A;  1Q4B A;  2F2O A;  1PSR A;  1RMO A;  1YJ2 A;  1UIS A;  2LM5 A;  1SCM B;  2E6W A;  3PLF B;  3DPW A;  1YHI A;  3BXC A;  1G33 A;  3SSH A;  2WOR A;  4N1F A;  1B9A A;  5DKR A;  1EMM A;  2FJU B;  1YTZ C;  2LVI A;  2DUE A;  2F8P A;  4TNC A;  1ZOT B;  2KI4 C;  2VRG A;  2QLH A;  4C0L A;  3I5H B;  2V4E A;  1JC2 A;  1MQ1 A;  3A8R A;  3DQE A;  2O2B A;  1GFL A;  5CSN A; 
#chains in the Genus database with same CATH topology
 4MSP A;  1KSM A;  4DXM A;  1ODB A;  3JTD B;  3A4U B;  1S6I A;  5HLO A;  2HJO A;  2Q4U A;  1LIN A;  3BUO B;  3VRN A;  1Q80 A;  1JBZ A;  4DXQ A;  4ETO A;  2PMY A;  2AWL A;  5F6T A;  2A47 A;  5BTT A;  2COL B;  4W6L A;  4MZK A;  3U8A A;  3EK8 A;  3DF0 B;  4W6F A;  2K7B A;  1Q73 A;  4KGE A;  4IK1 A;  1F55 A;  2HGY A;  3S0A A;  4HRG A;  1MOV A;  3DQU A;  3E5V A;  1XAE A;  2QEO A;  2QT2 A;  4PDZ A;  1SBJ A;  4OCI A;  1W7U A;  4Q7R A;  4W6R A;  4GF6 B;  2LAP A;  3DQJ A;  1NX3 A;  4H3N A;  5LTP A;  2LVJ A;  2WSN A;  3SG2 A;  4GES B;  3CR4 X;  4W6N A;  3ICB A;  5HZU A;  3KO0 A;  1FBV A;  5D3O A;  1CMF A;  1KK8 C;  2PYQ A;  2RH7 A;  4W7C A;  2MLF C;  4ZF3 A;  3LL8 B;  4Q9W A;  4QJ3 B;  1W7J B;  1WDC C;  2LE9 B;  1YVH A;  3GOF A;  1XQM A;  1UHJ A;  1B8L A;  1SY9 A;  5DQB A;  4W73 A;  3GK1 A;  4ZB1 A;  2Y5I A;  4KPI A;  2EC6 B;  4W6J A;  3EG5 B;  2D8N A;  2MA2 A;  4YGE B;  1OW4 A;  3BFA A;  1QX5 B;  4OV2 A;  5K89 A;  2VZX A;  1RMP A;  1CDN A;  2JPO A;  2KQY A;  1F09 A;  2K2A A;  3O4Y A;  2QLG A;  4ZIN A;  4W6B A;  1IJ6 A;  5DTX A;  1E8A A;  1BJF A;  2WCE A;  1TIZ A;  3CDN A;  4OR9 B;  4EDO A;  2KBM A;  1F8H A;  1CV7 A;  1BG1 A;  4M2O A;  4MN0 A;  3SRY A;  3B88 A;  5DU0 A;  1JBY A;  3PSR A;  3CZ2 A;  3ZNI A;  1K94 A;  5HKY A;  2BL0 B;  2L4I A;  4J89 A;  3NT3 A;  3NSK A;  1ZGQ A;  4W7F A;  4P2Y B;  1DJW A;  2IB6 A;  1Z2C B;  2HQ8 A;  2A56 B;  4PE0 A;  1DGU A;  1CFD A;  1KFX L;  3OHM B;  4R6B A;  1HUY A;  3PIB A;  4BY4 A;  4KW8 A;  2ZN8 A;  3ZUJ A;  3EVV A;  3W1D A;  3EKH A;  1KWO B;  5FI6 A;  3SVN A;  1KK7 Y;  4GNK B;  5I94 A;  2KLE A;  3U0M A;  2JTZ A;  3I5G B;  4DS7 A;  3CGL A;  1EG4 A;  3L4A A;  4MRX A;  2O60 A;  4ORB B;  4NDB A;  3RLZ A;  2QEB A;  4MVF A;  1UWO A;  5HKW A;  1MXE A;  2L4H A;  2HQZ A;  2JQ6 A;  4HSZ A;  1MHO A;  1QWV A;  1TUJ A;  3OB1 B;  5FI7 A;  2MBX A;  2DDC A;  3VRR A;  2OTE A;  4YRU A;  1EL4 A;  1WLM A;  5HKZ A;  3TUY B;  5JOL A;  1L7Z A;  1QIW A;  1DJG A;  1OOH A;  2PAL A;  3R1V A;  1QJT A;  4XJK B;  3WCK A;  2M9G A;  1D1O A;  1OXE A;  1OOF A;  2BKI B;  4KW9 A;  1K90 D;  4HQ8 A;  3D0Y A;  5T3I A;  1R6P A;  1TRF A;  1SR6 B;  3PJ5 A;  2VVJ A;  1TCO B;  1Q4A A;  2OTG B;  3M22 A;  2G6Y A;  1GM0 A;  1U5I A;  3VK1 A;  3D73 A;  3UG0 A;  3DQ1 A;  4H48 A;  2P71 A;  2QAC A;  4ICB A;  4J88 A;  2JT8 A;  2L50 A;  2WIQ A;  3I5H C;  2P6B B;  4JKT A;  4W6G A;  4W72 A;  1FI6 A;  3NEZ A;  1KYR A;  3BQ3 A;  2L98 A;  2O5G A;  5ER5 A;  3VB1 A;  5D69 A;  3P28 A;  1J7R A;  5HLV A;  1FW4 A;  1EMB A;  1KFU S;  1EH2 A;  1ALW A;  1OMV A;  1G7K A;  1OSA A;  3BUM B;  1JFJ A;  3SIA A;  3E5W A;  1X02 A;  2H2K A;  1PUL A;  1S5G Z;  4JC2 A;  5FHV A;  1UHK A;  2KYC A;  3ST3 A;  3B86 A;  4W6C A;  1DF0 A;  1M39 A;  5IBW A;  5I8N A;  4W7A A;  3H1R A;  5CSI A;  2KSP A;  4PPL A;  1HCJ A;  2DUI A;  3PM8 A;  1XK4 C;  3NHI A;  1M31 A;  5DKQ A;  4CLN A;  2F33 A;  5BT0 A;  1REC A;  1WRZ A;  1KP5 A;  3GK4 X;  4L9M A;  2I18 A;  2OTB A;  4MEW A;  2KFF A;  2EMO A;  1G8I A;  1YUU A;  1QYF A;  4XOW A;  5EXU A;  4B5Y A;  2IOV A;  2K7C A;  3ADF A;  3FWC A;  1L2O C;  3SVB A;  3EVU A;  2MAZ A;  4W69 A;  2JC2 A;  5D7F A;  1NCZ A;  3TS5 C;  2BEC A;  3AI4 A;  3K21 A;  2JT0 A;  3SG5 A;  1S6J A;  2HCG A;  1K9K A;  3CD9 A;  3K1K A;  3SSP A;  2K7D A;  1H4U A;  4EMQ A;  3TZ1 A;  4DUQ A;  3BOW A;  4OKH A;  5HBD A;  2CBL A;  4KYN A;  1NIW A;  3QME A;  4GPL B;  1UP5 A;  3S0F A;  1EJ3 A;  4YGB B;  3NF0 A;  4XGY A;  1QVI Y;  2LVK A;  1OZO A;  5FVG A;  3DQM A;  1SPY A;  1WRK A;  3C1V A;  2KOT A;  5BPJ A;  3H4S E;  3FE6 A;  1A75 A;  4YGC B;  2DUH A;  4YI8 A;  4PFE A;  1YRU B;  4JGE A;  1YVL A;  1CKK A;  2B1U A;  1OMD A;  2LNK A;  4NDC A;  3CR5 X;  3UFZ A;  4PPJ A;  1NP8 A;  1TNX A;  5DY6 A;  1TOP A;  3DY9 A;  3IF7 A;  4Q7U A;  3EVR A;  2HF5 A;  2Q6P A;  5TNC A;  3SSY A;  2BL0 C;  4IK3 A;  1A4P A;  1B47 A;  2BE4 A;  5AEQ A;  1XO5 A;  4KAG A;  1NPQ A;  2LP3 A;  1NCY A;  2H8V A;  2JWW A;  2WC6 A;  4L13 A;  1WRL A;  4WQ3 A;  1CFP A;  1YHH A;  4IK4 A;  2OGR A;  1N2D A;  1JWD A;  3OBV A;  4N5X A;  2SAS A;  1CTR A;  1AUI B;  3I5F B;  3AKB A;  1BMO A;  4LQU A;  3DVE A;  3DQF A;  3JVT C;  1DEL A;  2ZN9 A;  2ZMU A;  5H88 A;  4ZF5 A;  2I7A A;  1GGZ A;  4L12 A;  4W6P A;  1EMF A;  3DVJ A;  3DVK A;  2TN4 A;  4C0J A;  4U2V A;  2BCA A;  4PT1 A;  2MJW B;  3MGF A;  3I5G C;  3SG7 A;  1KYP A;  5DPI A;  1Y1A A;  2C9J A;  4RTC A;  3PN7 B;  1DJI A;  4HQ9 A;  4Q7T A;  3KEV A;  3G9A A;  1MWN A;  4MBE A;  4WRI A;  5DQM A;  2Z1O A;  4JFG A;  3D78 A;  3SSK A;  1EME A;  4KW4 A;  4B30 B;  2L5Y A;  5EBJ A;  2EGD A;  1P28 A;  2FJY A;  3D74 A;  4IL1 A;  4PHN A;  1BOD A;  2KGB C;  3BXB A;  5CSF A;  3TUY C;  4CFQ A;  2KHN A;  2YFP A;  3AAJ A;  2ZRS A;  4CPV A;  4KA9 A;  1ZAC A;  1SL7 A;  3LF4 B;  1NX0 A;  1KCY A;  3VGO A;  2GGZ A;  1C7V A;  1XK4 A;  4W74 A;  1RM9 A;  2M7N A;  3ZWH A;  2SCP A;  5J3X A;  2G3O A;  1NUB A;  4W7D A;  1F4O A;  2M0R A;  4GOB A;  2V4E B;  3TDU A;  2IS9 A;  3D75 A;  2K0J A;  3FIA A;  2K60 A;  3DXL A;  3OB2 B;  2M1U A;  1J55 A;  4DRW A;  3EK7 A;  4ORA B;  2ICR A;  1Z4H A;  1QS7 A;  4I5L B;  1S6Z A;  4AOM A;  2POX A;  4PE4 A;  1W7S A;  2OJK A;  1S6C A;  4D1E A;  2WOS A;  5F9G A;  3I5I B;  2M7L A;  3SVD A;  3QRX A;  3O6B A;  4LJD C;  4MZL A;  2KPH A;  1AVS A;  5DRG A;  5BTT B;  4PHJ A;  4OY4 A;  2AH8 A;  2WSO A;  1W9Z A;  4PHK A;  4W6K A;  1KYS A;  3FS7 A;  1IQ3 A;  2FCE A;  2G2S B;  2JUL A;  1RMM A;  3PM2 A;  4W6D A;  2A46 A;  2WC5 A;  1KQV A;  3TMR A;  3IQO A;  3O77 A;  5B8I B;  3R1O A;  3D76 A;  3HX4 A;  1J7O A;  4JF9 A;  2MHH A;  1S1E A;  4JQ0 D;  2KDH A;  2OKY A;  3EKJ A;  2KQ6 A;  1K9P A;  2G6X A;  3CS1 A;  3LCP C;  1EML A;  2YE0 A;  1NCX A;  1WLZ A;  5DTZ A;  3L47 A;  2GX0 A;  1CDP A;  3SVU A;  3LLE A;  1CLL A;  2FWQ A;  2K61 A;  2LLT A;  1KQM C;  1Y6W A;  2A52 B;  2WUR A;  4HE4 A;  5FVI A;  1RK9 A;  2NXQ A;  4FQT A;  3SS4 A;  2HET A;  3OSR A;  3ST2 A;  1QY3 A;  4UTS A;  2L5X B;  3U0N A;  3U8P A;  3DQH A;  2QRF A;  2BCB A;  3DQC A;  3AKA A;  4IJ7 A;  1J1D A;  4OQW A;  1YRT B;  4ZFS A;  3N7H A;  3LK1 A;  1IKU A;  5HL1 A;  3DQD A;  1EMK A;  4WQ2 A;  4KGF A;  2FOT A;  2GTE A;  1A29 A;  4DKN A;  2QLG B;  1AJ5 A;  3GL4 A;  1YZW A;  5HW9 A;  1KFX S;  3VRP A;  2GW4 B;  3LVD A;  4W76 A;  4XVP A;  4GAO A;  3PAT A;  3S0E A;  2ZNE A;  4A4C A;  2O29 A;  3IVT A;  4W77 A;  1QIV A;  1QYO A;  2QZ0 A;  2YE1 A;  1S26 D;  2YDZ A;  4DKM A;  1OXD A;  2M1K B;  4PAL A;  1F54 A;  3EVP A;  2GV5 A;  2G16 B;  1S36 A;  4RYW A;  4W6M A;  4W6I A;  5CSJ A;  3IQQ A;  4INX A;  1EMA A;  2BBM A;  1J1E A;  4NQG A;  1YX8 A;  3BFH A;  2F3Z A;  3V2L A;  2AWJ A;  4W6O A;  5AER A;  2A53 B;  2WHU A;  2EHB A;  1B1G A;  1K96 A;  2ZRT A;  2H5R A;  1UHN A;  5DTY A;  2KI4 B;  3LVC A;  3E5T A;  1QLS A;  1QV0 A;  2M49 B;  3CR2 A;  3SJS A;  1N65 A;  3SS5 A;  3FE9 A;  4XYN A;  1DTL A;  2WCF A;  1K95 A;  5JJG A;  4DIR A;  5LTQ A;  1GGW A;  2BE6 A;  4ZCV A;  1DEK A;  2G6E A;  3I19 A;  2QDI A;  1SCM C;  5H89 A;  1ZFS A;  4ANJ A;  1CB1 A;  2DD7 A;  2BBN A;  2H5Q A;  3O78 A;  4JPZ B;  1IRJ A;  2GW3 A;  4GUK A;  4HVF A;  4LJD A;  1SK6 D;  1Q4C A;  3SG6 A;  2B3P A;  1SKT A;  1ZUX A;  4GGF C;  1JFK A;  1YUR A;  2JPT A;  3GK2 A;  3ED8 A;  2BKH B;  2Q57 A;  4UPG A;  1HQV A;  3GB3 A;  3SIB A;  3KHE A;  4W7R A;  1IG5 A;  1LKJ A;  2Y1M A;  5LTR A;  3D0Y B;  1ZGO A;  1HT9 A;  1FI5 A;  1F0B A;  3LK0 A;  3JTD C;  1C3Y A;  1B8R A;  1NWD A;  3DD4 A;  5AFP A;  2WCK A;  4R6D A;  1U5I B;  1S3P A;  5EB7 A;  4W6S A;  1ALV A;  2A48 A;  1KK8 B;  1ZUZ A;  1KFU L;  2DUF A;  1WDC B;  4HRE E;  1JUO A;  4W6A A;  4FQO A;  1BU3 A;  1UHI A;  2PVB A;  4J8A A;  2A4J A;  3SVO A;  3WNX B;  5DIC A;  4M2Q A;  3NXA A;  1JBA A;  1BR4 B;  1A2X A;  4IK9 A;  2CCM A;  2G5Z B;  2HGD A;  3ST4 A;  3U0K A;  1MF8 B;  2JNX A;  2HRS A;  2AMI A;  1IIO A;  1OOG A;  4TZG A;  2QU1 A;  1XVJ A;  3OX6 A;  1QX2 A;  3CFH A;  3L4L A;  2ERB A;  3S05 A;  4Z4K A;  2ZO6 A;  4YBH B;  3VIC A;  2Z6X A;  1XYD A;  1B7T Y;  4OVN F;  2K2F A;  1DF0 B;  1Z1P A;  2LUC A;  1CFF A;  2LAN A;  2VVH A;  2LMU A;  2M29 A;  2JAD A;  4OGS A;  5I2O A;  2WCH A;  2EC6 C;  2AAO A;  2M97 A;  1CMG A;  3SVE A;  3AI5 A;  2LCP A;  2LLS A;  4CFR A;  1QXP A;  2HPW A;  1PVA A;  1PVB A;  1F70 A;  1CFC A;  3OSQ A;  2LV7 A;  3S0D A;  1SL9 A;  1TWO A;  4PPK A;  3S0B A;  4AS8 A;  3VHT A;  3TDZ A;  3CD1 A;  3CBE A;  1XSS A;  1EXR A;  1V1F A;  5FI2 A;  2GX2 A;  3SSV A;  2BTJ A;  1DGV A;  2RGI A;  1IQ5 A;  3BOW B;  1DJZ A;  3OGO A;  1K8U A;  2Y0G A;  5DPJ A;  2ZFD A;  2JRF A;  2WHT A;  2P4M A;  3DQI A;  1PRW A;  2DDD A;  1SNL A;  2WC8 A;  5EXB A;  1YJF A;  3RM1 A;  1H4B A;  2DOQ A;  5AXI A;  2JXL A;  2LUX A;  4Q9X A;  1DJH A;  1KK7 Z;  2DD9 A;  4INW A;  2AUC A;  4NWS A;  2F3Y A;  1AK8 A;  3ST0 A;  4F7F A;  3CYZ A;  1A75 B;  2HPS A;  2WIS A;  3U8C A;  4YGA A;  5EXC I;  1GQM A;  2VVI A;  1EG3 A;  2NLN A;  3TDI A;  2ZKM X;  4GGF A;  3KF9 A;  5KTG A;  5HZS A;  1KWO C;  1LA3 A;  2PRU A;  1F4Q A;  3CLN A;  3E3R A;  2KI6 C;  1DMO A;  4PE7 A;  2FCD A;  3NSL A;  2BCX A;  1FF1 A;  1OOJ A;  3BYA A;  2LVV A;  1DJY A;  1OMR A;  3BUW B;  2PXS A;  3WXA A;  2WCJ A;  1TNP A;  2JOJ A;  2LLU A;  4KF4 A;  1QAT A;  2ISD A;  2K8M B;  1M63 B;  3UO9 A;  1TNQ A;  2F2P A;  3GJ1 A;  2KI6 D;  1C4F A;  4H47 A;  3BJH A;  5DPG A;  2IE2 A;  1K2H A;  2FL1 A;  1IJ5 A;  4MRY A;  3IR8 A;  4JEO A;  3GEX A;  3B7A A;  4CID A;  2CNP A;  4KF5 C;  1YFP A;  1XFY O;  1F71 A;  1EMG A;  1VRK A;  4HQC A;  4ORC B;  3DF0 A;  1DQE A;  3HCM A;  3LF3 A;  1Y1X A;  1SYM A;  1QX7 A;  3RWT A;  2OS8 B;  1BFP A;  1TUZ A;  1TN4 A;  5KU1 A;  2Y1N A;  4IK5 A;  1SR6 C;  2KAV A;  1UHH A;  4LQT A;  2M8U A;  4E68 A;  5DRF A;  3VRQ A;  2OTG C;  1N0Y A;  3DQ6 A;  5KTY A;  4AQI A;  2KLD A;  4XOV A;  5ER4 X;  4MLW A;  3WLC A;  1BLQ A;  2WND A;  1CM1 A;  4GBA A;  4BDU A;  4LJC A;  1TCF A;  3Q8I A;  4YGD B;  2YGU A;  3PFV A;  3CGA A;  1DT7 B;  4TZA A;  4IK8 A;  3D10 A;  3R1P A;  4L1I A;  4PE1 A;  2MLE C;  3SS0 A;  1SL8 A;  1QYQ A;  1K9U A;  1CNP A;  1S5G Y;  4GFT A;  4Z4M A;  1CLB A;  1YR5 A;  1RWY A;  3M0W A;  2WCB A;  4BY5 A;  2CT9 A;  3SVS A;  1XA5 A;  3DQN A;  1L2O B;  3WHU B;  1B8C A;  2JNF A;  3KPX A;  4FTG A;  1RJV A;  2G3D B;  2L2C A;  3DQ8 A;  1LVC D;  3TS5 B;  3DQ2 A;  2NCP A;  3DQ5 A;  4W75 A;  1RFJ A;  1RRO A;  3D77 A;  3DVM A;  4AR7 A;  3NSI A;  4R1E A;  3DPX A;  4EUL A;  3OX5 A;  1LXF C;  1MR8 A;  3CTN A;  4JRB A;  1WY9 A;  1B7T Z;  4ZCU A;  3DPZ A;  3NED A;  2BAP A;  3U0L A;  1EMC A;  1Q4D A;  2WCL A;  3F45 A;  2E30 A;  4YI9 A;  2QPT A;  4M2P A;  4OZD A;  2H6V A;  2H61 C;  1BR1 B;  2H8Q A;  2CXJ A;  5LK4 A;  4XL5 A;  1SRA A;  3CWG A;  1MOU A;  1YHG A;  3CZ1 A;  2L2E A;  3LVA A;  1AJ4 A;  2KYF A;  3SSL A;  1QVI Z;  3CFF A;  4W7X A;  1DC1 A;  1QTX A;  1B4C A;  4I2Y A;  3W1C A;  5H87 A;  1QAS A;  4RYS A;  2VAD A;  1GL4 A;  3P8U A;  4OHS A;  2QLE A;  4LJB A;  3IP2 A;  1JSA A;  2PSR A;  2I94 A;  2IB5 A;  3SST A;  3DQK A;  1CM4 A;  4I5K A;  1QXT A;  3PAL A;  2EMN A;  1Q4E A;  4Q04 A;  1C3Z A;  3LA1 A;  2M3W A;  5EHU A;  4IZN A;  1UUS A;  1OOI X;  1T14 A;  5DKN A;  4H3M A;  1AHR A;  3OGN A;  1XFZ O;  4C0K A;  3B6X A;  2KFG A;  4NDD A;  4KF5 A;  4LW5 A;  2QEH A;  1MUX A;  1DJX A;  4DCK A;  4DXO A;  1Y0V H;  2PAS A;  3BXK A;  3RZS A;  3JVT B;  3O2P A;  1RRX A;  4XJK A;  4HRH A;  2AWK A;  4H3L A;  3DQ7 A;  1GGX A;  1J7Q A;  3SVC A;  3BUX B;  2LMV A;  2NZ0 A;  1SCV A;  1IWQ A;  5FYX A;  2B3Q A;  4ZF4 A;  1CDL A;  1PAL A;  1OQP A;  1UUR A;  1R2U A;  5EJU A;  2HFC A;  4ZIO A;  2BNX A;  3I5F C;  2AWM A;  3PJB A;  3BFB A;  1J7P A;  3PJ7 A;  3LS3 A;  1Y1U A;  4U8D A;  3CFA A;  3EK4 A;  5I2L A;  2KGR A;  4DXN A;  1YUT A;  2H9W A;  5DTL A;  3VRO A;  2WHS A;  3LSA A;  1MXL C;  1XFU O;  4W6H A;  2LP2 A;  5EB6 A;  4JD9 A;  3ZTF A;  1SMG A;  3PN7 C;  1OE9 B;  4EDS A;  1NX2 A;  3PJI A;  5KSZ A;  3AKO A;  1QV1 A;  1A03 A;  2KAY A;  2P70 A;  2WCM A;  3KCS A;  2FZU A;  1XFW O;  1JF0 A;  3DQA A;  2DUG A;  3A8S A;  3MSE B;  1RTP 1;  3NT9 A;  3V3D A;  1GJY A;  4QJ4 B;  3WHT B;  1BT6 A;  1CDM A;  2QEV A;  5J2O A;  1ZGP A;  2OS8 C;  1XFR A;  1W7I B;  4P1Q A;  5BQL A;  4PCW A;  2ARL A;  4W7E A;  1YUS A;  2Q91 A;  5PAL A;  4MZJ A;  3DQO A;  1M46 A;  2VAE A;  1B9C A;  2A50 B;  2V4E C;  2H61 A;  3SVR A;  5DPH A;  2L51 A;  3FWB A;  4GGN A;  3RWA A;  2HQW A;  2JT3 A;  1FPW A;  1PK0 D;  5GQQ C;  1SSE B;  3NGV A;  2V53 A;  5I2Q A;  4PHM A;  5HZO A;  1ZMZ A;  1M45 A;  2ZND A;  4I5N B;  1XFV O;  3O4X A;  1C07 A;  4AQJ A;  1V1G A;  2Y4Q A;  3M24 A;  2LHL A;  3I5I C;  1NYA A;  3ZUF A;  2AHA A;  3TMT A;  2OKW A;  1JC1 A;  1XMZ A;  1JF2 A;  4QJ5 B;  2ZO7 A;  1KQM B;  2A54 B;  1BOC A;  3H1O A;  2LHI A;  3K1E A;  1BF5 A;  3BUN B;  1W7T A;  4DXI A;  2H5O A;  4W6U A;  1TNW A;  1IGV A;  4USL A;  2KBI A;  1IH0 A;  5G08 A;  2C9I A;  2PXW A;  2I2R E;  2R2I A;  3CAB A;  4DXP A;  4JWQ A;  2Z6Y A;  4I5J A;  5HYD A;  2LMT A;  1YX7 A;  1OXF A;  3GJ2 A;  3ZUL A;  1XFX O;  2LC5 A;  1C7W A;  2HQK A;  1H8B A;  5AAN A;  3SG3 A;  3CZT X;  1NX1 A;  1K93 D;  3DQ9 A;  2PQL A;  2L0P A;  3SS3 A;  5EL2 A;  5HZT A;  3NHT A;  1LA0 A;  1PSB A;  2CTN A;  1SW8 A;  3AAK A;  4EN1 A;  1OZS A;  1CLM A;  3DYE A;  4N1G A;  2QLI A;  2Z6Z A;  4W6T A;  2KFH A;  3DQ3 A;  3OP0 A;  1AP4 A;  3FE8 A;  1JC0 A;  4P76 A;  2NCO A;  2H5P A;  5AQB B;  4P5O E;  3KCT A;  3DQL A;  3SG4 A;  3BXA A;  3DZT A;  4ORN A;  3VHT B;  2O24 A;  4ZBL A;  1G4Y R;  2JZI A;  2JXC A;  2K7O A;  4A4B A;  1LS8 A;  2JU0 A;  2EMD A;  2G9B A;  3NSO A;  4OJ0 A;  4KEX A;  1XA9 A;  2GGM A;  3BX9 A;  1H6R A;  1NSH A;  5CPV A;  3SV5 A;  1QLK A;  1TTX A;  1KSO A;  3DQ4 A;  2G2B A;  1ORG A;  3WLD A;  2JTT A;  4N3D A;  4B30 A;  2MRD A;  5FVF A;  3UNW A;  2OPO A;  4F0Z B;  1DVI A;  1MYW A;  5HGE A;  2KAX A;  2KNE A;  2ZMW A;  3CB9 A;  1Z1Q A;  1Q4B A;  2F2O A;  1PSR A;  1RMO A;  1YJ2 A;  3CZ0 A;  1UIS A;  2LM5 A;  1SCM B;  2E6W A;  3PLF B;  3DPW A;  1YHI A;  3BXC A;  1G33 A;  3SSH A;  2WOR A;  4N1F A;  1B9A A;  5DKR A;  1EMM A;  2FJU B;  1YTZ C;  2LVI A;  2DUE A;  2F8P A;  4TNC A;  1ZOT B;  2KI4 C;  2VRG A;  3B87 A;  3R72 A;  2QLH A;  4C0L A;  3I5H B;  2V4E A;  3S0G A;  1JC2 A;  1MQ1 A;  3A8R A;  3DQE A;  2O2B A;  1GFL A;  5CSN A; 
#chains in the Genus database with same CATH homology
 4MSP A;  1KSM A;  4DXM A;  1ODB A;  3JTD B;  3A4U B;  1S6I A;  5HLO A;  2HJO A;  2Q4U A;  1LIN A;  3BUO B;  3VRN A;  1Q80 A;  1JBZ A;  4DXQ A;  4ETO A;  2PMY A;  2AWL A;  5F6T A;  2A47 A;  5BTT A;  2COL B;  4W6L A;  4MZK A;  3U8A A;  3EK8 A;  3DF0 B;  4W6F A;  2K7B A;  1Q73 A;  4KGE A;  4IK1 A;  1F55 A;  2HGY A;  4HRG A;  1MOV A;  3DQU A;  3E5V A;  1XAE A;  2QT2 A;  4PDZ A;  1SBJ A;  4OCI A;  1W7U A;  4Q7R A;  4W6R A;  4GF6 B;  2LAP A;  3DQJ A;  1NX3 A;  4H3N A;  5LTP A;  2LVJ A;  2WSN A;  3SG2 A;  4GES B;  3CR4 X;  4W6N A;  3ICB A;  5HZU A;  3KO0 A;  1FBV A;  1CMF A;  1KK8 C;  2RH7 A;  4W7C A;  2MLF C;  4ZF3 A;  3LL8 B;  4Q9W A;  4QJ3 B;  1W7J B;  1WDC C;  2LE9 B;  1YVH A;  3GOF A;  1XQM A;  1UHJ A;  1B8L A;  1SY9 A;  5DQB A;  4W73 A;  3GK1 A;  4ZB1 A;  2Y5I A;  4KPI A;  2EC6 B;  4W6J A;  2D8N A;  2MA2 A;  4YGE B;  1QX5 B;  4OV2 A;  5K89 A;  2VZX A;  1RMP A;  1CDN A;  2KQY A;  1F09 A;  2K2A A;  3O4Y A;  2QLG A;  4ZIN A;  4W6B A;  1IJ6 A;  5DTX A;  1E8A A;  1BJF A;  2WCE A;  1TIZ A;  4OR9 B;  4EDO A;  2KBM A;  1F8H A;  1CV7 A;  1BG1 A;  4M2O A;  4MN0 A;  3SRY A;  5DU0 A;  1JBY A;  3PSR A;  3ZNI A;  1K94 A;  5HKY A;  2BL0 B;  2L4I A;  4J89 A;  3NT3 A;  3NSK A;  1ZGQ A;  4W7F A;  4P2Y B;  1DJW A;  2IB6 A;  2HQ8 A;  2A56 B;  4PE0 A;  1DGU A;  1CFD A;  1KFX L;  3OHM B;  4R6B A;  1HUY A;  3PIB A;  4BY4 A;  4KW8 A;  2ZN8 A;  3ZUJ A;  3EVV A;  3W1D A;  3EKH A;  1KWO B;  3SVN A;  1KK7 Y;  4GNK B;  3U0M A;  2JTZ A;  3I5G B;  4DS7 A;  3CGL A;  1EG4 A;  4MRX A;  2O60 A;  4ORB B;  4NDB A;  3RLZ A;  4MVF A;  1UWO A;  5HKW A;  1MXE A;  2L4H A;  2HQZ A;  2JQ6 A;  4HSZ A;  1MHO A;  3OB1 B;  2MBX A;  2DDC A;  3VRR A;  2OTE A;  4YRU A;  1EL4 A;  1WLM A;  5HKZ A;  3TUY B;  5JOL A;  1L7Z A;  1QIW A;  1DJG A;  2PAL A;  1QJT A;  4XJK B;  3WCK A;  2M9G A;  1D1O A;  1OXE A;  2BKI B;  4KW9 A;  1K90 D;  4HQ8 A;  3D0Y A;  5T3I A;  1R6P A;  1TRF A;  1SR6 B;  3PJ5 A;  2VVJ A;  1TCO B;  1Q4A A;  2OTG B;  3M22 A;  2G6Y A;  1U5I A;  3VK1 A;  3UG0 A;  3DQ1 A;  4H48 A;  2QAC A;  4ICB A;  4J88 A;  2JT8 A;  2L50 A;  2WIQ A;  3I5H C;  2P6B B;  4W6G A;  4W72 A;  1FI6 A;  3NEZ A;  1KYR A;  3BQ3 A;  2L98 A;  2O5G A;  5ER5 A;  5D69 A;  3P28 A;  1J7R A;  5HLV A;  1FW4 A;  1EMB A;  1KFU S;  1EH2 A;  1ALW A;  1OMV A;  1G7K A;  1OSA A;  3BUM B;  1JFJ A;  3SIA A;  3E5W A;  1X02 A;  2H2K A;  1PUL A;  1S5G Z;  4JC2 A;  5FHV A;  1UHK A;  2KYC A;  3ST3 A;  4W6C A;  1DF0 A;  1M39 A;  5IBW A;  5I8N A;  4W7A A;  3H1R A;  5CSI A;  2KSP A;  4PPL A;  1HCJ A;  2DUI A;  3PM8 A;  1XK4 C;  1M31 A;  5DKQ A;  4CLN A;  2F33 A;  5BT0 A;  1REC A;  1WRZ A;  1KP5 A;  3GK4 X;  4L9M A;  2I18 A;  2OTB A;  4MEW A;  2KFF A;  2EMO A;  1G8I A;  1YUU A;  1QYF A;  4XOW A;  5EXU A;  4B5Y A;  2IOV A;  2K7C A;  3ADF A;  3FWC A;  1L2O C;  3SVB A;  3EVU A;  2MAZ A;  4W69 A;  2JC2 A;  5D7F A;  1NCZ A;  3TS5 C;  2BEC A;  3AI4 A;  3K21 A;  2JT0 A;  3SG5 A;  1S6J A;  2HCG A;  1K9K A;  3CD9 A;  3K1K A;  3SSP A;  2K7D A;  1H4U A;  4EMQ A;  3TZ1 A;  4DUQ A;  3BOW A;  4OKH A;  5HBD A;  2CBL A;  1NIW A;  4GPL B;  1UP5 A;  1EJ3 A;  3NF0 A;  4YGB B;  4XGY A;  1QVI Y;  2LVK A;  1OZO A;  5FVG A;  3DQM A;  1SPY A;  1WRK A;  3C1V A;  2KOT A;  5BPJ A;  3H4S E;  1A75 A;  4YGC B;  2DUH A;  4YI8 A;  4PFE A;  1YRU B;  4JGE A;  1YVL A;  1CKK A;  2B1U A;  1OMD A;  2LNK A;  4NDC A;  3CR5 X;  3UFZ A;  4PPJ A;  1NP8 A;  1TNX A;  5DY6 A;  1TOP A;  3IF7 A;  4Q7U A;  3EVR A;  2HF5 A;  2Q6P A;  5TNC A;  3SSY A;  2BL0 C;  4IK3 A;  1A4P A;  1B47 A;  2BE4 A;  5AEQ A;  1XO5 A;  4KAG A;  1NPQ A;  2LP3 A;  1NCY A;  2JWW A;  4L13 A;  1WRL A;  4WQ3 A;  1CFP A;  1YHH A;  4IK4 A;  2OGR A;  1N2D A;  1JWD A;  4N5X A;  2SAS A;  1CTR A;  1AUI B;  3I5F B;  3AKB A;  1BMO A;  4LQU A;  3DVE A;  3DQF A;  3JVT C;  2ZN9 A;  2ZMU A;  5H88 A;  4ZF5 A;  2I7A A;  1GGZ A;  4L12 A;  4W6P A;  1EMF A;  3DVJ A;  3DVK A;  2TN4 A;  4C0J A;  4U2V A;  2BCA A;  2MJW B;  3MGF A;  3I5G C;  3SG7 A;  1KYP A;  5DPI A;  1Y1A A;  2C9J A;  4RTC A;  3PN7 B;  1DJI A;  4HQ9 A;  4Q7T A;  3KEV A;  3G9A A;  1MWN A;  4MBE A;  4WRI A;  5DQM A;  2Z1O A;  4JFG A;  3SSK A;  1EME A;  4KW4 A;  4B30 B;  5EBJ A;  2EGD A;  4IL1 A;  4PHN A;  1BOD A;  2KGB C;  3BXB A;  5CSF A;  3TUY C;  4CFQ A;  2KHN A;  2YFP A;  3AAJ A;  2ZRS A;  4CPV A;  4KA9 A;  1ZAC A;  1SL7 A;  3LF4 B;  1NX0 A;  1KCY A;  3VGO A;  2GGZ A;  1C7V A;  1XK4 A;  4W74 A;  1RM9 A;  2M7N A;  3ZWH A;  2SCP A;  5J3X A;  2G3O A;  1NUB A;  4W7D A;  1F4O A;  2M0R A;  4GOB A;  2V4E B;  3TDU A;  2IS9 A;  3FIA A;  2K0J A;  3OB2 B;  2M1U A;  1J55 A;  4DRW A;  3EK7 A;  4ORA B;  2ICR A;  1QS7 A;  4I5L B;  1S6Z A;  4AOM A;  2POX A;  4PE4 A;  1W7S A;  2OJK A;  1S6C A;  4D1E A;  2WOS A;  5F9G A;  3I5I B;  2M7L A;  3SVD A;  3QRX A;  3O6B A;  4LJD C;  4MZL A;  1AVS A;  5DRG A;  5BTT B;  4PHJ A;  4OY4 A;  2AH8 A;  2WSO A;  4PHK A;  4W6K A;  1KYS A;  3FS7 A;  1IQ3 A;  2FCE A;  2G2S B;  2JUL A;  1RMM A;  4W6D A;  2A46 A;  1KQV A;  3TMR A;  3IQO A;  3O77 A;  5B8I B;  3HX4 A;  1J7O A;  4JF9 A;  2MHH A;  1S1E A;  4JQ0 D;  2KDH A;  2OKY A;  3EKJ A;  2KQ6 A;  1K9P A;  2G6X A;  3CS1 A;  3LCP C;  1EML A;  2YE0 A;  1NCX A;  1WLZ A;  5DTZ A;  2GX0 A;  1CDP A;  3SVU A;  3LLE A;  1CLL A;  2FWQ A;  2K61 A;  2LLT A;  1KQM C;  1Y6W A;  2A52 B;  2WUR A;  4HE4 A;  5FVI A;  1RK9 A;  2NXQ A;  2HET A;  3OSR A;  3ST2 A;  1QY3 A;  4UTS A;  2L5X B;  3U0N A;  3U8P A;  3DQH A;  2QRF A;  2BCB A;  3DQC A;  3AKA A;  1J1D A;  4OQW A;  1YRT B;  4ZFS A;  3LK1 A;  1IKU A;  3DQD A;  1EMK A;  4WQ2 A;  4KGF A;  2FOT A;  1A29 A;  4DKN A;  2QLG B;  1AJ5 A;  3GL4 A;  1YZW A;  5HW9 A;  1KFX S;  3VRP A;  2GW4 B;  3LVD A;  4W76 A;  4XVP A;  4GAO A;  3PAT A;  2ZNE A;  4A4C A;  2O29 A;  4W77 A;  1QIV A;  1QYO A;  2QZ0 A;  2YE1 A;  1S26 D;  2YDZ A;  4DKM A;  1OXD A;  2M1K B;  4PAL A;  1F54 A;  2G16 B;  2GV5 A;  3EVP A;  1S36 A;  4RYW A;  4W6M A;  4W6I A;  5CSJ A;  3IQQ A;  1EMA A;  2BBM A;  1J1E A;  4NQG A;  1YX8 A;  2F3Z A;  2AWJ A;  4W6O A;  5AER A;  2A53 B;  2WHU A;  2EHB A;  1B1G A;  1K96 A;  2ZRT A;  2H5R A;  1UHN A;  5DTY A;  2KI4 B;  3LVC A;  3E5T A;  1QLS A;  1QV0 A;  2M49 B;  3CR2 A;  3SJS A;  1N65 A;  4XYN A;  1DTL A;  2WCF A;  1K95 A;  5JJG A;  4DIR A;  5LTQ A;  1GGW A;  2BE6 A;  4ZCV A;  2G6E A;  3I19 A;  1SCM C;  5H89 A;  1ZFS A;  4ANJ A;  1CB1 A;  2DD7 A;  2BBN A;  2H5Q A;  3O78 A;  4JPZ B;  1IRJ A;  2GW3 A;  4GUK A;  4HVF A;  4LJD A;  1SK6 D;  1Q4C A;  3SG6 A;  2B3P A;  1SKT A;  1ZUX A;  4GGF C;  1JFK A;  1YUR A;  2JPT A;  3GK2 A;  3ED8 A;  2BKH B;  2Q57 A;  4UPG A;  1HQV A;  3GB3 A;  3SIB A;  3KHE A;  4W7R A;  1IG5 A;  1LKJ A;  2Y1M A;  5LTR A;  3D0Y B;  1ZGO A;  1HT9 A;  1FI5 A;  1F0B A;  3LK0 A;  3JTD C;  1B8R A;  1NWD A;  3DD4 A;  5AFP A;  4R6D A;  1U5I B;  1S3P A;  5EB7 A;  4W6S A;  1ALV A;  2A48 A;  1KK8 B;  1ZUZ A;  1KFU L;  2DUF A;  1WDC B;  4HRE E;  1JUO A;  4W6A A;  4FQO A;  1BU3 A;  1UHI A;  2PVB A;  4J8A A;  2A4J A;  3SVO A;  3WNX B;  4M2Q A;  3NXA A;  1JBA A;  1BR4 B;  1A2X A;  4IK9 A;  2CCM A;  2G5Z B;  2HGD A;  3ST4 A;  3U0K A;  1MF8 B;  2JNX A;  2HRS A;  2AMI A;  4TZG A;  2QU1 A;  1XVJ A;  3OX6 A;  1QX2 A;  3CFH A;  3S05 A;  4Z4K A;  2ZO6 A;  4YBH B;  3VIC A;  2Z6X A;  1XYD A;  1B7T Y;  4OVN F;  2K2F A;  1DF0 B;  1Z1P A;  2LUC A;  1CFF A;  2LAN A;  2VVH A;  2LMU A;  2M29 A;  2JAD A;  4OGS A;  5I2O A;  2EC6 C;  2AAO A;  2M97 A;  1CMG A;  3SVE A;  3AI5 A;  2LCP A;  2LLS A;  4CFR A;  1QXP A;  2HPW A;  1PVA A;  1PVB A;  1F70 A;  1CFC A;  3OSQ A;  2LV7 A;  1SL9 A;  4PPK A;  4AS8 A;  3VHT A;  3TDZ A;  3CD1 A;  3CBE A;  1XSS A;  1EXR A;  1V1F A;  2GX2 A;  3SSV A;  2BTJ A;  1DGV A;  2RGI A;  1IQ5 A;  3BOW B;  1DJZ A;  3OGO A;  1K8U A;  2Y0G A;  5DPJ A;  2ZFD A;  2JRF A;  2WHT A;  2P4M A;  3DQI A;  1PRW A;  2DDD A;  1SNL A;  2WC8 A;  5EXB A;  1YJF A;  3RM1 A;  1H4B A;  2DOQ A;  5AXI A;  2JXL A;  2LUX A;  4Q9X A;  1DJH A;  1KK7 Z;  2DD9 A;  2AUC A;  4NWS A;  2F3Y A;  1AK8 A;  3ST0 A;  1A75 B;  2HPS A;  2WIS A;  3U8C A;  4YGA A;  5EXC I;  1GQM A;  2VVI A;  1EG3 A;  2NLN A;  3TDI A;  2ZKM X;  4GGF A;  3KF9 A;  5KTG A;  5HZS A;  1KWO C;  1LA3 A;  2PRU A;  1F4Q A;  3CLN A;  3E3R A;  2KI6 C;  1DMO A;  4PE7 A;  2FCD A;  3NSL A;  2BCX A;  1FF1 A;  1OOJ A;  3BYA A;  2LVV A;  1DJY A;  1OMR A;  3BUW B;  2PXS A;  3WXA A;  1TNP A;  2JOJ A;  2LLU A;  4KF4 A;  1QAT A;  2ISD A;  2K8M B;  1M63 B;  1TNQ A;  2F2P A;  3GJ1 A;  2KI6 D;  1C4F A;  4H47 A;  5DPG A;  2IE2 A;  1K2H A;  2FL1 A;  1IJ5 A;  4MRY A;  3IR8 A;  4JEO A;  3GEX A;  4CID A;  2CNP A;  4KF5 C;  1YFP A;  1XFY O;  1F71 A;  1EMG A;  1VRK A;  4HQC A;  4ORC B;  3DF0 A;  3HCM A;  3LF3 A;  1Y1X A;  1SYM A;  1QX7 A;  3RWT A;  2OS8 B;  1BFP A;  1TN4 A;  5KU1 A;  2Y1N A;  4IK5 A;  1SR6 C;  2KAV A;  1UHH A;  4LQT A;  2M8U A;  4E68 A;  5DRF A;  3VRQ A;  2OTG C;  1N0Y A;  3DQ6 A;  5KTY A;  4AQI A;  4XOV A;  5ER4 X;  4MLW A;  3WLC A;  1BLQ A;  2WND A;  1CM1 A;  4GBA A;  4BDU A;  4LJC A;  1TCF A;  4YGD B;  3PFV A;  3CGA A;  1DT7 B;  4TZA A;  4IK8 A;  3D10 A;  4L1I A;  4PE1 A;  2MLE C;  3SS0 A;  1SL8 A;  1QYQ A;  1K9U A;  1CNP A;  1S5G Y;  4GFT A;  4Z4M A;  1CLB A;  1YR5 A;  1RWY A;  3M0W A;  2WCB A;  4BY5 A;  2CT9 A;  3SVS A;  1XA5 A;  3DQN A;  1L2O B;  3WHU B;  1B8C A;  2JNF A;  3KPX A;  4FTG A;  1RJV A;  2G3D B;  3DQ8 A;  1LVC D;  3TS5 B;  3DQ2 A;  2NCP A;  3DQ5 A;  4W75 A;  1RFJ A;  1RRO A;  3DVM A;  4AR7 A;  3NSI A;  4R1E A;  3DPX A;  4EUL A;  3OX5 A;  1LXF C;  1MR8 A;  3CTN A;  4JRB A;  1WY9 A;  1B7T Z;  4ZCU A;  3DPZ A;  3NED A;  3U0L A;  1EMC A;  1Q4D A;  3F45 A;  2E30 A;  4YI9 A;  2QPT A;  4M2P A;  2H6V A;  2H61 C;  1BR1 B;  2H8Q A;  2CXJ A;  5LK4 A;  4XL5 A;  1SRA A;  3CWG A;  1MOU A;  1YHG A;  2L2E A;  3LVA A;  1AJ4 A;  2KYF A;  3SSL A;  1QVI Z;  3CFF A;  4W7X A;  1QTX A;  1B4C A;  4I2Y A;  3W1C A;  5H87 A;  1QAS A;  4RYS A;  2VAD A;  1GL4 A;  3P8U A;  4OHS A;  2QLE A;  4LJB A;  3IP2 A;  1JSA A;  2PSR A;  2I94 A;  2IB5 A;  3SST A;  3DQK A;  1CM4 A;  4I5K A;  1QXT A;  3PAL A;  2EMN A;  1Q4E A;  4Q04 A;  3LA1 A;  2M3W A;  5EHU A;  4IZN A;  1UUS A;  5DKN A;  4H3M A;  1AHR A;  1XFZ O;  4C0K A;  2KFG A;  4NDD A;  4KF5 A;  4LW5 A;  1MUX A;  1DJX A;  4DCK A;  4DXO A;  1Y0V H;  2PAS A;  3BXK A;  3JVT B;  3O2P A;  1RRX A;  4XJK A;  4HRH A;  2AWK A;  4H3L A;  3DQ7 A;  1GGX A;  1J7Q A;  3SVC A;  3BUX B;  2LMV A;  2NZ0 A;  1SCV A;  1IWQ A;  5FYX A;  2B3Q A;  4ZF4 A;  1CDL A;  1PAL A;  1OQP A;  1UUR A;  1R2U A;  5EJU A;  2HFC A;  4ZIO A;  3I5F C;  2AWM A;  3PJB A;  1J7P A;  3PJ7 A;  3LS3 A;  1Y1U A;  4U8D A;  3CFA A;  3EK4 A;  5I2L A;  2KGR A;  4DXN A;  1YUT A;  2H9W A;  5DTL A;  3VRO A;  2WHS A;  3LSA A;  1MXL C;  1XFU O;  4W6H A;  2LP2 A;  5EB6 A;  3ZTF A;  1SMG A;  3PN7 C;  1OE9 B;  4EDS A;  1NX2 A;  5KSZ A;  3AKO A;  1QV1 A;  1A03 A;  2KAY A;  3KCS A;  2FZU A;  1XFW O;  1JF0 A;  3DQA A;  2DUG A;  3A8S A;  3MSE B;  1RTP 1;  3NT9 A;  3V3D A;  1GJY A;  4QJ4 B;  3WHT B;  1BT6 A;  1CDM A;  5J2O A;  1ZGP A;  2OS8 C;  1W7I B;  4P1Q A;  5BQL A;  4PCW A;  2ARL A;  4W7E A;  1YUS A;  2Q91 A;  5PAL A;  4MZJ A;  3DQO A;  1M46 A;  2VAE A;  1B9C A;  2A50 B;  2V4E C;  2H61 A;  3SVR A;  5DPH A;  2L51 A;  3FWB A;  4GGN A;  3RWA A;  2HQW A;  2JT3 A;  1FPW A;  1PK0 D;  5GQQ C;  2V53 A;  5I2Q A;  4PHM A;  5HZO A;  1ZMZ A;  1M45 A;  2ZND A;  4I5N B;  1XFV O;  1C07 A;  4AQJ A;  1V1G A;  2Y4Q A;  3M24 A;  2LHL A;  3I5I C;  1NYA A;  3ZUF A;  2AHA A;  3TMT A;  2OKW A;  1JC1 A;  1XMZ A;  1JF2 A;  4QJ5 B;  2ZO7 A;  1KQM B;  2A54 B;  1BOC A;  3H1O A;  2LHI A;  1BF5 A;  3BUN B;  1W7T A;  4DXI A;  2H5O A;  4W6U A;  1TNW A;  1IGV A;  4USL A;  2KBI A;  1IH0 A;  5G08 A;  2C9I A;  2PXW A;  2I2R E;  2R2I A;  4DXP A;  4JWQ A;  2Z6Y A;  4I5J A;  5HYD A;  2LMT A;  1YX7 A;  1OXF A;  3GJ2 A;  3ZUL A;  1XFX O;  2LC5 A;  1C7W A;  2HQK A;  1H8B A;  5AAN A;  3SG3 A;  3CZT X;  1NX1 A;  1K93 D;  3DQ9 A;  2L0P A;  5HZT A;  1LA0 A;  1PSB A;  2CTN A;  1SW8 A;  3AAK A;  4EN1 A;  1OZS A;  1CLM A;  4N1G A;  2QLI A;  2Z6Z A;  4W6T A;  2KFH A;  3DQ3 A;  3OP0 A;  1AP4 A;  1JC0 A;  4P76 A;  2NCO A;  2H5P A;  5AQB B;  4P5O E;  3KCT A;  3DQL A;  3SG4 A;  3BXA A;  4ORN A;  3VHT B;  2O24 A;  4ZBL A;  1G4Y R;  2JZI A;  2JXC A;  2K7O A;  4A4B A;  2JU0 A;  2EMD A;  2G9B A;  3NSO A;  4OJ0 A;  4KEX A;  1XA9 A;  2GGM A;  3BX9 A;  1H6R A;  1NSH A;  5CPV A;  3SV5 A;  1QLK A;  1TTX A;  1KSO A;  3DQ4 A;  2G2B A;  3WLD A;  2JTT A;  4N3D A;  4B30 A;  2MRD A;  5FVF A;  2OPO A;  4F0Z B;  1DVI A;  1MYW A;  5HGE A;  2KAX A;  2KNE A;  2ZMW A;  3CB9 A;  1Z1Q A;  1Q4B A;  2F2O A;  1PSR A;  1RMO A;  1YJ2 A;  1UIS A;  2LM5 A;  1SCM B;  2E6W A;  3PLF B;  3DPW A;  1YHI A;  3BXC A;  1G33 A;  3SSH A;  2WOR A;  4N1F A;  1B9A A;  5DKR A;  1EMM A;  2FJU B;  1YTZ C;  2LVI A;  2DUE A;  2F8P A;  4TNC A;  1ZOT B;  2KI4 C;  2VRG A;  2QLH A;  4C0L A;  3I5H B;  2V4E A;  1JC2 A;  1MQ1 A;  3A8R A;  3DQE A;  2O2B A;  1GFL A;  5CSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...