3EK4A

Calcium-saturated gcamp2 monomer
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
367
structure length
348
Chain Sequence
KTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 111
structure length 348
sequence length 367
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek4A02
4OR9B 2O60A 3TMTA 2FJUB 1TOPA 4DKMA 2MA2A 1Z1QA 2QLIA 4MLWA 1PK0D 3CR5X 2KFHA 2JOJA 3FS7A 2Q91A 3VRQA 3CS1A 2JQ6A 1GFLA 4Q04A 1SR6B 1EXRA 4ZCUA 3SG6A 1SY9A 4XOVA 4W6SA 2KFFA 1WLMA 4W6KA 2JTZA 1F71A 1FBVA 2P6BB 3SVCA 4GNKB 2KI4C 1K8UA 1SCMC 4YBHB 5CSJA 4AQIA 1IQ5A 1B4CA 2BE4A 1TTXA 1F54A 4PHMA 4LW5A 4LJDA 1AVSA 1G8IA 1DMOA 1WRLA 3O78A 2HGDA 1B8LA 1CLMA 4ZIOA 3P28A 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 4NQGA 1CV7A 5HZTA 1XVJA 2G6YA 5EHUA 2DDDA 4ZF4A 2WOSA 2A4JA 5EXUA 4LJDC 1CFCA 4GGFC 2M29A 2AWKA 2H5QA 2OGRA 5DQMA 1RWYA 5CSNA 3SSLA 4WQ3A 4ORAB 4ZFSA 5J3XA 4HQCA 3EVUA 4MSPA 1TCFA 2ARLA 3ST0A 1NYAA 2F2OA 3U0LA 5LTQA 4QJ5B 5KTGA 3W1DA 4EDOA 3D10A 5KTYA 2V4EB 4KGEA 2ZO6A 1WRKA 4DIRA 3PFVA 2LLTA 1UHNA 2EMDA 3CWGA 3LCPC 2BTJA 4JFGA 3ST2A 4HQ9A 1R2UA 5FVIA 4EDSA 1OMDA 1QX7A 5JOLA 1N0YA 2WCBA 1F55A 2QU1A 4W6BA 1NCYA 1WDCB 1QV0A 5DU0A 1ALVA 2QPTA 3NXAA 2ICRA 2YE0A 3W1CA 4ZINA 1Y0VH 4KPIA 3DF0B 2I7AA 3SVNA 2LUXA 4U8DA 1C4FA 3I5HB 2K61A 1MOVA 4TZAA 2JT8A 2L4IA 4PE7A 3I5FC 1OMRA 3ICBA 2D8NA 4UPGA 1NX3A 1PVBA 3SSPA 3IP2A 5F6TA 1XFXO 1IJ6A 2FWQA 1EJ3A 3G9AA 2KYCA 2PXSA 1GL4A 5I8NA 1HUYA 4B5YA 1XA9A 1S6JA 4GESB 1CTRA 3SVEA 1S5GZ 2A50B 2A47A 1CFFA 1ZGQA 4DS7A 4HRHA 4TNCA 2SCPA 2JADA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 3NT3A 5FVFA 4NDCA 4M2PA 4AR7A 2H5OA 2WISA 5HGEA 4AQJA 4RYWA 1EG4A 2LLUA 2L51A 4NDBA 4PALA 3TMRA 4PPJA 2JRFA 1KYSA 1X02A 4W6TA 1GGZA 1RK9A 5CSIA 1W7IB 2AWJA 4EN1A 1Y1UA 1KFXL 2BE6A 2JXCA 2Y1MA 1CFDA 3RWTA 2TN4A 1W7UA 4DXPA 1NX0A 3E3RA 3KF9A 4DXIA 3NSLA 4J88A 3E5TA 3AI4A 1AUIB 1LA0A 5KU1A 1AP4A 2EC6B 3DQ7A 3E5WA 2E6WA 1FW4A 1DVIA 4R1EA 2MLFC 3EVPA 2ZRSA 5DTLA 2K2FA 2L50A 5D69A 2LANA 4R6DA 1EMCA 3SG5A 4CIDA 3U8CA 4ETOA 1EMKA 1CDMA 1J7RA 3HX4A 2P4MA 1XFVO 5DPIA 1EMLA 1YUUA 3P8UA 1GGWA 3IQOA 4R6BA 4TZGA 2L2EA 1JF0A 4PHJA 5EBJA 3EK7A 1HCJA 4B30B 2K7CA 3DQLA 3A4UB 4OJ0A 3OX6A 2BCAA 2QT2A 2O5GA 4ORCB 1SR6C 2BECA 1YRTB 4ANJA 4W6CA 5G08A 5B8IB 3CBEA 2I94A 5HKZA 3U0MA 2JT0A 3DVEA 5I2QA 3U8AA 1ZGOA 2CXJA 5DTYA 3AKOA 2ZN8A 3D0YB 4W77A 2Q6PA 1RMOA 5HLOA 3VROA 1YTZC 4I5JA 2JNFA 1B9CA 4PE0A 1CKKA 2Y5IA 2AWMA 4PPLA 3NEZA 2PRUA 3TZ1A 2RGIA 3EKJA 1Q4EA 1NCZA 1QLKA 4MZKA 3CD9A 4JRBA 1B1GA 1NPQA 3H1OA 4ZF5A 2G3DB 3JTDB 1SL9A 4HSZA 3I5IB 3NEDA 2OKWA 5HKYA 4GPLB 1CM4A 2HFCA 3TUYB 1MUXA 4W6PA 2IB6A 3WLDA 1BJFA 1DT7B 2OTBA 4MEWA 1Y6WA 1S36A 1TIZA 5AQBB 4MN0A 5EB6A 2BL0C 1HQVA 5CPVA 3SVRA 1NX1A 5PALA 3LL8B 1NCXA 2QACA 3KCSA 4N5XA 1K96A 1WLZA 4Z4KA 1S5GY 1PULA 2DUFA 3SSTA 4W6MA 4BY5A 1XMZA 3DPZA 4W7AA 4H3LA 3OSRA 1JC2A 1WDCC 4PCWA 2VADA 5H89A 4IK1A 4N3DA 1EMEA 2MAZA 1C7WA 3BUMB 3DQUA 2DDCA 4LQUA 2WCFA 1B7TY 3I5HC 2LC5A 2G5ZB 2RH7A 5AERA 2B3QA 1IRJA 1KFUS 3AKBA 2VVHA 5DKNA 1MQ1A 1TCOB 1YVHA 1BFPA 2LNKA 1J1DA 1S6CA 5DKRA 1K90D 2Y1NA 2QZ0A 4W7FA 3GK2A 2LMTA 3CTNA 3SVOA 4QJ4B 1PSRA 4JC2A 3OX5A 1XFZO 1FI5A 2EMOA 1KP5A 1TN4A 1CDNA 4W74A 1KSMA 3I19A 3GK1A 1UUSA 2FCDA 2MJWB 1F4QA 1HT9A 1H8BA 3GOFA 2PSRA 1OXEA 1XO5A 1RTP1 3DQEA 1SNLA 4ORBB 4W7EA 2OKYA 2CT9A 4H48A 1QY3A 1JC1A 3SG4A 5HKWA 3WXAA 4W6JA 4W6RA 3DPWA 1QS7A 3VRNA 2VRGA 4W6UA 4H3MA 2K7BA 2VAEA 1JBAA 2YFPA 1EL4A 1ZOTB 2EC6C 3ZUJA 2JPTA 2WHUA 4GOBA 1IG5A 1SBJA 3DPXA 1KQVA 4HQ8A 1KWOB 1QLSA 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 1YR5A 3DQ8A 2LV7A 3K1KA 2DUHA 1YX8A 1Q80A 1S6IA 2VVJA 4B30A 5BPJA 3OSQA 1M31A 2HQKA 1V1GA 2PALA 1QX5B 4OY4A 5JJGA 1BR1B 3DQIA 3CR2A 1EMGA 4DKNA 1PSBA 2EMNA 1RMPA 2BL0B 2KGRA 4LQTA 2DD9A 3VICA 1ALWA 3D0YA 3TDIA 1B8CA 4JQ0D 1J1EA 2H6VA 2PVBA 1K9PA 1XFWO 2LVVA 3U8PA 3CGLA 2HPWA 3I5GB 3AAJA 2H61A 3S05A 3RWAA 3BUXB 2ZMUA 3PJ5A 1Q4BA 1S6ZA 1KK7Z 5AFPA 3DQDA 4KEXA 1IJ5A 2HRSA 4MZLA 1F8HA 1CDPA 2H61C 1UURA 4U2VA 2F3YA 2K7DA 3SG7A 5DRGA 4OKHA 2KYFA 3EVRA 2HETA 4L1IA 2KQ6A 4HRGA 4W6FA 2COLB 4I5NB 3JTDC 3PATA 3V3DA 3I5IC 4WQ2A 5FYXA 1WY9A 4BDUA 1S1EA 1CDLA 2JZIA 2H5PA 3TUYC 3OGOA 3DQ3A 2KOTA 1U5IB 2AH8A 3ST4A 1LVCD 1XQMA 3KPXA 3LLEA 1WRZA 2AAOA 3TDZA 3WHUB 3WNXB 2FL1A 1TRFA 2LCPA 3AI5A 2HCGA 3SVSA 2L98A 5AEQA 1B7TZ 1J7OA 3DQAA 5HZUA 4W6OA 3A8SA 5K89A 3EK4A 3C1VA 2GV5A 1ODBA 4ZCVA 2NZ0A 2M97A 2ZMWA 1RECA 4BY4A 2Q4UA 1YVLA 3PM8A 4OCIA 3SIAA 4ICBA 2HPSA 3BOWA 2NCOA 4L13A 3ZTFA 3JVTC 1F0BA 1LA3A 4HVFA 2L5XB 1L7ZA 3LVAA 4JWQA 2WHTA 2WIQA 1PVAA 2IE2A 5FVGA 4KA9A 1YFPA 2YE1A 3GEXA 3LSAA 1IH0A 1CLBA 4E68A 2NLNA 2KBIA 4W7DA 1RFJA 1UHHA 3DVMA 4GBAA 2I18A 3SSHA 1PALA 2OTEA 5ER5A 1QTXA 1TNQA 1GQMA 3UG0A 3CZTX 1F70A 4L12A 1QASA 5H88A 4W6DA 4MRXA 2QLEA 3PIBA 4PE4A 1JWDA 2A53B 1OQPA 1XSSA 5HZOA 1MF8B 3PLFB 1MHOA 4ZBLA 1S26D 2F8PA 2ZFDA 2KI6D 3CR4X 2G2SB 3PJBA 2E30A 1EMAA 3M22A 2KFGA 3SVDA 4XGYA 1TNXA 1KFUL 1K93D 3M0WA 1G4YR 4KAGA 1UISA 2OPOA 1SCVA 1G33A 4L9MA 2A52B 3DQ2A 2B3PA 4W69A 1FI6A 2C9IA 1TNPA 4P1QA 3CB9A 1QYOA 1XAEA 3BXCA 4Z4MA 1TNWA 2KAXA 3KHEA 3DQOA 1NUBA 1RROA 3DQ4A 4W7XA 4W6HA 3VGOA 4PE1A 2H9WA 2G6EA 1YHGA 4DXMA 1F09A 4ORNA 4MBEA 4GF6B 1KWOC 5EXBA 4W6NA 2OJKA 1W7SA 2LP2A 1BR4B 5FHVA 2BCBA 5ER4X 1KK7Y 3O6BA 1OE9B 5KSZA 4H3NA 2BKHB 1DJYA 1K9KA 1L2OB 5DTZA 1A2XA 4YGBB 2PASA 1BOCA 1NWDA 1A75A 2M7NA 2IB5A 2L4HA 3DQMA 4JGEA 1KFXS 2GGMA 1OZSA 1F4OA 1KK8B 2OS8B 3LK1A 1JFKA 5HW9A 4W6IA 5BQLA 1SK6D 3SSYA 4PFEA 2KSPA 3DQFA 2QLGA 2HQWA 3I5GC 2O29A 4IZNA 3DQKA 2Z6ZA 1A03A 3BQ3A 1RJVA 4JPZB 5H87A 3LS3A 5EJUA 1M39A 2Q57A 3SVUA 2MLEC 4KW4A 3JVTB 4Q7TA 4CLNA 1YJFA 2NXQA 1OSAA 2OTGC 1SKTA 3NSIA 4D1EA 4W6AA 4XYNA 3GJ2A 2WCEA 3DQ1A 4XOWA 1QX2A 1YRUB 1KSOA 3BOWB 2F33A 4N1GA 1U5IA 2AUCA 3SRYA 1FPWA 3NT9A 2ZNEA 3NF0A 3SV5A 1ZACA 1Y1XA 1RRXA 3SG3A 4JEOA 2JU0A 1AHRA 1QYQA 2C9JA 4M2OA 1JSAA 4IK4A 1J7QA 1UHJA 3LF4B 2LM5A 3FIAA 2WHSA 1BLQA 1N65A 4KF4A 5DKQA 3NSOA 2PMYA 4P5OE 1M63B 3DQCA 4Q7UA 3GB3A 1BF5A 2WC8A 3GL4A 1XYDA 2G16B 1S3PA 1CLLA 1VRKA 4CFRA 1XA5A 1YHHA 3BX9A 1EMFA 2GX0A 5D7FA 2FZUA 2KAVA 3U0NA 3GJ1A 1JF2A 3SVBA 3FWBA 3SJSA 2F3ZA 4A4CA 2HGYA 4W72A 4KW9A 1SL7A 2JULA 4IK9A 1AK8A 5BTTB 3OHMB 3FWCA 2HQZA 4DXQA 3TDUA 1QJTA 2AHAA 2JNXA 1YZWA 2G3OA 3BXBA 3KO0A 3WCKA 3EVVA 2I2RE 1QXTA 5EXCI 1SYMA 3VRRA 2DUIA 1IQ3A 4IK5A 4GGFA 4YRUA 1JUOA 2QLHA 5LTRA 2VVIA 1QIWA 2GX2A 3GK4X 3WLCA 1BG1A 3NSKA 2Z1OA 2F2PA 4OGSA 3SSKA 1JC0A 3CFHA 3EK8A 3CD1A 4YI9A 5LTPA 3HCMA 3OP0A 5AXIA 1R6PA 4W6LA 1YUTA 1BT6A 1H4BA 1OXDA 2ZO7A 2GW4B 4YGAA 4XVPA 4W73A 2M3WA 3PSRA 4GUKA 1Q73A 2LHIA 2M1UA 2WORA 2GGZA 3BUNB 5AANA 4DUQA 4FQOA 1JBYA 1A75B 1YURA 1Q4DA 3LVCA 3VHTB 3DQNA 2FOTA 2K8MB 2LLSA 1D1OA 2M1KB 1YUSA 1DGUA 1QVIY 1RM9A 4IK8A 4I5LB 3SS0A 1DF0A 1RMMA 3M24A 4W75A 3SSVA 1J55A 1MR8A 3BUWB 4XJKB 1KYPA 1OMVA 1K9UA 2JXLA 2CTNA 2LP3A 2M49B 3O4YA 4DXNA 2QLGB 4QJ3B 1IWQA 2EGDA 5DQBA 3A8RA 5J2OA 2LAPA 2OTGB 3H4SE 3DQ6A 2WSOA 1V1FA 4GGNA 1GGXA 1YX7A 3WHTB 3DQJA 1SPYA 5IBWA 4NWSA 1QXPA 1C07A 1EMBA 1ZUXA 2KDHA 4HE4A 2O24A 5T3IA 3DQ5A 1JBZA 5DPHA 1B9AA 1MXLC 3LA1A 1L2OC 4RYSA 1A4PA 4Q7RA 1XK4A 1BMOA 2A48A 4I5KA 4W7CA 2M7LA 5DTXA 2MRDA 2MBXA 4YGCB 1KQMC 3CLNA 1KK8C 2OS8C 1XK4C 2G6XA 1LKJA 1OZOA 4HREE 1ZFSA 3IF7A 1CMFA 3CGAA 3AKAA 3ADFA 4DCKA 2V53A 1GJYA 5DPJA 2QRFA 4PHKA 2LVIA 4DRWA 3EKHA 5BT0A 1CNPA 3IQQA 3LK0A 2DUEA 3H1RA 4LJCA 1IKUA 2JWWA 1W7TA 1B47A 2MHHA 4FTGA 5HLVA 3RM1A 3O77A 4W7RA 2DUGA 1DJGA 1DJWA 4C0LA 1B8RA 4GFTA 1QV1A 1OXFA 1CM1A 3ZWHA 5CSFA 2KI4B 2O2BA 1QYFA 4J89A 1J7PA 1SCMB 2A56B 2DOQA 5DRFA 4OQWA 3MSEB 2Y0GA 2SASA 1MWNA 1BODA 1KYRA 4M2QA 1DTLA 1DJHA 4DXOA 1EG3A 4A4BA 1ZGPA 2WNDA 3U0KA 2LMUA 2AMIA 2A46A 2M0RA 4WRIA 1SL8A 4MVFA 4IK3A 2HF5A 1AJ5A 4EMQA 2H5RA 2G9BA 3OB2B 4OV2A 3UFZA 2BKIB 2AWLA 3DQ9A 2JTTA 3VRPA 1PRWA 4Q9WA 4XL5A 1NIWA 4MZJA 2POXA 2HJOA 1OOJA 2KI6C 4F0ZB 2CCMA 2M8UA 2K2AA 2CNPA 2ZN9A 5BTTA 1UHIA 2LVJA 3DVJA 4J8AA 4N1FA 2YDZA 4H47A 4KGFA 4W6GA 4UTSA 2Y4QA 2WURA 2WSNA 4OHSA 3CFFA 3LVDA 1UP5A 1K2HA 4KF5A 2GW3A 3LF3A 2IOVA 3PJ7A 3DQHA 3E5VA 4PPKA 4C0KA 2ZKMX 4P76A 4CPVA 2KQYA 2ZRTA 4PHNA 2BCXA 3SIBA 2DD7A 3ZULA 3RLZA 4ZB1A 2FCEA 1DGVA 1MXEA 1DF0B 1YJ2A 4KF5C 4RTCA 1Y1AA 4I2YA 2LUCA 5LK4A 4W76A 1IGVA 1H4UA 4YGEB 2LVKA 1DJXA 4OVNF 3F45A 3ST3A 3CFAA 1AJ4A 1DJZA 3I5FB 1XFUO 2NCPA 3BXKA 1UHKA 4AS8A 2B1UA 1MOUA 2PXWA 3VHTA 4USLA 1G7KA 3BUOB 1QVIZ 1SMGA 1FF1A 1LINA 2V4EA 2JC2A 2BBNA 4PDZA 1KQMB 1EH2A 5F9GA 2LHLA 2EHBA 1KCYA 2K7OA 3QRXA 2HQ8A 4KW8A 3KEVA 2LE9B 5HBDA 1MYWA 4XJKA 4ZF3A 3KCTA 2LMVA 3PN7B 3TS5B 1NP8A 1Q4CA 4YGDB 2V4EC 2VZXA 4CFQA 1BU3A 3PALA 4YI8A 2M9GA 3ED8A 1E8AA 2CBLA 5HZSA 1Q4AA 4IL1A 1C7VA 1EMMA 5I2OA 1QIVA 1M45A 3DF0A 2Z6YA 1CFPA 5HYDA 1CMGA 3IR8A 1QATA 4Q9XA 3DVKA 1SRAA 2G2BA 2IS9A 4AOMA 1Z1PA 5TNCA 4JF9A 2ISDA 2BBMA 2Z6XA 3VK1A 2A54B 3O2PA 1JFJA 3BYAA 3ZUFA 1ZMZA 2H2KA 2KAYA 5GQQC 4NDDA 5DY6A 5EB7A 1N2DA 3MGFA 2JT3A 5DPGA 2KHNA 3AAKA 1K95A 2L0PA 2KBMA 1NSHA 1NX2A 1UWOA 1SW8A 1DJIA 4P2YB 4EULA 4LJBA 1XFYO 2KNEA 1K94A 1M46A 2K0JA 3BXAA 1H6RA 2H8QA 5I2LA 1YHIA 3SG2A 3DD4A 4MRYA
chains in the Genus database with same CATH superfamily
3B7AA 4OR9B 2O60A 3TMTA 2FJUB 1TOPA 4DKMA 2MA2A 1Z1QA 2QLIA 4MLWA 1PK0D 3CR5X 2KFHA 2JOJA 3FS7A 2Q91A 3VRQA 3CS1A 2JQ6A 1GFLA 4Q04A 1SR6B 1EXRA 4ZCUA 3SG6A 1SY9A 4XOVA 4W6SA 2KFFA 1WLMA 4W6KA 2JTZA 1F71A 1FBVA 2P6BB 3SVCA 4GNKB 2KI4C 1K8UA 1SCMC 4YBHB 3BFAA 5CSJA 4AQIA 1IQ5A 1B4CA 2BE4A 1TTXA 1F54A 4PHMA 4LW5A 4LJDA 1AVSA 1G8IA 1DMOA 1WRLA 3O78A 2HGDA 1B8LA 1CLMA 4ZIOA 2FJYA 3P28A 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 4NQGA 1CV7A 5HZTA 1XVJA 2G6YA 5EHUA 2DDDA 4ZF4A 2WOSA 2A4JA 5EXUA 4LJDC 1CFCA 4GGFC 2M29A 2AWKA 2H5QA 2OGRA 5DQMA 1RWYA 5CSNA 3SSLA 4WQ3A 4ORAB 1DEKA 2K60A 4ZFSA 5J3XA 4HQCA 3EVUA 3B6XA 1TCFA 4MSPA 2ARLA 3ST0A 1NYAA 2F2OA 3U0LA 3CDNA 5LTQA 4QJ5B 5KTGA 3W1DA 4EDOA 3D10A 5KTYA 2V4EB 4KGEA 2ZO6A 1WRKA 4DIRA 3PFVA 2LLTA 1UHNA 2EMDA 3CWGA 3LCPC 2BTJA 4JFGA 3ST2A 4HQ9A 3B86A 1R2UA 5FVIA 4EDSA 1ORGA 1OMDA 1QX7A 5JOLA 2P71A 1N0YA 2WCBA 1F55A 2QU1A 4W6BA 1NCYA 1WDCB 1QV0A 5DU0A 1ALVA 2QPTA 3NXAA 2ICRA 2YE0A 3W1CA 3R72A 4ZINA 1Y0VH 3V2LA 4KPIA 3DF0B 2I7AA 3SVNA 2LUXA 4U8DA 1C4FA 3I5HB 3R1VA 2K61A 1MOVA 4TZAA 2JT8A 2L4IA 4PE7A 3I5FC 1OMRA 3ICBA 2D8NA 4UPGA 1NX3A 1PVBA 3SSPA 3IP2A 5F6TA 1XFXO 1IJ6A 2FWQA 1EJ3A 3G9AA 2KYCA 2PXSA 1GL4A 5I8NA 1HUYA 4B5YA 1XA9A 1S6JA 4GESB 1CTRA 3SVEA 1S5GZ 2A50B 2A47A 3CZ1A 1CFFA 1ZGQA 4DS7A 4HRHA 4TNCA 2SCPA 2JADA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 3NT3A 5FVFA 4NDCA 1OOGA 4M2PA 4AR7A 2H5OA 2WISA 5HGEA 4AQJA 4RYWA 1EG4A 3L47A 2LLUA 2L51A 4NDBA 4PALA 3TMRA 4PPJA 2JRFA 1KYSA 1X02A 4W6TA 1GGZA 5DICA 1TUZA 1RK9A 5CSIA 2QDIA 1W7IB 2AWJA 4EN1A 1Y1UA 1KFXL 3CABA 2BE6A 2JXCA 2Y1MA 1CFDA 3RWTA 2TN4A 1W7UA 3S0EA 4DXPA 1NX0A 3E3RA 3KF9A 4DXIA 3NSLA 4J88A 3E5TA 1OOFA 3PM2A 3AI4A 1AUIB 1LA0A 5KU1A 1AP4A 2EC6B 3DQ7A 3E5WA 2E6WA 1FW4A 1DVIA 4R1EA 2MLFC 3EVPA 5FI6A 2ZRSA 5DTLA 2K2FA 2L50A 5D69A 2LANA 4R6DA 1EMCA 2WC5A 3SG5A 4CIDA 3U8CA 4ETOA 1EMKA 1CDMA 3R1PA 1J7RA 3HX4A 2P4MA 1XFVO 5DPIA 1EMLA 1YUUA 3P8UA 1GGWA 3IQOA 4R6BA 2WCJA 1W9ZA 4TZGA 2L2EA 1JF0A 4PHJA 5EBJA 3B87A 3EK7A 1HCJA 4B30B 2K7CA 3DQLA 3A4UB 4OJ0A 3OX6A 2BCAA 2QT2A 2JPOA 2O5GA 4ORCB 1SR6C 2BECA 1YRTB 5EL2A 4ANJA 4W6CA 5G08A 5B8IB 3CBEA 2I94A 5HKZA 3U0MA 2JT0A 3DVEA 5I2QA 2WCKA 1ZGOA 3U8AA 1C3ZA 2CXJA 5DTYA 3AKOA 2ZN8A 1LS8A 3D0YB 3D76A 4W77A 2Q6PA 1RMOA 5HLOA 3VROA 1YTZC 4I5JA 2JNFA 1B9CA 4PE0A 1CKKA 2Y5IA 2AWMA 4PPLA 3NEZA 2PRUA 3TZ1A 2RGIA 3EKJA 2ERBA 1Q4EA 1NCZA 1QLKA 4MZKA 1OW4A 3CD9A 4JRBA 1B1GA 1NPQA 3H1OA 4ZF5A 3D78A 2G3DB 3JTDB 1SL9A 4HSZA 3I5IB 3NEDA 2OKWA 5HKYA 4GPLB 1CM4A 3S0DA 2HFCA 3TUYB 1MUXA 4W6PA 2IB6A 3WLDA 1BJFA 1DT7B 2OTBA 4MEWA 1Y6WA 1S36A 1TIZA 5AQBB 4MN0A 5EB6A 2BL0C 1HQVA 5CPVA 3SVRA 1NX1A 5PALA 3LL8B 1NCXA 2QACA 3KCSA 4N5XA 1K96A 1WLZA 4Z4KA 1S5GY 1PULA 2DUFA 2QEOA 3SSTA 4W6MA 4BY5A 1XMZA 3DPZA 2YGUA 4W7AA 4H3LA 3OSRA 1JC2A 1WDCC 4PCWA 2VADA 5H89A 4IK1A 4N3DA 1EMEA 2MAZA 1C7WA 3BUMB 3DQUA 2DDCA 4LQUA 2WCFA 1DC1A 1B7TY 3I5HC 2LC5A 2G5ZB 2RH7A 3UNWA 5AERA 2B3QA 1IRJA 1KFUS 3AKBA 2VVHA 5DKNA 2GTEA 1MQ1A 1TCOB 1YVHA 1BFPA 2LNKA 1J1DA 1S6CA 5DKRA 1K90D 2Y1NA 3S0BA 2QZ0A 4W7FA 3GK2A 2LMTA 3CTNA 3SVOA 4QJ4B 1PSRA 4JC2A 3OX5A 1XFZO 1FI5A 2EMOA 3S0GA 1KP5A 1TN4A 1CDNA 4W74A 5HL1A 3B88A 1KSMA 3I19A 3GK1A 1UUSA 2FCDA 2MJWB 1F4QA 3NHTA 1HT9A 1H8BA 3GOFA 2PSRA 1OXEA 2KPHA 1XO5A 3DXLA 1RTP1 3DQEA 1SNLA 4ORBB 4W7EA 2OKYA 2CT9A 4H48A 1QY3A 1JC1A 3SG4A 5HKWA 3WXAA 4W6JA 4W6RA 3DPWA 1QS7A 3VRNA 2VRGA 4W6UA 4H3MA 2K7BA 2VAEA 1JBAA 2YFPA 1EL4A 1ZOTB 2EC6C 3ZUJA 2JPTA 2WHUA 4GOBA 1IG5A 1SBJA 3DPXA 1KQVA 4HQ8A 1KWOB 1QLSA 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 1YR5A 3DQ8A 2LV7A 3K1KA 2DUHA 1YX8A 1Q80A 1S6IA 2VVJA 4B30A 5BPJA 1Z4HA 3VB1A 3O4XA 3OSQA 1M31A 2HQKA 1V1GA 2PALA 1QX5B 4OY4A 5JJGA 1BR1B 3DQIA 3CR2A 1EMGA 4DKNA 1PSBA 3DZTA 2EMNA 1OOHA 3SS5A 1RMPA 2BL0B 2KGRA 4LQTA 2DD9A 3D77A 3VICA 1ALWA 3D0YA 2P70A 3TDIA 1B8CA 4JQ0D 1J1EA 2H6VA 2PVBA 1K9PA 1XFWO 2LVVA 3U8PA 3CGLA 2HPWA 3I5GB 3AAJA 2H61A 3S05A 3RWAA 3BUXB 2ZMUA 3PJ5A 1Q4BA 1S6ZA 1KK7Z 5AFPA 3DQDA 4KEXA 1IJ5A 2HRSA 4MZLA 1F8HA 1CDPA 2H61C 1UURA 4U2VA 2F3YA 2K7DA 2PQLA 3SG7A 5DRGA 2KLDA 4OKHA 2KYFA 3EVRA 2HETA 1TWOA 3L4AA 4L1IA 2KQ6A 4HRGA 4W6FA 2COLB 4I5NB 3JTDC 3PATA 3V3DA 3I5IC 4WQ2A 5FYXA 1WY9A 4BDUA 1S1EA 1CDLA 2JZIA 2H5PA 3TUYC 3OGOA 3DQ3A 2KOTA 1U5IB 2AH8A 3ST4A 1LVCD 1XQMA 3KPXA 3RZSA 3LLEA 4OZDA 1WRZA 2AAOA 3TDZA 3WHUB 3WNXB 2FL1A 1TRFA 2LCPA 3AI5A 2HCGA 3SVSA 3BJHA 2L98A 5AEQA 1B7TZ 1J7OA 3DQAA 5HZUA 4W6OA 3D75A 3A8SA 5K89A 3EK4A 3C1VA 2GV5A 1ODBA 4ZCVA 2NZ0A 2M97A 2ZMWA 1RECA 4BY4A 2Q4UA 1YVLA 3PM8A 4OCIA 3SIAA 4ICBA 2HPSA 3BOWA 2NCOA 4L13A 3ZTFA 3JVTC 1F0BA 1LA3A 4HVFA 2L5XB 1L7ZA 3LVAA 4JWQA 2WHTA 2WIQA 1PVAA 2L5YA 2IE2A 4KA9A 5FVGA 1YFPA 2YE1A 3GEXA 3LSAA 1IH0A 1QWVA 1CLBA 4E68A 2NLNA 2KBIA 4W7DA 1RFJA 1UHHA 3DVMA 4GBAA 2I18A 3SSHA 1PALA 3FE8A 2OTEA 5ER5A 1QTXA 2PYQA 1TNQA 1GQMA 3UG0A 3CZTX 4IJ7A 1F70A 4L12A 1QASA 5H88A 4W6DA 4MRXA 1GM0A 2H8VA 2QLEA 3PIBA 4PE4A 3PJIA 1JWDA 2A53B 1OQPA 1XSSA 5HZOA 1MF8B 3PLFB 1MHOA 4ZBLA 3CZ0A 1S26D 2F8PA 2ZFDA 2KI6D 3CR4X 2G2SB 3PJBA 2E30A 1EMAA 3M22A 2KFGA 3SVDA 1DQEA 4XGYA 1TNXA 1KFUL 1K93D 3M0WA 1G4YR 4KAGA 1UISA 2OPOA 1SCVA 1G33A 4L9MA 2A52B 1T14A 3DQ2A 2B3PA 4W69A 1FI6A 2C9IA 1TNPA 4P1QA 3CB9A 1QYOA 1XAEA 3BXCA 4Z4MA 1TNWA 2KAXA 1OOIX 3D73A 2KLEA 3KHEA 3DQOA 1NUBA 1RROA 3DQ4A 4W7XA 4W6HA 3VGOA 4PE1A 2H9WA 2G6EA 1YHGA 4DXMA 1F09A 4ORNA 4MBEA 4GF6B 1KWOC 5EXBA 3S0FA 4W6NA 2OJKA 1W7SA 2LP2A 1BR4B 5FHVA 2BCBA 5ER4X 1KK7Y 3O6BA 1OE9B 5KSZA 4H3NA 2BKHB 1DJYA 1K9KA 1L2OB 5DTZA 1A2XA 4YGBB 2PASA 1BOCA 1NWDA 1A75A 2M7NA 2IB5A 2L4HA 3DQMA 4JGEA 1KFXS 2GGMA 1OZSA 1F4OA 1KK8B 2OS8B 3LK1A 1JFKA 5HW9A 4W6IA 5BQLA 1SK6D 3SSYA 4PFEA 2KSPA 3DQFA 2QLGA 2HQWA 3I5GC 2O29A 4IZNA 3DQKA 2Z6ZA 1A03A 3BQ3A 1RJVA 4JPZB 5FI7A 5H87A 3LS3A 5EJUA 1M39A 2Q57A 3SVUA 2MLEC 3BFBA 4KW4A 3JVTB 4Q7TA 4CLNA 1YJFA 2NXQA 1OSAA 2OTGC 1SKTA 3NSIA 4D1EA 4W6AA 4XYNA 3GJ2A 2WCEA 3DQ1A 4XOWA 1QX2A 1YRUB 1KSOA 3BOWB 2F33A 4N1GA 1U5IA 2AUCA 3SRYA 3D74A 1FPWA 3NT9A 2ZNEA 3NF0A 3SV5A 1ZACA 4F7FA 1Y1XA 1RRXA 3QMEA 3SG3A 4JEOA 2JU0A 1AHRA 1QYQA 2C9JA 4M2OA 1JSAA 4IK4A 1J7QA 1UHJA 3LF4B 2LM5A 3FIAA 2WHSA 1BLQA 1N65A 3SS4A 4KF4A 5DKQA 3NSOA 2PMYA 4P5OE 1M63B 3DQCA 4Q7UA 3GB3A 1BF5A 2WC8A 3GL4A 1XYDA 2G16B 1S3PA 1CLLA 1VRKA 4CFRA 1XA5A 1YHHA 3BX9A 1EMFA 2GX0A 2QEBA 5D7FA 2FZUA 2KAVA 3U0NA 3GJ1A 1JF2A 3SVBA 3FWBA 3SJSA 2F3ZA 4A4CA 2HGYA 4W72A 4KW9A 1SL7A 2JULA 4IK9A 1AK8A 5BTTB 3OHMB 3FWCA 2HQZA 3DY9A 4DXQA 3TDUA 1QJTA 2AHAA 2JNXA 4KYNA 1YZWA 2G3OA 3BXBA 3KO0A 3CYZA 3WCKA 3EVVA 2I2RE 1QXTA 5EXCI 1SYMA 3VRRA 2DUIA 1IQ3A 4IK5A 4GGFA 4YRUA 1JUOA 2QLHA 3IVTA 5LTRA 3SS3A 2VVIA 1QIWA 2GX2A 3GK4X 3WLCA 1BG1A 3NSKA 2Z1OA 2F2PA 4OGSA 3SSKA 1JC0A 3CFHA 3EK8A 3CD1A 4YI9A 5LTPA 3HCMA 3OP0A 5AXIA 1R6PA 4W6LA 1YUTA 1BT6A 1H4BA 1OXDA 2ZO7A 2GW4B 4YGAA 4XVPA 4W73A 2M3WA 3PSRA 4GUKA 1Q73A 2LHIA 2M1UA 2WORA 3UO9A 2GGZA 3BUNB 5AANA 4DUQA 4FQOA 1JBYA 1A75B 1YURA 1Q4DA 3LVCA 3VHTB 3FE9A 3DQNA 2FOTA 2K8MB 2LLSA 1D1OA 2M1KB 3FE6A 1YUSA 1DGUA 1QVIY 1RM9A 4IK8A 4I5LB 3SS0A 2QEVA 1C3YA 1DF0A 1RMMA 3M24A 4W75A 3SSVA 1J55A 1MR8A 3BUWB 4XJKB 1DELA 2WC6A 1KYPA 1OMVA 1K9UA 2JXLA 2CTNA 2LP3A 2M49B 3O4YA 2BAPA 4DXNA 2QLGB 4QJ3B 1IWQA 2EGDA 5DQBA 3A8RA 5J2OA 2LAPA 2OTGB 3H4SE 3CZ2A 2WSOA 3DQ6A 1V1FA 4GGNA 1GGXA 1YX7A 3WHTB 3DQJA 1SPYA 5IBWA 2WCMA 4NWSA 1QXPA 1C07A 1EMBA 1ZUXA 2KDHA 4HE4A 2O24A 4JKTA 5T3IA 3DQ5A 1JBZA 5DPHA 1B9AA 3NHIA 1MXLC 3LA1A 1L2OC 4RYSA 1A4PA 4Q7RA 3EG5B 1XK4A 1BMOA 2A48A 4I5KA 4W7CA 2M7LA 4INWA 5DTXA 2MRDA 2MBXA 4YGCB 1KQMC 3CLNA 1KK8C 4PT1A 2OS8C 1XK4C 2G6XA 1LKJA 1OZOA 4HREE 1ZFSA 3IF7A 1CMFA 3CGAA 3AKAA 3ADFA 4DCKA 2V53A 1GJYA 3K1EA 5DPJA 2QRFA 4PHKA 2LVIA 4DRWA 3EKHA 5BT0A 1CNPA 3IQQA 3LK0A 2DUEA 3H1RA 4LJCA 1IKUA 2JWWA 1W7TA 1B47A 2MHHA 3OBVA 4FTGA 5HLVA 3RM1A 3O77A 2L2CA 4W7RA 2DUGA 1DJGA 1DJWA 4C0LA 1B8RA 4GFTA 1QV1A 1OXFA 1CM1A 3ZWHA 5CSFA 2KI4B 2O2BA 1QYFA 4J89A 1J7PA 1SCMB 2A56B 2DOQA 5DRFA 2WCHA 4OQWA 3MSEB 2Y0GA 2SASA 1MWNA 1BODA 1KYRA 4M2QA 1DTLA 1DJHA 4DXOA 1EG3A 4A4BA 1ZGPA 3NGVA 2WNDA 3U0KA 2LMUA 2AMIA 2A46A 2M0RA 4WRIA 1SL8A 4MVFA 4IK3A 2HF5A 1AJ5A 4EMQA 2H5RA 2G9BA 3OB2B 4OV2A 3UFZA 2BKIB 2AWLA 3DQ9A 2JTTA 3R1OA 3VRPA 1PRWA 4Q9WA 4XL5A 1NIWA 4MZJA 2POXA 2HJOA 1OOJA 2KI6C 4F0ZB 2CCMA 2M8UA 2K2AA 2CNPA 2ZN9A 5BTTA 1UHIA 2LVJA 3DVJA 4J8AA 4N1FA 2YDZA 4H47A 4KGFA 4W6GA 4UTSA 2Y4QA 2WURA 2WSNA 5I94A 4OHSA 3CFFA 3LVDA 4FQTA 1UP5A 1K2HA 4KF5A 2GW3A 3LF3A 2IOVA 3PJ7A 3DQHA 3E5VA 4PPKA 1XFRA 4C0KA 2ZKMX 4P76A 4CPVA 3Q8IA 2KQYA 2ZRTA 4PHNA 2BCXA 3SIBA 2DD7A 3ZULA 3RLZA 1TUJA 4ZB1A 2FCEA 1DGVA 1MXEA 1DF0B 1YJ2A 4KF5C 4RTCA 1Y1AA 4I2YA 2LUCA 4JD9A 5LK4A 4W76A 1IGVA 1H4UA 4YGEB 2LVKA 2WCLA 1DJXA 4OVNF 1SSEB 3F45A 3ST3A 3CFAA 1AJ4A 1DJZA 3I5FB 1XFUO 2NCPA 3BXKA 1UHKA 4AS8A 2B1UA 1MOUA 2PXWA 3VHTA 4USLA 1G7KA 3BUOB 1QVIZ 1SMGA 1FF1A 1LINA 2V4EA 2JC2A 2BBNA 4PDZA 5FI2A 1KQMB 1EH2A 5F9GA 2LHLA 2EHBA 1KCYA 2K7OA 3QRXA 2HQ8A 4KW8A 3KEVA 2LE9B 5HBDA 1MYWA 4XJKA 4ZF3A 3KCTA 2LMVA 3PN7B 3TS5B 1NP8A 1Q4CA 4YGDB 2V4EC 2VZXA 4CFQA 4INXA 1BU3A 3PALA 2QEHA 4YI8A 2M9GA 3S0AA 3ED8A 1E8AA 2CBLA 5HZSA 1Q4AA 3L4LA 4IL1A 1C7VA 5D3OA 1EMMA 5I2OA 1QIVA 1M45A 3DF0A 2Z6YA 1CFPA 5HYDA 1CMGA 3IR8A 1QATA 4Q9XA 3DVKA 1SRAA 2G2BA 2IS9A 4AOMA 3OGNA 1Z2CB 1Z1PA 5TNCA 4JF9A 2ISDA 3BFHA 2BBMA 2Z6XA 3VK1A 2A54B 3O2PA 1JFJA 3BYAA 3ZUFA 1ZMZA 2H2KA 2KAYA 5GQQC 4NDDA 5DY6A 5EB7A 1N2DA 3MGFA 2JT3A 5DPGA 2KHNA 3AAKA 3DYEA 1K95A 2BNXA 2L0PA 2KBMA 1NSHA 1IIOA 1NX2A 1UWOA 1SW8A 1DJIA 4P2YB 4EULA 4LJBA 1XFYO 2KNEA 1P28A 1K94A 3N7HA 1M46A 2K0JA 3BXAA 1H6RA 2H8QA 5I2LA 1YHIA 3SG2A 3DD4A 4MRYA
chains in the Genus database with same CATH topology
4OR9B 2O60A 3TMTA 2FJUB 1TOPA 4DKMA 2MA2A 1Z1QA 2QLIA 4MLWA 1PK0D 3CR5X 2KFHA 2JOJA 3FS7A 2Q91A 3VRQA 3CS1A 2JQ6A 1GFLA 4Q04A 1SR6B 1EXRA 4ZCUA 3SG6A 1SY9A 4XOVA 4W6SA 2KFFA 1WLMA 4W6KA 2JTZA 1F71A 1FBVA 2P6BB 3SVCA 4GNKB 2KI4C 1K8UA 1SCMC 4YBHB 5CSJA 4AQIA 1IQ5A 1B4CA 2BE4A 1TTXA 1F54A 4PHMA 4LW5A 4LJDA 1AVSA 1G8IA 1DMOA 1WRLA 3O78A 2HGDA 1B8LA 1CLMA 4ZIOA 3P28A 4C0JA 1CB1A 4GAOA 2KGBC 3ZNIA 4NQGA 1CV7A 5HZTA 1XVJA 2G6YA 5EHUA 2DDDA 4ZF4A 2WOSA 2A4JA 5EXUA 4LJDC 1CFCA 4GGFC 2M29A 2AWKA 2H5QA 2OGRA 5DQMA 1RWYA 5CSNA 3SSLA 4WQ3A 4ORAB 4ZFSA 5J3XA 4HQCA 3EVUA 4MSPA 1TCFA 2ARLA 3ST0A 1NYAA 2F2OA 3U0LA 5LTQA 4QJ5B 5KTGA 3W1DA 4EDOA 3D10A 5KTYA 2V4EB 4KGEA 2ZO6A 1WRKA 4DIRA 3PFVA 2LLTA 1UHNA 2EMDA 3CWGA 3LCPC 2BTJA 4JFGA 3ST2A 4HQ9A 1R2UA 5FVIA 4EDSA 1OMDA 1QX7A 5JOLA 1N0YA 2WCBA 1F55A 2QU1A 4W6BA 1NCYA 1WDCB 1QV0A 5DU0A 1ALVA 2QPTA 3NXAA 2ICRA 2YE0A 3W1CA 4ZINA 1Y0VH 4KPIA 3DF0B 2I7AA 3SVNA 2LUXA 4U8DA 1C4FA 3I5HB 2K61A 1MOVA 4TZAA 2JT8A 2L4IA 4PE7A 3I5FC 1OMRA 3ICBA 2D8NA 4UPGA 1NX3A 1PVBA 3SSPA 3IP2A 5F6TA 1XFXO 1IJ6A 2FWQA 1EJ3A 3G9AA 2KYCA 2PXSA 1GL4A 5I8NA 1HUYA 4B5YA 1XA9A 1S6JA 4GESB 1CTRA 3SVEA 1S5GZ 2A50B 2A47A 1CFFA 1ZGQA 4DS7A 4HRHA 4TNCA 2SCPA 2JADA 3PN7C 3TS5C 2R2IA 2ZNDA 1W7JB 3NT3A 5FVFA 4NDCA 4M2PA 4AR7A 2H5OA 2WISA 5HGEA 4AQJA 4RYWA 1EG4A 2LLUA 2L51A 4NDBA 4PALA 3TMRA 4PPJA 2JRFA 1KYSA 1X02A 4W6TA 1GGZA 1RK9A 5CSIA 1W7IB 2AWJA 4EN1A 1Y1UA 1KFXL 2BE6A 2JXCA 2Y1MA 1CFDA 3RWTA 2TN4A 1W7UA 4DXPA 1NX0A 3E3RA 3KF9A 4DXIA 3NSLA 4J88A 3E5TA 3AI4A 1AUIB 1LA0A 5KU1A 1AP4A 2EC6B 3DQ7A 3E5WA 2E6WA 1FW4A 1DVIA 4R1EA 2MLFC 3EVPA 2ZRSA 5DTLA 2K2FA 2L50A 5D69A 2LANA 4R6DA 1EMCA 3SG5A 4CIDA 3U8CA 4ETOA 1EMKA 1CDMA 1J7RA 3HX4A 2P4MA 1XFVO 5DPIA 1EMLA 1YUUA 3P8UA 1GGWA 3IQOA 4R6BA 4TZGA 2L2EA 1JF0A 4PHJA 5EBJA 3EK7A 1HCJA 4B30B 2K7CA 3DQLA 3A4UB 4OJ0A 3OX6A 2BCAA 2QT2A 2O5GA 4ORCB 1SR6C 2BECA 1YRTB 4ANJA 4W6CA 5G08A 5B8IB 3CBEA 2I94A 5HKZA 3U0MA 2JT0A 3DVEA 5I2QA 3U8AA 1ZGOA 2CXJA 5DTYA 3AKOA 2ZN8A 3D0YB 4W77A 2Q6PA 1RMOA 5HLOA 3VROA 1YTZC 4I5JA 2JNFA 1B9CA 4PE0A 1CKKA 2Y5IA 2AWMA 4PPLA 3NEZA 2PRUA 3TZ1A 2RGIA 3EKJA 1Q4EA 1NCZA 1QLKA 4MZKA 3CD9A 4JRBA 1B1GA 1NPQA 3H1OA 4ZF5A 2G3DB 3JTDB 1SL9A 4HSZA 3I5IB 3NEDA 2OKWA 5HKYA 4GPLB 1CM4A 2HFCA 3TUYB 1MUXA 4W6PA 2IB6A 3WLDA 1BJFA 1DT7B 2OTBA 4MEWA 1Y6WA 1S36A 1TIZA 5AQBB 4MN0A 5EB6A 2BL0C 1HQVA 5CPVA 3SVRA 1NX1A 5PALA 3LL8B 1NCXA 2QACA 3KCSA 4N5XA 1K96A 1WLZA 4Z4KA 1S5GY 1PULA 2DUFA 3SSTA 4W6MA 4BY5A 1XMZA 3DPZA 4W7AA 4H3LA 3OSRA 1JC2A 1WDCC 4PCWA 2VADA 5H89A 4IK1A 4N3DA 1EMEA 2MAZA 1C7WA 3BUMB 3DQUA 2DDCA 4LQUA 2WCFA 1B7TY 3I5HC 2LC5A 2G5ZB 2RH7A 5AERA 2B3QA 1IRJA 1KFUS 3AKBA 2VVHA 5DKNA 1MQ1A 1TCOB 1YVHA 1BFPA 2LNKA 1J1DA 1S6CA 5DKRA 1K90D 2Y1NA 2QZ0A 4W7FA 3GK2A 2LMTA 3CTNA 3SVOA 4QJ4B 1PSRA 4JC2A 3OX5A 1XFZO 1FI5A 2EMOA 1KP5A 1TN4A 1CDNA 4W74A 1KSMA 3I19A 3GK1A 1UUSA 2FCDA 2MJWB 1F4QA 1HT9A 1H8BA 3GOFA 2PSRA 1OXEA 1XO5A 1RTP1 3DQEA 1SNLA 4ORBB 4W7EA 2OKYA 2CT9A 4H48A 1QY3A 1JC1A 3SG4A 5HKWA 3WXAA 4W6JA 4W6RA 3DPWA 1QS7A 3VRNA 2VRGA 4W6UA 4H3MA 2K7BA 2VAEA 1JBAA 2YFPA 1EL4A 1ZOTB 2EC6C 3ZUJA 2JPTA 2WHUA 4GOBA 1IG5A 1SBJA 3DPXA 1KQVA 4HQ8A 1KWOB 1QLSA 3OB1B 1A29A 1LXFC 1ZUZA 3K21A 1YR5A 3DQ8A 2LV7A 3K1KA 2DUHA 1YX8A 1Q80A 1S6IA 2VVJA 4B30A 5BPJA 3OSQA 1M31A 2HQKA 1V1GA 2PALA 1QX5B 4OY4A 5JJGA 1BR1B 3DQIA 3CR2A 1EMGA 4DKNA 1PSBA 2EMNA 1RMPA 2BL0B 2KGRA 4LQTA 2DD9A 3VICA 1ALWA 3D0YA 3TDIA 1B8CA 4JQ0D 1J1EA 2H6VA 2PVBA 1K9PA 1XFWO 2LVVA 3U8PA 3CGLA 2HPWA 3I5GB 3AAJA 2H61A 3S05A 3RWAA 3BUXB 2ZMUA 3PJ5A 1Q4BA 1S6ZA 1KK7Z 5AFPA 3DQDA 4KEXA 1IJ5A 2HRSA 4MZLA 1F8HA 1CDPA 2H61C 1UURA 4U2VA 2F3YA 2K7DA 3SG7A 5DRGA 4OKHA 2KYFA 3EVRA 2HETA 4L1IA 2KQ6A 4HRGA 4W6FA 2COLB 4I5NB 3JTDC 3PATA 3V3DA 3I5IC 4WQ2A 5FYXA 1WY9A 4BDUA 1S1EA 1CDLA 2JZIA 2H5PA 3TUYC 3OGOA 3DQ3A 2KOTA 1U5IB 2AH8A 3ST4A 1LVCD 1XQMA 3KPXA 3LLEA 1WRZA 2AAOA 3TDZA 3WHUB 3WNXB 2FL1A 1TRFA 2LCPA 3AI5A 2HCGA 3SVSA 2L98A 5AEQA 1B7TZ 1J7OA 3DQAA 5HZUA 4W6OA 3A8SA 5K89A 3EK4A 3C1VA 2GV5A 1ODBA 4ZCVA 2NZ0A 2M97A 2ZMWA 1RECA 4BY4A 2Q4UA 1YVLA 3PM8A 4OCIA 3SIAA 4ICBA 2HPSA 3BOWA 2NCOA 4L13A 3ZTFA 3JVTC 1F0BA 1LA3A 4HVFA 2L5XB 1L7ZA 3LVAA 4JWQA 2WHTA 2WIQA 1PVAA 2IE2A 5FVGA 4KA9A 1YFPA 2YE1A 3GEXA 3LSAA 1IH0A 1CLBA 4E68A 2NLNA 2KBIA 4W7DA 1RFJA 1UHHA 3DVMA 4GBAA 2I18A 3SSHA 1PALA 2OTEA 5ER5A 1QTXA 1TNQA 1GQMA 3UG0A 3CZTX 1F70A 4L12A 1QASA 5H88A 4W6DA 4MRXA 2QLEA 3PIBA 4PE4A 1JWDA 2A53B 1OQPA 1XSSA 5HZOA 1MF8B 3PLFB 1MHOA 4ZBLA 1S26D 2F8PA 2ZFDA 2KI6D 3CR4X 2G2SB 3PJBA 2E30A 1EMAA 3M22A 2KFGA 3SVDA 4XGYA 1TNXA 1KFUL 1K93D 3M0WA 1G4YR 4KAGA 1UISA 2OPOA 1SCVA 1G33A 4L9MA 2A52B 3DQ2A 2B3PA 4W69A 1FI6A 2C9IA 1TNPA 4P1QA 3CB9A 1QYOA 1XAEA 3BXCA 4Z4MA 1TNWA 2KAXA 3KHEA 3DQOA 1NUBA 1RROA 3DQ4A 4W7XA 4W6HA 3VGOA 4PE1A 2H9WA 2G6EA 1YHGA 4DXMA 1F09A 4ORNA 4MBEA 4GF6B 1KWOC 5EXBA 4W6NA 2OJKA 1W7SA 2LP2A 1BR4B 5FHVA 2BCBA 5ER4X 1KK7Y 3O6BA 1OE9B 5KSZA 4H3NA 2BKHB 1DJYA 1K9KA 1L2OB 5DTZA 1A2XA 4YGBB 2PASA 1BOCA 1NWDA 1A75A 2M7NA 2IB5A 2L4HA 3DQMA 4JGEA 1KFXS 2GGMA 1OZSA 1F4OA 1KK8B 2OS8B 3LK1A 1JFKA 5HW9A 4W6IA 5BQLA 1SK6D 3SSYA 4PFEA 2KSPA 3DQFA 2QLGA 2HQWA 3I5GC 2O29A 4IZNA 3DQKA 2Z6ZA 1A03A 3BQ3A 1RJVA 4JPZB 5H87A 3LS3A 5EJUA 1M39A 2Q57A 3SVUA 2MLEC 4KW4A 3JVTB 4Q7TA 4CLNA 1YJFA 2NXQA 1OSAA 2OTGC 1SKTA 3NSIA 4D1EA 4W6AA 4XYNA 3GJ2A 2WCEA 3DQ1A 4XOWA 1QX2A 1YRUB 1KSOA 3BOWB 2F33A 4N1GA 1U5IA 2AUCA 3SRYA 1FPWA 3NT9A 2ZNEA 3NF0A 3SV5A 1ZACA 1Y1XA 1RRXA 3SG3A 4JEOA 2JU0A 1AHRA 1QYQA 2C9JA 4M2OA 1JSAA 4IK4A 1J7QA 1UHJA 3LF4B 2LM5A 3FIAA 2WHSA 1BLQA 1N65A 4KF4A 5DKQA 3NSOA 2PMYA 4P5OE 1M63B 3DQCA 4Q7UA 3GB3A 1BF5A 2WC8A 3GL4A 1XYDA 2G16B 1S3PA 1CLLA 1VRKA 4CFRA 1XA5A 1YHHA 3BX9A 1EMFA 2GX0A 5D7FA 2FZUA 2KAVA 3U0NA 3GJ1A 1JF2A 3SVBA 3FWBA 3SJSA 2F3ZA 4A4CA 2HGYA 4W72A 4KW9A 1SL7A 2JULA 4IK9A 1AK8A 5BTTB 3OHMB 3FWCA 2HQZA 4DXQA 3TDUA 1QJTA 2AHAA 2JNXA 1YZWA 2G3OA 3BXBA 3KO0A 3WCKA 3EVVA 2I2RE 1QXTA 5EXCI 1SYMA 3VRRA 2DUIA 1IQ3A 4IK5A 4GGFA 4YRUA 1JUOA 2QLHA 5LTRA 2VVIA 1QIWA 2GX2A 3GK4X 3WLCA 1BG1A 3NSKA 2Z1OA 2F2PA 4OGSA 3SSKA 1JC0A 3CFHA 3EK8A 3CD1A 4YI9A 5LTPA 3HCMA 3OP0A 5AXIA 1R6PA 4W6LA 1YUTA 1BT6A 1H4BA 1OXDA 2ZO7A 2GW4B 4YGAA 4XVPA 4W73A 2M3WA 3PSRA 4GUKA 1Q73A 2LHIA 2M1UA 2WORA 2GGZA 3BUNB 5AANA 4DUQA 4FQOA 1JBYA 1A75B 1YURA 1Q4DA 3LVCA 3VHTB 3DQNA 2FOTA 2K8MB 2LLSA 1D1OA 2M1KB 1YUSA 1DGUA 1QVIY 1RM9A 4IK8A 4I5LB 3SS0A 1DF0A 1RMMA 3M24A 4W75A 3SSVA 1J55A 1MR8A 3BUWB 4XJKB 1KYPA 1OMVA 1K9UA 2JXLA 2CTNA 2LP3A 2M49B 3O4YA 4DXNA 2QLGB 4QJ3B 1IWQA 2EGDA 5DQBA 3A8RA 5J2OA 2LAPA 2OTGB 3H4SE 3DQ6A 2WSOA 1V1FA 4GGNA 1GGXA 1YX7A 3WHTB 3DQJA 1SPYA 5IBWA 4NWSA 1QXPA 1C07A 1EMBA 1ZUXA 2KDHA 4HE4A 2O24A 5T3IA 3DQ5A 1JBZA 5DPHA 1B9AA 1MXLC 3LA1A 1L2OC 4RYSA 1A4PA 4Q7RA 1XK4A 1BMOA 2A48A 4I5KA 4W7CA 2M7LA 5DTXA 2MRDA 2MBXA 4YGCB 1KQMC 3CLNA 1KK8C 2OS8C 1XK4C 2G6XA 1LKJA 1OZOA 4HREE 1ZFSA 3IF7A 1CMFA 3CGAA 3AKAA 3ADFA 4DCKA 2V53A 1GJYA 5DPJA 2QRFA 4PHKA 2LVIA 4DRWA 3EKHA 5BT0A 1CNPA 3IQQA 3LK0A 2DUEA 3H1RA 4LJCA 1IKUA 2JWWA 1W7TA 1B47A 2MHHA 4FTGA 5HLVA 3RM1A 3O77A 4W7RA 2DUGA 1DJGA 1DJWA 4C0LA 1B8RA 4GFTA 1QV1A 1OXFA 1CM1A 3ZWHA 5CSFA 2KI4B 2O2BA 1QYFA 4J89A 1J7PA 1SCMB 2A56B 2DOQA 5DRFA 4OQWA 3MSEB 2Y0GA 2SASA 1MWNA 1BODA 1KYRA 4M2QA 1DTLA 1DJHA 4DXOA 1EG3A 4A4BA 1ZGPA 2WNDA 3U0KA 2LMUA 2AMIA 2A46A 2M0RA 4WRIA 1SL8A 4MVFA 4IK3A 2HF5A 1AJ5A 4EMQA 2H5RA 2G9BA 3OB2B 4OV2A 3UFZA 2BKIB 2AWLA 3DQ9A 2JTTA 3VRPA 1PRWA 4Q9WA 4XL5A 1NIWA 4MZJA 2POXA 2HJOA 1OOJA 2KI6C 4F0ZB 2CCMA 2M8UA 2K2AA 2CNPA 2ZN9A 5BTTA 1UHIA 2LVJA 3DVJA 4J8AA 4N1FA 2YDZA 4H47A 4KGFA 4W6GA 4UTSA 2Y4QA 2WURA 2WSNA 4OHSA 3CFFA 3LVDA 1UP5A 1K2HA 4KF5A 2GW3A 3LF3A 2IOVA 3PJ7A 3DQHA 3E5VA 4PPKA 4C0KA 2ZKMX 4P76A 4CPVA 2KQYA 2ZRTA 4PHNA 2BCXA 3SIBA 2DD7A 3ZULA 3RLZA 4ZB1A 2FCEA 1DGVA 1MXEA 1DF0B 1YJ2A 4KF5C 4RTCA 1Y1AA 4I2YA 2LUCA 5LK4A 4W76A 1IGVA 1H4UA 4YGEB 2LVKA 1DJXA 4OVNF 3F45A 3ST3A 3CFAA 1AJ4A 1DJZA 3I5FB 1XFUO 2NCPA 3BXKA 1UHKA 4AS8A 2B1UA 1MOUA 2PXWA 3VHTA 4USLA 1G7KA 3BUOB 1QVIZ 1SMGA 1FF1A 1LINA 2V4EA 2JC2A 2BBNA 4PDZA 1KQMB 1EH2A 5F9GA 2LHLA 2EHBA 1KCYA 2K7OA 3QRXA 2HQ8A 4KW8A 3KEVA 2LE9B 5HBDA 1MYWA 4XJKA 4ZF3A 3KCTA 2LMVA 3PN7B 3TS5B 1NP8A 1Q4CA 4YGDB 2V4EC 2VZXA 4CFQA 1BU3A 3PALA 4YI8A 2M9GA 3ED8A 1E8AA 2CBLA 5HZSA 1Q4AA 4IL1A 1C7VA 1EMMA 5I2OA 1QIVA 1M45A 3DF0A 2Z6YA 1CFPA 5HYDA 1CMGA 3IR8A 1QATA 4Q9XA 3DVKA 1SRAA 2G2BA 2IS9A 4AOMA 1Z1PA 5TNCA 4JF9A 2ISDA 2BBMA 2Z6XA 3VK1A 2A54B 3O2PA 1JFJA 3BYAA 3ZUFA 1ZMZA 2H2KA 2KAYA 5GQQC 4NDDA 5DY6A 5EB7A 1N2DA 3MGFA 2JT3A 5DPGA 2KHNA 3AAKA 1K95A 2L0PA 2KBMA 1NSHA 1NX2A 1UWOA 1SW8A 1DJIA 4P2YB 4EULA 4LJBA 1XFYO 2KNEA 1K94A 1M46A 2K0JA 3BXAA 1H6RA 2H8QA 5I2LA 1YHIA 3SG2A 3DD4A 4MRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OR9 B;  2O60 A;  3TMT A;  2FJU B;  1TOP A;  4DKM A;  2MA2 A;  1Z1Q A;  2QLI A;  4MLW A;  1PK0 D;  3CR5 X;  2KFH A;  2JOJ A;  3FS7 A;  2Q91 A;  3VRQ A;  3CS1 A;  2JQ6 A;  1GFL A;  4Q04 A;  1SR6 B;  1EXR A;  4ZCU A;  3SG6 A;  1SY9 A;  4XOV A;  4W6S A;  2KFF A;  1WLM A;  4W6K A;  2JTZ A;  1F71 A;  1FBV A;  2P6B B;  3SVC A;  4GNK B;  2KI4 C;  1K8U A;  1SCM C;  4YBH B;  5CSJ A;  4AQI A;  1IQ5 A;  1B4C A;  2BE4 A;  1TTX A;  1F54 A;  4PHM A;  4LW5 A;  4LJD A;  1AVS A;  1G8I A;  1DMO A;  1WRL A;  3O78 A;  2HGD A;  1B8L A;  1CLM A;  4ZIO A;  3P28 A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  4NQG A;  1CV7 A;  5HZT A;  1XVJ A;  2G6Y A;  5EHU A;  2DDD A;  4ZF4 A;  2WOS A;  2A4J A;  5EXU A;  4LJD C;  1CFC A;  4GGF C;  2M29 A;  2AWK A;  2H5Q A;  2OGR A;  5DQM A;  1RWY A;  5CSN A;  3SSL A;  4WQ3 A;  4ORA B;  4ZFS A;  5J3X A;  4HQC A;  3EVU A;  4MSP A;  1TCF A;  2ARL A;  3ST0 A;  1NYA A;  2F2O A;  3U0L A;  5LTQ A;  4QJ5 B;  5KTG A;  3W1D A;  4EDO A;  3D10 A;  5KTY A;  2V4E B;  4KGE A;  2ZO6 A;  1WRK A;  4DIR A;  3PFV A;  2LLT A;  1UHN A;  2EMD A;  3CWG A;  3LCP C;  2BTJ A;  4JFG A;  3ST2 A;  4HQ9 A;  1R2U A;  5FVI A;  4EDS A;  1OMD A;  1QX7 A;  5JOL A;  1N0Y A;  2WCB A;  1F55 A;  2QU1 A;  4W6B A;  1NCY A;  1WDC B;  1QV0 A;  5DU0 A;  1ALV A;  2QPT A;  3NXA A;  2ICR A;  2YE0 A;  3W1C A;  4ZIN A;  1Y0V H;  4KPI A;  3DF0 B;  2I7A A;  3SVN A;  2LUX A;  4U8D A;  1C4F A;  3I5H B;  2K61 A;  1MOV A;  4TZA A;  2JT8 A;  2L4I A;  4PE7 A;  3I5F C;  1OMR A;  3ICB A;  2D8N A;  4UPG A;  1NX3 A;  1PVB A;  3SSP A;  3IP2 A;  5F6T A;  1XFX O;  1IJ6 A;  2FWQ A;  1EJ3 A;  3G9A A;  2KYC A;  2PXS A;  1GL4 A;  5I8N A;  1HUY A;  4B5Y A;  1XA9 A;  1S6J A;  4GES B;  1CTR A;  3SVE A;  1S5G Z;  2A50 B;  2A47 A;  1CFF A;  1ZGQ A;  4DS7 A;  4HRH A;  4TNC A;  2SCP A;  2JAD A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  3NT3 A;  5FVF A;  4NDC A;  4M2P A;  4AR7 A;  2H5O A;  2WIS A;  5HGE A;  4AQJ A;  4RYW A;  1EG4 A;  2LLU A;  2L51 A;  4NDB A;  4PAL A;  3TMR A;  4PPJ A;  2JRF A;  1KYS A;  1X02 A;  4W6T A;  1GGZ A;  1RK9 A;  5CSI A;  1W7I B;  2AWJ A;  4EN1 A;  1Y1U A;  1KFX L;  2BE6 A;  2JXC A;  2Y1M A;  1CFD A;  3RWT A;  2TN4 A;  1W7U A;  4DXP A;  1NX0 A;  3E3R A;  3KF9 A;  4DXI A;  3NSL A;  4J88 A;  3E5T A;  3AI4 A;  1AUI B;  1LA0 A;  5KU1 A;  1AP4 A;  2EC6 B;  3DQ7 A;  3E5W A;  2E6W A;  1FW4 A;  1DVI A;  4R1E A;  2MLF C;  3EVP A;  2ZRS A;  5DTL A;  2K2F A;  2L50 A;  5D69 A;  2LAN A;  4R6D A;  1EMC A;  3SG5 A;  4CID A;  3U8C A;  4ETO A;  1EMK A;  1CDM A;  1J7R A;  3HX4 A;  2P4M A;  1XFV O;  5DPI A;  1EML A;  1YUU A;  3P8U A;  1GGW A;  3IQO A;  4R6B A;  4TZG A;  2L2E A;  1JF0 A;  4PHJ A;  5EBJ A;  3EK7 A;  1HCJ A;  4B30 B;  2K7C A;  3DQL A;  3A4U B;  4OJ0 A;  3OX6 A;  2BCA A;  2QT2 A;  2O5G A;  4ORC B;  1SR6 C;  2BEC A;  1YRT B;  4ANJ A;  4W6C A;  5G08 A;  5B8I B;  3CBE A;  2I94 A;  5HKZ A;  3U0M A;  2JT0 A;  3DVE A;  5I2Q A;  3U8A A;  1ZGO A;  2CXJ A;  5DTY A;  3AKO A;  2ZN8 A;  3D0Y B;  4W77 A;  2Q6P A;  1RMO A;  5HLO A;  3VRO A;  1YTZ C;  4I5J A;  2JNF A;  1B9C A;  4PE0 A;  1CKK A;  2Y5I A;  2AWM A;  4PPL A;  3NEZ A;  2PRU A;  3TZ1 A;  2RGI A;  3EKJ A;  1Q4E A;  1NCZ A;  1QLK A;  4MZK A;  3CD9 A;  4JRB A;  1B1G A;  1NPQ A;  3H1O A;  4ZF5 A;  2G3D B;  3JTD B;  1SL9 A;  4HSZ A;  3I5I B;  3NED A;  2OKW A;  5HKY A;  4GPL B;  1CM4 A;  2HFC A;  3TUY B;  1MUX A;  4W6P A;  2IB6 A;  3WLD A;  1BJF A;  1DT7 B;  2OTB A;  4MEW A;  1Y6W A;  1S36 A;  1TIZ A;  5AQB B;  4MN0 A;  5EB6 A;  2BL0 C;  1HQV A;  5CPV A;  3SVR A;  1NX1 A;  5PAL A;  3LL8 B;  1NCX A;  2QAC A;  3KCS A;  4N5X A;  1K96 A;  1WLZ A;  4Z4K A;  1S5G Y;  1PUL A;  2DUF A;  3SST A;  4W6M A;  4BY5 A;  1XMZ A;  3DPZ A;  4W7A A;  4H3L A;  3OSR A;  1JC2 A;  1WDC C;  4PCW A;  2VAD A;  5H89 A;  4IK1 A;  4N3D A;  1EME A;  2MAZ A;  1C7W A;  3BUM B;  3DQU A;  2DDC A;  4LQU A;  2WCF A;  1B7T Y;  3I5H C;  2LC5 A;  2G5Z B;  2RH7 A;  5AER A;  2B3Q A;  1IRJ A;  1KFU S;  3AKB A;  2VVH A;  5DKN A;  1MQ1 A;  1TCO B;  1YVH A;  1BFP A;  2LNK A;  1J1D A;  1S6C A;  5DKR A;  1K90 D;  2Y1N A;  2QZ0 A;  4W7F A;  3GK2 A;  2LMT A;  3CTN A;  3SVO A;  4QJ4 B;  1PSR A;  4JC2 A;  3OX5 A;  1XFZ O;  1FI5 A;  2EMO A;  1KP5 A;  1TN4 A;  1CDN A;  4W74 A;  1KSM A;  3I19 A;  3GK1 A;  1UUS A;  2FCD A;  2MJW B;  1F4Q A;  1HT9 A;  1H8B A;  3GOF A;  2PSR A;  1OXE A;  1XO5 A;  1RTP 1;  3DQE A;  1SNL A;  4ORB B;  4W7E A;  2OKY A;  2CT9 A;  4H48 A;  1QY3 A;  1JC1 A;  3SG4 A;  5HKW A;  3WXA A;  4W6J A;  4W6R A;  3DPW A;  1QS7 A;  3VRN A;  2VRG A;  4W6U A;  4H3M A;  2K7B A;  2VAE A;  1JBA A;  2YFP A;  1EL4 A;  1ZOT B;  2EC6 C;  3ZUJ A;  2JPT A;  2WHU A;  4GOB A;  1IG5 A;  1SBJ A;  3DPX A;  1KQV A;  4HQ8 A;  1KWO B;  1QLS A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  1YR5 A;  3DQ8 A;  2LV7 A;  3K1K A;  2DUH A;  1YX8 A;  1Q80 A;  1S6I A;  2VVJ A;  4B30 A;  5BPJ A;  3OSQ A;  1M31 A;  2HQK A;  1V1G A;  2PAL A;  1QX5 B;  4OY4 A;  5JJG A;  1BR1 B;  3DQI A;  3CR2 A;  1EMG A;  4DKN A;  1PSB A;  2EMN A;  1RMP A;  2BL0 B;  2KGR A;  4LQT A;  2DD9 A;  3VIC A;  1ALW A;  3D0Y A;  3TDI A;  1B8C A;  4JQ0 D;  1J1E A;  2H6V A;  2PVB A;  1K9P A;  1XFW O;  2LVV A;  3U8P A;  3CGL A;  2HPW A;  3I5G B;  3AAJ A;  2H61 A;  3S05 A;  3RWA A;  3BUX B;  2ZMU A;  3PJ5 A;  1Q4B A;  1S6Z A;  1KK7 Z;  5AFP A;  3DQD A;  4KEX A;  1IJ5 A;  2HRS A;  4MZL A;  1F8H A;  1CDP A;  2H61 C;  1UUR A;  4U2V A;  2F3Y A;  2K7D A;  3SG7 A;  5DRG A;  4OKH A;  2KYF A;  3EVR A;  2HET A;  4L1I A;  2KQ6 A;  4HRG A;  4W6F A;  2COL B;  4I5N B;  3JTD C;  3PAT A;  3V3D A;  3I5I C;  4WQ2 A;  5FYX A;  1WY9 A;  4BDU A;  1S1E A;  1CDL A;  2JZI A;  2H5P A;  3TUY C;  3OGO A;  3DQ3 A;  2KOT A;  1U5I B;  2AH8 A;  3ST4 A;  1LVC D;  1XQM A;  3KPX A;  3LLE A;  1WRZ A;  2AAO A;  3TDZ A;  3WHU B;  3WNX B;  2FL1 A;  1TRF A;  2LCP A;  3AI5 A;  2HCG A;  3SVS A;  2L98 A;  5AEQ A;  1B7T Z;  1J7O A;  3DQA A;  5HZU A;  4W6O A;  3A8S A;  5K89 A;  3EK4 A;  3C1V A;  2GV5 A;  1ODB A;  4ZCV A;  2NZ0 A;  2M97 A;  2ZMW A;  1REC A;  4BY4 A;  2Q4U A;  1YVL A;  3PM8 A;  4OCI A;  3SIA A;  4ICB A;  2HPS A;  3BOW A;  2NCO A;  4L13 A;  3ZTF A;  3JVT C;  1F0B A;  1LA3 A;  4HVF A;  2L5X B;  1L7Z A;  3LVA A;  4JWQ A;  2WHT A;  2WIQ A;  1PVA A;  2IE2 A;  5FVG A;  4KA9 A;  1YFP A;  2YE1 A;  3GEX A;  3LSA A;  1IH0 A;  1CLB A;  4E68 A;  2NLN A;  2KBI A;  4W7D A;  1RFJ A;  1UHH A;  3DVM A;  4GBA A;  2I18 A;  3SSH A;  1PAL A;  2OTE A;  5ER5 A;  1QTX A;  1TNQ A;  1GQM A;  3UG0 A;  3CZT X;  1F70 A;  4L12 A;  1QAS A;  5H88 A;  4W6D A;  4MRX A;  2QLE A;  3PIB A;  4PE4 A;  1JWD A;  2A53 B;  1OQP A;  1XSS A;  5HZO A;  1MF8 B;  3PLF B;  1MHO A;  4ZBL A;  1S26 D;  2F8P A;  2ZFD A;  2KI6 D;  3CR4 X;  2G2S B;  3PJB A;  2E30 A;  1EMA A;  3M22 A;  2KFG A;  3SVD A;  4XGY A;  1TNX A;  1KFU L;  1K93 D;  3M0W A;  1G4Y R;  4KAG A;  1UIS A;  2OPO A;  1SCV A;  1G33 A;  4L9M A;  2A52 B;  3DQ2 A;  2B3P A;  4W69 A;  1FI6 A;  2C9I A;  1TNP A;  4P1Q A;  3CB9 A;  1QYO A;  1XAE A;  3BXC A;  4Z4M A;  1TNW A;  2KAX A;  3KHE A;  3DQO A;  1NUB A;  1RRO A;  3DQ4 A;  4W7X A;  4W6H A;  3VGO A;  4PE1 A;  2H9W A;  2G6E A;  1YHG A;  4DXM A;  1F09 A;  4ORN A;  4MBE A;  4GF6 B;  1KWO C;  5EXB A;  4W6N A;  2OJK A;  1W7S A;  2LP2 A;  1BR4 B;  5FHV A;  2BCB A;  5ER4 X;  1KK7 Y;  3O6B A;  1OE9 B;  5KSZ A;  4H3N A;  2BKH B;  1DJY A;  1K9K A;  1L2O B;  5DTZ A;  1A2X A;  4YGB B;  2PAS A;  1BOC A;  1NWD A;  1A75 A;  2M7N A;  2IB5 A;  2L4H A;  3DQM A;  4JGE A;  1KFX S;  2GGM A;  1OZS A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  1JFK A;  5HW9 A;  4W6I A;  5BQL A;  1SK6 D;  3SSY A;  4PFE A;  2KSP A;  3DQF A;  2QLG A;  2HQW A;  3I5G C;  2O29 A;  4IZN A;  3DQK A;  2Z6Z A;  1A03 A;  3BQ3 A;  1RJV A;  4JPZ B;  5H87 A;  3LS3 A;  5EJU A;  1M39 A;  2Q57 A;  3SVU A;  2MLE C;  4KW4 A;  3JVT B;  4Q7T A;  4CLN A;  1YJF A;  2NXQ A;  1OSA A;  2OTG C;  1SKT A;  3NSI A;  4D1E A;  4W6A A;  4XYN A;  3GJ2 A;  2WCE A;  3DQ1 A;  4XOW A;  1QX2 A;  1YRU B;  1KSO A;  3BOW B;  2F33 A;  4N1G A;  1U5I A;  2AUC A;  3SRY A;  1FPW A;  3NT9 A;  2ZNE A;  3NF0 A;  3SV5 A;  1ZAC A;  1Y1X A;  1RRX A;  3SG3 A;  4JEO A;  2JU0 A;  1AHR A;  1QYQ A;  2C9J A;  4M2O A;  1JSA A;  4IK4 A;  1J7Q A;  1UHJ A;  3LF4 B;  2LM5 A;  3FIA A;  2WHS A;  1BLQ A;  1N65 A;  4KF4 A;  5DKQ A;  3NSO A;  2PMY A;  4P5O E;  1M63 B;  3DQC A;  4Q7U A;  3GB3 A;  1BF5 A;  2WC8 A;  3GL4 A;  1XYD A;  2G16 B;  1S3P A;  1CLL A;  1VRK A;  4CFR A;  1XA5 A;  1YHH A;  3BX9 A;  1EMF A;  2GX0 A;  5D7F A;  2FZU A;  2KAV A;  3U0N A;  3GJ1 A;  1JF2 A;  3SVB A;  3FWB A;  3SJS A;  2F3Z A;  4A4C A;  2HGY A;  4W72 A;  4KW9 A;  1SL7 A;  2JUL A;  4IK9 A;  1AK8 A;  5BTT B;  3OHM B;  3FWC A;  2HQZ A;  4DXQ A;  3TDU A;  1QJT A;  2AHA A;  2JNX A;  1YZW A;  2G3O A;  3BXB A;  3KO0 A;  3WCK A;  3EVV A;  2I2R E;  1QXT A;  5EXC I;  1SYM A;  3VRR A;  2DUI A;  1IQ3 A;  4IK5 A;  4GGF A;  4YRU A;  1JUO A;  2QLH A;  5LTR A;  2VVI A;  1QIW A;  2GX2 A;  3GK4 X;  3WLC A;  1BG1 A;  3NSK A;  2Z1O A;  2F2P A;  4OGS A;  3SSK A;  1JC0 A;  3CFH A;  3EK8 A;  3CD1 A;  4YI9 A;  5LTP A;  3HCM A;  3OP0 A;  5AXI A;  1R6P A;  4W6L A;  1YUT A;  1BT6 A;  1H4B A;  1OXD A;  2ZO7 A;  2GW4 B;  4YGA A;  4XVP A;  4W73 A;  2M3W A;  3PSR A;  4GUK A;  1Q73 A;  2LHI A;  2M1U A;  2WOR A;  2GGZ A;  3BUN B;  5AAN A;  4DUQ A;  4FQO A;  1JBY A;  1A75 B;  1YUR A;  1Q4D A;  3LVC A;  3VHT B;  3DQN A;  2FOT A;  2K8M B;  2LLS A;  1D1O A;  2M1K B;  1YUS A;  1DGU A;  1QVI Y;  1RM9 A;  4IK8 A;  4I5L B;  3SS0 A;  1DF0 A;  1RMM A;  3M24 A;  4W75 A;  3SSV A;  1J55 A;  1MR8 A;  3BUW B;  4XJK B;  1KYP A;  1OMV A;  1K9U A;  2JXL A;  2CTN A;  2LP3 A;  2M49 B;  3O4Y A;  4DXN A;  2QLG B;  4QJ3 B;  1IWQ A;  2EGD A;  5DQB A;  3A8R A;  5J2O A;  2LAP A;  2OTG B;  3H4S E;  3DQ6 A;  2WSO A;  1V1F A;  4GGN A;  1GGX A;  1YX7 A;  3WHT B;  3DQJ A;  1SPY A;  5IBW A;  4NWS A;  1QXP A;  1C07 A;  1EMB A;  1ZUX A;  2KDH A;  4HE4 A;  2O24 A;  5T3I A;  3DQ5 A;  1JBZ A;  5DPH A;  1B9A A;  1MXL C;  3LA1 A;  1L2O C;  4RYS A;  1A4P A;  4Q7R A;  1XK4 A;  1BMO A;  2A48 A;  4I5K A;  4W7C A;  2M7L A;  5DTX A;  2MRD A;  2MBX A;  4YGC B;  1KQM C;  3CLN A;  1KK8 C;  2OS8 C;  1XK4 C;  2G6X A;  1LKJ A;  1OZO A;  4HRE E;  1ZFS A;  3IF7 A;  1CMF A;  3CGA A;  3AKA A;  3ADF A;  4DCK A;  2V53 A;  1GJY A;  5DPJ A;  2QRF A;  4PHK A;  2LVI A;  4DRW A;  3EKH A;  5BT0 A;  1CNP A;  3IQQ A;  3LK0 A;  2DUE A;  3H1R A;  4LJC A;  1IKU A;  2JWW A;  1W7T A;  1B47 A;  2MHH A;  4FTG A;  5HLV A;  3RM1 A;  3O77 A;  4W7R A;  2DUG A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  4GFT A;  1QV1 A;  1OXF A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  2O2B A;  1QYF A;  4J89 A;  1J7P A;  1SCM B;  2A56 B;  2DOQ A;  5DRF A;  4OQW A;  3MSE B;  2Y0G A;  2SAS A;  1MWN A;  1BOD A;  1KYR A;  4M2Q A;  1DTL A;  1DJH A;  4DXO A;  1EG3 A;  4A4B A;  1ZGP A;  2WND A;  3U0K A;  2LMU A;  2AMI A;  2A46 A;  2M0R A;  4WRI A;  1SL8 A;  4MVF A;  4IK3 A;  2HF5 A;  1AJ5 A;  4EMQ A;  2H5R A;  2G9B A;  3OB2 B;  4OV2 A;  3UFZ A;  2BKI B;  2AWL A;  3DQ9 A;  2JTT A;  3VRP A;  1PRW A;  4Q9W A;  4XL5 A;  1NIW A;  4MZJ A;  2POX A;  2HJO A;  1OOJ A;  2KI6 C;  4F0Z B;  2CCM A;  2M8U A;  2K2A A;  2CNP A;  2ZN9 A;  5BTT A;  1UHI A;  2LVJ A;  3DVJ A;  4J8A A;  4N1F A;  2YDZ A;  4H47 A;  4KGF A;  4W6G A;  4UTS A;  2Y4Q A;  2WUR A;  2WSN A;  4OHS A;  3CFF A;  3LVD A;  1UP5 A;  1K2H A;  4KF5 A;  2GW3 A;  3LF3 A;  2IOV A;  3PJ7 A;  3DQH A;  3E5V A;  4PPK A;  4C0K A;  2ZKM X;  4P76 A;  4CPV A;  2KQY A;  2ZRT A;  4PHN A;  2BCX A;  3SIB A;  2DD7 A;  3ZUL A;  3RLZ A;  4ZB1 A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  1YJ2 A;  4KF5 C;  4RTC A;  1Y1A A;  4I2Y A;  2LUC A;  5LK4 A;  4W76 A;  1IGV A;  1H4U A;  4YGE B;  2LVK A;  1DJX A;  4OVN F;  3F45 A;  3ST3 A;  3CFA A;  1AJ4 A;  1DJZ A;  3I5F B;  1XFU O;  2NCP A;  3BXK A;  1UHK A;  4AS8 A;  2B1U A;  1MOU A;  2PXW A;  3VHT A;  4USL A;  1G7K A;  3BUO B;  1QVI Z;  1SMG A;  1FF1 A;  1LIN A;  2V4E A;  2JC2 A;  2BBN A;  4PDZ A;  1KQM B;  1EH2 A;  5F9G A;  2LHL A;  2EHB A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  4KW8 A;  3KEV A;  2LE9 B;  5HBD A;  1MYW A;  4XJK A;  4ZF3 A;  3KCT A;  2LMV A;  3PN7 B;  3TS5 B;  1NP8 A;  1Q4C A;  4YGD B;  2V4E C;  2VZX A;  4CFQ A;  1BU3 A;  3PAL A;  4YI8 A;  2M9G A;  3ED8 A;  1E8A A;  2CBL A;  5HZS A;  1Q4A A;  4IL1 A;  1C7V A;  1EMM A;  5I2O A;  1QIV A;  1M45 A;  3DF0 A;  2Z6Y A;  1CFP A;  5HYD A;  1CMG A;  3IR8 A;  1QAT A;  4Q9X A;  3DVK A;  1SRA A;  2G2B A;  2IS9 A;  4AOM A;  1Z1P A;  5TNC A;  4JF9 A;  2ISD A;  2BBM A;  2Z6X A;  3VK1 A;  2A54 B;  3O2P A;  1JFJ A;  3BYA A;  3ZUF A;  1ZMZ A;  2H2K A;  2KAY A;  5GQQ C;  4NDD A;  5DY6 A;  5EB7 A;  1N2D A;  3MGF A;  2JT3 A;  5DPG A;  2KHN A;  3AAK A;  1K95 A;  2L0P A;  2KBM A;  1NSH A;  1NX2 A;  1UWO A;  1SW8 A;  1DJI A;  4P2Y B;  4EUL A;  4LJB A;  1XFY O;  2KNE A;  1K94 A;  1M46 A;  2K0J A;  3BXA A;  1H6R A;  2H8Q A;  5I2L A;  1YHI A;  3SG2 A;  3DD4 A;  4MRY A; 
#chains in the Genus database with same CATH topology
 3B7A A;  4OR9 B;  2O60 A;  3TMT A;  2FJU B;  1TOP A;  4DKM A;  2MA2 A;  1Z1Q A;  2QLI A;  4MLW A;  1PK0 D;  3CR5 X;  2KFH A;  2JOJ A;  3FS7 A;  2Q91 A;  3VRQ A;  3CS1 A;  2JQ6 A;  1GFL A;  4Q04 A;  1SR6 B;  1EXR A;  4ZCU A;  3SG6 A;  1SY9 A;  4XOV A;  4W6S A;  2KFF A;  1WLM A;  4W6K A;  2JTZ A;  1F71 A;  1FBV A;  2P6B B;  3SVC A;  4GNK B;  2KI4 C;  1K8U A;  1SCM C;  4YBH B;  3BFA A;  5CSJ A;  4AQI A;  1IQ5 A;  1B4C A;  2BE4 A;  1TTX A;  1F54 A;  4PHM A;  4LW5 A;  4LJD A;  1AVS A;  1G8I A;  1DMO A;  1WRL A;  3O78 A;  2HGD A;  1B8L A;  1CLM A;  4ZIO A;  2FJY A;  3P28 A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  4NQG A;  1CV7 A;  5HZT A;  1XVJ A;  2G6Y A;  5EHU A;  2DDD A;  4ZF4 A;  2WOS A;  2A4J A;  5EXU A;  4LJD C;  1CFC A;  4GGF C;  2M29 A;  2AWK A;  2H5Q A;  2OGR A;  5DQM A;  1RWY A;  5CSN A;  3SSL A;  4WQ3 A;  4ORA B;  1DEK A;  2K60 A;  4ZFS A;  5J3X A;  4HQC A;  3EVU A;  3B6X A;  1TCF A;  4MSP A;  2ARL A;  3ST0 A;  1NYA A;  2F2O A;  3U0L A;  3CDN A;  5LTQ A;  4QJ5 B;  5KTG A;  3W1D A;  4EDO A;  3D10 A;  5KTY A;  2V4E B;  4KGE A;  2ZO6 A;  1WRK A;  4DIR A;  3PFV A;  2LLT A;  1UHN A;  2EMD A;  3CWG A;  3LCP C;  2BTJ A;  4JFG A;  3ST2 A;  4HQ9 A;  3B86 A;  1R2U A;  5FVI A;  4EDS A;  1ORG A;  1OMD A;  1QX7 A;  5JOL A;  2P71 A;  1N0Y A;  2WCB A;  1F55 A;  2QU1 A;  4W6B A;  1NCY A;  1WDC B;  1QV0 A;  5DU0 A;  1ALV A;  2QPT A;  3NXA A;  2ICR A;  2YE0 A;  3W1C A;  3R72 A;  4ZIN A;  1Y0V H;  3V2L A;  4KPI A;  3DF0 B;  2I7A A;  3SVN A;  2LUX A;  4U8D A;  1C4F A;  3I5H B;  3R1V A;  2K61 A;  1MOV A;  4TZA A;  2JT8 A;  2L4I A;  4PE7 A;  3I5F C;  1OMR A;  3ICB A;  2D8N A;  4UPG A;  1NX3 A;  1PVB A;  3SSP A;  3IP2 A;  5F6T A;  1XFX O;  1IJ6 A;  2FWQ A;  1EJ3 A;  3G9A A;  2KYC A;  2PXS A;  1GL4 A;  5I8N A;  1HUY A;  4B5Y A;  1XA9 A;  1S6J A;  4GES B;  1CTR A;  3SVE A;  1S5G Z;  2A50 B;  2A47 A;  3CZ1 A;  1CFF A;  1ZGQ A;  4DS7 A;  4HRH A;  4TNC A;  2SCP A;  2JAD A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  3NT3 A;  5FVF A;  4NDC A;  1OOG A;  4M2P A;  4AR7 A;  2H5O A;  2WIS A;  5HGE A;  4AQJ A;  4RYW A;  1EG4 A;  3L47 A;  2LLU A;  2L51 A;  4NDB A;  4PAL A;  3TMR A;  4PPJ A;  2JRF A;  1KYS A;  1X02 A;  4W6T A;  1GGZ A;  5DIC A;  1TUZ A;  1RK9 A;  5CSI A;  2QDI A;  1W7I B;  2AWJ A;  4EN1 A;  1Y1U A;  1KFX L;  3CAB A;  2BE6 A;  2JXC A;  2Y1M A;  1CFD A;  3RWT A;  2TN4 A;  1W7U A;  3S0E A;  4DXP A;  1NX0 A;  3E3R A;  3KF9 A;  4DXI A;  3NSL A;  4J88 A;  3E5T A;  1OOF A;  3PM2 A;  3AI4 A;  1AUI B;  1LA0 A;  5KU1 A;  1AP4 A;  2EC6 B;  3DQ7 A;  3E5W A;  2E6W A;  1FW4 A;  1DVI A;  4R1E A;  2MLF C;  3EVP A;  5FI6 A;  2ZRS A;  5DTL A;  2K2F A;  2L50 A;  5D69 A;  2LAN A;  4R6D A;  1EMC A;  2WC5 A;  3SG5 A;  4CID A;  3U8C A;  4ETO A;  1EMK A;  1CDM A;  3R1P A;  1J7R A;  3HX4 A;  2P4M A;  1XFV O;  5DPI A;  1EML A;  1YUU A;  3P8U A;  1GGW A;  3IQO A;  4R6B A;  2WCJ A;  1W9Z A;  4TZG A;  2L2E A;  1JF0 A;  4PHJ A;  5EBJ A;  3B87 A;  3EK7 A;  1HCJ A;  4B30 B;  2K7C A;  3DQL A;  3A4U B;  4OJ0 A;  3OX6 A;  2BCA A;  2QT2 A;  2JPO A;  2O5G A;  4ORC B;  1SR6 C;  2BEC A;  1YRT B;  5EL2 A;  4ANJ A;  4W6C A;  5G08 A;  5B8I B;  3CBE A;  2I94 A;  5HKZ A;  3U0M A;  2JT0 A;  3DVE A;  5I2Q A;  2WCK A;  1ZGO A;  3U8A A;  1C3Z A;  2CXJ A;  5DTY A;  3AKO A;  2ZN8 A;  1LS8 A;  3D0Y B;  3D76 A;  4W77 A;  2Q6P A;  1RMO A;  5HLO A;  3VRO A;  1YTZ C;  4I5J A;  2JNF A;  1B9C A;  4PE0 A;  1CKK A;  2Y5I A;  2AWM A;  4PPL A;  3NEZ A;  2PRU A;  3TZ1 A;  2RGI A;  3EKJ A;  2ERB A;  1Q4E A;  1NCZ A;  1QLK A;  4MZK A;  1OW4 A;  3CD9 A;  4JRB A;  1B1G A;  1NPQ A;  3H1O A;  4ZF5 A;  3D78 A;  2G3D B;  3JTD B;  1SL9 A;  4HSZ A;  3I5I B;  3NED A;  2OKW A;  5HKY A;  4GPL B;  1CM4 A;  3S0D A;  2HFC A;  3TUY B;  1MUX A;  4W6P A;  2IB6 A;  3WLD A;  1BJF A;  1DT7 B;  2OTB A;  4MEW A;  1Y6W A;  1S36 A;  1TIZ A;  5AQB B;  4MN0 A;  5EB6 A;  2BL0 C;  1HQV A;  5CPV A;  3SVR A;  1NX1 A;  5PAL A;  3LL8 B;  1NCX A;  2QAC A;  3KCS A;  4N5X A;  1K96 A;  1WLZ A;  4Z4K A;  1S5G Y;  1PUL A;  2DUF A;  2QEO A;  3SST A;  4W6M A;  4BY5 A;  1XMZ A;  3DPZ A;  2YGU A;  4W7A A;  4H3L A;  3OSR A;  1JC2 A;  1WDC C;  4PCW A;  2VAD A;  5H89 A;  4IK1 A;  4N3D A;  1EME A;  2MAZ A;  1C7W A;  3BUM B;  3DQU A;  2DDC A;  4LQU A;  2WCF A;  1DC1 A;  1B7T Y;  3I5H C;  2LC5 A;  2G5Z B;  2RH7 A;  3UNW A;  5AER A;  2B3Q A;  1IRJ A;  1KFU S;  3AKB A;  2VVH A;  5DKN A;  2GTE A;  1MQ1 A;  1TCO B;  1YVH A;  1BFP A;  2LNK A;  1J1D A;  1S6C A;  5DKR A;  1K90 D;  2Y1N A;  3S0B A;  2QZ0 A;  4W7F A;  3GK2 A;  2LMT A;  3CTN A;  3SVO A;  4QJ4 B;  1PSR A;  4JC2 A;  3OX5 A;  1XFZ O;  1FI5 A;  2EMO A;  3S0G A;  1KP5 A;  1TN4 A;  1CDN A;  4W74 A;  5HL1 A;  3B88 A;  1KSM A;  3I19 A;  3GK1 A;  1UUS A;  2FCD A;  2MJW B;  1F4Q A;  3NHT A;  1HT9 A;  1H8B A;  3GOF A;  2PSR A;  1OXE A;  2KPH A;  1XO5 A;  3DXL A;  1RTP 1;  3DQE A;  1SNL A;  4ORB B;  4W7E A;  2OKY A;  2CT9 A;  4H48 A;  1QY3 A;  1JC1 A;  3SG4 A;  5HKW A;  3WXA A;  4W6J A;  4W6R A;  3DPW A;  1QS7 A;  3VRN A;  2VRG A;  4W6U A;  4H3M A;  2K7B A;  2VAE A;  1JBA A;  2YFP A;  1EL4 A;  1ZOT B;  2EC6 C;  3ZUJ A;  2JPT A;  2WHU A;  4GOB A;  1IG5 A;  1SBJ A;  3DPX A;  1KQV A;  4HQ8 A;  1KWO B;  1QLS A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  1YR5 A;  3DQ8 A;  2LV7 A;  3K1K A;  2DUH A;  1YX8 A;  1Q80 A;  1S6I A;  2VVJ A;  4B30 A;  5BPJ A;  1Z4H A;  3VB1 A;  3O4X A;  3OSQ A;  1M31 A;  2HQK A;  1V1G A;  2PAL A;  1QX5 B;  4OY4 A;  5JJG A;  1BR1 B;  3DQI A;  3CR2 A;  1EMG A;  4DKN A;  1PSB A;  3DZT A;  2EMN A;  1OOH A;  3SS5 A;  1RMP A;  2BL0 B;  2KGR A;  4LQT A;  2DD9 A;  3D77 A;  3VIC A;  1ALW A;  3D0Y A;  2P70 A;  3TDI A;  1B8C A;  4JQ0 D;  1J1E A;  2H6V A;  2PVB A;  1K9P A;  1XFW O;  2LVV A;  3U8P A;  3CGL A;  2HPW A;  3I5G B;  3AAJ A;  2H61 A;  3S05 A;  3RWA A;  3BUX B;  2ZMU A;  3PJ5 A;  1Q4B A;  1S6Z A;  1KK7 Z;  5AFP A;  3DQD A;  4KEX A;  1IJ5 A;  2HRS A;  4MZL A;  1F8H A;  1CDP A;  2H61 C;  1UUR A;  4U2V A;  2F3Y A;  2K7D A;  2PQL A;  3SG7 A;  5DRG A;  2KLD A;  4OKH A;  2KYF A;  3EVR A;  2HET A;  1TWO A;  3L4A A;  4L1I A;  2KQ6 A;  4HRG A;  4W6F A;  2COL B;  4I5N B;  3JTD C;  3PAT A;  3V3D A;  3I5I C;  4WQ2 A;  5FYX A;  1WY9 A;  4BDU A;  1S1E A;  1CDL A;  2JZI A;  2H5P A;  3TUY C;  3OGO A;  3DQ3 A;  2KOT A;  1U5I B;  2AH8 A;  3ST4 A;  1LVC D;  1XQM A;  3KPX A;  3RZS A;  3LLE A;  4OZD A;  1WRZ A;  2AAO A;  3TDZ A;  3WHU B;  3WNX B;  2FL1 A;  1TRF A;  2LCP A;  3AI5 A;  2HCG A;  3SVS A;  3BJH A;  2L98 A;  5AEQ A;  1B7T Z;  1J7O A;  3DQA A;  5HZU A;  4W6O A;  3D75 A;  3A8S A;  5K89 A;  3EK4 A;  3C1V A;  2GV5 A;  1ODB A;  4ZCV A;  2NZ0 A;  2M97 A;  2ZMW A;  1REC A;  4BY4 A;  2Q4U A;  1YVL A;  3PM8 A;  4OCI A;  3SIA A;  4ICB A;  2HPS A;  3BOW A;  2NCO A;  4L13 A;  3ZTF A;  3JVT C;  1F0B A;  1LA3 A;  4HVF A;  2L5X B;  1L7Z A;  3LVA A;  4JWQ A;  2WHT A;  2WIQ A;  1PVA A;  2L5Y A;  2IE2 A;  4KA9 A;  5FVG A;  1YFP A;  2YE1 A;  3GEX A;  3LSA A;  1IH0 A;  1QWV A;  1CLB A;  4E68 A;  2NLN A;  2KBI A;  4W7D A;  1RFJ A;  1UHH A;  3DVM A;  4GBA A;  2I18 A;  3SSH A;  1PAL A;  3FE8 A;  2OTE A;  5ER5 A;  1QTX A;  2PYQ A;  1TNQ A;  1GQM A;  3UG0 A;  3CZT X;  4IJ7 A;  1F70 A;  4L12 A;  1QAS A;  5H88 A;  4W6D A;  4MRX A;  1GM0 A;  2H8V A;  2QLE A;  3PIB A;  4PE4 A;  3PJI A;  1JWD A;  2A53 B;  1OQP A;  1XSS A;  5HZO A;  1MF8 B;  3PLF B;  1MHO A;  4ZBL A;  3CZ0 A;  1S26 D;  2F8P A;  2ZFD A;  2KI6 D;  3CR4 X;  2G2S B;  3PJB A;  2E30 A;  1EMA A;  3M22 A;  2KFG A;  3SVD A;  1DQE A;  4XGY A;  1TNX A;  1KFU L;  1K93 D;  3M0W A;  1G4Y R;  4KAG A;  1UIS A;  2OPO A;  1SCV A;  1G33 A;  4L9M A;  2A52 B;  1T14 A;  3DQ2 A;  2B3P A;  4W69 A;  1FI6 A;  2C9I A;  1TNP A;  4P1Q A;  3CB9 A;  1QYO A;  1XAE A;  3BXC A;  4Z4M A;  1TNW A;  2KAX A;  1OOI X;  3D73 A;  2KLE A;  3KHE A;  3DQO A;  1NUB A;  1RRO A;  3DQ4 A;  4W7X A;  4W6H A;  3VGO A;  4PE1 A;  2H9W A;  2G6E A;  1YHG A;  4DXM A;  1F09 A;  4ORN A;  4MBE A;  4GF6 B;  1KWO C;  5EXB A;  3S0F A;  4W6N A;  2OJK A;  1W7S A;  2LP2 A;  1BR4 B;  5FHV A;  2BCB A;  5ER4 X;  1KK7 Y;  3O6B A;  1OE9 B;  5KSZ A;  4H3N A;  2BKH B;  1DJY A;  1K9K A;  1L2O B;  5DTZ A;  1A2X A;  4YGB B;  2PAS A;  1BOC A;  1NWD A;  1A75 A;  2M7N A;  2IB5 A;  2L4H A;  3DQM A;  4JGE A;  1KFX S;  2GGM A;  1OZS A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  1JFK A;  5HW9 A;  4W6I A;  5BQL A;  1SK6 D;  3SSY A;  4PFE A;  2KSP A;  3DQF A;  2QLG A;  2HQW A;  3I5G C;  2O29 A;  4IZN A;  3DQK A;  2Z6Z A;  1A03 A;  3BQ3 A;  1RJV A;  4JPZ B;  5FI7 A;  5H87 A;  3LS3 A;  5EJU A;  1M39 A;  2Q57 A;  3SVU A;  2MLE C;  3BFB A;  4KW4 A;  3JVT B;  4Q7T A;  4CLN A;  1YJF A;  2NXQ A;  1OSA A;  2OTG C;  1SKT A;  3NSI A;  4D1E A;  4W6A A;  4XYN A;  3GJ2 A;  2WCE A;  3DQ1 A;  4XOW A;  1QX2 A;  1YRU B;  1KSO A;  3BOW B;  2F33 A;  4N1G A;  1U5I A;  2AUC A;  3SRY A;  3D74 A;  1FPW A;  3NT9 A;  2ZNE A;  3NF0 A;  3SV5 A;  1ZAC A;  4F7F A;  1Y1X A;  1RRX A;  3QME A;  3SG3 A;  4JEO A;  2JU0 A;  1AHR A;  1QYQ A;  2C9J A;  4M2O A;  1JSA A;  4IK4 A;  1J7Q A;  1UHJ A;  3LF4 B;  2LM5 A;  3FIA A;  2WHS A;  1BLQ A;  1N65 A;  3SS4 A;  4KF4 A;  5DKQ A;  3NSO A;  2PMY A;  4P5O E;  1M63 B;  3DQC A;  4Q7U A;  3GB3 A;  1BF5 A;  2WC8 A;  3GL4 A;  1XYD A;  2G16 B;  1S3P A;  1CLL A;  1VRK A;  4CFR A;  1XA5 A;  1YHH A;  3BX9 A;  1EMF A;  2GX0 A;  2QEB A;  5D7F A;  2FZU A;  2KAV A;  3U0N A;  3GJ1 A;  1JF2 A;  3SVB A;  3FWB A;  3SJS A;  2F3Z A;  4A4C A;  2HGY A;  4W72 A;  4KW9 A;  1SL7 A;  2JUL A;  4IK9 A;  1AK8 A;  5BTT B;  3OHM B;  3FWC A;  2HQZ A;  3DY9 A;  4DXQ A;  3TDU A;  1QJT A;  2AHA A;  2JNX A;  4KYN A;  1YZW A;  2G3O A;  3BXB A;  3KO0 A;  3CYZ A;  3WCK A;  3EVV A;  2I2R E;  1QXT A;  5EXC I;  1SYM A;  3VRR A;  2DUI A;  1IQ3 A;  4IK5 A;  4GGF A;  4YRU A;  1JUO A;  2QLH A;  3IVT A;  5LTR A;  3SS3 A;  2VVI A;  1QIW A;  2GX2 A;  3GK4 X;  3WLC A;  1BG1 A;  3NSK A;  2Z1O A;  2F2P A;  4OGS A;  3SSK A;  1JC0 A;  3CFH A;  3EK8 A;  3CD1 A;  4YI9 A;  5LTP A;  3HCM A;  3OP0 A;  5AXI A;  1R6P A;  4W6L A;  1YUT A;  1BT6 A;  1H4B A;  1OXD A;  2ZO7 A;  2GW4 B;  4YGA A;  4XVP A;  4W73 A;  2M3W A;  3PSR A;  4GUK A;  1Q73 A;  2LHI A;  2M1U A;  2WOR A;  3UO9 A;  2GGZ A;  3BUN B;  5AAN A;  4DUQ A;  4FQO A;  1JBY A;  1A75 B;  1YUR A;  1Q4D A;  3LVC A;  3VHT B;  3FE9 A;  3DQN A;  2FOT A;  2K8M B;  2LLS A;  1D1O A;  2M1K B;  3FE6 A;  1YUS A;  1DGU A;  1QVI Y;  1RM9 A;  4IK8 A;  4I5L B;  3SS0 A;  2QEV A;  1C3Y A;  1DF0 A;  1RMM A;  3M24 A;  4W75 A;  3SSV A;  1J55 A;  1MR8 A;  3BUW B;  4XJK B;  1DEL A;  2WC6 A;  1KYP A;  1OMV A;  1K9U A;  2JXL A;  2CTN A;  2LP3 A;  2M49 B;  3O4Y A;  2BAP A;  4DXN A;  2QLG B;  4QJ3 B;  1IWQ A;  2EGD A;  5DQB A;  3A8R A;  5J2O A;  2LAP A;  2OTG B;  3H4S E;  3CZ2 A;  2WSO A;  3DQ6 A;  1V1F A;  4GGN A;  1GGX A;  1YX7 A;  3WHT B;  3DQJ A;  1SPY A;  5IBW A;  2WCM A;  4NWS A;  1QXP A;  1C07 A;  1EMB A;  1ZUX A;  2KDH A;  4HE4 A;  2O24 A;  4JKT A;  5T3I A;  3DQ5 A;  1JBZ A;  5DPH A;  1B9A A;  3NHI A;  1MXL C;  3LA1 A;  1L2O C;  4RYS A;  1A4P A;  4Q7R A;  3EG5 B;  1XK4 A;  1BMO A;  2A48 A;  4I5K A;  4W7C A;  2M7L A;  4INW A;  5DTX A;  2MRD A;  2MBX A;  4YGC B;  1KQM C;  3CLN A;  1KK8 C;  4PT1 A;  2OS8 C;  1XK4 C;  2G6X A;  1LKJ A;  1OZO A;  4HRE E;  1ZFS A;  3IF7 A;  1CMF A;  3CGA A;  3AKA A;  3ADF A;  4DCK A;  2V53 A;  1GJY A;  3K1E A;  5DPJ A;  2QRF A;  4PHK A;  2LVI A;  4DRW A;  3EKH A;  5BT0 A;  1CNP A;  3IQQ A;  3LK0 A;  2DUE A;  3H1R A;  4LJC A;  1IKU A;  2JWW A;  1W7T A;  1B47 A;  2MHH A;  3OBV A;  4FTG A;  5HLV A;  3RM1 A;  3O77 A;  2L2C A;  4W7R A;  2DUG A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  4GFT A;  1QV1 A;  1OXF A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  2O2B A;  1QYF A;  4J89 A;  1J7P A;  1SCM B;  2A56 B;  2DOQ A;  5DRF A;  2WCH A;  4OQW A;  3MSE B;  2Y0G A;  2SAS A;  1MWN A;  1BOD A;  1KYR A;  4M2Q A;  1DTL A;  1DJH A;  4DXO A;  1EG3 A;  4A4B A;  1ZGP A;  3NGV A;  2WND A;  3U0K A;  2LMU A;  2AMI A;  2A46 A;  2M0R A;  4WRI A;  1SL8 A;  4MVF A;  4IK3 A;  2HF5 A;  1AJ5 A;  4EMQ A;  2H5R A;  2G9B A;  3OB2 B;  4OV2 A;  3UFZ A;  2BKI B;  2AWL A;  3DQ9 A;  2JTT A;  3R1O A;  3VRP A;  1PRW A;  4Q9W A;  4XL5 A;  1NIW A;  4MZJ A;  2POX A;  2HJO A;  1OOJ A;  2KI6 C;  4F0Z B;  2CCM A;  2M8U A;  2K2A A;  2CNP A;  2ZN9 A;  5BTT A;  1UHI A;  2LVJ A;  3DVJ A;  4J8A A;  4N1F A;  2YDZ A;  4H47 A;  4KGF A;  4W6G A;  4UTS A;  2Y4Q A;  2WUR A;  2WSN A;  5I94 A;  4OHS A;  3CFF A;  3LVD A;  4FQT A;  1UP5 A;  1K2H A;  4KF5 A;  2GW3 A;  3LF3 A;  2IOV A;  3PJ7 A;  3DQH A;  3E5V A;  4PPK A;  1XFR A;  4C0K A;  2ZKM X;  4P76 A;  4CPV A;  3Q8I A;  2KQY A;  2ZRT A;  4PHN A;  2BCX A;  3SIB A;  2DD7 A;  3ZUL A;  3RLZ A;  1TUJ A;  4ZB1 A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  1YJ2 A;  4KF5 C;  4RTC A;  1Y1A A;  4I2Y A;  2LUC A;  4JD9 A;  5LK4 A;  4W76 A;  1IGV A;  1H4U A;  4YGE B;  2LVK A;  2WCL A;  1DJX A;  4OVN F;  1SSE B;  3F45 A;  3ST3 A;  3CFA A;  1AJ4 A;  1DJZ A;  3I5F B;  1XFU O;  2NCP A;  3BXK A;  1UHK A;  4AS8 A;  2B1U A;  1MOU A;  2PXW A;  3VHT A;  4USL A;  1G7K A;  3BUO B;  1QVI Z;  1SMG A;  1FF1 A;  1LIN A;  2V4E A;  2JC2 A;  2BBN A;  4PDZ A;  5FI2 A;  1KQM B;  1EH2 A;  5F9G A;  2LHL A;  2EHB A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  4KW8 A;  3KEV A;  2LE9 B;  5HBD A;  1MYW A;  4XJK A;  4ZF3 A;  3KCT A;  2LMV A;  3PN7 B;  3TS5 B;  1NP8 A;  1Q4C A;  4YGD B;  2V4E C;  2VZX A;  4CFQ A;  4INX A;  1BU3 A;  3PAL A;  2QEH A;  4YI8 A;  2M9G A;  3S0A A;  3ED8 A;  1E8A A;  2CBL A;  5HZS A;  1Q4A A;  3L4L A;  4IL1 A;  1C7V A;  5D3O A;  1EMM A;  5I2O A;  1QIV A;  1M45 A;  3DF0 A;  2Z6Y A;  1CFP A;  5HYD A;  1CMG A;  3IR8 A;  1QAT A;  4Q9X A;  3DVK A;  1SRA A;  2G2B A;  2IS9 A;  4AOM A;  3OGN A;  1Z2C B;  1Z1P A;  5TNC A;  4JF9 A;  2ISD A;  3BFH A;  2BBM A;  2Z6X A;  3VK1 A;  2A54 B;  3O2P A;  1JFJ A;  3BYA A;  3ZUF A;  1ZMZ A;  2H2K A;  2KAY A;  5GQQ C;  4NDD A;  5DY6 A;  5EB7 A;  1N2D A;  3MGF A;  2JT3 A;  5DPG A;  2KHN A;  3AAK A;  3DYE A;  1K95 A;  2BNX A;  2L0P A;  2KBM A;  1NSH A;  1IIO A;  1NX2 A;  1UWO A;  1SW8 A;  1DJI A;  4P2Y B;  4EUL A;  4LJB A;  1XFY O;  2KNE A;  1P28 A;  1K94 A;  3N7H A;  1M46 A;  2K0J A;  3BXA A;  1H6R A;  2H8Q A;  5I2L A;  1YHI A;  3SG2 A;  3DD4 A;  4MRY A; 
#chains in the Genus database with same CATH homology
 4OR9 B;  2O60 A;  3TMT A;  2FJU B;  1TOP A;  4DKM A;  2MA2 A;  1Z1Q A;  2QLI A;  4MLW A;  1PK0 D;  3CR5 X;  2KFH A;  2JOJ A;  3FS7 A;  2Q91 A;  3VRQ A;  3CS1 A;  2JQ6 A;  1GFL A;  4Q04 A;  1SR6 B;  1EXR A;  4ZCU A;  3SG6 A;  1SY9 A;  4XOV A;  4W6S A;  2KFF A;  1WLM A;  4W6K A;  2JTZ A;  1F71 A;  1FBV A;  2P6B B;  3SVC A;  4GNK B;  2KI4 C;  1K8U A;  1SCM C;  4YBH B;  5CSJ A;  4AQI A;  1IQ5 A;  1B4C A;  2BE4 A;  1TTX A;  1F54 A;  4PHM A;  4LW5 A;  4LJD A;  1AVS A;  1G8I A;  1DMO A;  1WRL A;  3O78 A;  2HGD A;  1B8L A;  1CLM A;  4ZIO A;  3P28 A;  4C0J A;  1CB1 A;  4GAO A;  2KGB C;  3ZNI A;  4NQG A;  1CV7 A;  5HZT A;  1XVJ A;  2G6Y A;  5EHU A;  2DDD A;  4ZF4 A;  2WOS A;  2A4J A;  5EXU A;  4LJD C;  1CFC A;  4GGF C;  2M29 A;  2AWK A;  2H5Q A;  2OGR A;  5DQM A;  1RWY A;  5CSN A;  3SSL A;  4WQ3 A;  4ORA B;  4ZFS A;  5J3X A;  4HQC A;  3EVU A;  4MSP A;  1TCF A;  2ARL A;  3ST0 A;  1NYA A;  2F2O A;  3U0L A;  5LTQ A;  4QJ5 B;  5KTG A;  3W1D A;  4EDO A;  3D10 A;  5KTY A;  2V4E B;  4KGE A;  2ZO6 A;  1WRK A;  4DIR A;  3PFV A;  2LLT A;  1UHN A;  2EMD A;  3CWG A;  3LCP C;  2BTJ A;  4JFG A;  3ST2 A;  4HQ9 A;  1R2U A;  5FVI A;  4EDS A;  1OMD A;  1QX7 A;  5JOL A;  1N0Y A;  2WCB A;  1F55 A;  2QU1 A;  4W6B A;  1NCY A;  1WDC B;  1QV0 A;  5DU0 A;  1ALV A;  2QPT A;  3NXA A;  2ICR A;  2YE0 A;  3W1C A;  4ZIN A;  1Y0V H;  4KPI A;  3DF0 B;  2I7A A;  3SVN A;  2LUX A;  4U8D A;  1C4F A;  3I5H B;  2K61 A;  1MOV A;  4TZA A;  2JT8 A;  2L4I A;  4PE7 A;  3I5F C;  1OMR A;  3ICB A;  2D8N A;  4UPG A;  1NX3 A;  1PVB A;  3SSP A;  3IP2 A;  5F6T A;  1XFX O;  1IJ6 A;  2FWQ A;  1EJ3 A;  3G9A A;  2KYC A;  2PXS A;  1GL4 A;  5I8N A;  1HUY A;  4B5Y A;  1XA9 A;  1S6J A;  4GES B;  1CTR A;  3SVE A;  1S5G Z;  2A50 B;  2A47 A;  1CFF A;  1ZGQ A;  4DS7 A;  4HRH A;  4TNC A;  2SCP A;  2JAD A;  3PN7 C;  3TS5 C;  2R2I A;  2ZND A;  1W7J B;  3NT3 A;  5FVF A;  4NDC A;  4M2P A;  4AR7 A;  2H5O A;  2WIS A;  5HGE A;  4AQJ A;  4RYW A;  1EG4 A;  2LLU A;  2L51 A;  4NDB A;  4PAL A;  3TMR A;  4PPJ A;  2JRF A;  1KYS A;  1X02 A;  4W6T A;  1GGZ A;  1RK9 A;  5CSI A;  1W7I B;  2AWJ A;  4EN1 A;  1Y1U A;  1KFX L;  2BE6 A;  2JXC A;  2Y1M A;  1CFD A;  3RWT A;  2TN4 A;  1W7U A;  4DXP A;  1NX0 A;  3E3R A;  3KF9 A;  4DXI A;  3NSL A;  4J88 A;  3E5T A;  3AI4 A;  1AUI B;  1LA0 A;  5KU1 A;  1AP4 A;  2EC6 B;  3DQ7 A;  3E5W A;  2E6W A;  1FW4 A;  1DVI A;  4R1E A;  2MLF C;  3EVP A;  2ZRS A;  5DTL A;  2K2F A;  2L50 A;  5D69 A;  2LAN A;  4R6D A;  1EMC A;  3SG5 A;  4CID A;  3U8C A;  4ETO A;  1EMK A;  1CDM A;  1J7R A;  3HX4 A;  2P4M A;  1XFV O;  5DPI A;  1EML A;  1YUU A;  3P8U A;  1GGW A;  3IQO A;  4R6B A;  4TZG A;  2L2E A;  1JF0 A;  4PHJ A;  5EBJ A;  3EK7 A;  1HCJ A;  4B30 B;  2K7C A;  3DQL A;  3A4U B;  4OJ0 A;  3OX6 A;  2BCA A;  2QT2 A;  2O5G A;  4ORC B;  1SR6 C;  2BEC A;  1YRT B;  4ANJ A;  4W6C A;  5G08 A;  5B8I B;  3CBE A;  2I94 A;  5HKZ A;  3U0M A;  2JT0 A;  3DVE A;  5I2Q A;  3U8A A;  1ZGO A;  2CXJ A;  5DTY A;  3AKO A;  2ZN8 A;  3D0Y B;  4W77 A;  2Q6P A;  1RMO A;  5HLO A;  3VRO A;  1YTZ C;  4I5J A;  2JNF A;  1B9C A;  4PE0 A;  1CKK A;  2Y5I A;  2AWM A;  4PPL A;  3NEZ A;  2PRU A;  3TZ1 A;  2RGI A;  3EKJ A;  1Q4E A;  1NCZ A;  1QLK A;  4MZK A;  3CD9 A;  4JRB A;  1B1G A;  1NPQ A;  3H1O A;  4ZF5 A;  2G3D B;  3JTD B;  1SL9 A;  4HSZ A;  3I5I B;  3NED A;  2OKW A;  5HKY A;  4GPL B;  1CM4 A;  2HFC A;  3TUY B;  1MUX A;  4W6P A;  2IB6 A;  3WLD A;  1BJF A;  1DT7 B;  2OTB A;  4MEW A;  1Y6W A;  1S36 A;  1TIZ A;  5AQB B;  4MN0 A;  5EB6 A;  2BL0 C;  1HQV A;  5CPV A;  3SVR A;  1NX1 A;  5PAL A;  3LL8 B;  1NCX A;  2QAC A;  3KCS A;  4N5X A;  1K96 A;  1WLZ A;  4Z4K A;  1S5G Y;  1PUL A;  2DUF A;  3SST A;  4W6M A;  4BY5 A;  1XMZ A;  3DPZ A;  4W7A A;  4H3L A;  3OSR A;  1JC2 A;  1WDC C;  4PCW A;  2VAD A;  5H89 A;  4IK1 A;  4N3D A;  1EME A;  2MAZ A;  1C7W A;  3BUM B;  3DQU A;  2DDC A;  4LQU A;  2WCF A;  1B7T Y;  3I5H C;  2LC5 A;  2G5Z B;  2RH7 A;  5AER A;  2B3Q A;  1IRJ A;  1KFU S;  3AKB A;  2VVH A;  5DKN A;  1MQ1 A;  1TCO B;  1YVH A;  1BFP A;  2LNK A;  1J1D A;  1S6C A;  5DKR A;  1K90 D;  2Y1N A;  2QZ0 A;  4W7F A;  3GK2 A;  2LMT A;  3CTN A;  3SVO A;  4QJ4 B;  1PSR A;  4JC2 A;  3OX5 A;  1XFZ O;  1FI5 A;  2EMO A;  1KP5 A;  1TN4 A;  1CDN A;  4W74 A;  1KSM A;  3I19 A;  3GK1 A;  1UUS A;  2FCD A;  2MJW B;  1F4Q A;  1HT9 A;  1H8B A;  3GOF A;  2PSR A;  1OXE A;  1XO5 A;  1RTP 1;  3DQE A;  1SNL A;  4ORB B;  4W7E A;  2OKY A;  2CT9 A;  4H48 A;  1QY3 A;  1JC1 A;  3SG4 A;  5HKW A;  3WXA A;  4W6J A;  4W6R A;  3DPW A;  1QS7 A;  3VRN A;  2VRG A;  4W6U A;  4H3M A;  2K7B A;  2VAE A;  1JBA A;  2YFP A;  1EL4 A;  1ZOT B;  2EC6 C;  3ZUJ A;  2JPT A;  2WHU A;  4GOB A;  1IG5 A;  1SBJ A;  3DPX A;  1KQV A;  4HQ8 A;  1KWO B;  1QLS A;  3OB1 B;  1A29 A;  1LXF C;  1ZUZ A;  3K21 A;  1YR5 A;  3DQ8 A;  2LV7 A;  3K1K A;  2DUH A;  1YX8 A;  1Q80 A;  1S6I A;  2VVJ A;  4B30 A;  5BPJ A;  3OSQ A;  1M31 A;  2HQK A;  1V1G A;  2PAL A;  1QX5 B;  4OY4 A;  5JJG A;  1BR1 B;  3DQI A;  3CR2 A;  1EMG A;  4DKN A;  1PSB A;  2EMN A;  1RMP A;  2BL0 B;  2KGR A;  4LQT A;  2DD9 A;  3VIC A;  1ALW A;  3D0Y A;  3TDI A;  1B8C A;  4JQ0 D;  1J1E A;  2H6V A;  2PVB A;  1K9P A;  1XFW O;  2LVV A;  3U8P A;  3CGL A;  2HPW A;  3I5G B;  3AAJ A;  2H61 A;  3S05 A;  3RWA A;  3BUX B;  2ZMU A;  3PJ5 A;  1Q4B A;  1S6Z A;  1KK7 Z;  5AFP A;  3DQD A;  4KEX A;  1IJ5 A;  2HRS A;  4MZL A;  1F8H A;  1CDP A;  2H61 C;  1UUR A;  4U2V A;  2F3Y A;  2K7D A;  3SG7 A;  5DRG A;  4OKH A;  2KYF A;  3EVR A;  2HET A;  4L1I A;  2KQ6 A;  4HRG A;  4W6F A;  2COL B;  4I5N B;  3JTD C;  3PAT A;  3V3D A;  3I5I C;  4WQ2 A;  5FYX A;  1WY9 A;  4BDU A;  1S1E A;  1CDL A;  2JZI A;  2H5P A;  3TUY C;  3OGO A;  3DQ3 A;  2KOT A;  1U5I B;  2AH8 A;  3ST4 A;  1LVC D;  1XQM A;  3KPX A;  3LLE A;  1WRZ A;  2AAO A;  3TDZ A;  3WHU B;  3WNX B;  2FL1 A;  1TRF A;  2LCP A;  3AI5 A;  2HCG A;  3SVS A;  2L98 A;  5AEQ A;  1B7T Z;  1J7O A;  3DQA A;  5HZU A;  4W6O A;  3A8S A;  5K89 A;  3EK4 A;  3C1V A;  2GV5 A;  1ODB A;  4ZCV A;  2NZ0 A;  2M97 A;  2ZMW A;  1REC A;  4BY4 A;  2Q4U A;  1YVL A;  3PM8 A;  4OCI A;  3SIA A;  4ICB A;  2HPS A;  3BOW A;  2NCO A;  4L13 A;  3ZTF A;  3JVT C;  1F0B A;  1LA3 A;  4HVF A;  2L5X B;  1L7Z A;  3LVA A;  4JWQ A;  2WHT A;  2WIQ A;  1PVA A;  2IE2 A;  5FVG A;  4KA9 A;  1YFP A;  2YE1 A;  3GEX A;  3LSA A;  1IH0 A;  1CLB A;  4E68 A;  2NLN A;  2KBI A;  4W7D A;  1RFJ A;  1UHH A;  3DVM A;  4GBA A;  2I18 A;  3SSH A;  1PAL A;  2OTE A;  5ER5 A;  1QTX A;  1TNQ A;  1GQM A;  3UG0 A;  3CZT X;  1F70 A;  4L12 A;  1QAS A;  5H88 A;  4W6D A;  4MRX A;  2QLE A;  3PIB A;  4PE4 A;  1JWD A;  2A53 B;  1OQP A;  1XSS A;  5HZO A;  1MF8 B;  3PLF B;  1MHO A;  4ZBL A;  1S26 D;  2F8P A;  2ZFD A;  2KI6 D;  3CR4 X;  2G2S B;  3PJB A;  2E30 A;  1EMA A;  3M22 A;  2KFG A;  3SVD A;  4XGY A;  1TNX A;  1KFU L;  1K93 D;  3M0W A;  1G4Y R;  4KAG A;  1UIS A;  2OPO A;  1SCV A;  1G33 A;  4L9M A;  2A52 B;  3DQ2 A;  2B3P A;  4W69 A;  1FI6 A;  2C9I A;  1TNP A;  4P1Q A;  3CB9 A;  1QYO A;  1XAE A;  3BXC A;  4Z4M A;  1TNW A;  2KAX A;  3KHE A;  3DQO A;  1NUB A;  1RRO A;  3DQ4 A;  4W7X A;  4W6H A;  3VGO A;  4PE1 A;  2H9W A;  2G6E A;  1YHG A;  4DXM A;  1F09 A;  4ORN A;  4MBE A;  4GF6 B;  1KWO C;  5EXB A;  4W6N A;  2OJK A;  1W7S A;  2LP2 A;  1BR4 B;  5FHV A;  2BCB A;  5ER4 X;  1KK7 Y;  3O6B A;  1OE9 B;  5KSZ A;  4H3N A;  2BKH B;  1DJY A;  1K9K A;  1L2O B;  5DTZ A;  1A2X A;  4YGB B;  2PAS A;  1BOC A;  1NWD A;  1A75 A;  2M7N A;  2IB5 A;  2L4H A;  3DQM A;  4JGE A;  1KFX S;  2GGM A;  1OZS A;  1F4O A;  1KK8 B;  2OS8 B;  3LK1 A;  1JFK A;  5HW9 A;  4W6I A;  5BQL A;  1SK6 D;  3SSY A;  4PFE A;  2KSP A;  3DQF A;  2QLG A;  2HQW A;  3I5G C;  2O29 A;  4IZN A;  3DQK A;  2Z6Z A;  1A03 A;  3BQ3 A;  1RJV A;  4JPZ B;  5H87 A;  3LS3 A;  5EJU A;  1M39 A;  2Q57 A;  3SVU A;  2MLE C;  4KW4 A;  3JVT B;  4Q7T A;  4CLN A;  1YJF A;  2NXQ A;  1OSA A;  2OTG C;  1SKT A;  3NSI A;  4D1E A;  4W6A A;  4XYN A;  3GJ2 A;  2WCE A;  3DQ1 A;  4XOW A;  1QX2 A;  1YRU B;  1KSO A;  3BOW B;  2F33 A;  4N1G A;  1U5I A;  2AUC A;  3SRY A;  1FPW A;  3NT9 A;  2ZNE A;  3NF0 A;  3SV5 A;  1ZAC A;  1Y1X A;  1RRX A;  3SG3 A;  4JEO A;  2JU0 A;  1AHR A;  1QYQ A;  2C9J A;  4M2O A;  1JSA A;  4IK4 A;  1J7Q A;  1UHJ A;  3LF4 B;  2LM5 A;  3FIA A;  2WHS A;  1BLQ A;  1N65 A;  4KF4 A;  5DKQ A;  3NSO A;  2PMY A;  4P5O E;  1M63 B;  3DQC A;  4Q7U A;  3GB3 A;  1BF5 A;  2WC8 A;  3GL4 A;  1XYD A;  2G16 B;  1S3P A;  1CLL A;  1VRK A;  4CFR A;  1XA5 A;  1YHH A;  3BX9 A;  1EMF A;  2GX0 A;  5D7F A;  2FZU A;  2KAV A;  3U0N A;  3GJ1 A;  1JF2 A;  3SVB A;  3FWB A;  3SJS A;  2F3Z A;  4A4C A;  2HGY A;  4W72 A;  4KW9 A;  1SL7 A;  2JUL A;  4IK9 A;  1AK8 A;  5BTT B;  3OHM B;  3FWC A;  2HQZ A;  4DXQ A;  3TDU A;  1QJT A;  2AHA A;  2JNX A;  1YZW A;  2G3O A;  3BXB A;  3KO0 A;  3WCK A;  3EVV A;  2I2R E;  1QXT A;  5EXC I;  1SYM A;  3VRR A;  2DUI A;  1IQ3 A;  4IK5 A;  4GGF A;  4YRU A;  1JUO A;  2QLH A;  5LTR A;  2VVI A;  1QIW A;  2GX2 A;  3GK4 X;  3WLC A;  1BG1 A;  3NSK A;  2Z1O A;  2F2P A;  4OGS A;  3SSK A;  1JC0 A;  3CFH A;  3EK8 A;  3CD1 A;  4YI9 A;  5LTP A;  3HCM A;  3OP0 A;  5AXI A;  1R6P A;  4W6L A;  1YUT A;  1BT6 A;  1H4B A;  1OXD A;  2ZO7 A;  2GW4 B;  4YGA A;  4XVP A;  4W73 A;  2M3W A;  3PSR A;  4GUK A;  1Q73 A;  2LHI A;  2M1U A;  2WOR A;  2GGZ A;  3BUN B;  5AAN A;  4DUQ A;  4FQO A;  1JBY A;  1A75 B;  1YUR A;  1Q4D A;  3LVC A;  3VHT B;  3DQN A;  2FOT A;  2K8M B;  2LLS A;  1D1O A;  2M1K B;  1YUS A;  1DGU A;  1QVI Y;  1RM9 A;  4IK8 A;  4I5L B;  3SS0 A;  1DF0 A;  1RMM A;  3M24 A;  4W75 A;  3SSV A;  1J55 A;  1MR8 A;  3BUW B;  4XJK B;  1KYP A;  1OMV A;  1K9U A;  2JXL A;  2CTN A;  2LP3 A;  2M49 B;  3O4Y A;  4DXN A;  2QLG B;  4QJ3 B;  1IWQ A;  2EGD A;  5DQB A;  3A8R A;  5J2O A;  2LAP A;  2OTG B;  3H4S E;  3DQ6 A;  2WSO A;  1V1F A;  4GGN A;  1GGX A;  1YX7 A;  3WHT B;  3DQJ A;  1SPY A;  5IBW A;  4NWS A;  1QXP A;  1C07 A;  1EMB A;  1ZUX A;  2KDH A;  4HE4 A;  2O24 A;  5T3I A;  3DQ5 A;  1JBZ A;  5DPH A;  1B9A A;  1MXL C;  3LA1 A;  1L2O C;  4RYS A;  1A4P A;  4Q7R A;  1XK4 A;  1BMO A;  2A48 A;  4I5K A;  4W7C A;  2M7L A;  5DTX A;  2MRD A;  2MBX A;  4YGC B;  1KQM C;  3CLN A;  1KK8 C;  2OS8 C;  1XK4 C;  2G6X A;  1LKJ A;  1OZO A;  4HRE E;  1ZFS A;  3IF7 A;  1CMF A;  3CGA A;  3AKA A;  3ADF A;  4DCK A;  2V53 A;  1GJY A;  5DPJ A;  2QRF A;  4PHK A;  2LVI A;  4DRW A;  3EKH A;  5BT0 A;  1CNP A;  3IQQ A;  3LK0 A;  2DUE A;  3H1R A;  4LJC A;  1IKU A;  2JWW A;  1W7T A;  1B47 A;  2MHH A;  4FTG A;  5HLV A;  3RM1 A;  3O77 A;  4W7R A;  2DUG A;  1DJG A;  1DJW A;  4C0L A;  1B8R A;  4GFT A;  1QV1 A;  1OXF A;  1CM1 A;  3ZWH A;  5CSF A;  2KI4 B;  2O2B A;  1QYF A;  4J89 A;  1J7P A;  1SCM B;  2A56 B;  2DOQ A;  5DRF A;  4OQW A;  3MSE B;  2Y0G A;  2SAS A;  1MWN A;  1BOD A;  1KYR A;  4M2Q A;  1DTL A;  1DJH A;  4DXO A;  1EG3 A;  4A4B A;  1ZGP A;  2WND A;  3U0K A;  2LMU A;  2AMI A;  2A46 A;  2M0R A;  4WRI A;  1SL8 A;  4MVF A;  4IK3 A;  2HF5 A;  1AJ5 A;  4EMQ A;  2H5R A;  2G9B A;  3OB2 B;  4OV2 A;  3UFZ A;  2BKI B;  2AWL A;  3DQ9 A;  2JTT A;  3VRP A;  1PRW A;  4Q9W A;  4XL5 A;  1NIW A;  4MZJ A;  2POX A;  2HJO A;  1OOJ A;  2KI6 C;  4F0Z B;  2CCM A;  2M8U A;  2K2A A;  2CNP A;  2ZN9 A;  5BTT A;  1UHI A;  2LVJ A;  3DVJ A;  4J8A A;  4N1F A;  2YDZ A;  4H47 A;  4KGF A;  4W6G A;  4UTS A;  2Y4Q A;  2WUR A;  2WSN A;  4OHS A;  3CFF A;  3LVD A;  1UP5 A;  1K2H A;  4KF5 A;  2GW3 A;  3LF3 A;  2IOV A;  3PJ7 A;  3DQH A;  3E5V A;  4PPK A;  4C0K A;  2ZKM X;  4P76 A;  4CPV A;  2KQY A;  2ZRT A;  4PHN A;  2BCX A;  3SIB A;  2DD7 A;  3ZUL A;  3RLZ A;  4ZB1 A;  2FCE A;  1DGV A;  1MXE A;  1DF0 B;  1YJ2 A;  4KF5 C;  4RTC A;  1Y1A A;  4I2Y A;  2LUC A;  5LK4 A;  4W76 A;  1IGV A;  1H4U A;  4YGE B;  2LVK A;  1DJX A;  4OVN F;  3F45 A;  3ST3 A;  3CFA A;  1AJ4 A;  1DJZ A;  3I5F B;  1XFU O;  2NCP A;  3BXK A;  1UHK A;  4AS8 A;  2B1U A;  1MOU A;  2PXW A;  3VHT A;  4USL A;  1G7K A;  3BUO B;  1QVI Z;  1SMG A;  1FF1 A;  1LIN A;  2V4E A;  2JC2 A;  2BBN A;  4PDZ A;  1KQM B;  1EH2 A;  5F9G A;  2LHL A;  2EHB A;  1KCY A;  2K7O A;  3QRX A;  2HQ8 A;  4KW8 A;  3KEV A;  2LE9 B;  5HBD A;  1MYW A;  4XJK A;  4ZF3 A;  3KCT A;  2LMV A;  3PN7 B;  3TS5 B;  1NP8 A;  1Q4C A;  4YGD B;  2V4E C;  2VZX A;  4CFQ A;  1BU3 A;  3PAL A;  4YI8 A;  2M9G A;  3ED8 A;  1E8A A;  2CBL A;  5HZS A;  1Q4A A;  4IL1 A;  1C7V A;  1EMM A;  5I2O A;  1QIV A;  1M45 A;  3DF0 A;  2Z6Y A;  1CFP A;  5HYD A;  1CMG A;  3IR8 A;  1QAT A;  4Q9X A;  3DVK A;  1SRA A;  2G2B A;  2IS9 A;  4AOM A;  1Z1P A;  5TNC A;  4JF9 A;  2ISD A;  2BBM A;  2Z6X A;  3VK1 A;  2A54 B;  3O2P A;  1JFJ A;  3BYA A;  3ZUF A;  1ZMZ A;  2H2K A;  2KAY A;  5GQQ C;  4NDD A;  5DY6 A;  5EB7 A;  1N2D A;  3MGF A;  2JT3 A;  5DPG A;  2KHN A;  3AAK A;  1K95 A;  2L0P A;  2KBM A;  1NSH A;  1NX2 A;  1UWO A;  1SW8 A;  1DJI A;  4P2Y B;  4EUL A;  4LJB A;  1XFY O;  2KNE A;  1K94 A;  1M46 A;  2K0J A;  3BXA A;  1H6R A;  2H8Q A;  5I2L A;  1YHI A;  3SG2 A;  3DD4 A;  4MRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...