3EK4A

Calcium-saturated gcamp2 monomer
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
348
Chain Sequence
b'KTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 111
structure length 348
sequence length 367
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek4A02
2M7LA 1CKKA 2G16B 4J89A 2M97A 2BCXA 4MVFA 1SL8A 1SW8A 5I8NA 5HZSA 2F3ZA 3DPWA 4YGCB 1RTP1 1CM1A 1DJZA 1TNQA 2AMIA 1EXRA 3BUNB 5KTYA 1UURA 2O2BA 2V4EB 2Y4QA 4PHNA 2E30A 2ZMWA 3RWAA 1KQMB 2EHBA 4DXQA 2BTJA 5TNCA 5AQBB 2ZNDA 3JVTC 2KI6D 3DVEA 2Y5IA 4Z4MA 4AR7A 2KYFA 2VRGA 4ORNA 1Q80A 1N2DA 1BT6A 1W7JB 4W6KA 1QATA 3VROA 4H48A 2JULA 4JC2A 4OV2A 1YHHA 4YI8A 1TCOB 3DQ4A 3LCPC 4CFQA 1DGUA 3TMTA 1SCMC 1F09A 1RK9A 5AFPA 4H3MA 1CDMA 4PALA 3TDIA 2MLFC 3SVOA 3ST0A 4NDBA 1CTRA 4HRGA 5LTPA 4I5KA 4NQGA 3WHTB 1UHNA 2OGRA 3NSLA 5DPGA 1CFCA 2M7NA 1RMOA 3LLEA 4YGBB 1ZOTB 2RH7A 3PN7C 1EMLA 1JF2A 5BTTB 3I5GC 3SVBA 4W6FA 3DQHA 4R6DA 3U8PA 5EBJA 1JC1A 4CPVA 5I2QA 1QLKA 1SY9A 2KQ6A 1S1EA 2AUCA 2B3QA 2Y1MA 3CR5X 1BJFA 4HE4A 1YJFA 4DXNA 1GGZA 4ICBA 4HQ9A 3EK4A 4WQ3A 3SSTA 5HZTA 1B7TZ 1N0YA 1NX0A 1MXLC 4W6LA 4HVFA 1LVCD 2MHHA 1XA5A 3CS1A 4EDSA 1OOJA 1BG1A 2LUXA 1MYWA 3DQ3A 3BYAA 2CNPA 2GV5A 4KF5C 4KGEA 1YZWA 4W6CA 2JT8A 5D69A 1AK8A 5I2OA 4I5LB 2O24A 3BXCA 1MR8A 3PM8A 1QIWA 2HFCA 2AWLA 1A2XA 3WNXB 2WSNA 1RECA 4TZGA 3SJSA 4QJ4B 4W6GA 4A4CA 2KBMA 3U0LA 4LQUA 5DRGA 5DQMA 5BTTA 1A4PA 3ST2A 1XAEA 3DVMA 1DJHA 3FWBA 4ZBLA 1YJ2A 1LA0A 3TUYC 5H88A 1XYDA 1K8UA 5AERA 1DJIA 3NXAA 4I2YA 1CFDA 4LJDC 2K61A 5B8IB 3BOWA 1AJ5A 3SRYA 4YRUA 1N65A 5DTLA 3U0KA 1K9PA 1FBVA 2VVHA 1A29A 3SSPA 1B4CA 4Z4KA 4DCKA 1QS7A 3LF4B 2LVVA 3I5FB 1F70A 1MWNA 4I5JA 2BL0B 4AQIA 3WXAA 4FTGA 4W6AA 3GK2A 1LKJA 1IJ5A 1CB1A 3LVCA 1NP8A 1Z1PA 2PRUA 4LW5A 1E8AA 2K7CA 4W69A 1CDLA 2ICRA 2KFHA 1KWOC 3SVSA 3CR4X 1B7TY 1EMCA 1NSHA 3SSKA 1JF0A 1CDNA 4W73A 2YE0A 4W6BA 1NCXA 1OSAA 2WISA 4WQ2A 3FS7A 4E68A 5GQQC 4OKHA 5HLVA 4PHMA 1RM9A 1UISA 4ZCVA 4BY5A 2EMDA 1YHGA 3SG4A 2EC6B 3IQOA 3W1DA 3SVNA 1L2OB 3WHUB 1JBZA 4Q7TA 1IJ6A 1FPWA 2L98A 2HF5A 3CZTX 3LA1A 3NT9A 1Y0VH 5HKZA 4W7XA 1G7KA 1RRXA 1M31A 3DQUA 4W74A 1BODA 4A4BA 1JBYA 1SKTA 3TMRA 4GFTA 2KDHA 2PMYA 3CLNA 4HQCA 4W6PA 1J7PA 1QXTA 1B47A 1KK8B 4FQOA 4HRHA 2QU1A 5D7FA 3U8CA 1QXPA 2F2PA 1Q4CA 2OKWA 4B30B 2ZFDA 4Q9XA 1TCFA 4OJ0A 5HZUA 2M3WA 1BLQA 3SVEA 4BDUA 2K2FA 2OTGC 3O77A 4AOMA 1K9UA 2AH8A 2WNDA 4P76A 3I5HB 1KQMC 2JXCA 1F4OA 3BUMB 1S6ZA 2H2KA 4W7AA 2F33A 2MA2A 1YHIA 3BXBA 2GW3A 1QX7A 2LANA 2JXLA 1SYMA 2KGRA 1HQVA 1EMKA 3CR2A 1FI6A 1LXFC 4GGFA 2WIQA 2O5GA 4DKMA 1QJTA 4JGEA 4KW4A 4Q7RA 4N1GA 3NEDA 2KYCA 4MZKA 4IK9A 1RFJA 3KF9A 1X02A 1CLMA 4KAGA 2QLEA 3DQOA 4ORAB 3VHTB 2WC8A 1KFXS 4RTCA 2DUFA 2A47A 1J1DA 4L9MA 4KA9A 2JQ6A 2QZ0A 5EHUA 1ALVA 2JZIA 4JRBA 1ZMZA 5FYXA 1HT9A 3I5IB 4PE4A 1Q4DA 2H61A 3I19A 4KW8A 2KNEA 3SVDA 2FL1A 4L1IA 5K89A 3VK1A 1K94A 3PALA 2OTEA 1CFPA 1PSRA 3CWGA 2FJUB 4Q7UA 4N3DA 1QIVA 1PVAA 1C4FA 2ZRTA 3F45A 3SG3A 4N5XA 4XVPA 5DKQA 2QLHA 4JPZB 3E3RA 2K7DA 4ZF5A 3SSVA 2M1KB 3NSIA 2H5RA 3WCKA 4XGYA 2G9BA 5F9GA 1SPYA 3C1VA 2Q6PA 1U5IA 4W77A 3BXAA 2I94A 3O4YA 2KBIA 2H6VA 2F3YA 2GGZA 4W6RA 2O29A 1MOUA 4F0ZB 1CV7A 3GEXA 2HPSA 3FWCA 4OQWA 1S26D 1OZOA 5DPJA 4C0KA 2G3DB 2BKHB 4Q04A 2JNFA 3IP2A 4W72A 5DY6A 4NDCA 1XA9A 2L4HA 4ZCUA 1BFPA 1YR5A 2LLUA 5CSIA 4J88A 4JFGA 3CGLA 3IQQA 4YGAA 4UTSA 1H8BA 1FF1A 1XQMA 2POXA 3DQDA 1A75B 3BUXB 4DXOA 3SIAA 1J7RA 1XK4A 4I5NB 3ST3A 3DF0B 4W76A 4PCWA 3SVRA 3KO0A 1YURA 2LNKA 4EN1A 1KK7Z 5LTRA 4R1EA 1AVSA 4W6SA 4W6TA 4PE0A 1XFWO 3BUOB 4GPLB 4H47A 1KCYA 3AI4A 3NSKA 3SSHA 1TNWA 3I5FC 1EJ3A 2LUCA 4GGNA 4DXMA 1S36A 4M2PA 4ZIOA 3QRXA 4MRYA 3LK1A 4ORCB 3ZNIA 1KQVA 2VZXA 2FOTA 3DQ7A 2BBMA 1OMDA 2A53B 1B9CA 2CXJA 2GW4B 5EXUA 4EULA 2F8PA 4C0LA 4P5OE 1NUBA 1IH0A 3K1KA 1SR6C 3EVVA 3EKJA 4DUQA 1KP5A 2M9GA 1DJXA 2V4EA 1KYPA 4CLNA 2L51A 2PXWA 3SVCA 4H3LA 2Z6XA 4ANJA 3PJ5A 4YI9A 5KSZA 3BX9A 4NWSA 3U0NA 2GGMA 1Y1AA 1F8HA 2Z1OA 3DQ6A 3AKAA 2HPWA 2L2EA 1L2OC 3NSOA 1XMZA 4GGFC 2LHLA 1YTZC 2KI4B 1CM4A 1NX1A 3AKOA 1XFYO 3TDZA 3DQCA 3DQNA 5DTXA 3LF3A 3M0WA 1H6RA 2DD7A 2MLEC 2I18A 5EB7A 2HQ8A 1S6JA 5BQLA 3PLFB 4KGFA 1KK8C 1K93D 3EVUA 3P28A 1WRZA 2ZKMX 1J7QA 2H61C 2DUGA 3JTDB 1BR4B 4ZINA 3E5TA 1QTXA 1GJYA 3O78A 2DDDA 1MQ1A 4MBEA 1WDCB 1BMOA 2KGBC 1YX8A 1G33A 3VICA 2ZN9A 2IE2A 2FWQA 3G9AA 2PVBA 1CFFA 2BE4A 1XVJA 1ZFSA 2KI6C 2H5PA 2I7AA 1Y1XA 4MEWA 3NEZA 2WSOA 4AS8A 2QRFA 2QT2A 2WCEA 1CLBA 4JF9A 1CLLA 3RM1A 1AJ4A 5FVFA 4GBAA 3A4UB 2Z6YA 2Y1NA 3ICBA 3IF7A 5J2OA 1J55A 1JUOA 1UP5A 1W7UA 2C9JA 1TIZA 2P6BB 5HLOA 2WCFA 2NCPA 4GNKB 1QYOA 4OCIA 2WHSA 3LVDA 3W1CA 3BXKA 2K7OA 1TNXA 1C7WA 2H8QA 1XSSA 4MZLA 1NPQA 4PPJA 1OXEA 5HW9A 1TOPA 2M29A 1RJVA 4W6JA 1JFKA 3DQLA 5JOLA 4OVNF 1SL7A 5JJGA 2V53A 2Y0GA 3DQFA 1XK4C 3LSAA 1QYQA 2B3PA 4DIRA 2Q91A 4HREE 1F71A 1OQPA 1XFVO 4R6BA 3O2PA 1DJGA 2FCDA 3KHEA 1TNPA 3RLZA 4DXPA 1YRUB 5KTGA 5DU0A 2KOTA 1M46A 1ZUXA 3H1RA 1UHHA 2O60A 3NF0A 4L12A 1KFXL 4DS7A 4J8AA 2JTTA 3PN7B 5LK4A 1NCYA 3OSQA 2HGDA 2HQZA 3GJ1A 4YGEB 3RWTA 4GUKA 3CFAA 3SSYA 1CNPA 1PRWA 4N1FA 1TN4A 5FVIA 1AHRA 1VRKA 1K96A 2EMNA 2DUHA 4GF6B 2LE9B 3EVPA 3VRQA 3D10A 2LVIA 4KW9A 4JEOA 2ZO7A 2ZO6A 5BT0A 1S6IA 3AI5A 4ETOA 2V4EC 3DD4A 2B1UA 1S5GZ 4M2OA 3DVJA 1BF5A 1SBJA 5F6TA 3KCTA 1YVLA 2CT9A 4P1QA 2CTNA 4NDDA 1KYSA 1DT7B 4PHJA 2K8MB 2G6XA 1GFLA 3E5WA 1M39A 1EMGA 4DKNA 2MAZA 1K9KA 4W7CA 4W6NA 3GL4A 1IQ3A 2QLGB 1GGWA 1JBAA 4WRIA 5DQBA 3PSRA 1Q4BA 1XFXO 3GOFA 1XFUO 3HX4A 4ZB1A 4XYNA 5J3XA 3DQMA 2I2RE 2LMTA 3KPXA 2D8NA 2K2AA 2G2BA 4RYSA 3PATA 2LLSA 1IGVA 2BBNA 4B30A 4PPLA 2CBLA 4HSZA 2Q57A 5PALA 3ST4A 3OB2B 4PHKA 2E6WA 1KSOA 2YFPA 4QJ5B 2H5QA 5AANA 5LTQA 3ADFA 2OS8B 4JWQA 1QLSA 2JTZA 3CFFA 2JADA 1EMFA 4U2VA 1KWOB 1ZUZA 2QACA 1HUYA 3D0YB 3SIBA 1A03A 4ZFSA 1S6CA 2A50B 4IK1A 1QX5B 1M45A 3SG6A 2KFGA 2M1UA 2QLGA 5ER4X 2VVJA 4ZF4A 4JQ0D 1GGXA 1EMBA 2QPTA 5DTZA 3TS5B 4OHSA 3EK7A 1S5GY 5AXIA 2KAXA 3DPXA 1M63B 4MRXA 2MBXA 3VGOA 1ALWA 5EB6A 1HCJA 2BKIB 1SRAA 3VHTA 5HBDA 5IBWA 1QX2A 2LM5A 4CIDA 4W6IA 2LMUA 1L7ZA 1TRFA 1MOVA 1DVIA 3ED8A 1RMPA 1SL9A 5EXBA 2DDCA 4W75A 4KF4A 1DJYA 1B1GA 5EJUA 2EGDA 1F55A 3PJBA 2JRFA 1MUXA 3PFVA 2NLNA 1ZGOA 1K2HA 1YUUA 2LMVA 4DRWA 1XO5A 1W7TA 4C0JA 1W7IB 4MZJA 4CFRA 2YE1A 3PJ7A 2AWJA 1EG3A 4MLWA 5T3IA 3ZULA 1GQMA 3D0YA 4YGDB 1SMGA 4W7DA 2JC2A 2OTGB 3CD9A 3OP0A 3VRNA 2LLTA 5BPJA 1KFUS 3OX6A 1WRLA 5DKNA 1EMMA 1J1EA 1EL4A 2WURA 3MSEB 2BL0C 1W7SA 1IG5A 2KHNA 3SG7A 1AUIB 5G08A 5DPIA 3IR8A 2VAEA 3NT3A 1SNLA 2AAOA 2ISDA 3OX5A 2OJKA 4LJCA 5DKRA 1AP4A 1IQ5A 3SS0A 1B8RA 1BOCA 3SV5A 1B8LA 1A75A 1FI5A 1OXFA 4XJKB 1YFPA 2L5XB 3DVKA 1G4YR 3DF0A 5KU1A 3GJ2A 1BU3A 1OMVA 1SK6D 2YDZA 1PALA 2GX0A 4W7FA 2EC6C 3UG0A 2NCOA 1YVHA 1C07A 2LAPA 2ARLA 1IRJA 1EG4A 5HZOA 3CFHA 2HQKA 1Z1QA 2QLIA 1NWDA 3OB1B 3ZUFA 1JC0A 3BOWB 4MSPA 1LINA 2F2OA 1DF0B 5CSNA 3GK4X 4LQTA 3S05A 4IZNA 3U8AA 3DQ1A 3O6BA 1WY9A 3A8RA 1CMGA 2VADA 2H9WA 5H87A 2FCEA 1KK7Y 2JNXA 3M24A 2FZUA 5CSFA 2MRDA 2A4JA 2M49B 3M22A 1Q4EA 2NZ0A 1MHOA 3I5HC 2PXSA 2A54B 4XJKA 1YRTB 2TN4A 2PASA 5ER5A 2BCAA 2EMOA 1K90D 3KCSA 3OGOA 1WRKA 3BQ3A 1C7VA 5EXCI 1B9AA 2WCBA 3LVAA 4PFEA 3ZWHA 1DTLA 1H4BA 1IWQA 1K95A 2WHTA 3VRRA 2A46A 1PULA 3AAKA 2KAVA 1QASA 1PK0D 5CSJA 1NX2A 4OR9B 1DF0A 4U8DA 3JVTB 2PSRA 2K0JA 1KYRA 2HCGA 3SG5A 3CTNA 4IK4A 3OSRA 1F0BA 4GOBA 2R2IA 4HQ8A 1JWDA 3P8UA 2NXQA 3I5IC 3FIAA 4W7EA 1G8IA 1S3PA 2JT3A 4IL1A 2JPTA 3V3DA 3DQEA 1SCMB 3K21A 2IOVA 4IK8A 2WOSA 4D1EA 2WORA 1Q73A 2LVKA 2BE6A 3DQ8A 2KSPA 4M2QA 3MGFA 4IK5A 2CCMA 2Q4UA 4W6UA 2AWKA 4YBHB 2L4IA 2OS8C 3GB3A 3AKBA 2IB6A 2HETA 2G6EA 1XFZO 4P2YB 1UUSA 1SR6B 1QY3A 4DXIA 4OGSA 1QVIZ 1QV0A 5HKYA 3GK1A 1F4QA 1OE9B 1IKUA 3I5GB 2M0RA 2HJOA 3ZTFA 1BR1B 3H4SE 2BECA 1UHKA 3TS5C 1ODBA 2AHAA 1FW4A 3CGAA 2BCBA 1QYFA 2HGYA 1CDPA 2LC5A 1PSBA 1R2UA 3VRPA 4H3NA 1PVBA 4IK3A 1UWOA 1CMFA 3EK8A 4USLA 1B8CA 2ZNEA 1GL4A 2OKYA 2KAYA 4XOWA 3DQJA 5AEQA 2LV7A 1YUSA 2H5OA 1EMAA 5HKWA 1JSAA 1KSMA 3DQIA 1NIWA 4ZF3A 2AWMA 1YX7A 3LL8B 3DQ5A 1UHJA 1JFJA 2G5ZB 3WLDA 4W6MA 4AQJA 4GAOA 3LS3A 2COLB 4PE7A 2G2SB 3WLCA 1RMMA 3LK0A 1MXEA 3DPZA 4TNCA 2OPOA 5HGEA 2DUIA 2OTBA 4GESB 3SG2A 4ORBB 3DQ2A 4RYWA 3KEVA 3HCMA 1Q4AA 2K7BA 3U0MA 4LJBA 1LA3A 2IB5A 1YUTA 5DTYA 2LVJA 5DRFA 1UHIA 3CB9A 3CBEA 3TUYB 4EMQA 1DJWA 2L50A 1WLZA 2HQWA 2HRSA 3SVUA 3TDUA 1H4UA 2JT0A 2Z6ZA 1J7OA 1U5IB 1QV1A 1RWYA 2A56B 3OHMB 2C9IA 2A48A 1EH2A 1NCZA 3CD1A 2GX2A 2M8UA 4MN0A 4XL5A 2KFFA 2LHIA 3UFZA 3E5VA 5H89A 1RROA 3ZUJA 1Y1UA 1ZGQA 4W7RA 1QVIY 4PDZA 1R6PA 1JC2A 4OY4A 1ZACA 2RGIA 4KF5A 2ZRSA 1DGVA 1MF8B 4L13A 4KEXA 2LP2A 1KFUL 1NYAA 3DQ9A 2P4MA 2A52B 1D1OA 1DMOA 5FHVA 1WLMA 3TZ1A 4W6HA 1EMEA 2MJWB 4W6OA 2WHUA 2JWWA 2LP3A 1F54A 2L0PA 2DD9A 2G6YA 2KI4C 1NX3A 4B5YA 4QJ3B 5HYDA 4TZAA 4BY4A 3EVRA 2JU0A 1OMRA 2DOQA 1OXDA 1V1FA 2SCPA 2ZN8A 2SASA 4XOVA 4KPIA 3BUWB 2DUEA 4EDOA 2VVIA 5DPHA 3A8SA 3DQAA 1V1GA 1TTXA 4LJDA 2KQYA 2IS9A 4W6DA 4PE1A 1SCVA 1ZGPA 2PALA 3DQKA 3AAJA 4PPKA 3SSLA 3JTDC 1Y6WA 3PIBA 1OZSA 2ZMUA 3EKHA 2LCPA 5FVGA 2G3OA 2JOJA 4Q9WA 1WDCC 5I2LA 5CPVA 4UPGA 3H1OA
chains in the Genus database with same CATH superfamily
2M7LA 1CKKA 2G16B 4J89A 2M97A 2BCXA 4MVFA 1SL8A 1SW8A 3CZ2A 5I8NA 5HZSA 2F3ZA 3DPWA 4YGCB 1RTP1 1CM1A 1DJZA 1TNQA 3FE9A 2AMIA 1EXRA 3BUNB 5KTYA 1UURA 2O2BA 2V4EB 2Y4QA 4PHNA 2E30A 2ZMWA 3RWAA 1KQMB 2EHBA 4DXQA 2BTJA 5TNCA 5AQBB 1OOHA 2ZNDA 3JVTC 2KI6D 3DVEA 2Y5IA 4Z4MA 4AR7A 2KYFA 2VRGA 4INWA 4ORNA 1Q80A 1N2DA 3Q8IA 1BT6A 3CZ0A 1W7JB 4W6KA 1QATA 3VROA 4H48A 2JULA 4JC2A 1TUZA 4OV2A 1YHHA 3IVTA 4YI8A 3S0GA 1TCOB 3DQ4A 3LCPC 4CFQA 1DGUA 3TMTA 1SCMC 1F09A 1RK9A 5AFPA 4JD9A 4H3MA 1CDMA 4PALA 3TDIA 2MLFC 3DYEA 3SVOA 3ST0A 4NDBA 1CTRA 4HRGA 5LTPA 4I5KA 4NQGA 3WHTB 1UHNA 2OGRA 3SS3A 3NSLA 5DPGA 1CFCA 2M7NA 1RMOA 3LLEA 4YGBB 1ZOTB 2RH7A 3PN7C 1EMLA 1JF2A 5BTTB 3I5GC 3SVBA 4W6FA 3DQHA 4R6DA 3U8PA 5EBJA 1JC1A 3SS4A 4CPVA 5I2QA 1QLKA 1SY9A 2KQ6A 1S1EA 2AUCA 2B3QA 2Y1MA 3CR5X 1BJFA 4HE4A 1YJFA 4DXNA 1GGZA 4ICBA 4HQ9A 3EK4A 4WQ3A 3SSTA 5HZTA 1B7TZ 1N0YA 1NX0A 1MXLC 4W6LA 4HVFA 1LVCD 2MHHA 1XA5A 3CS1A 3V2LA 4EDSA 1OOJA 1BG1A 2LUXA 1MYWA 3DQ3A 3BYAA 2CNPA 1OOFA 2GV5A 4KF5C 4KGEA 1YZWA 4W6CA 2JT8A 5D69A 1AK8A 5I2OA 4I5LB 2WCMA 2O24A 3BXCA 1MR8A 3PM8A 1QIWA 2HFCA 2AWLA 1A2XA 3WNXB 2WSNA 1RECA 4TZGA 3SJSA 4QJ4B 4W6GA 4A4CA 3B86A 2KBMA 3U0LA 4LQUA 5DRGA 5DQMA 5BTTA 1A4PA 3D75A 3ST2A 1XAEA 3DVMA 1DJHA 3FWBA 4ZBLA 1YJ2A 1LA0A 3TUYC 5H88A 1XYDA 2WCLA 1K8UA 5AERA 1DJIA 3NXAA 4I2YA 1CFDA 4LJDC 2K61A 5B8IB 3BOWA 1AJ5A 3SRYA 4YRUA 1N65A 5DTLA 3U0KA 1K9PA 4F7FA 1FBVA 2VVHA 1A29A 3SSPA 1B4CA 4Z4KA 4DCKA 1QS7A 3LF4B 2ERBA 2LVVA 3I5FB 1F70A 1MWNA 4I5JA 2BL0B 2KLDA 4AQIA 3WXAA 4FTGA 4W6AA 3GK2A 1LKJA 1IJ5A 1CB1A 3LVCA 1NP8A 1Z1PA 2QDIA 2PRUA 4LW5A 1E8AA 2K7CA 4W69A 1CDLA 2ICRA 2KFHA 1KWOC 3SVSA 3CR4X 1B7TY 1EMCA 1NSHA 3SSKA 1JF0A 1CDNA 4W73A 2YE0A 4W6BA 1NCXA 1OSAA 2WISA 4WQ2A 3FS7A 3L4AA 4E68A 5GQQC 4OKHA 5HLVA 4PHMA 1RM9A 1UISA 4ZCVA 1YHGA 2EMDA 4BY5A 3SG4A 2EC6B 3IQOA 3W1DA 3SVNA 1L2OB 3WHUB 1JBZA 4Q7TA 1IJ6A 1FPWA 2L98A 2HF5A 3CZTX 3LA1A 3NT9A 1Y0VH 5HKZA 4W7XA 3S0FA 1G7KA 1RRXA 1M31A 2QEVA 3DQUA 1BODA 4A4BA 4W74A 3PM2A 1JBYA 1SKTA 3TMRA 4GFTA 2KDHA 2P71A 2PMYA 3CLNA 4HQCA 4W6PA 1J7PA 1QXTA 1B47A 1KK8B 4FQOA 4HRHA 2QU1A 5D7FA 3U8CA 1QXPA 1LS8A 2F2PA 1Q4CA 2OKWA 4B30B 2ZFDA 4Q9XA 1TCFA 4OJ0A 5HZUA 2M3WA 1BLQA 3SVEA 3B87A 4BDUA 2K2FA 2L2CA 2OTGC 3O77A 4AOMA 1K9UA 2AH8A 2WNDA 4P76A 3I5HB 1KQMC 2JXCA 1F4OA 3BUMB 1S6ZA 2H2KA 4W7AA 2F33A 2MA2A 1YHIA 3BXBA 2GW3A 1QX7A 2LANA 2JXLA 1SYMA 2KGRA 1HQVA 1EMKA 3CR2A 1FI6A 1LXFC 2JPOA 4OZDA 4GGFA 2WIQA 2O5GA 4DKMA 1QJTA 4JGEA 4KW4A 4Q7RA 4N1GA 3NEDA 2KYCA 4MZKA 4IK9A 1RFJA 3KF9A 1X02A 1CLMA 3EG5B 4KAGA 2QLEA 3DQOA 4ORAB 3VHTB 2WC8A 1KFXS 4RTCA 2DUFA 2A47A 1J1DA 4L9MA 4KA9A 2JQ6A 2QZ0A 5EHUA 1ALVA 2JZIA 4JRBA 1ZMZA 5FYXA 1HT9A 3I5IB 4PE4A 1Q4DA 2H61A 3I19A 4KW8A 2KNEA 3SVDA 2FL1A 4L1IA 5K89A 3VK1A 1K94A 3PALA 2OTEA 1CFPA 2H8VA 1PSRA 3CWGA 2FJUB 4Q7UA 4N3DA 1QIVA 1PVAA 1C4FA 2ZRTA 3F45A 3SG3A 4N5XA 4XVPA 5DKQA 4KYNA 2QLHA 4JPZB 3E3RA 2K7DA 4ZF5A 2QEOA 3SSVA 2M1KB 3NSIA 3PJIA 2H5RA 3WCKA 4XGYA 2G9BA 5F9GA 1SPYA 3C1VA 2Q6PA 1U5IA 4W77A 3BXAA 2I94A 3O4YA 2KBIA 2H6VA 2F3YA 2GGZA 4W6RA 2O29A 1MOUA 4F0ZB 1CV7A 3GEXA 2HPSA 3FWCA 4OQWA 1S26D 1OZOA 5DPJA 4C0KA 2G3DB 2BKHB 4Q04A 2JNFA 5D3OA 3IP2A 4W72A 5DY6A 4NDCA 1XA9A 2L4HA 4ZCUA 1BFPA 1YR5A 2LLUA 5CSIA 4J88A 4JFGA 3CGLA 1DELA 3IQQA 4YGAA 4UTSA 1H8BA 1FF1A 1XQMA 2POXA 3DQDA 1A75B 3BUXB 4DXOA 3SIAA 1J7RA 3N7HA 1XK4A 4I5NB 3ST3A 3DF0B 4W76A 3CABA 4PCWA 3SVRA 3KO0A 2KLEA 1YURA 2LNKA 3R1VA 4EN1A 3FE8A 1KK7Z 5LTRA 4R1EA 1AVSA 4W6SA 4W6TA 4PE0A 1XFWO 3BUOB 4GPLB 4H47A 1KCYA 3AI4A 3NSKA 3SSHA 1TNWA 3I5FC 1EJ3A 2LUCA 3K1EA 4GGNA 4DXMA 1S36A 4M2PA 4ZIOA 3QRXA 4MRYA 3LK1A 3B88A 4ORCB 3ZNIA 1KQVA 5DICA 2VZXA 2FOTA 3DQ7A 2BBMA 1OMDA 2A53B 1B9CA 2CXJA 2GW4B 5EXUA 4EULA 2F8PA 4C0LA 4P5OE 1NUBA 1IH0A 3K1KA 1SR6C 3EVVA 3EKJA 4DUQA 1KP5A 2M9GA 1C3ZA 1DJXA 2V4EA 1KYPA 4CLNA 2L51A 2PXWA 1IIOA 3SVCA 4H3LA 2Z6XA 4ANJA 3PJ5A 4YI9A 5KSZA 2QEBA 3BX9A 4NWSA 3U0NA 2GGMA 1Y1AA 1F8HA 2Z1OA 3DQ6A 3AKAA 2HPWA 3BFBA 2L2EA 1L2OC 3NSOA 1XMZA 4GGFC 2LHLA 1YTZC 2KI4B 1CM4A 1NX1A 3AKOA 1XFYO 3TDZA 3DQCA 3DQNA 5DTXA 3LF3A 3M0WA 1H6RA 2DD7A 2MLEC 2I18A 5EB7A 2HQ8A 1S6JA 5BQLA 3PLFB 4KGFA 1KK8C 1K93D 3EVUA 3L47A 3P28A 1WRZA 2ZKMX 1J7QA 2H61C 2DUGA 3JTDB 1BR4B 4ZINA 3E5TA 1QTXA 1XFRA 1GJYA 3O78A 2DDDA 1MQ1A 4MBEA 1WDCB 1BMOA 2KGBC 3D74A 1YX8A 1G33A 3VICA 2ZN9A 2IE2A 3S0DA 2FWQA 3G9AA 2PVBA 1CFFA 2BE4A 1XVJA 1ZFSA 2KI6C 2H5PA 2I7AA 1Y1XA 4MEWA 3NEZA 2WSOA 4AS8A 2QRFA 2QT2A 1DC1A 3RZSA 2WCEA 1CLBA 4JF9A 1CLLA 2PQLA 3RM1A 2WCJA 1AJ4A 3CDNA 5FVFA 4GBAA 3A4UB 2Z6YA 2Y1NA 3ICBA 3IF7A 5J2OA 1J55A 1JUOA 1T14A 1UP5A 1W7UA 3VB1A 2C9JA 1TIZA 2P6BB 5HLOA 2WCFA 2NCPA 4GNKB 1QYOA 4OCIA 2WHSA 3LVDA 3W1CA 3BXKA 2K7OA 1TNXA 1C7WA 2H8QA 1XSSA 4MZLA 1NPQA 4PPJA 1OXEA 5HW9A 1TOPA 2M29A 1RJVA 3B7AA 4W6JA 1JFKA 3DQLA 4INXA 5JOLA 4OVNF 1SL7A 5JJGA 2V53A 2Y0GA 3DQFA 1XK4C 3LSAA 1QYQA 2B3PA 4DIRA 2Q91A 4HREE 3CYZA 1F71A 1OQPA 1XFVO 4R6BA 3O2PA 3D77A 1DJGA 3D76A 2FCDA 3KHEA 1TNPA 3RLZA 4DXPA 1YRUB 5KTGA 5DU0A 2KOTA 1M46A 1ZUXA 3H1RA 1UHHA 2O60A 3NF0A 4L12A 5FI2A 1KFXL 4DS7A 4J8AA 2JTTA 3PN7B 5LK4A 1NCYA 1OW4A 3OSQA 2HGDA 2HQZA 3GJ1A 4YGEB 3RWTA 4GUKA 3CFAA 3SSYA 1CNPA 1PRWA 4N1FA 1TN4A 1TUJA 5FVIA 3S0AA 1AHRA 1VRKA 1K96A 2EMNA 2DUHA 4GF6B 2LE9B 3EVPA 3VRQA 3D10A 4JKTA 2LVIA 4KW9A 4JEOA 1DEKA 2ZO7A 2ZO6A 5BT0A 1S6IA 3AI5A 4ETOA 2V4EC 3DD4A 2B1UA 1S5GZ 3NGVA 4M2OA 3DVJA 1BF5A 1SBJA 5F6TA 3KCTA 1YVLA 2CT9A 4P1QA 2CTNA 3UNWA 4NDDA 1KYSA 3DZTA 1DT7B 5HL1A 4PHJA 2K8MB 2G6XA 1GFLA 3E5WA 1M39A 1EMGA 4DKNA 2MAZA 1K9KA 4W7CA 4W6NA 2YGUA 3GL4A 1IQ3A 2QLGB 3CZ1A 3BFHA 1GGWA 2K60A 2BNXA 4WRIA 1JBAA 5DQBA 3PSRA 1Q4BA 1XFXO 3GOFA 1XFUO 3HX4A 4ZB1A 3R1PA 4XYNA 5J3XA 3DQMA 2I2RE 2LMTA 1W9ZA 3KPXA 2D8NA 2K2AA 2G2BA 4RYSA 3PATA 2LLSA 1IGVA 2BBNA 4B30A 4PPLA 5FI7A 2CBLA 4HSZA 2Q57A 5PALA 3ST4A 3OB2B 4PHKA 2E6WA 2WCHA 1KSOA 2YFPA 2WCKA 4QJ5B 2H5QA 5AANA 5LTQA 3ADFA 2OS8B 4JWQA 1QLSA 2JTZA 3CFFA 2JADA 1EMFA 4U2VA 1KWOB 1ZUZA 2QACA 1HUYA 3D0YB 3SIBA 1A03A 4ZFSA 1S6CA 2A50B 4IK1A 1QX5B 1M45A 3SG6A 2KFGA 2M1UA 2QLGA 5ER4X 2VVJA 4ZF4A 4JQ0D 1GGXA 1EMBA 2QPTA 5DTZA 3TS5B 4OHSA 3EK7A 1S5GY 5AXIA 2KAXA 3DPXA 1M63B 4MRXA 2MBXA 3VGOA 1ALWA 5EB6A 1HCJA 2BKIB 1SRAA 3VHTA 5HBDA 5IBWA 1QX2A 2LM5A 4CIDA 4W6IA 2LMUA 1L7ZA 1TRFA 1MOVA 3UO9A 1DVIA 3ED8A 1RMPA 2L5YA 1SL9A 5EXBA 2DDCA 4W75A 4KF4A 1DJYA 1B1GA 5EJUA 2EGDA 3R1OA 1F55A 2JRFA 3PJBA 1MUXA 3PFVA 2NLNA 1ZGOA 1OOIX 1K2HA 1YUUA 2LMVA 1P28A 4DRWA 1C3YA 2BAPA 1XO5A 1W7TA 4C0JA 1W7IB 4MZJA 4CFRA 2YE1A 3PJ7A 2AWJA 1EG3A 4MLWA 5T3IA 3ZULA 1GQMA 3D0YA 4YGDB 1SMGA 4W7DA 2JC2A 2OTGB 3CD9A 3OP0A 3VRNA 2LLTA 5BPJA 1KFUS 3OX6A 1WRLA 5DKNA 1EMMA 1J1EA 1EL4A 2WURA 3MSEB 2BL0C 1W7SA 3O4XA 1IG5A 2KHNA 3SG7A 2QEHA 1AUIB 5G08A 5DPIA 3IR8A 2VAEA 3NT3A 1SNLA 2AAOA 2ISDA 3OX5A 5FI6A 2OJKA 4LJCA 5DKRA 1AP4A 1IQ5A 3SS0A 1B8RA 1BOCA 4IJ7A 3SV5A 1B8LA 1A75A 3SS5A 1FI5A 1OXFA 5I94A 4XJKB 1YFPA 2L5XB 3DVKA 1G4YR 3DF0A 3D78A 5KU1A 3GJ2A 1BU3A 1OMVA 2WC6A 1SK6D 2YDZA 1PALA 2GX0A 4W7FA 1OOGA 2EC6C 3UG0A 2NCOA 1YVHA 1C07A 2LAPA 2ARLA 1IRJA 1EG4A 5HZOA 3CFHA 2HQKA 1Z1QA 2QLIA 1NWDA 3OB1B 3ZUFA 1JC0A 1DQEA 3BOWB 4MSPA 1LINA 2F2OA 4FQTA 1DF0B 5CSNA 3GK4X 4LQTA 3S05A 4IZNA 3U8AA 3DQ1A 3O6BA 1WY9A 3A8RA 1CMGA 2VADA 2H9WA 5H87A 2FCEA 1KK7Y 2JNXA 3M24A 2FZUA 5CSFA 5EL2A 2MRDA 2A4JA 2M49B 3M22A 1Q4EA 2NZ0A 1MHOA 3BFAA 3I5HC 2PXSA 2A54B 4XJKA 1Z4HA 1YRTB 1QWVA 2TN4A 2PASA 5ER5A 2BCAA 2EMOA 1K90D 3KCSA 3OGNA 3OGOA 1WRKA 3BQ3A 1C7VA 3S0EA 5EXCI 1B9AA 2WCBA 3LVAA 4PFEA 3ZWHA 1DTLA 1H4BA 1IWQA 1K95A 2WHTA 3VRRA 2A46A 1PULA 3AAKA 2KAVA 1QASA 1PK0D 5CSJA 1NX2A 4OR9B 1DF0A 4U8DA 3JVTB 2PSRA 2K0JA 1KYRA 2HCGA 2FJYA 3SG5A 3CTNA 4IK4A 3OSRA 1F0BA 4GOBA 2R2IA 4HQ8A 1JWDA 3P8UA 2NXQA 3I5IC 3FIAA 4W7EA 3BJHA 1G8IA 1S3PA 2JT3A 4IL1A 2JPTA 3V3DA 3DQEA 1SCMB 3K21A 2IOVA 4IK8A 2WOSA 4D1EA 2WORA 1Q73A 2LVKA 2BE6A 3DQ8A 2KSPA 4M2QA 3MGFA 4IK5A 2CCMA 2Q4UA 4W6UA 2AWKA 4YBHB 2L4IA 2OS8C 3GB3A 3AKBA 2IB6A 2HETA 2G6EA 1XFZO 4P2YB 1UUSA 3OBVA 1SR6B 1QY3A 4DXIA 4OGSA 1QVIZ 1QV0A 5HKYA 3GK1A 4PT1A 1F4QA 1OE9B 1IKUA 2GTEA 3I5GB 2M0RA 2HJOA 3ZTFA 1BR1B 3H4SE 1UHKA 2BECA 3TS5C 1SSEB 1ODBA 2AHAA 1FW4A 3CGAA 2BCBA 1QYFA 2HGYA 1CDPA 2LC5A 1PSBA 1R2UA 3VRPA 4H3NA 1PVBA 4IK3A 1UWOA 1Z2CB 1CMFA 3EK8A 4USLA 3D73A 1B8CA 2ZNEA 1GL4A 2OKYA 2KAYA 4XOWA 3DQJA 5AEQA 2LV7A 1YUSA 2H5OA 1EMAA 3R72A 5HKWA 1JSAA 1KSMA 3DQIA 1NIWA 4ZF3A 2AWMA 1YX7A 3LL8B 3DQ5A 1UHJA 1JFJA 2G5ZB 3WLDA 4W6MA 4AQJA 3QMEA 4GAOA 3LS3A 2COLB 4PE7A 2G2SB 3WLCA 2KPHA 1RMMA 3LK0A 1MXEA 3DPZA 3L4LA 4TNCA 2OPOA 3NHIA 5HGEA 2DUIA 2OTBA 4GESB 3SG2A 4ORBB 3DQ2A 4RYWA 3KEVA 3HCMA 3B6XA 1Q4AA 2K7BA 3U0MA 4LJBA 1LA3A 2IB5A 1YUTA 5DTYA 2LVJA 5DRFA 1UHIA 3CB9A 3CBEA 3TUYB 4EMQA 1DJWA 2L50A 1GM0A 1WLZA 2HQWA 2HRSA 3SVUA 3TDUA 1H4UA 2JT0A 2Z6ZA 1J7OA 1U5IB 1QV1A 1RWYA 2A56B 3OHMB 2C9IA 2A48A 1EH2A 1NCZA 3CD1A 3FE6A 2GX2A 2M8UA 4MN0A 4XL5A 2KFFA 2LHIA 3UFZA 3E5VA 5H89A 1RROA 3ZUJA 1Y1UA 1ZGQA 4W7RA 1QVIY 4PDZA 2P70A 1R6PA 1JC2A 4OY4A 1ZACA 2RGIA 4KF5A 2ZRSA 1DGVA 1MF8B 4L13A 4KEXA 2LP2A 1KFUL 1NYAA 3DQ9A 2P4MA 2A52B 1D1OA 1DMOA 5FHVA 1WLMA 3TZ1A 3S0BA 1EMEA 2MJWB 4W6HA 4W6OA 2WHUA 2WC5A 2JWWA 2LP3A 1F54A 2L0PA 2DD9A 2G6YA 2KI4C 1NX3A 4B5YA 4QJ3B 5HYDA 4TZAA 4BY4A 3EVRA 2JU0A 1OMRA 2DOQA 1OXDA 1TWOA 1V1FA 2SCPA 2ZN8A 1ORGA 2SASA 4XOVA 4KPIA 3BUWB 2DUEA 4EDOA 2VVIA 5DPHA 3A8SA 3DQAA 1V1GA 1TTXA 2PYQA 4LJDA 2KQYA 2IS9A 4W6DA 4PE1A 3DXLA 1SCVA 3NHTA 1ZGPA 2PALA 3DQKA 3AAJA 4PPKA 3SSLA 3JTDC 1Y6WA 3PIBA 1OZSA 2ZMUA 3EKHA 2LCPA 5FVGA 2G3OA 2JOJA 4Q9WA 1WDCC 5I2LA 3DY9A 5CPVA 4UPGA 3H1OA
chains in the Genus database with same CATH topology
2M7LA 1CKKA 2G16B 4J89A 2M97A 2BCXA 4MVFA 1SL8A 1SW8A 5I8NA 5HZSA 2F3ZA 3DPWA 4YGCB 1RTP1 1CM1A 1DJZA 1TNQA 2AMIA 1EXRA 3BUNB 5KTYA 1UURA 2O2BA 2V4EB 2Y4QA 4PHNA 2E30A 2ZMWA 3RWAA 1KQMB 2EHBA 4DXQA 2BTJA 5TNCA 5AQBB 2ZNDA 3JVTC 2KI6D 3DVEA 2Y5IA 4Z4MA 4AR7A 2KYFA 2VRGA 4ORNA 1Q80A 1N2DA 1BT6A 1W7JB 4W6KA 1QATA 3VROA 4H48A 2JULA 4JC2A 4OV2A 1YHHA 4YI8A 1TCOB 3DQ4A 3LCPC 4CFQA 1DGUA 3TMTA 1SCMC 1F09A 1RK9A 5AFPA 4H3MA 1CDMA 4PALA 3TDIA 2MLFC 3SVOA 3ST0A 4NDBA 1CTRA 4HRGA 5LTPA 4I5KA 4NQGA 3WHTB 1UHNA 2OGRA 3NSLA 5DPGA 1CFCA 2M7NA 1RMOA 3LLEA 4YGBB 1ZOTB 2RH7A 3PN7C 1EMLA 1JF2A 5BTTB 3I5GC 3SVBA 4W6FA 3DQHA 4R6DA 3U8PA 5EBJA 1JC1A 4CPVA 5I2QA 1QLKA 1SY9A 2KQ6A 1S1EA 2AUCA 2B3QA 2Y1MA 3CR5X 1BJFA 4HE4A 1YJFA 4DXNA 1GGZA 4ICBA 4HQ9A 3EK4A 4WQ3A 3SSTA 5HZTA 1B7TZ 1N0YA 1NX0A 1MXLC 4W6LA 4HVFA 1LVCD 2MHHA 1XA5A 3CS1A 4EDSA 1OOJA 1BG1A 2LUXA 1MYWA 3DQ3A 3BYAA 2CNPA 2GV5A 4KF5C 4KGEA 1YZWA 4W6CA 2JT8A 5D69A 1AK8A 5I2OA 4I5LB 2O24A 3BXCA 1MR8A 3PM8A 1QIWA 2HFCA 2AWLA 1A2XA 3WNXB 2WSNA 1RECA 4TZGA 3SJSA 4QJ4B 4W6GA 4A4CA 2KBMA 3U0LA 4LQUA 5DRGA 5DQMA 5BTTA 1A4PA 3ST2A 1XAEA 3DVMA 1DJHA 3FWBA 4ZBLA 1YJ2A 1LA0A 3TUYC 5H88A 1XYDA 1K8UA 5AERA 1DJIA 3NXAA 4I2YA 1CFDA 4LJDC 2K61A 5B8IB 3BOWA 1AJ5A 3SRYA 4YRUA 1N65A 5DTLA 3U0KA 1K9PA 1FBVA 2VVHA 1A29A 3SSPA 1B4CA 4Z4KA 4DCKA 1QS7A 3LF4B 2LVVA 3I5FB 1F70A 1MWNA 4I5JA 2BL0B 4AQIA 3WXAA 4FTGA 4W6AA 3GK2A 1LKJA 1IJ5A 1CB1A 3LVCA 1NP8A 1Z1PA 2PRUA 4LW5A 1E8AA 2K7CA 4W69A 1CDLA 2ICRA 2KFHA 1KWOC 3SVSA 3CR4X 1B7TY 1EMCA 1NSHA 3SSKA 1JF0A 1CDNA 4W73A 2YE0A 4W6BA 1NCXA 1OSAA 2WISA 4WQ2A 3FS7A 4E68A 5GQQC 4OKHA 5HLVA 4PHMA 1RM9A 1UISA 4ZCVA 4BY5A 2EMDA 1YHGA 3SG4A 2EC6B 3IQOA 3W1DA 3SVNA 1L2OB 3WHUB 1JBZA 4Q7TA 1IJ6A 1FPWA 2L98A 2HF5A 3CZTX 3LA1A 3NT9A 1Y0VH 5HKZA 4W7XA 1G7KA 1RRXA 1M31A 3DQUA 4W74A 1BODA 4A4BA 1JBYA 1SKTA 3TMRA 4GFTA 2KDHA 2PMYA 3CLNA 4HQCA 4W6PA 1J7PA 1QXTA 1B47A 1KK8B 4FQOA 4HRHA 2QU1A 5D7FA 3U8CA 1QXPA 2F2PA 1Q4CA 2OKWA 4B30B 2ZFDA 4Q9XA 1TCFA 4OJ0A 5HZUA 2M3WA 1BLQA 3SVEA 4BDUA 2K2FA 2OTGC 3O77A 4AOMA 1K9UA 2AH8A 2WNDA 4P76A 3I5HB 1KQMC 2JXCA 1F4OA 3BUMB 1S6ZA 2H2KA 4W7AA 2F33A 2MA2A 1YHIA 3BXBA 2GW3A 1QX7A 2LANA 2JXLA 1SYMA 2KGRA 1HQVA 1EMKA 3CR2A 1FI6A 1LXFC 4GGFA 2WIQA 2O5GA 4DKMA 1QJTA 4JGEA 4KW4A 4Q7RA 4N1GA 3NEDA 2KYCA 4MZKA 4IK9A 1RFJA 3KF9A 1X02A 1CLMA 4KAGA 2QLEA 3DQOA 4ORAB 3VHTB 2WC8A 1KFXS 4RTCA 2DUFA 2A47A 1J1DA 4L9MA 4KA9A 2JQ6A 2QZ0A 5EHUA 1ALVA 2JZIA 4JRBA 1ZMZA 5FYXA 1HT9A 3I5IB 4PE4A 1Q4DA 2H61A 3I19A 4KW8A 2KNEA 3SVDA 2FL1A 4L1IA 5K89A 3VK1A 1K94A 3PALA 2OTEA 1CFPA 1PSRA 3CWGA 2FJUB 4Q7UA 4N3DA 1QIVA 1PVAA 1C4FA 2ZRTA 3F45A 3SG3A 4N5XA 4XVPA 5DKQA 2QLHA 4JPZB 3E3RA 2K7DA 4ZF5A 3SSVA 2M1KB 3NSIA 2H5RA 3WCKA 4XGYA 2G9BA 5F9GA 1SPYA 3C1VA 2Q6PA 1U5IA 4W77A 3BXAA 2I94A 3O4YA 2KBIA 2H6VA 2F3YA 2GGZA 4W6RA 2O29A 1MOUA 4F0ZB 1CV7A 3GEXA 2HPSA 3FWCA 4OQWA 1S26D 1OZOA 5DPJA 4C0KA 2G3DB 2BKHB 4Q04A 2JNFA 3IP2A 4W72A 5DY6A 4NDCA 1XA9A 2L4HA 4ZCUA 1BFPA 1YR5A 2LLUA 5CSIA 4J88A 4JFGA 3CGLA 3IQQA 4YGAA 4UTSA 1H8BA 1FF1A 1XQMA 2POXA 3DQDA 1A75B 3BUXB 4DXOA 3SIAA 1J7RA 1XK4A 4I5NB 3ST3A 3DF0B 4W76A 4PCWA 3SVRA 3KO0A 1YURA 2LNKA 4EN1A 1KK7Z 5LTRA 4R1EA 1AVSA 4W6SA 4W6TA 4PE0A 1XFWO 3BUOB 4GPLB 4H47A 1KCYA 3AI4A 3NSKA 3SSHA 1TNWA 3I5FC 1EJ3A 2LUCA 4GGNA 4DXMA 1S36A 4M2PA 4ZIOA 3QRXA 4MRYA 3LK1A 4ORCB 3ZNIA 1KQVA 2VZXA 2FOTA 3DQ7A 2BBMA 1OMDA 2A53B 1B9CA 2CXJA 2GW4B 5EXUA 4EULA 2F8PA 4C0LA 4P5OE 1NUBA 1IH0A 3K1KA 1SR6C 3EVVA 3EKJA 4DUQA 1KP5A 2M9GA 1DJXA 2V4EA 1KYPA 4CLNA 2L51A 2PXWA 3SVCA 4H3LA 2Z6XA 4ANJA 3PJ5A 4YI9A 5KSZA 3BX9A 4NWSA 3U0NA 2GGMA 1Y1AA 1F8HA 2Z1OA 3DQ6A 3AKAA 2HPWA 2L2EA 1L2OC 3NSOA 1XMZA 4GGFC 2LHLA 1YTZC 2KI4B 1CM4A 1NX1A 3AKOA 1XFYO 3TDZA 3DQCA 3DQNA 5DTXA 3LF3A 3M0WA 1H6RA 2DD7A 2MLEC 2I18A 5EB7A 2HQ8A 1S6JA 5BQLA 3PLFB 4KGFA 1KK8C 1K93D 3EVUA 3P28A 1WRZA 2ZKMX 1J7QA 2H61C 2DUGA 3JTDB 1BR4B 4ZINA 3E5TA 1QTXA 1GJYA 3O78A 2DDDA 1MQ1A 4MBEA 1WDCB 1BMOA 2KGBC 1YX8A 1G33A 3VICA 2ZN9A 2IE2A 2FWQA 3G9AA 2PVBA 1CFFA 2BE4A 1XVJA 1ZFSA 2KI6C 2H5PA 2I7AA 1Y1XA 4MEWA 3NEZA 2WSOA 4AS8A 2QRFA 2QT2A 2WCEA 1CLBA 4JF9A 1CLLA 3RM1A 1AJ4A 5FVFA 4GBAA 3A4UB 2Z6YA 2Y1NA 3ICBA 3IF7A 5J2OA 1J55A 1JUOA 1UP5A 1W7UA 2C9JA 1TIZA 2P6BB 5HLOA 2WCFA 2NCPA 4GNKB 1QYOA 4OCIA 2WHSA 3LVDA 3W1CA 3BXKA 2K7OA 1TNXA 1C7WA 2H8QA 1XSSA 4MZLA 1NPQA 4PPJA 1OXEA 5HW9A 1TOPA 2M29A 1RJVA 4W6JA 1JFKA 3DQLA 5JOLA 4OVNF 1SL7A 5JJGA 2V53A 2Y0GA 3DQFA 1XK4C 3LSAA 1QYQA 2B3PA 4DIRA 2Q91A 4HREE 1F71A 1OQPA 1XFVO 4R6BA 3O2PA 1DJGA 2FCDA 3KHEA 1TNPA 3RLZA 4DXPA 1YRUB 5KTGA 5DU0A 2KOTA 1M46A 1ZUXA 3H1RA 1UHHA 2O60A 3NF0A 4L12A 1KFXL 4DS7A 4J8AA 2JTTA 3PN7B 5LK4A 1NCYA 3OSQA 2HGDA 2HQZA 3GJ1A 4YGEB 3RWTA 4GUKA 3CFAA 3SSYA 1CNPA 1PRWA 4N1FA 1TN4A 5FVIA 1AHRA 1VRKA 1K96A 2EMNA 2DUHA 4GF6B 2LE9B 3EVPA 3VRQA 3D10A 2LVIA 4KW9A 4JEOA 2ZO7A 2ZO6A 5BT0A 1S6IA 3AI5A 4ETOA 2V4EC 3DD4A 2B1UA 1S5GZ 4M2OA 3DVJA 1BF5A 1SBJA 5F6TA 3KCTA 1YVLA 2CT9A 4P1QA 2CTNA 4NDDA 1KYSA 1DT7B 4PHJA 2K8MB 2G6XA 1GFLA 3E5WA 1M39A 1EMGA 4DKNA 2MAZA 1K9KA 4W7CA 4W6NA 3GL4A 1IQ3A 2QLGB 1GGWA 1JBAA 4WRIA 5DQBA 3PSRA 1Q4BA 1XFXO 3GOFA 1XFUO 3HX4A 4ZB1A 4XYNA 5J3XA 3DQMA 2I2RE 2LMTA 3KPXA 2D8NA 2K2AA 2G2BA 4RYSA 3PATA 2LLSA 1IGVA 2BBNA 4B30A 4PPLA 2CBLA 4HSZA 2Q57A 5PALA 3ST4A 3OB2B 4PHKA 2E6WA 1KSOA 2YFPA 4QJ5B 2H5QA 5AANA 5LTQA 3ADFA 2OS8B 4JWQA 1QLSA 2JTZA 3CFFA 2JADA 1EMFA 4U2VA 1KWOB 1ZUZA 2QACA 1HUYA 3D0YB 3SIBA 1A03A 4ZFSA 1S6CA 2A50B 4IK1A 1QX5B 1M45A 3SG6A 2KFGA 2M1UA 2QLGA 5ER4X 2VVJA 4ZF4A 4JQ0D 1GGXA 1EMBA 2QPTA 5DTZA 3TS5B 4OHSA 3EK7A 1S5GY 5AXIA 2KAXA 3DPXA 1M63B 4MRXA 2MBXA 3VGOA 1ALWA 5EB6A 1HCJA 2BKIB 1SRAA 3VHTA 5HBDA 5IBWA 1QX2A 2LM5A 4CIDA 4W6IA 2LMUA 1L7ZA 1TRFA 1MOVA 1DVIA 3ED8A 1RMPA 1SL9A 5EXBA 2DDCA 4W75A 4KF4A 1DJYA 1B1GA 5EJUA 2EGDA 1F55A 3PJBA 2JRFA 1MUXA 3PFVA 2NLNA 1ZGOA 1K2HA 1YUUA 2LMVA 4DRWA 1XO5A 1W7TA 4C0JA 1W7IB 4MZJA 4CFRA 2YE1A 3PJ7A 2AWJA 1EG3A 4MLWA 5T3IA 3ZULA 1GQMA 3D0YA 4YGDB 1SMGA 4W7DA 2JC2A 2OTGB 3CD9A 3OP0A 3VRNA 2LLTA 5BPJA 1KFUS 3OX6A 1WRLA 5DKNA 1EMMA 1J1EA 1EL4A 2WURA 3MSEB 2BL0C 1W7SA 1IG5A 2KHNA 3SG7A 1AUIB 5G08A 5DPIA 3IR8A 2VAEA 3NT3A 1SNLA 2AAOA 2ISDA 3OX5A 2OJKA 4LJCA 5DKRA 1AP4A 1IQ5A 3SS0A 1B8RA 1BOCA 3SV5A 1B8LA 1A75A 1FI5A 1OXFA 4XJKB 1YFPA 2L5XB 3DVKA 1G4YR 3DF0A 5KU1A 3GJ2A 1BU3A 1OMVA 1SK6D 2YDZA 1PALA 2GX0A 4W7FA 2EC6C 3UG0A 2NCOA 1YVHA 1C07A 2LAPA 2ARLA 1IRJA 1EG4A 5HZOA 3CFHA 2HQKA 1Z1QA 2QLIA 1NWDA 3OB1B 3ZUFA 1JC0A 3BOWB 4MSPA 1LINA 2F2OA 1DF0B 5CSNA 3GK4X 4LQTA 3S05A 4IZNA 3U8AA 3DQ1A 3O6BA 1WY9A 3A8RA 1CMGA 2VADA 2H9WA 5H87A 2FCEA 1KK7Y 2JNXA 3M24A 2FZUA 5CSFA 2MRDA 2A4JA 2M49B 3M22A 1Q4EA 2NZ0A 1MHOA 3I5HC 2PXSA 2A54B 4XJKA 1YRTB 2TN4A 2PASA 5ER5A 2BCAA 2EMOA 1K90D 3KCSA 3OGOA 1WRKA 3BQ3A 1C7VA 5EXCI 1B9AA 2WCBA 3LVAA 4PFEA 3ZWHA 1DTLA 1H4BA 1IWQA 1K95A 2WHTA 3VRRA 2A46A 1PULA 3AAKA 2KAVA 1QASA 1PK0D 5CSJA 1NX2A 4OR9B 1DF0A 4U8DA 3JVTB 2PSRA 2K0JA 1KYRA 2HCGA 3SG5A 3CTNA 4IK4A 3OSRA 1F0BA 4GOBA 2R2IA 4HQ8A 1JWDA 3P8UA 2NXQA 3I5IC 3FIAA 4W7EA 1G8IA 1S3PA 2JT3A 4IL1A 2JPTA 3V3DA 3DQEA 1SCMB 3K21A 2IOVA 4IK8A 2WOSA 4D1EA 2WORA 1Q73A 2LVKA 2BE6A 3DQ8A 2KSPA 4M2QA 3MGFA 4IK5A 2CCMA 2Q4UA 4W6UA 2AWKA 4YBHB 2L4IA 2OS8C 3GB3A 3AKBA 2IB6A 2HETA 2G6EA 1XFZO 4P2YB 1UUSA 1SR6B 1QY3A 4DXIA 4OGSA 1QVIZ 1QV0A 5HKYA 3GK1A 1F4QA 1OE9B 1IKUA 3I5GB 2M0RA 2HJOA 3ZTFA 1BR1B 3H4SE 2BECA 1UHKA 3TS5C 1ODBA 2AHAA 1FW4A 3CGAA 2BCBA 1QYFA 2HGYA 1CDPA 2LC5A 1PSBA 1R2UA 3VRPA 4H3NA 1PVBA 4IK3A 1UWOA 1CMFA 3EK8A 4USLA 1B8CA 2ZNEA 1GL4A 2OKYA 2KAYA 4XOWA 3DQJA 5AEQA 2LV7A 1YUSA 2H5OA 1EMAA 5HKWA 1JSAA 1KSMA 3DQIA 1NIWA 4ZF3A 2AWMA 1YX7A 3LL8B 3DQ5A 1UHJA 1JFJA 2G5ZB 3WLDA 4W6MA 4AQJA 4GAOA 3LS3A 2COLB 4PE7A 2G2SB 3WLCA 1RMMA 3LK0A 1MXEA 3DPZA 4TNCA 2OPOA 5HGEA 2DUIA 2OTBA 4GESB 3SG2A 4ORBB 3DQ2A 4RYWA 3KEVA 3HCMA 1Q4AA 2K7BA 3U0MA 4LJBA 1LA3A 2IB5A 1YUTA 5DTYA 2LVJA 5DRFA 1UHIA 3CB9A 3CBEA 3TUYB 4EMQA 1DJWA 2L50A 1WLZA 2HQWA 2HRSA 3SVUA 3TDUA 1H4UA 2JT0A 2Z6ZA 1J7OA 1U5IB 1QV1A 1RWYA 2A56B 3OHMB 2C9IA 2A48A 1EH2A 1NCZA 3CD1A 2GX2A 2M8UA 4MN0A 4XL5A 2KFFA 2LHIA 3UFZA 3E5VA 5H89A 1RROA 3ZUJA 1Y1UA 1ZGQA 4W7RA 1QVIY 4PDZA 1R6PA 1JC2A 4OY4A 1ZACA 2RGIA 4KF5A 2ZRSA 1DGVA 1MF8B 4L13A 4KEXA 2LP2A 1KFUL 1NYAA 3DQ9A 2P4MA 2A52B 1D1OA 1DMOA 5FHVA 1WLMA 3TZ1A 4W6HA 1EMEA 2MJWB 4W6OA 2WHUA 2JWWA 2LP3A 1F54A 2L0PA 2DD9A 2G6YA 2KI4C 1NX3A 4B5YA 4QJ3B 5HYDA 4TZAA 4BY4A 3EVRA 2JU0A 1OMRA 2DOQA 1OXDA 1V1FA 2SCPA 2ZN8A 2SASA 4XOVA 4KPIA 3BUWB 2DUEA 4EDOA 2VVIA 5DPHA 3A8SA 3DQAA 1V1GA 1TTXA 4LJDA 2KQYA 2IS9A 4W6DA 4PE1A 1SCVA 1ZGPA 2PALA 3DQKA 3AAJA 4PPKA 3SSLA 3JTDC 1Y6WA 3PIBA 1OZSA 2ZMUA 3EKHA 2LCPA 5FVGA 2G3OA 2JOJA 4Q9WA 1WDCC 5I2LA 5CPVA 4UPGA 3H1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7L A;  1CKK A;  2G16 B;  4J89 A;  2M97 A;  2BCX A;  4MVF A;  1SL8 A;  1SW8 A;  5I8N A;  5HZS A;  2F3Z A;  3DPW A;  4YGC B;  1RTP 1;  1CM1 A;  1DJZ A;  1TNQ A;  2AMI A;  1EXR A;  3BUN B;  5KTY A;  1UUR A;  2O2B A;  2V4E B;  2Y4Q A;  4PHN A;  2E30 A;  2ZMW A;  3RWA A;  1KQM B;  2EHB A;  4DXQ A;  2BTJ A;  5TNC A;  5AQB B;  2ZND A;  3JVT C;  2KI6 D;  3DVE A;  2Y5I A;  4Z4M A;  4AR7 A;  2KYF A;  2VRG A;  4ORN A;  1Q80 A;  1N2D A;  1BT6 A;  1W7J B;  4W6K A;  1QAT A;  3VRO A;  4H48 A;  2JUL A;  4JC2 A;  4OV2 A;  1YHH A;  4YI8 A;  1TCO B;  3DQ4 A;  3LCP C;  4CFQ A;  1DGU A;  3TMT A;  1SCM C;  1F09 A;  1RK9 A;  5AFP A;  4H3M A;  1CDM A;  4PAL A;  3TDI A;  2MLF C;  3SVO A;  3ST0 A;  4NDB A;  1CTR A;  4HRG A;  5LTP A;  4I5K A;  4NQG A;  3WHT B;  1UHN A;  2OGR A;  3NSL A;  5DPG A;  1CFC A;  2M7N A;  1RMO A;  3LLE A;  4YGB B;  1ZOT B;  2RH7 A;  3PN7 C;  1EML A;  1JF2 A;  5BTT B;  3I5G C;  3SVB A;  4W6F A;  3DQH A;  4R6D A;  3U8P A;  5EBJ A;  1JC1 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2KQ6 A;  1S1E A;  2AUC A;  2B3Q A;  2Y1M A;  3CR5 X;  1BJF A;  4HE4 A;  1YJF A;  4DXN A;  1GGZ A;  4ICB A;  4HQ9 A;  3EK4 A;  4WQ3 A;  3SST A;  5HZT A;  1B7T Z;  1N0Y A;  1NX0 A;  1MXL C;  4W6L A;  4HVF A;  1LVC D;  2MHH A;  1XA5 A;  3CS1 A;  4EDS A;  1OOJ A;  1BG1 A;  2LUX A;  1MYW A;  3DQ3 A;  3BYA A;  2CNP A;  2GV5 A;  4KF5 C;  4KGE A;  1YZW A;  4W6C A;  2JT8 A;  5D69 A;  1AK8 A;  5I2O A;  4I5L B;  2O24 A;  3BXC A;  1MR8 A;  3PM8 A;  1QIW A;  2HFC A;  2AWL A;  1A2X A;  3WNX B;  2WSN A;  1REC A;  4TZG A;  3SJS A;  4QJ4 B;  4W6G A;  4A4C A;  2KBM A;  3U0L A;  4LQU A;  5DRG A;  5DQM A;  5BTT A;  1A4P A;  3ST2 A;  1XAE A;  3DVM A;  1DJH A;  3FWB A;  4ZBL A;  1YJ2 A;  1LA0 A;  3TUY C;  5H88 A;  1XYD A;  1K8U A;  5AER A;  1DJI A;  3NXA A;  4I2Y A;  1CFD A;  4LJD C;  2K61 A;  5B8I B;  3BOW A;  1AJ5 A;  3SRY A;  4YRU A;  1N65 A;  5DTL A;  3U0K A;  1K9P A;  1FBV A;  2VVH A;  1A29 A;  3SSP A;  1B4C A;  4Z4K A;  4DCK A;  1QS7 A;  3LF4 B;  2LVV A;  3I5F B;  1F70 A;  1MWN A;  4I5J A;  2BL0 B;  4AQI A;  3WXA A;  4FTG A;  4W6A A;  3GK2 A;  1LKJ A;  1IJ5 A;  1CB1 A;  3LVC A;  1NP8 A;  1Z1P A;  2PRU A;  4LW5 A;  1E8A A;  2K7C A;  4W69 A;  1CDL A;  2ICR A;  2KFH A;  1KWO C;  3SVS A;  3CR4 X;  1B7T Y;  1EMC A;  1NSH A;  3SSK A;  1JF0 A;  1CDN A;  4W73 A;  2YE0 A;  4W6B A;  1NCX A;  1OSA A;  2WIS A;  4WQ2 A;  3FS7 A;  4E68 A;  5GQQ C;  4OKH A;  5HLV A;  4PHM A;  1RM9 A;  1UIS A;  4ZCV A;  4BY5 A;  2EMD A;  1YHG A;  3SG4 A;  2EC6 B;  3IQO A;  3W1D A;  3SVN A;  1L2O B;  3WHU B;  1JBZ A;  4Q7T A;  1IJ6 A;  1FPW A;  2L98 A;  2HF5 A;  3CZT X;  3LA1 A;  3NT9 A;  1Y0V H;  5HKZ A;  4W7X A;  1G7K A;  1RRX A;  1M31 A;  3DQU A;  4W74 A;  1BOD A;  4A4B A;  1JBY A;  1SKT A;  3TMR A;  4GFT A;  2KDH A;  2PMY A;  3CLN A;  4HQC A;  4W6P A;  1J7P A;  1QXT A;  1B47 A;  1KK8 B;  4FQO A;  4HRH A;  2QU1 A;  5D7F A;  3U8C A;  1QXP A;  2F2P A;  1Q4C A;  2OKW A;  4B30 B;  2ZFD A;  4Q9X A;  1TCF A;  4OJ0 A;  5HZU A;  2M3W A;  1BLQ A;  3SVE A;  4BDU A;  2K2F A;  2OTG C;  3O77 A;  4AOM A;  1K9U A;  2AH8 A;  2WND A;  4P76 A;  3I5H B;  1KQM C;  2JXC A;  1F4O A;  3BUM B;  1S6Z A;  2H2K A;  4W7A A;  2F33 A;  2MA2 A;  1YHI A;  3BXB A;  2GW3 A;  1QX7 A;  2LAN A;  2JXL A;  1SYM A;  2KGR A;  1HQV A;  1EMK A;  3CR2 A;  1FI6 A;  1LXF C;  4GGF A;  2WIQ A;  2O5G A;  4DKM A;  1QJT A;  4JGE A;  4KW4 A;  4Q7R A;  4N1G A;  3NED A;  2KYC A;  4MZK A;  4IK9 A;  1RFJ A;  3KF9 A;  1X02 A;  1CLM A;  4KAG A;  2QLE A;  3DQO A;  4ORA B;  3VHT B;  2WC8 A;  1KFX S;  4RTC A;  2DUF A;  2A47 A;  1J1D A;  4L9M A;  4KA9 A;  2JQ6 A;  2QZ0 A;  5EHU A;  1ALV A;  2JZI A;  4JRB A;  1ZMZ A;  5FYX A;  1HT9 A;  3I5I B;  4PE4 A;  1Q4D A;  2H61 A;  3I19 A;  4KW8 A;  2KNE A;  3SVD A;  2FL1 A;  4L1I A;  5K89 A;  3VK1 A;  1K94 A;  3PAL A;  2OTE A;  1CFP A;  1PSR A;  3CWG A;  2FJU B;  4Q7U A;  4N3D A;  1QIV A;  1PVA A;  1C4F A;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  4XVP A;  5DKQ A;  2QLH A;  4JPZ B;  3E3R A;  2K7D A;  4ZF5 A;  3SSV A;  2M1K B;  3NSI A;  2H5R A;  3WCK A;  4XGY A;  2G9B A;  5F9G A;  1SPY A;  3C1V A;  2Q6P A;  1U5I A;  4W77 A;  3BXA A;  2I94 A;  3O4Y A;  2KBI A;  2H6V A;  2F3Y A;  2GGZ A;  4W6R A;  2O29 A;  1MOU A;  4F0Z B;  1CV7 A;  3GEX A;  2HPS A;  3FWC A;  4OQW A;  1S26 D;  1OZO A;  5DPJ A;  4C0K A;  2G3D B;  2BKH B;  4Q04 A;  2JNF A;  3IP2 A;  4W72 A;  5DY6 A;  4NDC A;  1XA9 A;  2L4H A;  4ZCU A;  1BFP A;  1YR5 A;  2LLU A;  5CSI A;  4J88 A;  4JFG A;  3CGL A;  3IQQ A;  4YGA A;  4UTS A;  1H8B A;  1FF1 A;  1XQM A;  2POX A;  3DQD A;  1A75 B;  3BUX B;  4DXO A;  3SIA A;  1J7R A;  1XK4 A;  4I5N B;  3ST3 A;  3DF0 B;  4W76 A;  4PCW A;  3SVR A;  3KO0 A;  1YUR A;  2LNK A;  4EN1 A;  1KK7 Z;  5LTR A;  4R1E A;  1AVS A;  4W6S A;  4W6T A;  4PE0 A;  1XFW O;  3BUO B;  4GPL B;  4H47 A;  1KCY A;  3AI4 A;  3NSK A;  3SSH A;  1TNW A;  3I5F C;  1EJ3 A;  2LUC A;  4GGN A;  4DXM A;  1S36 A;  4M2P A;  4ZIO A;  3QRX A;  4MRY A;  3LK1 A;  4ORC B;  3ZNI A;  1KQV A;  2VZX A;  2FOT A;  3DQ7 A;  2BBM A;  1OMD A;  2A53 B;  1B9C A;  2CXJ A;  2GW4 B;  5EXU A;  4EUL A;  2F8P A;  4C0L A;  4P5O E;  1NUB A;  1IH0 A;  3K1K A;  1SR6 C;  3EVV A;  3EKJ A;  4DUQ A;  1KP5 A;  2M9G A;  1DJX A;  2V4E A;  1KYP A;  4CLN A;  2L51 A;  2PXW A;  3SVC A;  4H3L A;  2Z6X A;  4ANJ A;  3PJ5 A;  4YI9 A;  5KSZ A;  3BX9 A;  4NWS A;  3U0N A;  2GGM A;  1Y1A A;  1F8H A;  2Z1O A;  3DQ6 A;  3AKA A;  2HPW A;  2L2E A;  1L2O C;  3NSO A;  1XMZ A;  4GGF C;  2LHL A;  1YTZ C;  2KI4 B;  1CM4 A;  1NX1 A;  3AKO A;  1XFY O;  3TDZ A;  3DQC A;  3DQN A;  5DTX A;  3LF3 A;  3M0W A;  1H6R A;  2DD7 A;  2MLE C;  2I18 A;  5EB7 A;  2HQ8 A;  1S6J A;  5BQL A;  3PLF B;  4KGF A;  1KK8 C;  1K93 D;  3EVU A;  3P28 A;  1WRZ A;  2ZKM X;  1J7Q A;  2H61 C;  2DUG A;  3JTD B;  1BR4 B;  4ZIN A;  3E5T A;  1QTX A;  1GJY A;  3O78 A;  2DDD A;  1MQ1 A;  4MBE A;  1WDC B;  1BMO A;  2KGB C;  1YX8 A;  1G33 A;  3VIC A;  2ZN9 A;  2IE2 A;  2FWQ A;  3G9A A;  2PVB A;  1CFF A;  2BE4 A;  1XVJ A;  1ZFS A;  2KI6 C;  2H5P A;  2I7A A;  1Y1X A;  4MEW A;  3NEZ A;  2WSO A;  4AS8 A;  2QRF A;  2QT2 A;  2WCE A;  1CLB A;  4JF9 A;  1CLL A;  3RM1 A;  1AJ4 A;  5FVF A;  4GBA A;  3A4U B;  2Z6Y A;  2Y1N A;  3ICB A;  3IF7 A;  5J2O A;  1J55 A;  1JUO A;  1UP5 A;  1W7U A;  2C9J A;  1TIZ A;  2P6B B;  5HLO A;  2WCF A;  2NCP A;  4GNK B;  1QYO A;  4OCI A;  2WHS A;  3LVD A;  3W1C A;  3BXK A;  2K7O A;  1TNX A;  1C7W A;  2H8Q A;  1XSS A;  4MZL A;  1NPQ A;  4PPJ A;  1OXE A;  5HW9 A;  1TOP A;  2M29 A;  1RJV A;  4W6J A;  1JFK A;  3DQL A;  5JOL A;  4OVN F;  1SL7 A;  5JJG A;  2V53 A;  2Y0G A;  3DQF A;  1XK4 C;  3LSA A;  1QYQ A;  2B3P A;  4DIR A;  2Q91 A;  4HRE E;  1F71 A;  1OQP A;  1XFV O;  4R6B A;  3O2P A;  1DJG A;  2FCD A;  3KHE A;  1TNP A;  3RLZ A;  4DXP A;  1YRU B;  5KTG A;  5DU0 A;  2KOT A;  1M46 A;  1ZUX A;  3H1R A;  1UHH A;  2O60 A;  3NF0 A;  4L12 A;  1KFX L;  4DS7 A;  4J8A A;  2JTT A;  3PN7 B;  5LK4 A;  1NCY A;  3OSQ A;  2HGD A;  2HQZ A;  3GJ1 A;  4YGE B;  3RWT A;  4GUK A;  3CFA A;  3SSY A;  1CNP A;  1PRW A;  4N1F A;  1TN4 A;  5FVI A;  1AHR A;  1VRK A;  1K96 A;  2EMN A;  2DUH A;  4GF6 B;  2LE9 B;  3EVP A;  3VRQ A;  3D10 A;  2LVI A;  4KW9 A;  4JEO A;  2ZO7 A;  2ZO6 A;  5BT0 A;  1S6I A;  3AI5 A;  4ETO A;  2V4E C;  3DD4 A;  2B1U A;  1S5G Z;  4M2O A;  3DVJ A;  1BF5 A;  1SBJ A;  5F6T A;  3KCT A;  1YVL A;  2CT9 A;  4P1Q A;  2CTN A;  4NDD A;  1KYS A;  1DT7 B;  4PHJ A;  2K8M B;  2G6X A;  1GFL A;  3E5W A;  1M39 A;  1EMG A;  4DKN A;  2MAZ A;  1K9K A;  4W7C A;  4W6N A;  3GL4 A;  1IQ3 A;  2QLG B;  1GGW A;  1JBA A;  4WRI A;  5DQB A;  3PSR A;  1Q4B A;  1XFX O;  3GOF A;  1XFU O;  3HX4 A;  4ZB1 A;  4XYN A;  5J3X A;  3DQM A;  2I2R E;  2LMT A;  3KPX A;  2D8N A;  2K2A A;  2G2B A;  4RYS A;  3PAT A;  2LLS A;  1IGV A;  2BBN A;  4B30 A;  4PPL A;  2CBL A;  4HSZ A;  2Q57 A;  5PAL A;  3ST4 A;  3OB2 B;  4PHK A;  2E6W A;  1KSO A;  2YFP A;  4QJ5 B;  2H5Q A;  5AAN A;  5LTQ A;  3ADF A;  2OS8 B;  4JWQ A;  1QLS A;  2JTZ A;  3CFF A;  2JAD A;  1EMF A;  4U2V A;  1KWO B;  1ZUZ A;  2QAC A;  1HUY A;  3D0Y B;  3SIB A;  1A03 A;  4ZFS A;  1S6C A;  2A50 B;  4IK1 A;  1QX5 B;  1M45 A;  3SG6 A;  2KFG A;  2M1U A;  2QLG A;  5ER4 X;  2VVJ A;  4ZF4 A;  4JQ0 D;  1GGX A;  1EMB A;  2QPT A;  5DTZ A;  3TS5 B;  4OHS A;  3EK7 A;  1S5G Y;  5AXI A;  2KAX A;  3DPX A;  1M63 B;  4MRX A;  2MBX A;  3VGO A;  1ALW A;  5EB6 A;  1HCJ A;  2BKI B;  1SRA A;  3VHT A;  5HBD A;  5IBW A;  1QX2 A;  2LM5 A;  4CID A;  4W6I A;  2LMU A;  1L7Z A;  1TRF A;  1MOV A;  1DVI A;  3ED8 A;  1RMP A;  1SL9 A;  5EXB A;  2DDC A;  4W75 A;  4KF4 A;  1DJY A;  1B1G A;  5EJU A;  2EGD A;  1F55 A;  3PJB A;  2JRF A;  1MUX A;  3PFV A;  2NLN A;  1ZGO A;  1K2H A;  1YUU A;  2LMV A;  4DRW A;  1XO5 A;  1W7T A;  4C0J A;  1W7I B;  4MZJ A;  4CFR A;  2YE1 A;  3PJ7 A;  2AWJ A;  1EG3 A;  4MLW A;  5T3I A;  3ZUL A;  1GQM A;  3D0Y A;  4YGD B;  1SMG A;  4W7D A;  2JC2 A;  2OTG B;  3CD9 A;  3OP0 A;  3VRN A;  2LLT A;  5BPJ A;  1KFU S;  3OX6 A;  1WRL A;  5DKN A;  1EMM A;  1J1E A;  1EL4 A;  2WUR A;  3MSE B;  2BL0 C;  1W7S A;  1IG5 A;  2KHN A;  3SG7 A;  1AUI B;  5G08 A;  5DPI A;  3IR8 A;  2VAE A;  3NT3 A;  1SNL A;  2AAO A;  2ISD A;  3OX5 A;  2OJK A;  4LJC A;  5DKR A;  1AP4 A;  1IQ5 A;  3SS0 A;  1B8R A;  1BOC A;  3SV5 A;  1B8L A;  1A75 A;  1FI5 A;  1OXF A;  4XJK B;  1YFP A;  2L5X B;  3DVK A;  1G4Y R;  3DF0 A;  5KU1 A;  3GJ2 A;  1BU3 A;  1OMV A;  1SK6 D;  2YDZ A;  1PAL A;  2GX0 A;  4W7F A;  2EC6 C;  3UG0 A;  2NCO A;  1YVH A;  1C07 A;  2LAP A;  2ARL A;  1IRJ A;  1EG4 A;  5HZO A;  3CFH A;  2HQK A;  1Z1Q A;  2QLI A;  1NWD A;  3OB1 B;  3ZUF A;  1JC0 A;  3BOW B;  4MSP A;  1LIN A;  2F2O A;  1DF0 B;  5CSN A;  3GK4 X;  4LQT A;  3S05 A;  4IZN A;  3U8A A;  3DQ1 A;  3O6B A;  1WY9 A;  3A8R A;  1CMG A;  2VAD A;  2H9W A;  5H87 A;  2FCE A;  1KK7 Y;  2JNX A;  3M24 A;  2FZU A;  5CSF A;  2MRD A;  2A4J A;  2M49 B;  3M22 A;  1Q4E A;  2NZ0 A;  1MHO A;  3I5H C;  2PXS A;  2A54 B;  4XJK A;  1YRT B;  2TN4 A;  2PAS A;  5ER5 A;  2BCA A;  2EMO A;  1K90 D;  3KCS A;  3OGO A;  1WRK A;  3BQ3 A;  1C7V A;  5EXC I;  1B9A A;  2WCB A;  3LVA A;  4PFE A;  3ZWH A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2WHT A;  3VRR A;  2A46 A;  1PUL A;  3AAK A;  2KAV A;  1QAS A;  1PK0 D;  5CSJ A;  1NX2 A;  4OR9 B;  1DF0 A;  4U8D A;  3JVT B;  2PSR A;  2K0J A;  1KYR A;  2HCG A;  3SG5 A;  3CTN A;  4IK4 A;  3OSR A;  1F0B A;  4GOB A;  2R2I A;  4HQ8 A;  1JWD A;  3P8U A;  2NXQ A;  3I5I C;  3FIA A;  4W7E A;  1G8I A;  1S3P A;  2JT3 A;  4IL1 A;  2JPT A;  3V3D A;  3DQE A;  1SCM B;  3K21 A;  2IOV A;  4IK8 A;  2WOS A;  4D1E A;  2WOR A;  1Q73 A;  2LVK A;  2BE6 A;  3DQ8 A;  2KSP A;  4M2Q A;  3MGF A;  4IK5 A;  2CCM A;  2Q4U A;  4W6U A;  2AWK A;  4YBH B;  2L4I A;  2OS8 C;  3GB3 A;  3AKB A;  2IB6 A;  2HET A;  2G6E A;  1XFZ O;  4P2Y B;  1UUS A;  1SR6 B;  1QY3 A;  4DXI A;  4OGS A;  1QVI Z;  1QV0 A;  5HKY A;  3GK1 A;  1F4Q A;  1OE9 B;  1IKU A;  3I5G B;  2M0R A;  2HJO A;  3ZTF A;  1BR1 B;  3H4S E;  2BEC A;  1UHK A;  3TS5 C;  1ODB A;  2AHA A;  1FW4 A;  3CGA A;  2BCB A;  1QYF A;  2HGY A;  1CDP A;  2LC5 A;  1PSB A;  1R2U A;  3VRP A;  4H3N A;  1PVB A;  4IK3 A;  1UWO A;  1CMF A;  3EK8 A;  4USL A;  1B8C A;  2ZNE A;  1GL4 A;  2OKY A;  2KAY A;  4XOW A;  3DQJ A;  5AEQ A;  2LV7 A;  1YUS A;  2H5O A;  1EMA A;  5HKW A;  1JSA A;  1KSM A;  3DQI A;  1NIW A;  4ZF3 A;  2AWM A;  1YX7 A;  3LL8 B;  3DQ5 A;  1UHJ A;  1JFJ A;  2G5Z B;  3WLD A;  4W6M A;  4AQJ A;  4GAO A;  3LS3 A;  2COL B;  4PE7 A;  2G2S B;  3WLC A;  1RMM A;  3LK0 A;  1MXE A;  3DPZ A;  4TNC A;  2OPO A;  5HGE A;  2DUI A;  2OTB A;  4GES B;  3SG2 A;  4ORB B;  3DQ2 A;  4RYW A;  3KEV A;  3HCM A;  1Q4A A;  2K7B A;  3U0M A;  4LJB A;  1LA3 A;  2IB5 A;  1YUT A;  5DTY A;  2LVJ A;  5DRF A;  1UHI A;  3CB9 A;  3CBE A;  3TUY B;  4EMQ A;  1DJW A;  2L50 A;  1WLZ A;  2HQW A;  2HRS A;  3SVU A;  3TDU A;  1H4U A;  2JT0 A;  2Z6Z A;  1J7O A;  1U5I B;  1QV1 A;  1RWY A;  2A56 B;  3OHM B;  2C9I A;  2A48 A;  1EH2 A;  1NCZ A;  3CD1 A;  2GX2 A;  2M8U A;  4MN0 A;  4XL5 A;  2KFF A;  2LHI A;  3UFZ A;  3E5V A;  5H89 A;  1RRO A;  3ZUJ A;  1Y1U A;  1ZGQ A;  4W7R A;  1QVI Y;  4PDZ A;  1R6P A;  1JC2 A;  4OY4 A;  1ZAC A;  2RGI A;  4KF5 A;  2ZRS A;  1DGV A;  1MF8 B;  4L13 A;  4KEX A;  2LP2 A;  1KFU L;  1NYA A;  3DQ9 A;  2P4M A;  2A52 B;  1D1O A;  1DMO A;  5FHV A;  1WLM A;  3TZ1 A;  4W6H A;  1EME A;  2MJW B;  4W6O A;  2WHU A;  2JWW A;  2LP3 A;  1F54 A;  2L0P A;  2DD9 A;  2G6Y A;  2KI4 C;  1NX3 A;  4B5Y A;  4QJ3 B;  5HYD A;  4TZA A;  4BY4 A;  3EVR A;  2JU0 A;  1OMR A;  2DOQ A;  1OXD A;  1V1F A;  2SCP A;  2ZN8 A;  2SAS A;  4XOV A;  4KPI A;  3BUW B;  2DUE A;  4EDO A;  2VVI A;  5DPH A;  3A8S A;  3DQA A;  1V1G A;  1TTX A;  4LJD A;  2KQY A;  2IS9 A;  4W6D A;  4PE1 A;  1SCV A;  1ZGP A;  2PAL A;  3DQK A;  3AAJ A;  4PPK A;  3SSL A;  3JTD C;  1Y6W A;  3PIB A;  1OZS A;  2ZMU A;  3EKH A;  2LCP A;  5FVG A;  2G3O A;  2JOJ A;  4Q9W A;  1WDC C;  5I2L A;  5CPV A;  4UPG A;  3H1O A; 
#chains in the Genus database with same CATH topology
 2M7L A;  1CKK A;  2G16 B;  4J89 A;  2M97 A;  2BCX A;  4MVF A;  1SL8 A;  1SW8 A;  3CZ2 A;  5I8N A;  5HZS A;  2F3Z A;  3DPW A;  4YGC B;  1RTP 1;  1CM1 A;  1DJZ A;  1TNQ A;  3FE9 A;  2AMI A;  1EXR A;  3BUN B;  5KTY A;  1UUR A;  2O2B A;  2V4E B;  2Y4Q A;  4PHN A;  2E30 A;  2ZMW A;  3RWA A;  1KQM B;  2EHB A;  4DXQ A;  2BTJ A;  5TNC A;  5AQB B;  1OOH A;  2ZND A;  3JVT C;  2KI6 D;  3DVE A;  2Y5I A;  4Z4M A;  4AR7 A;  2KYF A;  2VRG A;  4INW A;  4ORN A;  1Q80 A;  1N2D A;  3Q8I A;  1BT6 A;  3CZ0 A;  1W7J B;  4W6K A;  1QAT A;  3VRO A;  4H48 A;  2JUL A;  4JC2 A;  1TUZ A;  4OV2 A;  1YHH A;  3IVT A;  4YI8 A;  3S0G A;  1TCO B;  3DQ4 A;  3LCP C;  4CFQ A;  1DGU A;  3TMT A;  1SCM C;  1F09 A;  1RK9 A;  5AFP A;  4JD9 A;  4H3M A;  1CDM A;  4PAL A;  3TDI A;  2MLF C;  3DYE A;  3SVO A;  3ST0 A;  4NDB A;  1CTR A;  4HRG A;  5LTP A;  4I5K A;  4NQG A;  3WHT B;  1UHN A;  2OGR A;  3SS3 A;  3NSL A;  5DPG A;  1CFC A;  2M7N A;  1RMO A;  3LLE A;  4YGB B;  1ZOT B;  2RH7 A;  3PN7 C;  1EML A;  1JF2 A;  5BTT B;  3I5G C;  3SVB A;  4W6F A;  3DQH A;  4R6D A;  3U8P A;  5EBJ A;  1JC1 A;  3SS4 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2KQ6 A;  1S1E A;  2AUC A;  2B3Q A;  2Y1M A;  3CR5 X;  1BJF A;  4HE4 A;  1YJF A;  4DXN A;  1GGZ A;  4ICB A;  4HQ9 A;  3EK4 A;  4WQ3 A;  3SST A;  5HZT A;  1B7T Z;  1N0Y A;  1NX0 A;  1MXL C;  4W6L A;  4HVF A;  1LVC D;  2MHH A;  1XA5 A;  3CS1 A;  3V2L A;  4EDS A;  1OOJ A;  1BG1 A;  2LUX A;  1MYW A;  3DQ3 A;  3BYA A;  2CNP A;  1OOF A;  2GV5 A;  4KF5 C;  4KGE A;  1YZW A;  4W6C A;  2JT8 A;  5D69 A;  1AK8 A;  5I2O A;  4I5L B;  2WCM A;  2O24 A;  3BXC A;  1MR8 A;  3PM8 A;  1QIW A;  2HFC A;  2AWL A;  1A2X A;  3WNX B;  2WSN A;  1REC A;  4TZG A;  3SJS A;  4QJ4 B;  4W6G A;  4A4C A;  3B86 A;  2KBM A;  3U0L A;  4LQU A;  5DRG A;  5DQM A;  5BTT A;  1A4P A;  3D75 A;  3ST2 A;  1XAE A;  3DVM A;  1DJH A;  3FWB A;  4ZBL A;  1YJ2 A;  1LA0 A;  3TUY C;  5H88 A;  1XYD A;  2WCL A;  1K8U A;  5AER A;  1DJI A;  3NXA A;  4I2Y A;  1CFD A;  4LJD C;  2K61 A;  5B8I B;  3BOW A;  1AJ5 A;  3SRY A;  4YRU A;  1N65 A;  5DTL A;  3U0K A;  1K9P A;  4F7F A;  1FBV A;  2VVH A;  1A29 A;  3SSP A;  1B4C A;  4Z4K A;  4DCK A;  1QS7 A;  3LF4 B;  2ERB A;  2LVV A;  3I5F B;  1F70 A;  1MWN A;  4I5J A;  2BL0 B;  2KLD A;  4AQI A;  3WXA A;  4FTG A;  4W6A A;  3GK2 A;  1LKJ A;  1IJ5 A;  1CB1 A;  3LVC A;  1NP8 A;  1Z1P A;  2QDI A;  2PRU A;  4LW5 A;  1E8A A;  2K7C A;  4W69 A;  1CDL A;  2ICR A;  2KFH A;  1KWO C;  3SVS A;  3CR4 X;  1B7T Y;  1EMC A;  1NSH A;  3SSK A;  1JF0 A;  1CDN A;  4W73 A;  2YE0 A;  4W6B A;  1NCX A;  1OSA A;  2WIS A;  4WQ2 A;  3FS7 A;  3L4A A;  4E68 A;  5GQQ C;  4OKH A;  5HLV A;  4PHM A;  1RM9 A;  1UIS A;  4ZCV A;  1YHG A;  2EMD A;  4BY5 A;  3SG4 A;  2EC6 B;  3IQO A;  3W1D A;  3SVN A;  1L2O B;  3WHU B;  1JBZ A;  4Q7T A;  1IJ6 A;  1FPW A;  2L98 A;  2HF5 A;  3CZT X;  3LA1 A;  3NT9 A;  1Y0V H;  5HKZ A;  4W7X A;  3S0F A;  1G7K A;  1RRX A;  1M31 A;  2QEV A;  3DQU A;  1BOD A;  4A4B A;  4W74 A;  3PM2 A;  1JBY A;  1SKT A;  3TMR A;  4GFT A;  2KDH A;  2P71 A;  2PMY A;  3CLN A;  4HQC A;  4W6P A;  1J7P A;  1QXT A;  1B47 A;  1KK8 B;  4FQO A;  4HRH A;  2QU1 A;  5D7F A;  3U8C A;  1QXP A;  1LS8 A;  2F2P A;  1Q4C A;  2OKW A;  4B30 B;  2ZFD A;  4Q9X A;  1TCF A;  4OJ0 A;  5HZU A;  2M3W A;  1BLQ A;  3SVE A;  3B87 A;  4BDU A;  2K2F A;  2L2C A;  2OTG C;  3O77 A;  4AOM A;  1K9U A;  2AH8 A;  2WND A;  4P76 A;  3I5H B;  1KQM C;  2JXC A;  1F4O A;  3BUM B;  1S6Z A;  2H2K A;  4W7A A;  2F33 A;  2MA2 A;  1YHI A;  3BXB A;  2GW3 A;  1QX7 A;  2LAN A;  2JXL A;  1SYM A;  2KGR A;  1HQV A;  1EMK A;  3CR2 A;  1FI6 A;  1LXF C;  2JPO A;  4OZD A;  4GGF A;  2WIQ A;  2O5G A;  4DKM A;  1QJT A;  4JGE A;  4KW4 A;  4Q7R A;  4N1G A;  3NED A;  2KYC A;  4MZK A;  4IK9 A;  1RFJ A;  3KF9 A;  1X02 A;  1CLM A;  3EG5 B;  4KAG A;  2QLE A;  3DQO A;  4ORA B;  3VHT B;  2WC8 A;  1KFX S;  4RTC A;  2DUF A;  2A47 A;  1J1D A;  4L9M A;  4KA9 A;  2JQ6 A;  2QZ0 A;  5EHU A;  1ALV A;  2JZI A;  4JRB A;  1ZMZ A;  5FYX A;  1HT9 A;  3I5I B;  4PE4 A;  1Q4D A;  2H61 A;  3I19 A;  4KW8 A;  2KNE A;  3SVD A;  2FL1 A;  4L1I A;  5K89 A;  3VK1 A;  1K94 A;  3PAL A;  2OTE A;  1CFP A;  2H8V A;  1PSR A;  3CWG A;  2FJU B;  4Q7U A;  4N3D A;  1QIV A;  1PVA A;  1C4F A;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  4XVP A;  5DKQ A;  4KYN A;  2QLH A;  4JPZ B;  3E3R A;  2K7D A;  4ZF5 A;  2QEO A;  3SSV A;  2M1K B;  3NSI A;  3PJI A;  2H5R A;  3WCK A;  4XGY A;  2G9B A;  5F9G A;  1SPY A;  3C1V A;  2Q6P A;  1U5I A;  4W77 A;  3BXA A;  2I94 A;  3O4Y A;  2KBI A;  2H6V A;  2F3Y A;  2GGZ A;  4W6R A;  2O29 A;  1MOU A;  4F0Z B;  1CV7 A;  3GEX A;  2HPS A;  3FWC A;  4OQW A;  1S26 D;  1OZO A;  5DPJ A;  4C0K A;  2G3D B;  2BKH B;  4Q04 A;  2JNF A;  5D3O A;  3IP2 A;  4W72 A;  5DY6 A;  4NDC A;  1XA9 A;  2L4H A;  4ZCU A;  1BFP A;  1YR5 A;  2LLU A;  5CSI A;  4J88 A;  4JFG A;  3CGL A;  1DEL A;  3IQQ A;  4YGA A;  4UTS A;  1H8B A;  1FF1 A;  1XQM A;  2POX A;  3DQD A;  1A75 B;  3BUX B;  4DXO A;  3SIA A;  1J7R A;  3N7H A;  1XK4 A;  4I5N B;  3ST3 A;  3DF0 B;  4W76 A;  3CAB A;  4PCW A;  3SVR A;  3KO0 A;  2KLE A;  1YUR A;  2LNK A;  3R1V A;  4EN1 A;  3FE8 A;  1KK7 Z;  5LTR A;  4R1E A;  1AVS A;  4W6S A;  4W6T A;  4PE0 A;  1XFW O;  3BUO B;  4GPL B;  4H47 A;  1KCY A;  3AI4 A;  3NSK A;  3SSH A;  1TNW A;  3I5F C;  1EJ3 A;  2LUC A;  3K1E A;  4GGN A;  4DXM A;  1S36 A;  4M2P A;  4ZIO A;  3QRX A;  4MRY A;  3LK1 A;  3B88 A;  4ORC B;  3ZNI A;  1KQV A;  5DIC A;  2VZX A;  2FOT A;  3DQ7 A;  2BBM A;  1OMD A;  2A53 B;  1B9C A;  2CXJ A;  2GW4 B;  5EXU A;  4EUL A;  2F8P A;  4C0L A;  4P5O E;  1NUB A;  1IH0 A;  3K1K A;  1SR6 C;  3EVV A;  3EKJ A;  4DUQ A;  1KP5 A;  2M9G A;  1C3Z A;  1DJX A;  2V4E A;  1KYP A;  4CLN A;  2L51 A;  2PXW A;  1IIO A;  3SVC A;  4H3L A;  2Z6X A;  4ANJ A;  3PJ5 A;  4YI9 A;  5KSZ A;  2QEB A;  3BX9 A;  4NWS A;  3U0N A;  2GGM A;  1Y1A A;  1F8H A;  2Z1O A;  3DQ6 A;  3AKA A;  2HPW A;  3BFB A;  2L2E A;  1L2O C;  3NSO A;  1XMZ A;  4GGF C;  2LHL A;  1YTZ C;  2KI4 B;  1CM4 A;  1NX1 A;  3AKO A;  1XFY O;  3TDZ A;  3DQC A;  3DQN A;  5DTX A;  3LF3 A;  3M0W A;  1H6R A;  2DD7 A;  2MLE C;  2I18 A;  5EB7 A;  2HQ8 A;  1S6J A;  5BQL A;  3PLF B;  4KGF A;  1KK8 C;  1K93 D;  3EVU A;  3L47 A;  3P28 A;  1WRZ A;  2ZKM X;  1J7Q A;  2H61 C;  2DUG A;  3JTD B;  1BR4 B;  4ZIN A;  3E5T A;  1QTX A;  1XFR A;  1GJY A;  3O78 A;  2DDD A;  1MQ1 A;  4MBE A;  1WDC B;  1BMO A;  2KGB C;  3D74 A;  1YX8 A;  1G33 A;  3VIC A;  2ZN9 A;  2IE2 A;  3S0D A;  2FWQ A;  3G9A A;  2PVB A;  1CFF A;  2BE4 A;  1XVJ A;  1ZFS A;  2KI6 C;  2H5P A;  2I7A A;  1Y1X A;  4MEW A;  3NEZ A;  2WSO A;  4AS8 A;  2QRF A;  2QT2 A;  1DC1 A;  3RZS A;  2WCE A;  1CLB A;  4JF9 A;  1CLL A;  2PQL A;  3RM1 A;  2WCJ A;  1AJ4 A;  3CDN A;  5FVF A;  4GBA A;  3A4U B;  2Z6Y A;  2Y1N A;  3ICB A;  3IF7 A;  5J2O A;  1J55 A;  1JUO A;  1T14 A;  1UP5 A;  1W7U A;  3VB1 A;  2C9J A;  1TIZ A;  2P6B B;  5HLO A;  2WCF A;  2NCP A;  4GNK B;  1QYO A;  4OCI A;  2WHS A;  3LVD A;  3W1C A;  3BXK A;  2K7O A;  1TNX A;  1C7W A;  2H8Q A;  1XSS A;  4MZL A;  1NPQ A;  4PPJ A;  1OXE A;  5HW9 A;  1TOP A;  2M29 A;  1RJV A;  3B7A A;  4W6J A;  1JFK A;  3DQL A;  4INX A;  5JOL A;  4OVN F;  1SL7 A;  5JJG A;  2V53 A;  2Y0G A;  3DQF A;  1XK4 C;  3LSA A;  1QYQ A;  2B3P A;  4DIR A;  2Q91 A;  4HRE E;  3CYZ A;  1F71 A;  1OQP A;  1XFV O;  4R6B A;  3O2P A;  3D77 A;  1DJG A;  3D76 A;  2FCD A;  3KHE A;  1TNP A;  3RLZ A;  4DXP A;  1YRU B;  5KTG A;  5DU0 A;  2KOT A;  1M46 A;  1ZUX A;  3H1R A;  1UHH A;  2O60 A;  3NF0 A;  4L12 A;  5FI2 A;  1KFX L;  4DS7 A;  4J8A A;  2JTT A;  3PN7 B;  5LK4 A;  1NCY A;  1OW4 A;  3OSQ A;  2HGD A;  2HQZ A;  3GJ1 A;  4YGE B;  3RWT A;  4GUK A;  3CFA A;  3SSY A;  1CNP A;  1PRW A;  4N1F A;  1TN4 A;  1TUJ A;  5FVI A;  3S0A A;  1AHR A;  1VRK A;  1K96 A;  2EMN A;  2DUH A;  4GF6 B;  2LE9 B;  3EVP A;  3VRQ A;  3D10 A;  4JKT A;  2LVI A;  4KW9 A;  4JEO A;  1DEK A;  2ZO7 A;  2ZO6 A;  5BT0 A;  1S6I A;  3AI5 A;  4ETO A;  2V4E C;  3DD4 A;  2B1U A;  1S5G Z;  3NGV A;  4M2O A;  3DVJ A;  1BF5 A;  1SBJ A;  5F6T A;  3KCT A;  1YVL A;  2CT9 A;  4P1Q A;  2CTN A;  3UNW A;  4NDD A;  1KYS A;  3DZT A;  1DT7 B;  5HL1 A;  4PHJ A;  2K8M B;  2G6X A;  1GFL A;  3E5W A;  1M39 A;  1EMG A;  4DKN A;  2MAZ A;  1K9K A;  4W7C A;  4W6N A;  2YGU A;  3GL4 A;  1IQ3 A;  2QLG B;  3CZ1 A;  3BFH A;  1GGW A;  2K60 A;  2BNX A;  4WRI A;  1JBA A;  5DQB A;  3PSR A;  1Q4B A;  1XFX O;  3GOF A;  1XFU O;  3HX4 A;  4ZB1 A;  3R1P A;  4XYN A;  5J3X A;  3DQM A;  2I2R E;  2LMT A;  1W9Z A;  3KPX A;  2D8N A;  2K2A A;  2G2B A;  4RYS A;  3PAT A;  2LLS A;  1IGV A;  2BBN A;  4B30 A;  4PPL A;  5FI7 A;  2CBL A;  4HSZ A;  2Q57 A;  5PAL A;  3ST4 A;  3OB2 B;  4PHK A;  2E6W A;  2WCH A;  1KSO A;  2YFP A;  2WCK A;  4QJ5 B;  2H5Q A;  5AAN A;  5LTQ A;  3ADF A;  2OS8 B;  4JWQ A;  1QLS A;  2JTZ A;  3CFF A;  2JAD A;  1EMF A;  4U2V A;  1KWO B;  1ZUZ A;  2QAC A;  1HUY A;  3D0Y B;  3SIB A;  1A03 A;  4ZFS A;  1S6C A;  2A50 B;  4IK1 A;  1QX5 B;  1M45 A;  3SG6 A;  2KFG A;  2M1U A;  2QLG A;  5ER4 X;  2VVJ A;  4ZF4 A;  4JQ0 D;  1GGX A;  1EMB A;  2QPT A;  5DTZ A;  3TS5 B;  4OHS A;  3EK7 A;  1S5G Y;  5AXI A;  2KAX A;  3DPX A;  1M63 B;  4MRX A;  2MBX A;  3VGO A;  1ALW A;  5EB6 A;  1HCJ A;  2BKI B;  1SRA A;  3VHT A;  5HBD A;  5IBW A;  1QX2 A;  2LM5 A;  4CID A;  4W6I A;  2LMU A;  1L7Z A;  1TRF A;  1MOV A;  3UO9 A;  1DVI A;  3ED8 A;  1RMP A;  2L5Y A;  1SL9 A;  5EXB A;  2DDC A;  4W75 A;  4KF4 A;  1DJY A;  1B1G A;  5EJU A;  2EGD A;  3R1O A;  1F55 A;  2JRF A;  3PJB A;  1MUX A;  3PFV A;  2NLN A;  1ZGO A;  1OOI X;  1K2H A;  1YUU A;  2LMV A;  1P28 A;  4DRW A;  1C3Y A;  2BAP A;  1XO5 A;  1W7T A;  4C0J A;  1W7I B;  4MZJ A;  4CFR A;  2YE1 A;  3PJ7 A;  2AWJ A;  1EG3 A;  4MLW A;  5T3I A;  3ZUL A;  1GQM A;  3D0Y A;  4YGD B;  1SMG A;  4W7D A;  2JC2 A;  2OTG B;  3CD9 A;  3OP0 A;  3VRN A;  2LLT A;  5BPJ A;  1KFU S;  3OX6 A;  1WRL A;  5DKN A;  1EMM A;  1J1E A;  1EL4 A;  2WUR A;  3MSE B;  2BL0 C;  1W7S A;  3O4X A;  1IG5 A;  2KHN A;  3SG7 A;  2QEH A;  1AUI B;  5G08 A;  5DPI A;  3IR8 A;  2VAE A;  3NT3 A;  1SNL A;  2AAO A;  2ISD A;  3OX5 A;  5FI6 A;  2OJK A;  4LJC A;  5DKR A;  1AP4 A;  1IQ5 A;  3SS0 A;  1B8R A;  1BOC A;  4IJ7 A;  3SV5 A;  1B8L A;  1A75 A;  3SS5 A;  1FI5 A;  1OXF A;  5I94 A;  4XJK B;  1YFP A;  2L5X B;  3DVK A;  1G4Y R;  3DF0 A;  3D78 A;  5KU1 A;  3GJ2 A;  1BU3 A;  1OMV A;  2WC6 A;  1SK6 D;  2YDZ A;  1PAL A;  2GX0 A;  4W7F A;  1OOG A;  2EC6 C;  3UG0 A;  2NCO A;  1YVH A;  1C07 A;  2LAP A;  2ARL A;  1IRJ A;  1EG4 A;  5HZO A;  3CFH A;  2HQK A;  1Z1Q A;  2QLI A;  1NWD A;  3OB1 B;  3ZUF A;  1JC0 A;  1DQE A;  3BOW B;  4MSP A;  1LIN A;  2F2O A;  4FQT A;  1DF0 B;  5CSN A;  3GK4 X;  4LQT A;  3S05 A;  4IZN A;  3U8A A;  3DQ1 A;  3O6B A;  1WY9 A;  3A8R A;  1CMG A;  2VAD A;  2H9W A;  5H87 A;  2FCE A;  1KK7 Y;  2JNX A;  3M24 A;  2FZU A;  5CSF A;  5EL2 A;  2MRD A;  2A4J A;  2M49 B;  3M22 A;  1Q4E A;  2NZ0 A;  1MHO A;  3BFA A;  3I5H C;  2PXS A;  2A54 B;  4XJK A;  1Z4H A;  1YRT B;  1QWV A;  2TN4 A;  2PAS A;  5ER5 A;  2BCA A;  2EMO A;  1K90 D;  3KCS A;  3OGN A;  3OGO A;  1WRK A;  3BQ3 A;  1C7V A;  3S0E A;  5EXC I;  1B9A A;  2WCB A;  3LVA A;  4PFE A;  3ZWH A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2WHT A;  3VRR A;  2A46 A;  1PUL A;  3AAK A;  2KAV A;  1QAS A;  1PK0 D;  5CSJ A;  1NX2 A;  4OR9 B;  1DF0 A;  4U8D A;  3JVT B;  2PSR A;  2K0J A;  1KYR A;  2HCG A;  2FJY A;  3SG5 A;  3CTN A;  4IK4 A;  3OSR A;  1F0B A;  4GOB A;  2R2I A;  4HQ8 A;  1JWD A;  3P8U A;  2NXQ A;  3I5I C;  3FIA A;  4W7E A;  3BJH A;  1G8I A;  1S3P A;  2JT3 A;  4IL1 A;  2JPT A;  3V3D A;  3DQE A;  1SCM B;  3K21 A;  2IOV A;  4IK8 A;  2WOS A;  4D1E A;  2WOR A;  1Q73 A;  2LVK A;  2BE6 A;  3DQ8 A;  2KSP A;  4M2Q A;  3MGF A;  4IK5 A;  2CCM A;  2Q4U A;  4W6U A;  2AWK A;  4YBH B;  2L4I A;  2OS8 C;  3GB3 A;  3AKB A;  2IB6 A;  2HET A;  2G6E A;  1XFZ O;  4P2Y B;  1UUS A;  3OBV A;  1SR6 B;  1QY3 A;  4DXI A;  4OGS A;  1QVI Z;  1QV0 A;  5HKY A;  3GK1 A;  4PT1 A;  1F4Q A;  1OE9 B;  1IKU A;  2GTE A;  3I5G B;  2M0R A;  2HJO A;  3ZTF A;  1BR1 B;  3H4S E;  1UHK A;  2BEC A;  3TS5 C;  1SSE B;  1ODB A;  2AHA A;  1FW4 A;  3CGA A;  2BCB A;  1QYF A;  2HGY A;  1CDP A;  2LC5 A;  1PSB A;  1R2U A;  3VRP A;  4H3N A;  1PVB A;  4IK3 A;  1UWO A;  1Z2C B;  1CMF A;  3EK8 A;  4USL A;  3D73 A;  1B8C A;  2ZNE A;  1GL4 A;  2OKY A;  2KAY A;  4XOW A;  3DQJ A;  5AEQ A;  2LV7 A;  1YUS A;  2H5O A;  1EMA A;  3R72 A;  5HKW A;  1JSA A;  1KSM A;  3DQI A;  1NIW A;  4ZF3 A;  2AWM A;  1YX7 A;  3LL8 B;  3DQ5 A;  1UHJ A;  1JFJ A;  2G5Z B;  3WLD A;  4W6M A;  4AQJ A;  3QME A;  4GAO A;  3LS3 A;  2COL B;  4PE7 A;  2G2S B;  3WLC A;  2KPH A;  1RMM A;  3LK0 A;  1MXE A;  3DPZ A;  3L4L A;  4TNC A;  2OPO A;  3NHI A;  5HGE A;  2DUI A;  2OTB A;  4GES B;  3SG2 A;  4ORB B;  3DQ2 A;  4RYW A;  3KEV A;  3HCM A;  3B6X A;  1Q4A A;  2K7B A;  3U0M A;  4LJB A;  1LA3 A;  2IB5 A;  1YUT A;  5DTY A;  2LVJ A;  5DRF A;  1UHI A;  3CB9 A;  3CBE A;  3TUY B;  4EMQ A;  1DJW A;  2L50 A;  1GM0 A;  1WLZ A;  2HQW A;  2HRS A;  3SVU A;  3TDU A;  1H4U A;  2JT0 A;  2Z6Z A;  1J7O A;  1U5I B;  1QV1 A;  1RWY A;  2A56 B;  3OHM B;  2C9I A;  2A48 A;  1EH2 A;  1NCZ A;  3CD1 A;  3FE6 A;  2GX2 A;  2M8U A;  4MN0 A;  4XL5 A;  2KFF A;  2LHI A;  3UFZ A;  3E5V A;  5H89 A;  1RRO A;  3ZUJ A;  1Y1U A;  1ZGQ A;  4W7R A;  1QVI Y;  4PDZ A;  2P70 A;  1R6P A;  1JC2 A;  4OY4 A;  1ZAC A;  2RGI A;  4KF5 A;  2ZRS A;  1DGV A;  1MF8 B;  4L13 A;  4KEX A;  2LP2 A;  1KFU L;  1NYA A;  3DQ9 A;  2P4M A;  2A52 B;  1D1O A;  1DMO A;  5FHV A;  1WLM A;  3TZ1 A;  3S0B A;  1EME A;  2MJW B;  4W6H A;  4W6O A;  2WHU A;  2WC5 A;  2JWW A;  2LP3 A;  1F54 A;  2L0P A;  2DD9 A;  2G6Y A;  2KI4 C;  1NX3 A;  4B5Y A;  4QJ3 B;  5HYD A;  4TZA A;  4BY4 A;  3EVR A;  2JU0 A;  1OMR A;  2DOQ A;  1OXD A;  1TWO A;  1V1F A;  2SCP A;  2ZN8 A;  1ORG A;  2SAS A;  4XOV A;  4KPI A;  3BUW B;  2DUE A;  4EDO A;  2VVI A;  5DPH A;  3A8S A;  3DQA A;  1V1G A;  1TTX A;  2PYQ A;  4LJD A;  2KQY A;  2IS9 A;  4W6D A;  4PE1 A;  3DXL A;  1SCV A;  3NHT A;  1ZGP A;  2PAL A;  3DQK A;  3AAJ A;  4PPK A;  3SSL A;  3JTD C;  1Y6W A;  3PIB A;  1OZS A;  2ZMU A;  3EKH A;  2LCP A;  5FVG A;  2G3O A;  2JOJ A;  4Q9W A;  1WDC C;  5I2L A;  3DY9 A;  5CPV A;  4UPG A;  3H1O A; 
#chains in the Genus database with same CATH homology
 2M7L A;  1CKK A;  2G16 B;  4J89 A;  2M97 A;  2BCX A;  4MVF A;  1SL8 A;  1SW8 A;  5I8N A;  5HZS A;  2F3Z A;  3DPW A;  4YGC B;  1RTP 1;  1CM1 A;  1DJZ A;  1TNQ A;  2AMI A;  1EXR A;  3BUN B;  5KTY A;  1UUR A;  2O2B A;  2V4E B;  2Y4Q A;  4PHN A;  2E30 A;  2ZMW A;  3RWA A;  1KQM B;  2EHB A;  4DXQ A;  2BTJ A;  5TNC A;  5AQB B;  2ZND A;  3JVT C;  2KI6 D;  3DVE A;  2Y5I A;  4Z4M A;  4AR7 A;  2KYF A;  2VRG A;  4ORN A;  1Q80 A;  1N2D A;  1BT6 A;  1W7J B;  4W6K A;  1QAT A;  3VRO A;  4H48 A;  2JUL A;  4JC2 A;  4OV2 A;  1YHH A;  4YI8 A;  1TCO B;  3DQ4 A;  3LCP C;  4CFQ A;  1DGU A;  3TMT A;  1SCM C;  1F09 A;  1RK9 A;  5AFP A;  4H3M A;  1CDM A;  4PAL A;  3TDI A;  2MLF C;  3SVO A;  3ST0 A;  4NDB A;  1CTR A;  4HRG A;  5LTP A;  4I5K A;  4NQG A;  3WHT B;  1UHN A;  2OGR A;  3NSL A;  5DPG A;  1CFC A;  2M7N A;  1RMO A;  3LLE A;  4YGB B;  1ZOT B;  2RH7 A;  3PN7 C;  1EML A;  1JF2 A;  5BTT B;  3I5G C;  3SVB A;  4W6F A;  3DQH A;  4R6D A;  3U8P A;  5EBJ A;  1JC1 A;  4CPV A;  5I2Q A;  1QLK A;  1SY9 A;  2KQ6 A;  1S1E A;  2AUC A;  2B3Q A;  2Y1M A;  3CR5 X;  1BJF A;  4HE4 A;  1YJF A;  4DXN A;  1GGZ A;  4ICB A;  4HQ9 A;  3EK4 A;  4WQ3 A;  3SST A;  5HZT A;  1B7T Z;  1N0Y A;  1NX0 A;  1MXL C;  4W6L A;  4HVF A;  1LVC D;  2MHH A;  1XA5 A;  3CS1 A;  4EDS A;  1OOJ A;  1BG1 A;  2LUX A;  1MYW A;  3DQ3 A;  3BYA A;  2CNP A;  2GV5 A;  4KF5 C;  4KGE A;  1YZW A;  4W6C A;  2JT8 A;  5D69 A;  1AK8 A;  5I2O A;  4I5L B;  2O24 A;  3BXC A;  1MR8 A;  3PM8 A;  1QIW A;  2HFC A;  2AWL A;  1A2X A;  3WNX B;  2WSN A;  1REC A;  4TZG A;  3SJS A;  4QJ4 B;  4W6G A;  4A4C A;  2KBM A;  3U0L A;  4LQU A;  5DRG A;  5DQM A;  5BTT A;  1A4P A;  3ST2 A;  1XAE A;  3DVM A;  1DJH A;  3FWB A;  4ZBL A;  1YJ2 A;  1LA0 A;  3TUY C;  5H88 A;  1XYD A;  1K8U A;  5AER A;  1DJI A;  3NXA A;  4I2Y A;  1CFD A;  4LJD C;  2K61 A;  5B8I B;  3BOW A;  1AJ5 A;  3SRY A;  4YRU A;  1N65 A;  5DTL A;  3U0K A;  1K9P A;  1FBV A;  2VVH A;  1A29 A;  3SSP A;  1B4C A;  4Z4K A;  4DCK A;  1QS7 A;  3LF4 B;  2LVV A;  3I5F B;  1F70 A;  1MWN A;  4I5J A;  2BL0 B;  4AQI A;  3WXA A;  4FTG A;  4W6A A;  3GK2 A;  1LKJ A;  1IJ5 A;  1CB1 A;  3LVC A;  1NP8 A;  1Z1P A;  2PRU A;  4LW5 A;  1E8A A;  2K7C A;  4W69 A;  1CDL A;  2ICR A;  2KFH A;  1KWO C;  3SVS A;  3CR4 X;  1B7T Y;  1EMC A;  1NSH A;  3SSK A;  1JF0 A;  1CDN A;  4W73 A;  2YE0 A;  4W6B A;  1NCX A;  1OSA A;  2WIS A;  4WQ2 A;  3FS7 A;  4E68 A;  5GQQ C;  4OKH A;  5HLV A;  4PHM A;  1RM9 A;  1UIS A;  4ZCV A;  4BY5 A;  2EMD A;  1YHG A;  3SG4 A;  2EC6 B;  3IQO A;  3W1D A;  3SVN A;  1L2O B;  3WHU B;  1JBZ A;  4Q7T A;  1IJ6 A;  1FPW A;  2L98 A;  2HF5 A;  3CZT X;  3LA1 A;  3NT9 A;  1Y0V H;  5HKZ A;  4W7X A;  1G7K A;  1RRX A;  1M31 A;  3DQU A;  4W74 A;  1BOD A;  4A4B A;  1JBY A;  1SKT A;  3TMR A;  4GFT A;  2KDH A;  2PMY A;  3CLN A;  4HQC A;  4W6P A;  1J7P A;  1QXT A;  1B47 A;  1KK8 B;  4FQO A;  4HRH A;  2QU1 A;  5D7F A;  3U8C A;  1QXP A;  2F2P A;  1Q4C A;  2OKW A;  4B30 B;  2ZFD A;  4Q9X A;  1TCF A;  4OJ0 A;  5HZU A;  2M3W A;  1BLQ A;  3SVE A;  4BDU A;  2K2F A;  2OTG C;  3O77 A;  4AOM A;  1K9U A;  2AH8 A;  2WND A;  4P76 A;  3I5H B;  1KQM C;  2JXC A;  1F4O A;  3BUM B;  1S6Z A;  2H2K A;  4W7A A;  2F33 A;  2MA2 A;  1YHI A;  3BXB A;  2GW3 A;  1QX7 A;  2LAN A;  2JXL A;  1SYM A;  2KGR A;  1HQV A;  1EMK A;  3CR2 A;  1FI6 A;  1LXF C;  4GGF A;  2WIQ A;  2O5G A;  4DKM A;  1QJT A;  4JGE A;  4KW4 A;  4Q7R A;  4N1G A;  3NED A;  2KYC A;  4MZK A;  4IK9 A;  1RFJ A;  3KF9 A;  1X02 A;  1CLM A;  4KAG A;  2QLE A;  3DQO A;  4ORA B;  3VHT B;  2WC8 A;  1KFX S;  4RTC A;  2DUF A;  2A47 A;  1J1D A;  4L9M A;  4KA9 A;  2JQ6 A;  2QZ0 A;  5EHU A;  1ALV A;  2JZI A;  4JRB A;  1ZMZ A;  5FYX A;  1HT9 A;  3I5I B;  4PE4 A;  1Q4D A;  2H61 A;  3I19 A;  4KW8 A;  2KNE A;  3SVD A;  2FL1 A;  4L1I A;  5K89 A;  3VK1 A;  1K94 A;  3PAL A;  2OTE A;  1CFP A;  1PSR A;  3CWG A;  2FJU B;  4Q7U A;  4N3D A;  1QIV A;  1PVA A;  1C4F A;  2ZRT A;  3F45 A;  3SG3 A;  4N5X A;  4XVP A;  5DKQ A;  2QLH A;  4JPZ B;  3E3R A;  2K7D A;  4ZF5 A;  3SSV A;  2M1K B;  3NSI A;  2H5R A;  3WCK A;  4XGY A;  2G9B A;  5F9G A;  1SPY A;  3C1V A;  2Q6P A;  1U5I A;  4W77 A;  3BXA A;  2I94 A;  3O4Y A;  2KBI A;  2H6V A;  2F3Y A;  2GGZ A;  4W6R A;  2O29 A;  1MOU A;  4F0Z B;  1CV7 A;  3GEX A;  2HPS A;  3FWC A;  4OQW A;  1S26 D;  1OZO A;  5DPJ A;  4C0K A;  2G3D B;  2BKH B;  4Q04 A;  2JNF A;  3IP2 A;  4W72 A;  5DY6 A;  4NDC A;  1XA9 A;  2L4H A;  4ZCU A;  1BFP A;  1YR5 A;  2LLU A;  5CSI A;  4J88 A;  4JFG A;  3CGL A;  3IQQ A;  4YGA A;  4UTS A;  1H8B A;  1FF1 A;  1XQM A;  2POX A;  3DQD A;  1A75 B;  3BUX B;  4DXO A;  3SIA A;  1J7R A;  1XK4 A;  4I5N B;  3ST3 A;  3DF0 B;  4W76 A;  4PCW A;  3SVR A;  3KO0 A;  1YUR A;  2LNK A;  4EN1 A;  1KK7 Z;  5LTR A;  4R1E A;  1AVS A;  4W6S A;  4W6T A;  4PE0 A;  1XFW O;  3BUO B;  4GPL B;  4H47 A;  1KCY A;  3AI4 A;  3NSK A;  3SSH A;  1TNW A;  3I5F C;  1EJ3 A;  2LUC A;  4GGN A;  4DXM A;  1S36 A;  4M2P A;  4ZIO A;  3QRX A;  4MRY A;  3LK1 A;  4ORC B;  3ZNI A;  1KQV A;  2VZX A;  2FOT A;  3DQ7 A;  2BBM A;  1OMD A;  2A53 B;  1B9C A;  2CXJ A;  2GW4 B;  5EXU A;  4EUL A;  2F8P A;  4C0L A;  4P5O E;  1NUB A;  1IH0 A;  3K1K A;  1SR6 C;  3EVV A;  3EKJ A;  4DUQ A;  1KP5 A;  2M9G A;  1DJX A;  2V4E A;  1KYP A;  4CLN A;  2L51 A;  2PXW A;  3SVC A;  4H3L A;  2Z6X A;  4ANJ A;  3PJ5 A;  4YI9 A;  5KSZ A;  3BX9 A;  4NWS A;  3U0N A;  2GGM A;  1Y1A A;  1F8H A;  2Z1O A;  3DQ6 A;  3AKA A;  2HPW A;  2L2E A;  1L2O C;  3NSO A;  1XMZ A;  4GGF C;  2LHL A;  1YTZ C;  2KI4 B;  1CM4 A;  1NX1 A;  3AKO A;  1XFY O;  3TDZ A;  3DQC A;  3DQN A;  5DTX A;  3LF3 A;  3M0W A;  1H6R A;  2DD7 A;  2MLE C;  2I18 A;  5EB7 A;  2HQ8 A;  1S6J A;  5BQL A;  3PLF B;  4KGF A;  1KK8 C;  1K93 D;  3EVU A;  3P28 A;  1WRZ A;  2ZKM X;  1J7Q A;  2H61 C;  2DUG A;  3JTD B;  1BR4 B;  4ZIN A;  3E5T A;  1QTX A;  1GJY A;  3O78 A;  2DDD A;  1MQ1 A;  4MBE A;  1WDC B;  1BMO A;  2KGB C;  1YX8 A;  1G33 A;  3VIC A;  2ZN9 A;  2IE2 A;  2FWQ A;  3G9A A;  2PVB A;  1CFF A;  2BE4 A;  1XVJ A;  1ZFS A;  2KI6 C;  2H5P A;  2I7A A;  1Y1X A;  4MEW A;  3NEZ A;  2WSO A;  4AS8 A;  2QRF A;  2QT2 A;  2WCE A;  1CLB A;  4JF9 A;  1CLL A;  3RM1 A;  1AJ4 A;  5FVF A;  4GBA A;  3A4U B;  2Z6Y A;  2Y1N A;  3ICB A;  3IF7 A;  5J2O A;  1J55 A;  1JUO A;  1UP5 A;  1W7U A;  2C9J A;  1TIZ A;  2P6B B;  5HLO A;  2WCF A;  2NCP A;  4GNK B;  1QYO A;  4OCI A;  2WHS A;  3LVD A;  3W1C A;  3BXK A;  2K7O A;  1TNX A;  1C7W A;  2H8Q A;  1XSS A;  4MZL A;  1NPQ A;  4PPJ A;  1OXE A;  5HW9 A;  1TOP A;  2M29 A;  1RJV A;  4W6J A;  1JFK A;  3DQL A;  5JOL A;  4OVN F;  1SL7 A;  5JJG A;  2V53 A;  2Y0G A;  3DQF A;  1XK4 C;  3LSA A;  1QYQ A;  2B3P A;  4DIR A;  2Q91 A;  4HRE E;  1F71 A;  1OQP A;  1XFV O;  4R6B A;  3O2P A;  1DJG A;  2FCD A;  3KHE A;  1TNP A;  3RLZ A;  4DXP A;  1YRU B;  5KTG A;  5DU0 A;  2KOT A;  1M46 A;  1ZUX A;  3H1R A;  1UHH A;  2O60 A;  3NF0 A;  4L12 A;  1KFX L;  4DS7 A;  4J8A A;  2JTT A;  3PN7 B;  5LK4 A;  1NCY A;  3OSQ A;  2HGD A;  2HQZ A;  3GJ1 A;  4YGE B;  3RWT A;  4GUK A;  3CFA A;  3SSY A;  1CNP A;  1PRW A;  4N1F A;  1TN4 A;  5FVI A;  1AHR A;  1VRK A;  1K96 A;  2EMN A;  2DUH A;  4GF6 B;  2LE9 B;  3EVP A;  3VRQ A;  3D10 A;  2LVI A;  4KW9 A;  4JEO A;  2ZO7 A;  2ZO6 A;  5BT0 A;  1S6I A;  3AI5 A;  4ETO A;  2V4E C;  3DD4 A;  2B1U A;  1S5G Z;  4M2O A;  3DVJ A;  1BF5 A;  1SBJ A;  5F6T A;  3KCT A;  1YVL A;  2CT9 A;  4P1Q A;  2CTN A;  4NDD A;  1KYS A;  1DT7 B;  4PHJ A;  2K8M B;  2G6X A;  1GFL A;  3E5W A;  1M39 A;  1EMG A;  4DKN A;  2MAZ A;  1K9K A;  4W7C A;  4W6N A;  3GL4 A;  1IQ3 A;  2QLG B;  1GGW A;  1JBA A;  4WRI A;  5DQB A;  3PSR A;  1Q4B A;  1XFX O;  3GOF A;  1XFU O;  3HX4 A;  4ZB1 A;  4XYN A;  5J3X A;  3DQM A;  2I2R E;  2LMT A;  3KPX A;  2D8N A;  2K2A A;  2G2B A;  4RYS A;  3PAT A;  2LLS A;  1IGV A;  2BBN A;  4B30 A;  4PPL A;  2CBL A;  4HSZ A;  2Q57 A;  5PAL A;  3ST4 A;  3OB2 B;  4PHK A;  2E6W A;  1KSO A;  2YFP A;  4QJ5 B;  2H5Q A;  5AAN A;  5LTQ A;  3ADF A;  2OS8 B;  4JWQ A;  1QLS A;  2JTZ A;  3CFF A;  2JAD A;  1EMF A;  4U2V A;  1KWO B;  1ZUZ A;  2QAC A;  1HUY A;  3D0Y B;  3SIB A;  1A03 A;  4ZFS A;  1S6C A;  2A50 B;  4IK1 A;  1QX5 B;  1M45 A;  3SG6 A;  2KFG A;  2M1U A;  2QLG A;  5ER4 X;  2VVJ A;  4ZF4 A;  4JQ0 D;  1GGX A;  1EMB A;  2QPT A;  5DTZ A;  3TS5 B;  4OHS A;  3EK7 A;  1S5G Y;  5AXI A;  2KAX A;  3DPX A;  1M63 B;  4MRX A;  2MBX A;  3VGO A;  1ALW A;  5EB6 A;  1HCJ A;  2BKI B;  1SRA A;  3VHT A;  5HBD A;  5IBW A;  1QX2 A;  2LM5 A;  4CID A;  4W6I A;  2LMU A;  1L7Z A;  1TRF A;  1MOV A;  1DVI A;  3ED8 A;  1RMP A;  1SL9 A;  5EXB A;  2DDC A;  4W75 A;  4KF4 A;  1DJY A;  1B1G A;  5EJU A;  2EGD A;  1F55 A;  3PJB A;  2JRF A;  1MUX A;  3PFV A;  2NLN A;  1ZGO A;  1K2H A;  1YUU A;  2LMV A;  4DRW A;  1XO5 A;  1W7T A;  4C0J A;  1W7I B;  4MZJ A;  4CFR A;  2YE1 A;  3PJ7 A;  2AWJ A;  1EG3 A;  4MLW A;  5T3I A;  3ZUL A;  1GQM A;  3D0Y A;  4YGD B;  1SMG A;  4W7D A;  2JC2 A;  2OTG B;  3CD9 A;  3OP0 A;  3VRN A;  2LLT A;  5BPJ A;  1KFU S;  3OX6 A;  1WRL A;  5DKN A;  1EMM A;  1J1E A;  1EL4 A;  2WUR A;  3MSE B;  2BL0 C;  1W7S A;  1IG5 A;  2KHN A;  3SG7 A;  1AUI B;  5G08 A;  5DPI A;  3IR8 A;  2VAE A;  3NT3 A;  1SNL A;  2AAO A;  2ISD A;  3OX5 A;  2OJK A;  4LJC A;  5DKR A;  1AP4 A;  1IQ5 A;  3SS0 A;  1B8R A;  1BOC A;  3SV5 A;  1B8L A;  1A75 A;  1FI5 A;  1OXF A;  4XJK B;  1YFP A;  2L5X B;  3DVK A;  1G4Y R;  3DF0 A;  5KU1 A;  3GJ2 A;  1BU3 A;  1OMV A;  1SK6 D;  2YDZ A;  1PAL A;  2GX0 A;  4W7F A;  2EC6 C;  3UG0 A;  2NCO A;  1YVH A;  1C07 A;  2LAP A;  2ARL A;  1IRJ A;  1EG4 A;  5HZO A;  3CFH A;  2HQK A;  1Z1Q A;  2QLI A;  1NWD A;  3OB1 B;  3ZUF A;  1JC0 A;  3BOW B;  4MSP A;  1LIN A;  2F2O A;  1DF0 B;  5CSN A;  3GK4 X;  4LQT A;  3S05 A;  4IZN A;  3U8A A;  3DQ1 A;  3O6B A;  1WY9 A;  3A8R A;  1CMG A;  2VAD A;  2H9W A;  5H87 A;  2FCE A;  1KK7 Y;  2JNX A;  3M24 A;  2FZU A;  5CSF A;  2MRD A;  2A4J A;  2M49 B;  3M22 A;  1Q4E A;  2NZ0 A;  1MHO A;  3I5H C;  2PXS A;  2A54 B;  4XJK A;  1YRT B;  2TN4 A;  2PAS A;  5ER5 A;  2BCA A;  2EMO A;  1K90 D;  3KCS A;  3OGO A;  1WRK A;  3BQ3 A;  1C7V A;  5EXC I;  1B9A A;  2WCB A;  3LVA A;  4PFE A;  3ZWH A;  1DTL A;  1H4B A;  1IWQ A;  1K95 A;  2WHT A;  3VRR A;  2A46 A;  1PUL A;  3AAK A;  2KAV A;  1QAS A;  1PK0 D;  5CSJ A;  1NX2 A;  4OR9 B;  1DF0 A;  4U8D A;  3JVT B;  2PSR A;  2K0J A;  1KYR A;  2HCG A;  3SG5 A;  3CTN A;  4IK4 A;  3OSR A;  1F0B A;  4GOB A;  2R2I A;  4HQ8 A;  1JWD A;  3P8U A;  2NXQ A;  3I5I C;  3FIA A;  4W7E A;  1G8I A;  1S3P A;  2JT3 A;  4IL1 A;  2JPT A;  3V3D A;  3DQE A;  1SCM B;  3K21 A;  2IOV A;  4IK8 A;  2WOS A;  4D1E A;  2WOR A;  1Q73 A;  2LVK A;  2BE6 A;  3DQ8 A;  2KSP A;  4M2Q A;  3MGF A;  4IK5 A;  2CCM A;  2Q4U A;  4W6U A;  2AWK A;  4YBH B;  2L4I A;  2OS8 C;  3GB3 A;  3AKB A;  2IB6 A;  2HET A;  2G6E A;  1XFZ O;  4P2Y B;  1UUS A;  1SR6 B;  1QY3 A;  4DXI A;  4OGS A;  1QVI Z;  1QV0 A;  5HKY A;  3GK1 A;  1F4Q A;  1OE9 B;  1IKU A;  3I5G B;  2M0R A;  2HJO A;  3ZTF A;  1BR1 B;  3H4S E;  2BEC A;  1UHK A;  3TS5 C;  1ODB A;  2AHA A;  1FW4 A;  3CGA A;  2BCB A;  1QYF A;  2HGY A;  1CDP A;  2LC5 A;  1PSB A;  1R2U A;  3VRP A;  4H3N A;  1PVB A;  4IK3 A;  1UWO A;  1CMF A;  3EK8 A;  4USL A;  1B8C A;  2ZNE A;  1GL4 A;  2OKY A;  2KAY A;  4XOW A;  3DQJ A;  5AEQ A;  2LV7 A;  1YUS A;  2H5O A;  1EMA A;  5HKW A;  1JSA A;  1KSM A;  3DQI A;  1NIW A;  4ZF3 A;  2AWM A;  1YX7 A;  3LL8 B;  3DQ5 A;  1UHJ A;  1JFJ A;  2G5Z B;  3WLD A;  4W6M A;  4AQJ A;  4GAO A;  3LS3 A;  2COL B;  4PE7 A;  2G2S B;  3WLC A;  1RMM A;  3LK0 A;  1MXE A;  3DPZ A;  4TNC A;  2OPO A;  5HGE A;  2DUI A;  2OTB A;  4GES B;  3SG2 A;  4ORB B;  3DQ2 A;  4RYW A;  3KEV A;  3HCM A;  1Q4A A;  2K7B A;  3U0M A;  4LJB A;  1LA3 A;  2IB5 A;  1YUT A;  5DTY A;  2LVJ A;  5DRF A;  1UHI A;  3CB9 A;  3CBE A;  3TUY B;  4EMQ A;  1DJW A;  2L50 A;  1WLZ A;  2HQW A;  2HRS A;  3SVU A;  3TDU A;  1H4U A;  2JT0 A;  2Z6Z A;  1J7O A;  1U5I B;  1QV1 A;  1RWY A;  2A56 B;  3OHM B;  2C9I A;  2A48 A;  1EH2 A;  1NCZ A;  3CD1 A;  2GX2 A;  2M8U A;  4MN0 A;  4XL5 A;  2KFF A;  2LHI A;  3UFZ A;  3E5V A;  5H89 A;  1RRO A;  3ZUJ A;  1Y1U A;  1ZGQ A;  4W7R A;  1QVI Y;  4PDZ A;  1R6P A;  1JC2 A;  4OY4 A;  1ZAC A;  2RGI A;  4KF5 A;  2ZRS A;  1DGV A;  1MF8 B;  4L13 A;  4KEX A;  2LP2 A;  1KFU L;  1NYA A;  3DQ9 A;  2P4M A;  2A52 B;  1D1O A;  1DMO A;  5FHV A;  1WLM A;  3TZ1 A;  4W6H A;  1EME A;  2MJW B;  4W6O A;  2WHU A;  2JWW A;  2LP3 A;  1F54 A;  2L0P A;  2DD9 A;  2G6Y A;  2KI4 C;  1NX3 A;  4B5Y A;  4QJ3 B;  5HYD A;  4TZA A;  4BY4 A;  3EVR A;  2JU0 A;  1OMR A;  2DOQ A;  1OXD A;  1V1F A;  2SCP A;  2ZN8 A;  2SAS A;  4XOV A;  4KPI A;  3BUW B;  2DUE A;  4EDO A;  2VVI A;  5DPH A;  3A8S A;  3DQA A;  1V1G A;  1TTX A;  4LJD A;  2KQY A;  2IS9 A;  4W6D A;  4PE1 A;  1SCV A;  1ZGP A;  2PAL A;  3DQK A;  3AAJ A;  4PPK A;  3SSL A;  3JTD C;  1Y6W A;  3PIB A;  1OZS A;  2ZMU A;  3EKH A;  2LCP A;  5FVG A;  2G3O A;  2JOJ A;  4Q9W A;  1WDC C;  5I2L A;  5CPV A;  4UPG A;  3H1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...