3SG4A

Crystal structure of gcamp3-d380y, lp(linker 2)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 133
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg4A02
1YRUB 3SVRA 4PE7A 3LF4B 2QLGA 5F6TA 1RMMA 2LAPA 3PN7B 4H48A 2GX2A 1EMBA 3I5GC 3SVOA 4DXIA 4AQJA 3NSOA 4Z4MA 3SVEA 3VGOA 2M7LA 1K96A 1A4PA 2AH8A 5LTPA 1K95A 1KSMA 2RGIA 2EC6C 4UTSA 3H1RA 2JWWA 5ER4X 4PE0A 4IK3A 5J3XA 3NEDA 4AS8A 5HKYA 1QS7A 1F8HA 1ODBA 3K1KA 2KAYA 1FI5A 5EB7A 4BDUA 1B7TY 2BTJA 1XK4A 5KU1A 2JADA 5DU0A 2QLEA 5EXBA 2CCMA 3BUXB 2A46A 5FVGA 1A2XA 4OQWA 3WLCA 3I5HC 2HGYA 1CDNA 1Y0VH 4JGEA 1J1EA 2L50A 2VRGA 4W6NA 1PRWA 4GF6B 2WURA 3SSVA 1KFXS 4PDZA 4MZLA 3SVUA 1CLMA 1RECA 1S5GY 1QATA 3GEXA 2H5PA 4GGNA 4WQ2A 1IQ3A 3SG5A 1RFJA 4P5OE 2YE0A 1KP5A 2QPTA 2WSNA 5LTRA 4ZINA 1QV1A 1J7RA 5AXIA 3VHTA 2YE1A 1XYDA 3PN7C 4W7RA 4L1IA 1MOVA 2MHHA 2KI4B 1BJFA 2L98A 3ICBA 3PLFB 3GB3A 4JEOA 1DJWA 1WY9A 3JTDB 2PALA 5T3IA 1U5IA 5EXUA 2B3QA 5CPVA 2AAOA 4MSPA 2BE6A 1YZWA 1DF0B 3UFZA 1KCYA 2KOTA 4DUQA 2L2EA 1B8LA 4JRBA 2AWKA 1S6CA 1AUIB 1A75B 4I5LB 3O77A 3D10A 1FPWA 1IQ5A 4H3LA 1TNWA 2KHNA 2GX0A 1TNXA 3HCMA 1QV0A 4AR7A 2ICRA 2MJWB 4OGSA 3OGOA 4KGFA 1CDLA 3LA1A 1JC2A 5DKRA 5EXCI 4B30B 1XFWO 2M1KB 5DQMA 2ZNDA 1YFPA 2YFPA 1ALWA 2M29A 5AANA 3LVAA 2GGMA 4GAOA 1WDCC 4ZF4A 5H87A 2JNFA 2KBIA 1A03A 1CV7A 5AERA 4XYNA 3FWBA 4ZCVA 1F0BA 3SRYA 2ZRTA 2LMVA 2PSRA 1XO5A 2LVJA 3DQMA 1JF2A 4YI9A 1YHIA 1WRKA 2EMDA 1BLQA 2QLHA 2A48A 4HRGA 1ZUXA 3A8SA 4IK9A 2A47A 2F2PA 4NQGA 1JC1A 3KCTA 1PK0D 1L2OB 3QRXA 1QVIY 1YUTA 4W6GA 1G7KA 1YX8A 5DTXA 4W6JA 1W7JB 4YGAA 3TMRA 5DPHA 1H8BA 1AVSA 1EMEA 3SSHA 2I7AA 3EKJA 1AJ4A 1A29A 3PJ7A 1UISA 3BUMB 3ZNIA 3ST2A 4J89A 1BR1B 1S6IA 2BCXA 3GK2A 3CR4X 4KW8A 1LVCD 2LMUA 3CFHA 1DJGA 2JULA 4PPLA 4Q7TA 2WORA 3CGLA 2K0JA 4JFGA 2ZN9A 1J7OA 2I2RE 4KGEA 3KEVA 3VK1A 3DQ2A 5DRFA 4NDBA 2JZIA 1QLKA 1BOCA 1KFXL 1QIVA 2LLSA 1SCMC 1EXRA 3DQAA 3EVUA 4M2PA 1YX7A 2JTTA 5I2QA 4DXPA 1K2HA 1SR6B 2Y1NA 5DPGA 1MF8B 1KWOC 2H2KA 1JFKA 1B9AA 1UHKA 3NEZA 1YUUA 3JVTC 1QYFA 3DQ4A 4HRHA 4GNKB 3SSTA 2LE9B 4GPLB 4I5NB 3CGAA 2H5RA 5DKNA 5D69A 2LP3A 1NYAA 3OP0A 5DY6A 3AI4A 4PHJA 1MYWA 3MSEB 1HUYA 1BU3A 1MXLC 1FW4A 1V1GA 1EJ3A 4MLWA 1DJYA 4ANJA 1S3PA 3EVPA 3SSYA 1SYMA 4PHNA 1IGVA 3VICA 5BT0A 3E5TA 2BBMA 1A75A 2Z1OA 1AJ5A 2Z6YA 2KAVA 3BOWB 3CLNA 1EMGA 4DRWA 2QZ0A 1K9UA 4W6MA 4NDCA 3I5IC 4HVFA 5IBWA 1SCVA 1M39A 3SG6A 1OOJA 5CSJA 1LINA 1JF0A 4EN1A 2K7DA 4N1GA 4HSZA 4W7AA 4A4CA 2LUCA 1B1GA 2K7CA 2LC5A 3WLDA 4L9MA 1Q4DA 1F55A 1U5IB 3ED8A 2GGZA 2AUCA 2OGRA 1J7PA 1XA5A 2H61C 4KA9A 1QASA 2NCOA 1NX3A 4OVNF 3DQ1A 4DXOA 3O2PA 3PJ5A 3PSRA 4W6IA 3O4YA 1QX5B 1MXEA 2Y4QA 2WOSA 1W7TA 1XQMA 4DS7A 1Y1AA 1TCOB 2G3OA 2HCGA 2DDCA 3I5GB 1EMKA 3LF3A 1RK9A 3NXAA 2KYFA 2WIQA 1CNPA 2EHBA 3SG4A 2O2BA 1M63B 3CS1A 2EC6B 3KHEA 2MLFC 2KQ6A 1HT9A 2JU0A 5TNCA 3AKOA 1NP8A 2ISDA 3TS5B 4DIRA 2Q91A 2L5XB 3PFVA 2OS8B 4CIDA 2G2BA 1Q4AA 4XL5A 1B7TZ 5I8NA 5HZOA 3LS3A 4W7DA 2DD7A 3I5HB 4P2YB 2OJKA 1YR5A 4GUKA 3U8CA 3GJ2A 5BTTA 2H5QA 2ZNEA 1Y1XA 5FYXA 5LK4A 3TDUA 2PVBA 1S5GZ 2QU1A 2GW3A 3F45A 2JRFA 2EMNA 4MVFA 4IK8A 3DVEA 1ZOTB 3CFAA 5GQQC 3CD9A 2HFCA 4JC2A 3LK0A 2G5ZB 2M0RA 2V4EC 1IKUA 4J8AA 3NSLA 4W6UA 1BR4B 1H6RA 1K94A 1M46A 3SG3A 2KFHA 2KNEA 1NX1A 3BXCA 3O6BA 1DGUA 2Q57A 3AAKA 1XMZA 5DQBA 3NT3A 2A4JA 3WHTB 3BYAA 2H61A 4ZBLA 3UG0A 1B8CA 5DTZA 2OKYA 1DGVA 1CFPA 2L4HA 2E30A 5BPJA 4FQOA 3TS5C 5EB6A 1JBYA 2OS8C 5DKQA 2LVVA 2C9IA 4F0ZB 4Q7UA 5HYDA 4PE4A 3M24A 3AAJA 2M9GA 4Q9WA 2FCEA 2F3YA 2AHAA 2JT3A 1K90D 2KDHA 2C9JA 1Q80A 2PXWA 2OTEA 1NX2A 1QXTA 2L4IA 4RYWA 3BOWA 3EKHA 1K8UA 3TMTA 3E5VA 3SVDA 4EDOA 3I5FB 4HQ8A 1HCJA 1ZACA 3GJ1A 5AQBB 1WDCB 3IR8A 1NIWA 2ZMWA 4MRXA 2BCAA 1OZSA 1TTXA 3SV5A 4KEXA 4IK1A 4FTGA 4R6DA 3SG7A 4KPIA 4GGFC 1K93D 5I2LA 1N0YA 2HPSA 2ZKMX 2HETA 1KSOA 2K7BA 4BY4A 3NT9A 4W7XA 2BECA 2CNPA 5I2OA 1SRAA 1CM1A 5HKWA 1QVIZ 1YVLA 3DQ5A 4J88A 3DPXA 3BUOB 4MZKA 4AOMA 5DTLA 2V4EA 1KYSA 4ORBB 2ARLA 1MOUA 4OKHA 2HQWA 4TNCA 2I94A 1XFZO 4W76A 2LM5A 3ZTFA 3BXAA 2H5OA 3M0WA 2PRUA 3DVKA 2B1UA 4CLNA 1PVAA 1KK7Y 2MAZA 1Q4EA 4YGBB 1XFXO 4ZIOA 4WQ3A 3I5FC 1OXFA 3W1CA 3G9AA 4KAGA 3LCPC 4KF4A 2ZFDA 3CTNA 3NSKA 3DQCA 4OCIA 3CR5X 1QX7A 1SCMB 2KGRA 3LK1A 2A54B 2LHLA 1YHGA 1B47A 5HBDA 2G16B 4W6RA 2CTNA 4JWQA 3W1DA 1KWOB 2JC2A 1W7UA 1MR8A 2MRDA 1KQVA 1GGXA 5HZSA 1Q73A 2B3PA 1C4FA 1F54A 1S6JA 2ZO6A 3OX5A 1YJFA 1F4QA 3JVTB 4PPJA 3DPWA 4PFEA 1DJZA 1TNPA 1W7SA 4RTCA 3IQOA 5K89A 5HKZA 1QY3A 1YUSA 2FZUA 3ZWHA 4GGFA 4W72A 1S36A 5DPIA 3DQ7A 1CKKA 3ZUJA 1C7VA 1S26D 2LLTA 3CR2A 4HQCA 4W7FA 2OPOA 4QJ5B 2KI6D 3VROA 1QYOA 3BXBA 4YGEB 4C0JA 2P4MA 5BTTB 4CFQA 1EH2A 4Z4KA 3DQLA 5H88A 4W7EA 4HE4A 4QJ4B 1W7IB 2YDZA 3ZUFA 1C07A 3AKAA 1LKJA 3I5IB 4YBHB 4L12A 2IB5A 3CZTX 1KK8C 1QIWA 1KQMC 1BMOA 3VRQA 2WHUA 5PALA 3SVBA 1Z1QA 1RM9A 3WXAA 4P1QA 2QACA 3HX4A 1Q4CA 4MZJA 3BXKA 1SKTA 2MLEC 4PE1A 2JOJA 4W7CA 2R2IA 4DKMA 2QLIA 2BCBA 4LW5A 4ETOA 3DQ6A 4KW9A 2VVJA 1S6ZA 3E5WA 4W6DA 1MQ1A 1BF5A 1CLBA 1OMDA 4CFRA 2GW4B 2Y1MA 2L51A 4DKNA 1WRZA 3TZ1A 3ADFA 1NCXA 1TRFA 1SW8A 2NXQA 1EL4A 2LVIA 1JWDA 4I2YA 2KFFA 3CFFA 2LLUA 3VRRA 5FVFA 4IL1A 2PXSA 4IK4A 4PPKA 2D8NA 2VVIA 2IB6A 2KQYA 4Q9XA 1CFFA 2ZN8A 2SASA 1AK8A 4W6OA 2AWJA 2O60A 3EVRA 2JQ6A 2L0PA 2KBMA 1TIZA 3FWCA 3DQKA 5CSIA 2K7OA 2WHTA 1YHHA 1XSSA 2G6EA 2HF5A 1Q4BA 3H4SE 4H47A 5HLOA 3D0YA 2Y5IA 2HQKA 3U0LA 3E3RA 1Y1UA 4M2QA 3KF9A 1OSAA 3SG2A 1OMRA 2DUGA 1J55A 1RJVA 2K8MB 1SNLA 4DXMA 1PVBA 2ZMUA 4KF5C 2M49B 1ZMZA 2TN4A 2V4EB 3DPZA 4JQ0D 1IWQA 1NPQA 2LV7A 2FCDA 2DUEA 4W6BA 5DPJA 3ZULA 4W75A 2WCEA 2M3WA 1EMFA 1LA3A 3DQOA 4YRUA 3GK1A 3CBEA 2G6YA 4XOVA 1BG1A 1IJ5A 1DMOA 4IZNA 3WCKA 2GV5A 3IF7A 3DD4A 4P76A 1ZUZA 4E68A 1SMGA 1CM4A 4WRIA 1XFVO 1SY9A 4W6FA 4XVPA 5HW9A 2KSPA 3LVDA 1ZFSA 1UHNA 4EMQA 5ER5A 2Q4UA 2SCPA 3PATA 1EMLA 3DQNA 2DOQA 2K2AA 2OTGB 2CT9A 2OTBA 3SSLA 4BY5A 1SL8A 1FI6A 4PALA 3TUYC 3DVMA 1RROA 1UHIA 1N65A 1DJIA 2OKWA 2COLB 2AMIA 4W6LA 2A53B 1XFYO 1PSBA 5HLVA 1LXFC 1QX2A 1G4YR 1UHHA 4L13A 2A52B 4OY4A 1JUOA 2E6WA 2G2SB 1DJXA 2DUHA 4PHKA 4ZCUA 5AEQA 5KSZA 1H4UA 4W6CA 1B4CA 2POXA 4AQIA 1HQVA 1XAEA 1CDMA 4Q7RA 3DVJA 4U2VA 3EK8A 3U0KA 1UP5A 2M8UA 1CTRA 4KF5A 3OB1B 3DQHA 1BODA 3H1OA 3WNXB 2KI6C 3GK4X 1XVJA 3OSRA 2A56B 2BE4A 4UPGA 2Q6PA 2K61A 2OTGC 2H8QA 1XA9A 1NUBA 2PMYA 3U0NA 3ST0A 1GGWA 4YGCB 2CXJA 1SL7A 3TDZA 1EMCA 5H89A 4HREE 4GESB 4JF9A 1CLLA 1JFJA 1RMOA 1S1EA 3OB2B 1Z1PA 2NLNA 4ZB1A 3DF0B 1OXDA 3WHUB 1KK7Z 4ORAB 2BL0C 2KYCA 4ZFSA 4YGDB 1D1OA 2F33A 2WSOA 3PIBA 3RM1A 1EMMA 4IK5A 4LQUA 3M22A 1F09A 5JOLA 2WC8A 4I5JA 3EK4A 4ZF3A 3AI5A 1AP4A 1RMPA 2AWMA 1TN4A 1LA0A 1J7QA 2F2OA 2LP2A 2P6BB 4W6PA 3KO0A 3NSIA 4PCWA 2KGBC 1QJTA 3A8RA 1PSRA 2EGDA 1OXEA 4H3NA 4PHMA 1EMAA 1QYQA 5EHUA 5AFPA 2JNXA 1J1DA 2NZ0A 3NF0A 2AWLA 2ZO7A 1UURA 2BKIB 4ICBA 1GQMA 4DXNA 2RH7A 2M97A 2MBXA 3TDIA 2DUFA 2NCPA 3BUNB 3D0YB 4LJDC 3EK7A 3OSQA 3O78A 1WRLA 1K9KA 5HGEA 4W69A 3CB9A 3DQFA 4XJKB 1SPYA 2JT0A 1NCYA 5LTQA 2QT2A 1OZOA 1K9PA 1YRTB 2WNDA 1KK8B 1MUXA 1GL4A 1G8IA 1OE9B 1KQMB 5F9GA 1NX0A 3KPXA 1CFCA 5D7FA 3DQ3A 1QXPA 4W6AA 5EJUA 5FHVA 5B8IB 3SVSA 1KFUS 1PULA 2JTZA 2LUXA 2IOVA 4XGYA 2BBNA 2KI4C 2LHIA 4XOWA 4OR9B 3JTDC 3P28A 1CB1A 2FL1A 4MN0A 2O24A 1DTLA 2O5GA 1MHOA 2WCFA 1JSAA 2Y0GA 2DUIA 3BQ3A 3SSPA 3SSKA 2JXLA 4DCKA 5FVIA 2MA2A 1DVIA 3PM8A 4GOBA 2EMOA 2IS9A 4OHSA 3BUWB 2G3DB 1JBAA 2O29A 2M7NA 2IE2A 4C0LA 1TCFA 4USLA 3RWAA 2VADA 4W6HA 4N3DA 4NDDA 2K2FA 4N5XA 3SIBA 3A4UB 4M2OA 1DT7B 4LQTA 3DQ8A 1C7WA 3C1VA 3U0MA 1ZGPA 4HQ9A 1R2UA 3GL4A 3KCSA 5DTYA 3RWTA 5G08A 3DQDA 1JBZA 2KFGA 1IG5A 1EG3A 4GFTA 1ALVA 3EVVA 3LL8B 2HRSA 5KTGA 3S05A 1YURA 2WCBA 2FWQA 2CBLA 3LVCA 4EDSA 4W6KA 3DQJA 3DF0A 4R1EA 3PJBA 4OV2A 4LJDA 1ZGOA 2H6VA 1X02A 1G33A 5HZTA 4OJ0A 2QLGB 4W74A 2HGDA 1TNQA 1L7ZA 2DDDA 1RRXA 3GOFA 5EBJA 2VAEA 4N1FA 3FS7A 5J2OA 3IQQA 3U8AA 1L2OC 1GFLA 3IP2A 2DD9A 1DJHA 4C0KA 4W77A 2G6XA 1VRKA 2A50B 1YJ2A 1UWOA 1FF1A 5CSNA 2M1UA 3VRNA 4TZAA 3ST3A 1QTXA 4I5KA 2G9BA 4ZF5A 3LLEA 1OQPA 1N2DA 1F71A 1JC0A 2H9WA 5DRGA 3CWGA 2JXCA 1DF0A 3BX9A 1IH0A 4B5YA 1UUSA 1NWDA 1RWYA 1NSHA 2Z6XA 4NWSA 4DXQA 3VRPA 4RYSA 4QJ3B 2JPTA 1SL9A 2F3ZA 4Q04A 2LVKA 1SBJA 1H4BA 3SIAA 3TUYB 5KTYA 1WLZA 1ZGQA 2FOTA 1YVHA 1F70A 4W6SA 3SVCA 2Z6ZA 3VHTB 2ZRSA 1M31A 4EULA 4B30A 1RTP1 4XJKA 2I18A 3P8UA 2HJOA 1Y6WA 3SS0A 3LSAA 1SR6C 1FBVA 1KFUL 4W6TA 1IJ6A 4CPVA 1YTZC 3PALA 3CD1A 4MRYA 4LJBA 2F8PA 2HQ8A 1PALA 2JT8A 2KAXA 3K21A 4MEWA 2HPWA 1UHJA 2QRFA 5BQLA 1BFPA 4ORCB 1CMGA 1KYRA 4TZGA 1XK4C 3U8PA 1QLSA 4LJCA 1AHRA 2VZXA 1SK6D 2V53A 3AKBA 4R6BA 3OX6A 4H3MA 2WISA 1GJYA 1F4OA 1V1FA 2LANA 3MGFA 1B8RA 3DQIA 4W73A 3RLZA 5CSFA 1TOPA 1GGZA 5HZUA 1NCZA 1CFDA 1R6PA 3DQ9A 4D1EA 3SJSA 4JPZB 4MBEA 3OHMB 5JJGA 2LCPA 2BKHB 2WHSA 2LNKA 4ORNA 1MWNA 2PASA 4U8DA 4A4BA 1BT6A 1B9CA 1IRJA 3DQEA 2BL0B 3DQUA 1E8AA 1M45A 2VVHA 3V3DA 1WLMA 2HQZA 2LMTA 1CDPA 3I19A 1CMFA 3FIAA 1KYPA 4YI8A 3ST4A 1OMVA 2FJUB 4KW4A 4GBAA 1XFUO 1EG4A 3SVNA
chains in the Genus database with same CATH superfamily
1W9ZA 1YRUB 3SVRA 4PE7A 3LF4B 2QLGA 5F6TA 1RMMA 2LAPA 3PN7B 4H48A 2GX2A 2K60A 1EMBA 3S0AA 1DELA 3I5GC 3SVOA 4DXIA 4AQJA 3NSOA 4Z4MA 3SVEA 3VGOA 2M7LA 1K96A 1A4PA 2AH8A 5LTPA 1K95A 1KSMA 2RGIA 2EC6C 4UTSA 3H1RA 2JWWA 5ER4X 4PE0A 4IK3A 5J3XA 3NEDA 4AS8A 5HKYA 1QS7A 1F8HA 1ODBA 3K1KA 2KAYA 1FI5A 5EB7A 3CZ2A 4BDUA 1B7TY 2BTJA 1XK4A 5KU1A 2JADA 5DU0A 2QLEA 5EXBA 2CCMA 3BUXB 2A46A 5FVGA 3DYEA 1A2XA 4OQWA 3WLCA 3I5HC 2HGYA 1CDNA 1Y0VH 4JGEA 1J1EA 2L50A 3DXLA 2VRGA 4W6NA 1PRWA 4GF6B 2WURA 3SSVA 1KFXS 4PDZA 3RZSA 4MZLA 3SVUA 1CLMA 1RECA 1S5GY 1QATA 3GEXA 2H5PA 4GGNA 4WQ2A 1IQ3A 2L2CA 3SG5A 1RFJA 4P5OE 2YE0A 1IIOA 1TWOA 1KP5A 2QPTA 2WSNA 5LTRA 4ZINA 1QV1A 1J7RA 5AXIA 3VHTA 2YE1A 1XYDA 3PN7C 4W7RA 4L1IA 1MOVA 2MHHA 2KI4B 1BJFA 2L98A 3ICBA 3PLFB 3GB3A 4JEOA 1DJWA 1WY9A 3JTDB 2PALA 2PQLA 5T3IA 1U5IA 5EXUA 2B3QA 5CPVA 2AAOA 4MSPA 2BE6A 1YZWA 1DF0B 3UFZA 1KCYA 2KOTA 4DUQA 2L2EA 1B8LA 4JRBA 2AWKA 1S6CA 1AUIB 3D75A 1A75B 4I5LB 3O77A 3D10A 1FPWA 3DY9A 1IQ5A 3R72A 4H3LA 1TNWA 2KHNA 2GX0A 1TNXA 3HCMA 1QV0A 4AR7A 2ICRA 2MJWB 4OGSA 3OGOA 4KGFA 1CDLA 3LA1A 1JC2A 5DKRA 5EXCI 4B30B 1XFWO 2M1KB 5DQMA 2ZNDA 1YFPA 2YFPA 1ALWA 2M29A 2WCMA 3S0EA 5AANA 3LVAA 2GGMA 4GAOA 2FJYA 1WDCC 4ZF4A 5H87A 2JNFA 2KBIA 1A03A 1CV7A 5AERA 4XYNA 3FWBA 3CDNA 4ZCVA 1F0BA 3SRYA 2ZRTA 2LMVA 2PSRA 1XO5A 2LVJA 3DQMA 1JF2A 4YI9A 1YHIA 1WRKA 2EMDA 1BLQA 2QLHA 2A48A 4HRGA 1ZUXA 3D77A 3A8SA 4IK9A 2A47A 2F2PA 4NQGA 1JC1A 3KCTA 1PK0D 1L2OB 3QRXA 1QVIY 1YUTA 4W6GA 1G7KA 1YX8A 5DTXA 4W6JA 1W7JB 4YGAA 3TMRA 5DPHA 1H8BA 1AVSA 1EMEA 3SSHA 2I7AA 3EKJA 1AJ4A 1A29A 3PJ7A 1UISA 3BUMB 3ZNIA 3S0FA 3OGNA 3ST2A 4J89A 1BR1B 1S6IA 2BCXA 3GK2A 3L4LA 3CR4X 4KW8A 1LVCD 2LMUA 3CFHA 1DJGA 2JULA 4PPLA 3FE9A 4Q7TA 2WORA 3CGLA 2K0JA 4JFGA 2ZN9A 1J7OA 2I2RE 4KGEA 3R1VA 3KEVA 3VK1A 3DQ2A 1ORGA 5DRFA 4NDBA 2JZIA 1QLKA 1BOCA 1KFXL 1QIVA 2LLSA 1SCMC 1EXRA 3DQAA 3EVUA 4M2PA 1YX7A 2JTTA 5I2QA 4DXPA 1K2HA 1SR6B 2Y1NA 5DPGA 1MF8B 1KWOC 2H2KA 1JFKA 1B9AA 1UHKA 3NEZA 1YUUA 3JVTC 1QYFA 3DQ4A 4HRHA 4GNKB 3SSTA 2LE9B 1DEKA 4GPLB 4I5NB 3CGAA 2H5RA 5DKNA 5D69A 2LP3A 1NYAA 3OP0A 5DY6A 3AI4A 4PHJA 1MYWA 3MSEB 1HUYA 1BU3A 1MXLC 1FW4A 1V1GA 3VB1A 1EJ3A 4MLWA 1DJYA 4ANJA 3K1EA 1S3PA 3Q8IA 2L5YA 3EVPA 3SSYA 1SYMA 4PHNA 1IGVA 3VICA 3SS4A 5BT0A 3E5TA 2BBMA 1A75A 2Z1OA 1AJ5A 2Z6YA 2KAVA 3BOWB 3CLNA 1EMGA 4DRWA 1OOFA 2QZ0A 1K9UA 4W6MA 4NDCA 3I5IC 4HVFA 5IBWA 1SCVA 1M39A 3SG6A 4JD9A 1OOJA 5CSJA 1LINA 1JF0A 4EN1A 2K7DA 4N1GA 4HSZA 4W7AA 4A4CA 2LUCA 2KPHA 1B1GA 2K7CA 2LC5A 3WLDA 4L9MA 1Q4DA 1F55A 1U5IB 3ED8A 2GGZA 2AUCA 2OGRA 1J7PA 1XA5A 2H61C 4KA9A 1SSEB 1QASA 2NCOA 1NX3A 4OVNF 3DQ1A 4DXOA 3O2PA 3PJ5A 3PSRA 4W6IA 3O4YA 1QX5B 1MXEA 2Y4QA 2WOSA 1W7TA 1XQMA 4DS7A 1Y1AA 1TCOB 2G3OA 2HCGA 2DDCA 5HL1A 3I5GB 3QMEA 1EMKA 3LF3A 1RK9A 3NXAA 2KYFA 2WIQA 1CNPA 2EHBA 3SG4A 2O2BA 1M63B 3CS1A 2EC6B 3KHEA 2MLFC 2KQ6A 1HT9A 2JU0A 5TNCA 3CABA 3AKOA 1NP8A 2ISDA 3TS5B 4DIRA 2Q91A 2L5XB 3PFVA 2OS8B 4CIDA 2G2BA 1Q4AA 4XL5A 1B7TZ 5I8NA 5HZOA 3LS3A 4W7DA 2DD7A 3I5HB 4P2YB 2OJKA 1YR5A 4GUKA 3U8CA 3GJ2A 5BTTA 2H5QA 2ZNEA 1Y1XA 5FYXA 5LK4A 3TDUA 3IVTA 2PVBA 1S5GZ 2QU1A 2GW3A 3F45A 1TUJA 2JRFA 2EMNA 4MVFA 4IK8A 3DVEA 1ZOTB 3CFAA 5GQQC 3CD9A 2HFCA 4JC2A 3LK0A 2G5ZB 2M0RA 2V4EC 1IKUA 4J8AA 3NSLA 4W6UA 1BR4B 1H6RA 1K94A 1M46A 3SG3A 2KFHA 2KNEA 1NX1A 3BXCA 3O6BA 1DGUA 2Q57A 3AAKA 1XMZA 5DQBA 3NT3A 2A4JA 3WHTB 3BYAA 3FE8A 2H61A 4ZBLA 3UG0A 1B8CA 5DTZA 1C3YA 2OKYA 1DGVA 1CFPA 2L4HA 2E30A 5BPJA 4FQOA 3TS5C 5EB6A 1JBYA 2OS8C 5DKQA 2LVVA 2C9IA 4F0ZB 4Q7UA 5HYDA 3B87A 4PE4A 3M24A 3AAJA 2M9GA 3L4AA 4Q9WA 2FCEA 2F3YA 2AHAA 2JT3A 1K90D 2KDHA 2C9JA 1Q80A 2PXWA 2OTEA 1NX2A 1QXTA 2L4IA 4RYWA 3BOWA 3EKHA 1K8UA 3TMTA 3E5VA 3SVDA 4EDOA 3I5FB 4HQ8A 1HCJA 1ZACA 3GJ1A 5AQBB 1WDCB 3SS3A 3IR8A 1NIWA 2ZMWA 4MRXA 2BCAA 1TUZA 2QEBA 1OZSA 1TTXA 3SV5A 4KEXA 4IK1A 4FTGA 4R6DA 3SG7A 4KPIA 4GGFC 1K93D 5I2LA 1N0YA 2HPSA 2ZKMX 2HETA 1OOGA 1KSOA 2K7BA 4BY4A 4FQTA 3NT9A 4W7XA 5FI7A 2BECA 2CNPA 5I2OA 1SRAA 1CM1A 5HKWA 1QVIZ 1YVLA 3DQ5A 4J88A 3DPXA 3BUOB 4MZKA 4AOMA 5DTLA 2V4EA 1GM0A 1KYSA 4ORBB 3BJHA 2ARLA 2KLEA 1MOUA 1XFRA 4OKHA 2HQWA 4TNCA 2I94A 1XFZO 4W76A 2LM5A 3ZTFA 3BXAA 2H5OA 3BFHA 3M0WA 2PRUA 3DVKA 2B1UA 4CLNA 1PVAA 1KK7Y 2MAZA 1Q4EA 4YGBB 1XFXO 4ZIOA 4WQ3A 3I5FC 1OXFA 3W1CA 3G9AA 4KAGA 2P71A 3LCPC 4KF4A 2ZFDA 3CTNA 3NSKA 3DQCA 4OCIA 3CR5X 1QX7A 1SCMB 2KGRA 3LK1A 2A54B 1OW4A 2LHLA 1YHGA 1B47A 5HBDA 2G16B 4PT1A 4W6RA 2CTNA 4JWQA 3W1DA 1KWOB 2JC2A 1W7UA 1MR8A 1P28A 2MRDA 1KQVA 1GGXA 5HZSA 1Q73A 2B3PA 1C4FA 1F54A 1S6JA 2ZO6A 3OX5A 1YJFA 1F4QA 3JVTB 4PPJA 3DPWA 4PFEA 1DJZA 1TNPA 1W7SA 4RTCA 1OOIX 3IQOA 5K89A 5HKZA 1QY3A 1YUSA 2FZUA 3ZWHA 1DQEA 4GGFA 4W72A 3PJIA 1S36A 5DPIA 3DQ7A 1CKKA 3ZUJA 1C7VA 1S26D 2LLTA 3CR2A 4HQCA 4W7FA 2OPOA 4QJ5B 2KI6D 3VROA 1QYOA 3BXBA 4YGEB 4C0JA 2P4MA 5BTTB 4CFQA 1EH2A 3D74A 4Z4KA 2ERBA 3DQLA 5H88A 4W7EA 4HE4A 4QJ4B 1W7IB 2YDZA 3ZUFA 1C07A 3AKAA 1LKJA 3I5IB 4YBHB 4L12A 2IB5A 3CZTX 1KK8C 1QIWA 1KQMC 1BMOA 3VRQA 2WHUA 5PALA 3SVBA 1Z1QA 1RM9A 3WXAA 4P1QA 2QACA 3HX4A 1Q4CA 4MZJA 3BXKA 1SKTA 2MLEC 4PE1A 2JOJA 4W7CA 3N7HA 2R2IA 4DKMA 2QLIA 2BCBA 4LW5A 4ETOA 3DQ6A 4KW9A 2VVJA 1S6ZA 3E5WA 4W6DA 1MQ1A 1BF5A 1CLBA 1OMDA 4CFRA 2GW4B 2Y1MA 2L51A 4DKNA 1WRZA 3TZ1A 3ADFA 1NCXA 1TRFA 1SW8A 2NXQA 1OOHA 1EL4A 2LVIA 1JWDA 3B88A 4I2YA 2KFFA 3CFFA 2LLUA 3VRRA 5FVFA 4IL1A 2PXSA 4IK4A 4PPKA 2D8NA 2VVIA 2IB6A 2H8VA 2KQYA 4Q9XA 3OBVA 1CFFA 2ZN8A 2SASA 1AK8A 4W6OA 2AWJA 2O60A 3EVRA 2JQ6A 2L0PA 2KBMA 1TIZA 3FWCA 3DQKA 5CSIA 2K7OA 2WHTA 1YHHA 1XSSA 2G6EA 2HF5A 1Q4BA 3H4SE 4H47A 3S0DA 5HLOA 3D0YA 5EL2A 2Y5IA 2HQKA 3U0LA 3E3RA 1Y1UA 4M2QA 3KF9A 1OSAA 3SG2A 1OMRA 2DUGA 1J55A 1RJVA 2K8MB 1SNLA 4DXMA 1PVBA 2ZMUA 4KF5C 2M49B 1ZMZA 2TN4A 2V4EB 3DPZA 4JQ0D 1IWQA 1NPQA 3S0GA 2LV7A 2FCDA 2DUEA 4W6BA 5DPJA 3ZULA 4W75A 2WCEA 2M3WA 1EMFA 1LA3A 3DQOA 4YRUA 3GK1A 3CBEA 2G6YA 4XOVA 1QWVA 1BG1A 1IJ5A 1DMOA 4IZNA 3WCKA 2GV5A 3IF7A 4OZDA 3DD4A 4P76A 1ZUZA 4E68A 1SMGA 1CM4A 4WRIA 1XFVO 1SY9A 5DICA 4W6FA 4XVPA 5HW9A 2KSPA 3LVDA 4JKTA 1ZFSA 1UHNA 4EMQA 5ER5A 2Q4UA 2SCPA 3PATA 1EMLA 3DQNA 3B7AA 2DOQA 2K2AA 2OTGB 2CT9A 2OTBA 3SSLA 4BY5A 1SL8A 1FI6A 4PALA 3TUYC 3DVMA 1RROA 1UHIA 1DC1A 1N65A 1DJIA 2OKWA 2COLB 2KLDA 2AMIA 4W6LA 2A53B 1XFYO 1PSBA 5HLVA 1LXFC 1QX2A 1G4YR 1UHHA 4L13A 2A52B 4OY4A 1JUOA 2E6WA 2G2SB 1DJXA 2DUHA 4PHKA 4ZCUA 5AEQA 5KSZA 1H4UA 4W6CA 1B4CA 2POXA 4AQIA 1HQVA 1XAEA 1CDMA 1LS8A 1Z2CB 4Q7RA 3DVJA 4U2VA 3EK8A 3U0KA 1UP5A 2M8UA 1CTRA 4KF5A 3OB1B 3DQHA 1BODA 3H1OA 3WNXB 2KI6C 3GK4X 1XVJA 3OSRA 2A56B 2BE4A 4UPGA 2Q6PA 2K61A 2OTGC 2H8QA 1XA9A 1NUBA 2PMYA 3U0NA 3ST0A 1GGWA 4YGCB 2CXJA 1SL7A 3TDZA 1EMCA 5H89A 4HREE 4GESB 2YGUA 4JF9A 3PM2A 1CLLA 1JFJA 1RMOA 1S1EA 3OB2B 1Z1PA 2NLNA 4ZB1A 3DF0B 1OXDA 3V2LA 3WHUB 1KK7Z 4ORAB 2BL0C 2KYCA 4ZFSA 3D76A 4YGDB 1D1OA 2F33A 2WSOA 3PIBA 3RM1A 1EMMA 4IK5A 4LQUA 3M22A 1F09A 5JOLA 2WC8A 4I5JA 3EK4A 5D3OA 4ZF3A 3AI5A 1AP4A 3UNWA 1RMPA 2AWMA 1TN4A 1LA0A 1J7QA 2F2OA 2LP2A 2P6BB 4W6PA 3KO0A 3NSIA 4PCWA 2KGBC 1QJTA 3A8RA 1PSRA 2EGDA 1OXEA 4H3NA 4PHMA 2QEHA 2BAPA 1EMAA 1QYQA 5EHUA 5AFPA 2JNXA 1J1DA 2NZ0A 3NF0A 2AWLA 2ZO7A 1UURA 2BKIB 4ICBA 1GQMA 4DXNA 2RH7A 2M97A 2MBXA 4F7FA 2PYQA 3TDIA 2DUFA 2NCPA 3BUNB 3D0YB 4LJDC 3EK7A 3OSQA 3O78A 1WRLA 1K9KA 5HGEA 4W69A 3B86A 3CB9A 3DQFA 3FE6A 4XJKB 1SPYA 4KYNA 2JT0A 1NCYA 5LTQA 2QT2A 1OZOA 1K9PA 1YRTB 2WNDA 3DZTA 1KK8B 1MUXA 1GL4A 1G8IA 1OE9B 1KQMB 5F9GA 1NX0A 3KPXA 1CFCA 5D7FA 3DQ3A 1QXPA 4W6AA 5EJUA 5FHVA 3CYZA 5B8IB 3SVSA 1KFUS 1PULA 2QEOA 3BFAA 2JTZA 2LUXA 2IOVA 4XGYA 2BBNA 2KI4C 2LHIA 4XOWA 4OR9B 3JTDC 3P28A 1CB1A 2FL1A 2WC5A 4MN0A 2O24A 3O4XA 1DTLA 2O5GA 3NHTA 1MHOA 2WCFA 2WCJA 1JSAA 2Y0GA 2DUIA 3BQ3A 3SSPA 3SSKA 3D78A 2JXLA 4DCKA 5FVIA 2MA2A 1Z4HA 2QDIA 1DVIA 3PM8A 4GOBA 2EMOA 2IS9A 4OHSA 3BUWB 1T14A 4INXA 2G3DB 1JBAA 2O29A 2M7NA 3CZ0A 2IE2A 4C0LA 1TCFA 4USLA 3RWAA 2VADA 4W6HA 4N3DA 4NDDA 2K2FA 4N5XA 4INWA 3SIBA 3A4UB 4M2OA 1DT7B 4LQTA 3DQ8A 1C7WA 3C1VA 3U0MA 3UO9A 1ZGPA 4HQ9A 4IJ7A 1R2UA 3GL4A 3KCSA 5DTYA 5I94A 3RWTA 5G08A 3DQDA 1JBZA 2KFGA 1IG5A 1EG3A 4GFTA 5FI2A 1ALVA 3EVVA 3LL8B 2HRSA 5KTGA 3S05A 3CZ1A 1YURA 2WCBA 2FWQA 2CBLA 3LVCA 4EDSA 3EG5B 4W6KA 3DQJA 3DF0A 4R1EA 3PJBA 4OV2A 4LJDA 1ZGOA 2H6VA 1X02A 1G33A 5HZTA 4OJ0A 2QLGB 4W74A 2HGDA 1TNQA 1L7ZA 2DDDA 1RRXA 3GOFA 5EBJA 2VAEA 4N1FA 3FS7A 2WCKA 5J2OA 3IQQA 3U8AA 1L2OC 1GFLA 3BFBA 3IP2A 2DD9A 1DJHA 2WCHA 4C0KA 4W77A 2G6XA 1VRKA 2A50B 1YJ2A 1UWOA 1FF1A 2P70A 5CSNA 2M1UA 3VRNA 4TZAA 3ST3A 1QTXA 4I5KA 2G9BA 4ZF5A 3LLEA 1OQPA 1N2DA 1F71A 1JC0A 2H9WA 5DRGA 3CWGA 2JXCA 1DF0A 3BX9A 1IH0A 4B5YA 1UUSA 2JPOA 1NWDA 1RWYA 2BNXA 1NSHA 2Z6XA 4NWSA 4DXQA 3VRPA 4RYSA 2WC6A 4QJ3B 2JPTA 3NGVA 1SL9A 2F3ZA 4Q04A 2LVKA 1SBJA 1H4BA 3SIAA 3TUYB 5KTYA 3NHIA 1WLZA 1ZGQA 2FOTA 1YVHA 1F70A 4W6SA 3SVCA 2Z6ZA 3VHTB 3S0BA 2ZRSA 1M31A 4EULA 4B30A 1RTP1 4XJKA 2I18A 3P8UA 2HJOA 1Y6WA 3SS0A 1C3ZA 3LSAA 1SR6C 1FBVA 1KFUL 3SS5A 4W6TA 1IJ6A 3B6XA 4CPVA 1YTZC 3PALA 3CD1A 4MRYA 4LJBA 2F8PA 2HQ8A 1PALA 2JT8A 2KAXA 3K21A 4MEWA 2HPWA 1UHJA 2QRFA 5BQLA 1BFPA 4ORCB 1CMGA 1KYRA 4TZGA 1XK4C 3U8PA 1QLSA 4LJCA 1AHRA 2VZXA 1SK6D 2V53A 3AKBA 4R6BA 3OX6A 4H3MA 2WISA 1GJYA 1F4OA 1V1FA 2LANA 3MGFA 1B8RA 3DQIA 4W73A 3RLZA 2GTEA 5CSFA 2QEVA 3D73A 1TOPA 1GGZA 5HZUA 1NCZA 3R1OA 1CFDA 1R6PA 5FI6A 3DQ9A 4D1EA 3SJSA 4JPZB 4MBEA 3OHMB 5JJGA 2LCPA 2BKHB 2WHSA 2LNKA 4ORNA 1MWNA 2PASA 4U8DA 4A4BA 1BT6A 1B9CA 1IRJA 3DQEA 2BL0B 3DQUA 1E8AA 1M45A 2VVHA 3V3DA 3R1PA 1WLMA 2HQZA 2LMTA 1CDPA 3I19A 1CMFA 3FIAA 1KYPA 4YI8A 3ST4A 1OMVA 3L47A 2FJUB 4KW4A 4GBAA 1XFUO 1EG4A 2WCLA 3SVNA
chains in the Genus database with same CATH topology
1YRUB 3SVRA 4PE7A 3LF4B 2QLGA 5F6TA 1RMMA 2LAPA 3PN7B 4H48A 2GX2A 1EMBA 3I5GC 3SVOA 4DXIA 4AQJA 3NSOA 4Z4MA 3SVEA 3VGOA 2M7LA 1K96A 1A4PA 2AH8A 5LTPA 1K95A 1KSMA 2RGIA 2EC6C 4UTSA 3H1RA 2JWWA 5ER4X 4PE0A 4IK3A 5J3XA 3NEDA 4AS8A 5HKYA 1QS7A 1F8HA 1ODBA 3K1KA 2KAYA 1FI5A 5EB7A 4BDUA 1B7TY 2BTJA 1XK4A 5KU1A 2JADA 5DU0A 2QLEA 5EXBA 2CCMA 3BUXB 2A46A 5FVGA 1A2XA 4OQWA 3WLCA 3I5HC 2HGYA 1CDNA 1Y0VH 4JGEA 1J1EA 2L50A 2VRGA 4W6NA 1PRWA 4GF6B 2WURA 3SSVA 1KFXS 4PDZA 4MZLA 3SVUA 1CLMA 1RECA 1S5GY 1QATA 3GEXA 2H5PA 4GGNA 4WQ2A 1IQ3A 3SG5A 1RFJA 4P5OE 2YE0A 1KP5A 2QPTA 2WSNA 5LTRA 4ZINA 1QV1A 1J7RA 5AXIA 3VHTA 2YE1A 1XYDA 3PN7C 4W7RA 4L1IA 1MOVA 2MHHA 2KI4B 1BJFA 2L98A 3ICBA 3PLFB 3GB3A 4JEOA 1DJWA 1WY9A 3JTDB 2PALA 5T3IA 1U5IA 5EXUA 2B3QA 5CPVA 2AAOA 4MSPA 2BE6A 1YZWA 1DF0B 3UFZA 1KCYA 2KOTA 4DUQA 2L2EA 1B8LA 4JRBA 2AWKA 1S6CA 1AUIB 1A75B 4I5LB 3O77A 3D10A 1FPWA 1IQ5A 4H3LA 1TNWA 2KHNA 2GX0A 1TNXA 3HCMA 1QV0A 4AR7A 2ICRA 2MJWB 4OGSA 3OGOA 4KGFA 1CDLA 3LA1A 1JC2A 5DKRA 5EXCI 4B30B 1XFWO 2M1KB 5DQMA 2ZNDA 1YFPA 2YFPA 1ALWA 2M29A 5AANA 3LVAA 2GGMA 4GAOA 1WDCC 4ZF4A 5H87A 2JNFA 2KBIA 1A03A 1CV7A 5AERA 4XYNA 3FWBA 4ZCVA 1F0BA 3SRYA 2ZRTA 2LMVA 2PSRA 1XO5A 2LVJA 3DQMA 1JF2A 4YI9A 1YHIA 1WRKA 2EMDA 1BLQA 2QLHA 2A48A 4HRGA 1ZUXA 3A8SA 4IK9A 2A47A 2F2PA 4NQGA 1JC1A 3KCTA 1PK0D 1L2OB 3QRXA 1QVIY 1YUTA 4W6GA 1G7KA 1YX8A 5DTXA 4W6JA 1W7JB 4YGAA 3TMRA 5DPHA 1H8BA 1AVSA 1EMEA 3SSHA 2I7AA 3EKJA 1AJ4A 1A29A 3PJ7A 1UISA 3BUMB 3ZNIA 3ST2A 4J89A 1BR1B 1S6IA 2BCXA 3GK2A 3CR4X 4KW8A 1LVCD 2LMUA 3CFHA 1DJGA 2JULA 4PPLA 4Q7TA 2WORA 3CGLA 2K0JA 4JFGA 2ZN9A 1J7OA 2I2RE 4KGEA 3KEVA 3VK1A 3DQ2A 5DRFA 4NDBA 2JZIA 1QLKA 1BOCA 1KFXL 1QIVA 2LLSA 1SCMC 1EXRA 3DQAA 3EVUA 4M2PA 1YX7A 2JTTA 5I2QA 4DXPA 1K2HA 1SR6B 2Y1NA 5DPGA 1MF8B 1KWOC 2H2KA 1JFKA 1B9AA 1UHKA 3NEZA 1YUUA 3JVTC 1QYFA 3DQ4A 4HRHA 4GNKB 3SSTA 2LE9B 4GPLB 4I5NB 3CGAA 2H5RA 5DKNA 5D69A 2LP3A 1NYAA 3OP0A 5DY6A 3AI4A 4PHJA 1MYWA 3MSEB 1HUYA 1BU3A 1MXLC 1FW4A 1V1GA 1EJ3A 4MLWA 1DJYA 4ANJA 1S3PA 3EVPA 3SSYA 1SYMA 4PHNA 1IGVA 3VICA 5BT0A 3E5TA 2BBMA 1A75A 2Z1OA 1AJ5A 2Z6YA 2KAVA 3BOWB 3CLNA 1EMGA 4DRWA 2QZ0A 1K9UA 4W6MA 4NDCA 3I5IC 4HVFA 5IBWA 1SCVA 1M39A 3SG6A 1OOJA 5CSJA 1LINA 1JF0A 4EN1A 2K7DA 4N1GA 4HSZA 4W7AA 4A4CA 2LUCA 1B1GA 2K7CA 2LC5A 3WLDA 4L9MA 1Q4DA 1F55A 1U5IB 3ED8A 2GGZA 2AUCA 2OGRA 1J7PA 1XA5A 2H61C 4KA9A 1QASA 2NCOA 1NX3A 4OVNF 3DQ1A 4DXOA 3O2PA 3PJ5A 3PSRA 4W6IA 3O4YA 1QX5B 1MXEA 2Y4QA 2WOSA 1W7TA 1XQMA 4DS7A 1Y1AA 1TCOB 2G3OA 2HCGA 2DDCA 3I5GB 1EMKA 3LF3A 1RK9A 3NXAA 2KYFA 2WIQA 1CNPA 2EHBA 3SG4A 2O2BA 1M63B 3CS1A 2EC6B 3KHEA 2MLFC 2KQ6A 1HT9A 2JU0A 5TNCA 3AKOA 1NP8A 2ISDA 3TS5B 4DIRA 2Q91A 2L5XB 3PFVA 2OS8B 4CIDA 2G2BA 1Q4AA 4XL5A 1B7TZ 5I8NA 5HZOA 3LS3A 4W7DA 2DD7A 3I5HB 4P2YB 2OJKA 1YR5A 4GUKA 3U8CA 3GJ2A 5BTTA 2H5QA 2ZNEA 1Y1XA 5FYXA 5LK4A 3TDUA 2PVBA 1S5GZ 2QU1A 2GW3A 3F45A 2JRFA 2EMNA 4MVFA 4IK8A 3DVEA 1ZOTB 3CFAA 5GQQC 3CD9A 2HFCA 4JC2A 3LK0A 2G5ZB 2M0RA 2V4EC 1IKUA 4J8AA 3NSLA 4W6UA 1BR4B 1H6RA 1K94A 1M46A 3SG3A 2KFHA 2KNEA 1NX1A 3BXCA 3O6BA 1DGUA 2Q57A 3AAKA 1XMZA 5DQBA 3NT3A 2A4JA 3WHTB 3BYAA 2H61A 4ZBLA 3UG0A 1B8CA 5DTZA 2OKYA 1DGVA 1CFPA 2L4HA 2E30A 5BPJA 4FQOA 3TS5C 5EB6A 1JBYA 2OS8C 5DKQA 2LVVA 2C9IA 4F0ZB 4Q7UA 5HYDA 4PE4A 3M24A 3AAJA 2M9GA 4Q9WA 2FCEA 2F3YA 2AHAA 2JT3A 1K90D 2KDHA 2C9JA 1Q80A 2PXWA 2OTEA 1NX2A 1QXTA 2L4IA 4RYWA 3BOWA 3EKHA 1K8UA 3TMTA 3E5VA 3SVDA 4EDOA 3I5FB 4HQ8A 1HCJA 1ZACA 3GJ1A 5AQBB 1WDCB 3IR8A 1NIWA 2ZMWA 4MRXA 2BCAA 1OZSA 1TTXA 3SV5A 4KEXA 4IK1A 4FTGA 4R6DA 3SG7A 4KPIA 4GGFC 1K93D 5I2LA 1N0YA 2HPSA 2ZKMX 2HETA 1KSOA 2K7BA 4BY4A 3NT9A 4W7XA 2BECA 2CNPA 5I2OA 1SRAA 1CM1A 5HKWA 1QVIZ 1YVLA 3DQ5A 4J88A 3DPXA 3BUOB 4MZKA 4AOMA 5DTLA 2V4EA 1KYSA 4ORBB 2ARLA 1MOUA 4OKHA 2HQWA 4TNCA 2I94A 1XFZO 4W76A 2LM5A 3ZTFA 3BXAA 2H5OA 3M0WA 2PRUA 3DVKA 2B1UA 4CLNA 1PVAA 1KK7Y 2MAZA 1Q4EA 4YGBB 1XFXO 4ZIOA 4WQ3A 3I5FC 1OXFA 3W1CA 3G9AA 4KAGA 3LCPC 4KF4A 2ZFDA 3CTNA 3NSKA 3DQCA 4OCIA 3CR5X 1QX7A 1SCMB 2KGRA 3LK1A 2A54B 2LHLA 1YHGA 1B47A 5HBDA 2G16B 4W6RA 2CTNA 4JWQA 3W1DA 1KWOB 2JC2A 1W7UA 1MR8A 2MRDA 1KQVA 1GGXA 5HZSA 1Q73A 2B3PA 1C4FA 1F54A 1S6JA 2ZO6A 3OX5A 1YJFA 1F4QA 3JVTB 4PPJA 3DPWA 4PFEA 1DJZA 1TNPA 1W7SA 4RTCA 3IQOA 5K89A 5HKZA 1QY3A 1YUSA 2FZUA 3ZWHA 4GGFA 4W72A 1S36A 5DPIA 3DQ7A 1CKKA 3ZUJA 1C7VA 1S26D 2LLTA 3CR2A 4HQCA 4W7FA 2OPOA 4QJ5B 2KI6D 3VROA 1QYOA 3BXBA 4YGEB 4C0JA 2P4MA 5BTTB 4CFQA 1EH2A 4Z4KA 3DQLA 5H88A 4W7EA 4HE4A 4QJ4B 1W7IB 2YDZA 3ZUFA 1C07A 3AKAA 1LKJA 3I5IB 4YBHB 4L12A 2IB5A 3CZTX 1KK8C 1QIWA 1KQMC 1BMOA 3VRQA 2WHUA 5PALA 3SVBA 1Z1QA 1RM9A 3WXAA 4P1QA 2QACA 3HX4A 1Q4CA 4MZJA 3BXKA 1SKTA 2MLEC 4PE1A 2JOJA 4W7CA 2R2IA 4DKMA 2QLIA 2BCBA 4LW5A 4ETOA 3DQ6A 4KW9A 2VVJA 1S6ZA 3E5WA 4W6DA 1MQ1A 1BF5A 1CLBA 1OMDA 4CFRA 2GW4B 2Y1MA 2L51A 4DKNA 1WRZA 3TZ1A 3ADFA 1NCXA 1TRFA 1SW8A 2NXQA 1EL4A 2LVIA 1JWDA 4I2YA 2KFFA 3CFFA 2LLUA 3VRRA 5FVFA 4IL1A 2PXSA 4IK4A 4PPKA 2D8NA 2VVIA 2IB6A 2KQYA 4Q9XA 1CFFA 2ZN8A 2SASA 1AK8A 4W6OA 2AWJA 2O60A 3EVRA 2JQ6A 2L0PA 2KBMA 1TIZA 3FWCA 3DQKA 5CSIA 2K7OA 2WHTA 1YHHA 1XSSA 2G6EA 2HF5A 1Q4BA 3H4SE 4H47A 5HLOA 3D0YA 2Y5IA 2HQKA 3U0LA 3E3RA 1Y1UA 4M2QA 3KF9A 1OSAA 3SG2A 1OMRA 2DUGA 1J55A 1RJVA 2K8MB 1SNLA 4DXMA 1PVBA 2ZMUA 4KF5C 2M49B 1ZMZA 2TN4A 2V4EB 3DPZA 4JQ0D 1IWQA 1NPQA 2LV7A 2FCDA 2DUEA 4W6BA 5DPJA 3ZULA 4W75A 2WCEA 2M3WA 1EMFA 1LA3A 3DQOA 4YRUA 3GK1A 3CBEA 2G6YA 4XOVA 1BG1A 1IJ5A 1DMOA 4IZNA 3WCKA 2GV5A 3IF7A 3DD4A 4P76A 1ZUZA 4E68A 1SMGA 1CM4A 4WRIA 1XFVO 1SY9A 4W6FA 4XVPA 5HW9A 2KSPA 3LVDA 1ZFSA 1UHNA 4EMQA 5ER5A 2Q4UA 2SCPA 3PATA 1EMLA 3DQNA 2DOQA 2K2AA 2OTGB 2CT9A 2OTBA 3SSLA 4BY5A 1SL8A 1FI6A 4PALA 3TUYC 3DVMA 1RROA 1UHIA 1N65A 1DJIA 2OKWA 2COLB 2AMIA 4W6LA 2A53B 1XFYO 1PSBA 5HLVA 1LXFC 1QX2A 1G4YR 1UHHA 4L13A 2A52B 4OY4A 1JUOA 2E6WA 2G2SB 1DJXA 2DUHA 4PHKA 4ZCUA 5AEQA 5KSZA 1H4UA 4W6CA 1B4CA 2POXA 4AQIA 1HQVA 1XAEA 1CDMA 4Q7RA 3DVJA 4U2VA 3EK8A 3U0KA 1UP5A 2M8UA 1CTRA 4KF5A 3OB1B 3DQHA 1BODA 3H1OA 3WNXB 2KI6C 3GK4X 1XVJA 3OSRA 2A56B 2BE4A 4UPGA 2Q6PA 2K61A 2OTGC 2H8QA 1XA9A 1NUBA 2PMYA 3U0NA 3ST0A 1GGWA 4YGCB 2CXJA 1SL7A 3TDZA 1EMCA 5H89A 4HREE 4GESB 4JF9A 1CLLA 1JFJA 1RMOA 1S1EA 3OB2B 1Z1PA 2NLNA 4ZB1A 3DF0B 1OXDA 3WHUB 1KK7Z 4ORAB 2BL0C 2KYCA 4ZFSA 4YGDB 1D1OA 2F33A 2WSOA 3PIBA 3RM1A 1EMMA 4IK5A 4LQUA 3M22A 1F09A 5JOLA 2WC8A 4I5JA 3EK4A 4ZF3A 3AI5A 1AP4A 1RMPA 2AWMA 1TN4A 1LA0A 1J7QA 2F2OA 2LP2A 2P6BB 4W6PA 3KO0A 3NSIA 4PCWA 2KGBC 1QJTA 3A8RA 1PSRA 2EGDA 1OXEA 4H3NA 4PHMA 1EMAA 1QYQA 5EHUA 5AFPA 2JNXA 1J1DA 2NZ0A 3NF0A 2AWLA 2ZO7A 1UURA 2BKIB 4ICBA 1GQMA 4DXNA 2RH7A 2M97A 2MBXA 3TDIA 2DUFA 2NCPA 3BUNB 3D0YB 4LJDC 3EK7A 3OSQA 3O78A 1WRLA 1K9KA 5HGEA 4W69A 3CB9A 3DQFA 4XJKB 1SPYA 2JT0A 1NCYA 5LTQA 2QT2A 1OZOA 1K9PA 1YRTB 2WNDA 1KK8B 1MUXA 1GL4A 1G8IA 1OE9B 1KQMB 5F9GA 1NX0A 3KPXA 1CFCA 5D7FA 3DQ3A 1QXPA 4W6AA 5EJUA 5FHVA 5B8IB 3SVSA 1KFUS 1PULA 2JTZA 2LUXA 2IOVA 4XGYA 2BBNA 2KI4C 2LHIA 4XOWA 4OR9B 3JTDC 3P28A 1CB1A 2FL1A 4MN0A 2O24A 1DTLA 2O5GA 1MHOA 2WCFA 1JSAA 2Y0GA 2DUIA 3BQ3A 3SSPA 3SSKA 2JXLA 4DCKA 5FVIA 2MA2A 1DVIA 3PM8A 4GOBA 2EMOA 2IS9A 4OHSA 3BUWB 2G3DB 1JBAA 2O29A 2M7NA 2IE2A 4C0LA 1TCFA 4USLA 3RWAA 2VADA 4W6HA 4N3DA 4NDDA 2K2FA 4N5XA 3SIBA 3A4UB 4M2OA 1DT7B 4LQTA 3DQ8A 1C7WA 3C1VA 3U0MA 1ZGPA 4HQ9A 1R2UA 3GL4A 3KCSA 5DTYA 3RWTA 5G08A 3DQDA 1JBZA 2KFGA 1IG5A 1EG3A 4GFTA 1ALVA 3EVVA 3LL8B 2HRSA 5KTGA 3S05A 1YURA 2WCBA 2FWQA 2CBLA 3LVCA 4EDSA 4W6KA 3DQJA 3DF0A 4R1EA 3PJBA 4OV2A 4LJDA 1ZGOA 2H6VA 1X02A 1G33A 5HZTA 4OJ0A 2QLGB 4W74A 2HGDA 1TNQA 1L7ZA 2DDDA 1RRXA 3GOFA 5EBJA 2VAEA 4N1FA 3FS7A 5J2OA 3IQQA 3U8AA 1L2OC 1GFLA 3IP2A 2DD9A 1DJHA 4C0KA 4W77A 2G6XA 1VRKA 2A50B 1YJ2A 1UWOA 1FF1A 5CSNA 2M1UA 3VRNA 4TZAA 3ST3A 1QTXA 4I5KA 2G9BA 4ZF5A 3LLEA 1OQPA 1N2DA 1F71A 1JC0A 2H9WA 5DRGA 3CWGA 2JXCA 1DF0A 3BX9A 1IH0A 4B5YA 1UUSA 1NWDA 1RWYA 1NSHA 2Z6XA 4NWSA 4DXQA 3VRPA 4RYSA 4QJ3B 2JPTA 1SL9A 2F3ZA 4Q04A 2LVKA 1SBJA 1H4BA 3SIAA 3TUYB 5KTYA 1WLZA 1ZGQA 2FOTA 1YVHA 1F70A 4W6SA 3SVCA 2Z6ZA 3VHTB 2ZRSA 1M31A 4EULA 4B30A 1RTP1 4XJKA 2I18A 3P8UA 2HJOA 1Y6WA 3SS0A 3LSAA 1SR6C 1FBVA 1KFUL 4W6TA 1IJ6A 4CPVA 1YTZC 3PALA 3CD1A 4MRYA 4LJBA 2F8PA 2HQ8A 1PALA 2JT8A 2KAXA 3K21A 4MEWA 2HPWA 1UHJA 2QRFA 5BQLA 1BFPA 4ORCB 1CMGA 1KYRA 4TZGA 1XK4C 3U8PA 1QLSA 4LJCA 1AHRA 2VZXA 1SK6D 2V53A 3AKBA 4R6BA 3OX6A 4H3MA 2WISA 1GJYA 1F4OA 1V1FA 2LANA 3MGFA 1B8RA 3DQIA 4W73A 3RLZA 5CSFA 1TOPA 1GGZA 5HZUA 1NCZA 1CFDA 1R6PA 3DQ9A 4D1EA 3SJSA 4JPZB 4MBEA 3OHMB 5JJGA 2LCPA 2BKHB 2WHSA 2LNKA 4ORNA 1MWNA 2PASA 4U8DA 4A4BA 1BT6A 1B9CA 1IRJA 3DQEA 2BL0B 3DQUA 1E8AA 1M45A 2VVHA 3V3DA 1WLMA 2HQZA 2LMTA 1CDPA 3I19A 1CMFA 3FIAA 1KYPA 4YI8A 3ST4A 1OMVA 2FJUB 4KW4A 4GBAA 1XFUO 1EG4A 3SVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRU B;  3SVR A;  4PE7 A;  3LF4 B;  2QLG A;  5F6T A;  1RMM A;  2LAP A;  3PN7 B;  4H48 A;  2GX2 A;  1EMB A;  3I5G C;  3SVO A;  4DXI A;  4AQJ A;  3NSO A;  4Z4M A;  3SVE A;  3VGO A;  2M7L A;  1K96 A;  1A4P A;  2AH8 A;  5LTP A;  1K95 A;  1KSM A;  2RGI A;  2EC6 C;  4UTS A;  3H1R A;  2JWW A;  5ER4 X;  4PE0 A;  4IK3 A;  5J3X A;  3NED A;  4AS8 A;  5HKY A;  1QS7 A;  1F8H A;  1ODB A;  3K1K A;  2KAY A;  1FI5 A;  5EB7 A;  4BDU A;  1B7T Y;  2BTJ A;  1XK4 A;  5KU1 A;  2JAD A;  5DU0 A;  2QLE A;  5EXB A;  2CCM A;  3BUX B;  2A46 A;  5FVG A;  1A2X A;  4OQW A;  3WLC A;  3I5H C;  2HGY A;  1CDN A;  1Y0V H;  4JGE A;  1J1E A;  2L50 A;  2VRG A;  4W6N A;  1PRW A;  4GF6 B;  2WUR A;  3SSV A;  1KFX S;  4PDZ A;  4MZL A;  3SVU A;  1CLM A;  1REC A;  1S5G Y;  1QAT A;  3GEX A;  2H5P A;  4GGN A;  4WQ2 A;  1IQ3 A;  3SG5 A;  1RFJ A;  4P5O E;  2YE0 A;  1KP5 A;  2QPT A;  2WSN A;  5LTR A;  4ZIN A;  1QV1 A;  1J7R A;  5AXI A;  3VHT A;  2YE1 A;  1XYD A;  3PN7 C;  4W7R A;  4L1I A;  1MOV A;  2MHH A;  2KI4 B;  1BJF A;  2L98 A;  3ICB A;  3PLF B;  3GB3 A;  4JEO A;  1DJW A;  1WY9 A;  3JTD B;  2PAL A;  5T3I A;  1U5I A;  5EXU A;  2B3Q A;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  1YZW A;  1DF0 B;  3UFZ A;  1KCY A;  2KOT A;  4DUQ A;  2L2E A;  1B8L A;  4JRB A;  2AWK A;  1S6C A;  1AUI B;  1A75 B;  4I5L B;  3O77 A;  3D10 A;  1FPW A;  1IQ5 A;  4H3L A;  1TNW A;  2KHN A;  2GX0 A;  1TNX A;  3HCM A;  1QV0 A;  4AR7 A;  2ICR A;  2MJW B;  4OGS A;  3OGO A;  4KGF A;  1CDL A;  3LA1 A;  1JC2 A;  5DKR A;  5EXC I;  4B30 B;  1XFW O;  2M1K B;  5DQM A;  2ZND A;  1YFP A;  2YFP A;  1ALW A;  2M29 A;  5AAN A;  3LVA A;  2GGM A;  4GAO A;  1WDC C;  4ZF4 A;  5H87 A;  2JNF A;  2KBI A;  1A03 A;  1CV7 A;  5AER A;  4XYN A;  3FWB A;  4ZCV A;  1F0B A;  3SRY A;  2ZRT A;  2LMV A;  2PSR A;  1XO5 A;  2LVJ A;  3DQM A;  1JF2 A;  4YI9 A;  1YHI A;  1WRK A;  2EMD A;  1BLQ A;  2QLH A;  2A48 A;  4HRG A;  1ZUX A;  3A8S A;  4IK9 A;  2A47 A;  2F2P A;  4NQG A;  1JC1 A;  3KCT A;  1PK0 D;  1L2O B;  3QRX A;  1QVI Y;  1YUT A;  4W6G A;  1G7K A;  1YX8 A;  5DTX A;  4W6J A;  1W7J B;  4YGA A;  3TMR A;  5DPH A;  1H8B A;  1AVS A;  1EME A;  3SSH A;  2I7A A;  3EKJ A;  1AJ4 A;  1A29 A;  3PJ7 A;  1UIS A;  3BUM B;  3ZNI A;  3ST2 A;  4J89 A;  1BR1 B;  1S6I A;  2BCX A;  3GK2 A;  3CR4 X;  4KW8 A;  1LVC D;  2LMU A;  3CFH A;  1DJG A;  2JUL A;  4PPL A;  4Q7T A;  2WOR A;  3CGL A;  2K0J A;  4JFG A;  2ZN9 A;  1J7O A;  2I2R E;  4KGE A;  3KEV A;  3VK1 A;  3DQ2 A;  5DRF A;  4NDB A;  2JZI A;  1QLK A;  1BOC A;  1KFX L;  1QIV A;  2LLS A;  1SCM C;  1EXR A;  3DQA A;  3EVU A;  4M2P A;  1YX7 A;  2JTT A;  5I2Q A;  4DXP A;  1K2H A;  1SR6 B;  2Y1N A;  5DPG A;  1MF8 B;  1KWO C;  2H2K A;  1JFK A;  1B9A A;  1UHK A;  3NEZ A;  1YUU A;  3JVT C;  1QYF A;  3DQ4 A;  4HRH A;  4GNK B;  3SST A;  2LE9 B;  4GPL B;  4I5N B;  3CGA A;  2H5R A;  5DKN A;  5D69 A;  2LP3 A;  1NYA A;  3OP0 A;  5DY6 A;  3AI4 A;  4PHJ A;  1MYW A;  3MSE B;  1HUY A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  1EJ3 A;  4MLW A;  1DJY A;  4ANJ A;  1S3P A;  3EVP A;  3SSY A;  1SYM A;  4PHN A;  1IGV A;  3VIC A;  5BT0 A;  3E5T A;  2BBM A;  1A75 A;  2Z1O A;  1AJ5 A;  2Z6Y A;  2KAV A;  3BOW B;  3CLN A;  1EMG A;  4DRW A;  2QZ0 A;  1K9U A;  4W6M A;  4NDC A;  3I5I C;  4HVF A;  5IBW A;  1SCV A;  1M39 A;  3SG6 A;  1OOJ A;  5CSJ A;  1LIN A;  1JF0 A;  4EN1 A;  2K7D A;  4N1G A;  4HSZ A;  4W7A A;  4A4C A;  2LUC A;  1B1G A;  2K7C A;  2LC5 A;  3WLD A;  4L9M A;  1Q4D A;  1F55 A;  1U5I B;  3ED8 A;  2GGZ A;  2AUC A;  2OGR A;  1J7P A;  1XA5 A;  2H61 C;  4KA9 A;  1QAS A;  2NCO A;  1NX3 A;  4OVN F;  3DQ1 A;  4DXO A;  3O2P A;  3PJ5 A;  3PSR A;  4W6I A;  3O4Y A;  1QX5 B;  1MXE A;  2Y4Q A;  2WOS A;  1W7T A;  1XQM A;  4DS7 A;  1Y1A A;  1TCO B;  2G3O A;  2HCG A;  2DDC A;  3I5G B;  1EMK A;  3LF3 A;  1RK9 A;  3NXA A;  2KYF A;  2WIQ A;  1CNP A;  2EHB A;  3SG4 A;  2O2B A;  1M63 B;  3CS1 A;  2EC6 B;  3KHE A;  2MLF C;  2KQ6 A;  1HT9 A;  2JU0 A;  5TNC A;  3AKO A;  1NP8 A;  2ISD A;  3TS5 B;  4DIR A;  2Q91 A;  2L5X B;  3PFV A;  2OS8 B;  4CID A;  2G2B A;  1Q4A A;  4XL5 A;  1B7T Z;  5I8N A;  5HZO A;  3LS3 A;  4W7D A;  2DD7 A;  3I5H B;  4P2Y B;  2OJK A;  1YR5 A;  4GUK A;  3U8C A;  3GJ2 A;  5BTT A;  2H5Q A;  2ZNE A;  1Y1X A;  5FYX A;  5LK4 A;  3TDU A;  2PVB A;  1S5G Z;  2QU1 A;  2GW3 A;  3F45 A;  2JRF A;  2EMN A;  4MVF A;  4IK8 A;  3DVE A;  1ZOT B;  3CFA A;  5GQQ C;  3CD9 A;  2HFC A;  4JC2 A;  3LK0 A;  2G5Z B;  2M0R A;  2V4E C;  1IKU A;  4J8A A;  3NSL A;  4W6U A;  1BR4 B;  1H6R A;  1K94 A;  1M46 A;  3SG3 A;  2KFH A;  2KNE A;  1NX1 A;  3BXC A;  3O6B A;  1DGU A;  2Q57 A;  3AAK A;  1XMZ A;  5DQB A;  3NT3 A;  2A4J A;  3WHT B;  3BYA A;  2H61 A;  4ZBL A;  3UG0 A;  1B8C A;  5DTZ A;  2OKY A;  1DGV A;  1CFP A;  2L4H A;  2E30 A;  5BPJ A;  4FQO A;  3TS5 C;  5EB6 A;  1JBY A;  2OS8 C;  5DKQ A;  2LVV A;  2C9I A;  4F0Z B;  4Q7U A;  5HYD A;  4PE4 A;  3M24 A;  3AAJ A;  2M9G A;  4Q9W A;  2FCE A;  2F3Y A;  2AHA A;  2JT3 A;  1K90 D;  2KDH A;  2C9J A;  1Q80 A;  2PXW A;  2OTE A;  1NX2 A;  1QXT A;  2L4I A;  4RYW A;  3BOW A;  3EKH A;  1K8U A;  3TMT A;  3E5V A;  3SVD A;  4EDO A;  3I5F B;  4HQ8 A;  1HCJ A;  1ZAC A;  3GJ1 A;  5AQB B;  1WDC B;  3IR8 A;  1NIW A;  2ZMW A;  4MRX A;  2BCA A;  1OZS A;  1TTX A;  3SV5 A;  4KEX A;  4IK1 A;  4FTG A;  4R6D A;  3SG7 A;  4KPI A;  4GGF C;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  2ZKM X;  2HET A;  1KSO A;  2K7B A;  4BY4 A;  3NT9 A;  4W7X A;  2BEC A;  2CNP A;  5I2O A;  1SRA A;  1CM1 A;  5HKW A;  1QVI Z;  1YVL A;  3DQ5 A;  4J88 A;  3DPX A;  3BUO B;  4MZK A;  4AOM A;  5DTL A;  2V4E A;  1KYS A;  4ORB B;  2ARL A;  1MOU A;  4OKH A;  2HQW A;  4TNC A;  2I94 A;  1XFZ O;  4W76 A;  2LM5 A;  3ZTF A;  3BXA A;  2H5O A;  3M0W A;  2PRU A;  3DVK A;  2B1U A;  4CLN A;  1PVA A;  1KK7 Y;  2MAZ A;  1Q4E A;  4YGB B;  1XFX O;  4ZIO A;  4WQ3 A;  3I5F C;  1OXF A;  3W1C A;  3G9A A;  4KAG A;  3LCP C;  4KF4 A;  2ZFD A;  3CTN A;  3NSK A;  3DQC A;  4OCI A;  3CR5 X;  1QX7 A;  1SCM B;  2KGR A;  3LK1 A;  2A54 B;  2LHL A;  1YHG A;  1B47 A;  5HBD A;  2G16 B;  4W6R A;  2CTN A;  4JWQ A;  3W1D A;  1KWO B;  2JC2 A;  1W7U A;  1MR8 A;  2MRD A;  1KQV A;  1GGX A;  5HZS A;  1Q73 A;  2B3P A;  1C4F A;  1F54 A;  1S6J A;  2ZO6 A;  3OX5 A;  1YJF A;  1F4Q A;  3JVT B;  4PPJ A;  3DPW A;  4PFE A;  1DJZ A;  1TNP A;  1W7S A;  4RTC A;  3IQO A;  5K89 A;  5HKZ A;  1QY3 A;  1YUS A;  2FZU A;  3ZWH A;  4GGF A;  4W72 A;  1S36 A;  5DPI A;  3DQ7 A;  1CKK A;  3ZUJ A;  1C7V A;  1S26 D;  2LLT A;  3CR2 A;  4HQC A;  4W7F A;  2OPO A;  4QJ5 B;  2KI6 D;  3VRO A;  1QYO A;  3BXB A;  4YGE B;  4C0J A;  2P4M A;  5BTT B;  4CFQ A;  1EH2 A;  4Z4K A;  3DQL A;  5H88 A;  4W7E A;  4HE4 A;  4QJ4 B;  1W7I B;  2YDZ A;  3ZUF A;  1C07 A;  3AKA A;  1LKJ A;  3I5I B;  4YBH B;  4L12 A;  2IB5 A;  3CZT X;  1KK8 C;  1QIW A;  1KQM C;  1BMO A;  3VRQ A;  2WHU A;  5PAL A;  3SVB A;  1Z1Q A;  1RM9 A;  3WXA A;  4P1Q A;  2QAC A;  3HX4 A;  1Q4C A;  4MZJ A;  3BXK A;  1SKT A;  2MLE C;  4PE1 A;  2JOJ A;  4W7C A;  2R2I A;  4DKM A;  2QLI A;  2BCB A;  4LW5 A;  4ETO A;  3DQ6 A;  4KW9 A;  2VVJ A;  1S6Z A;  3E5W A;  4W6D A;  1MQ1 A;  1BF5 A;  1CLB A;  1OMD A;  4CFR A;  2GW4 B;  2Y1M A;  2L51 A;  4DKN A;  1WRZ A;  3TZ1 A;  3ADF A;  1NCX A;  1TRF A;  1SW8 A;  2NXQ A;  1EL4 A;  2LVI A;  1JWD A;  4I2Y A;  2KFF A;  3CFF A;  2LLU A;  3VRR A;  5FVF A;  4IL1 A;  2PXS A;  4IK4 A;  4PPK A;  2D8N A;  2VVI A;  2IB6 A;  2KQY A;  4Q9X A;  1CFF A;  2ZN8 A;  2SAS A;  1AK8 A;  4W6O A;  2AWJ A;  2O60 A;  3EVR A;  2JQ6 A;  2L0P A;  2KBM A;  1TIZ A;  3FWC A;  3DQK A;  5CSI A;  2K7O A;  2WHT A;  1YHH A;  1XSS A;  2G6E A;  2HF5 A;  1Q4B A;  3H4S E;  4H47 A;  5HLO A;  3D0Y A;  2Y5I A;  2HQK A;  3U0L A;  3E3R A;  1Y1U A;  4M2Q A;  3KF9 A;  1OSA A;  3SG2 A;  1OMR A;  2DUG A;  1J55 A;  1RJV A;  2K8M B;  1SNL A;  4DXM A;  1PVB A;  2ZMU A;  4KF5 C;  2M49 B;  1ZMZ A;  2TN4 A;  2V4E B;  3DPZ A;  4JQ0 D;  1IWQ A;  1NPQ A;  2LV7 A;  2FCD A;  2DUE A;  4W6B A;  5DPJ A;  3ZUL A;  4W75 A;  2WCE A;  2M3W A;  1EMF A;  1LA3 A;  3DQO A;  4YRU A;  3GK1 A;  3CBE A;  2G6Y A;  4XOV A;  1BG1 A;  1IJ5 A;  1DMO A;  4IZN A;  3WCK A;  2GV5 A;  3IF7 A;  3DD4 A;  4P76 A;  1ZUZ A;  4E68 A;  1SMG A;  1CM4 A;  4WRI A;  1XFV O;  1SY9 A;  4W6F A;  4XVP A;  5HW9 A;  2KSP A;  3LVD A;  1ZFS A;  1UHN A;  4EMQ A;  5ER5 A;  2Q4U A;  2SCP A;  3PAT A;  1EML A;  3DQN A;  2DOQ A;  2K2A A;  2OTG B;  2CT9 A;  2OTB A;  3SSL A;  4BY5 A;  1SL8 A;  1FI6 A;  4PAL A;  3TUY C;  3DVM A;  1RRO A;  1UHI A;  1N65 A;  1DJI A;  2OKW A;  2COL B;  2AMI A;  4W6L A;  2A53 B;  1XFY O;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  1G4Y R;  1UHH A;  4L13 A;  2A52 B;  4OY4 A;  1JUO A;  2E6W A;  2G2S B;  1DJX A;  2DUH A;  4PHK A;  4ZCU A;  5AEQ A;  5KSZ A;  1H4U A;  4W6C A;  1B4C A;  2POX A;  4AQI A;  1HQV A;  1XAE A;  1CDM A;  4Q7R A;  3DVJ A;  4U2V A;  3EK8 A;  3U0K A;  1UP5 A;  2M8U A;  1CTR A;  4KF5 A;  3OB1 B;  3DQH A;  1BOD A;  3H1O A;  3WNX B;  2KI6 C;  3GK4 X;  1XVJ A;  3OSR A;  2A56 B;  2BE4 A;  4UPG A;  2Q6P A;  2K61 A;  2OTG C;  2H8Q A;  1XA9 A;  1NUB A;  2PMY A;  3U0N A;  3ST0 A;  1GGW A;  4YGC B;  2CXJ A;  1SL7 A;  3TDZ A;  1EMC A;  5H89 A;  4HRE E;  4GES B;  4JF9 A;  1CLL A;  1JFJ A;  1RMO A;  1S1E A;  3OB2 B;  1Z1P A;  2NLN A;  4ZB1 A;  3DF0 B;  1OXD A;  3WHU B;  1KK7 Z;  4ORA B;  2BL0 C;  2KYC A;  4ZFS A;  4YGD B;  1D1O A;  2F33 A;  2WSO A;  3PIB A;  3RM1 A;  1EMM A;  4IK5 A;  4LQU A;  3M22 A;  1F09 A;  5JOL A;  2WC8 A;  4I5J A;  3EK4 A;  4ZF3 A;  3AI5 A;  1AP4 A;  1RMP A;  2AWM A;  1TN4 A;  1LA0 A;  1J7Q A;  2F2O A;  2LP2 A;  2P6B B;  4W6P A;  3KO0 A;  3NSI A;  4PCW A;  2KGB C;  1QJT A;  3A8R A;  1PSR A;  2EGD A;  1OXE A;  4H3N A;  4PHM A;  1EMA A;  1QYQ A;  5EHU A;  5AFP A;  2JNX A;  1J1D A;  2NZ0 A;  3NF0 A;  2AWL A;  2ZO7 A;  1UUR A;  2BKI B;  4ICB A;  1GQM A;  4DXN A;  2RH7 A;  2M97 A;  2MBX A;  3TDI A;  2DUF A;  2NCP A;  3BUN B;  3D0Y B;  4LJD C;  3EK7 A;  3OSQ A;  3O78 A;  1WRL A;  1K9K A;  5HGE A;  4W69 A;  3CB9 A;  3DQF A;  4XJK B;  1SPY A;  2JT0 A;  1NCY A;  5LTQ A;  2QT2 A;  1OZO A;  1K9P A;  1YRT B;  2WND A;  1KK8 B;  1MUX A;  1GL4 A;  1G8I A;  1OE9 B;  1KQM B;  5F9G A;  1NX0 A;  3KPX A;  1CFC A;  5D7F A;  3DQ3 A;  1QXP A;  4W6A A;  5EJU A;  5FHV A;  5B8I B;  3SVS A;  1KFU S;  1PUL A;  2JTZ A;  2LUX A;  2IOV A;  4XGY A;  2BBN A;  2KI4 C;  2LHI A;  4XOW A;  4OR9 B;  3JTD C;  3P28 A;  1CB1 A;  2FL1 A;  4MN0 A;  2O24 A;  1DTL A;  2O5G A;  1MHO A;  2WCF A;  1JSA A;  2Y0G A;  2DUI A;  3BQ3 A;  3SSP A;  3SSK A;  2JXL A;  4DCK A;  5FVI A;  2MA2 A;  1DVI A;  3PM8 A;  4GOB A;  2EMO A;  2IS9 A;  4OHS A;  3BUW B;  2G3D B;  1JBA A;  2O29 A;  2M7N A;  2IE2 A;  4C0L A;  1TCF A;  4USL A;  3RWA A;  2VAD A;  4W6H A;  4N3D A;  4NDD A;  2K2F A;  4N5X A;  3SIB A;  3A4U B;  4M2O A;  1DT7 B;  4LQT A;  3DQ8 A;  1C7W A;  3C1V A;  3U0M A;  1ZGP A;  4HQ9 A;  1R2U A;  3GL4 A;  3KCS A;  5DTY A;  3RWT A;  5G08 A;  3DQD A;  1JBZ A;  2KFG A;  1IG5 A;  1EG3 A;  4GFT A;  1ALV A;  3EVV A;  3LL8 B;  2HRS A;  5KTG A;  3S05 A;  1YUR A;  2WCB A;  2FWQ A;  2CBL A;  3LVC A;  4EDS A;  4W6K A;  3DQJ A;  3DF0 A;  4R1E A;  3PJB A;  4OV2 A;  4LJD A;  1ZGO A;  2H6V A;  1X02 A;  1G33 A;  5HZT A;  4OJ0 A;  2QLG B;  4W74 A;  2HGD A;  1TNQ A;  1L7Z A;  2DDD A;  1RRX A;  3GOF A;  5EBJ A;  2VAE A;  4N1F A;  3FS7 A;  5J2O A;  3IQQ A;  3U8A A;  1L2O C;  1GFL A;  3IP2 A;  2DD9 A;  1DJH A;  4C0K A;  4W77 A;  2G6X A;  1VRK A;  2A50 B;  1YJ2 A;  1UWO A;  1FF1 A;  5CSN A;  2M1U A;  3VRN A;  4TZA A;  3ST3 A;  1QTX A;  4I5K A;  2G9B A;  4ZF5 A;  3LLE A;  1OQP A;  1N2D A;  1F71 A;  1JC0 A;  2H9W A;  5DRG A;  3CWG A;  2JXC A;  1DF0 A;  3BX9 A;  1IH0 A;  4B5Y A;  1UUS A;  1NWD A;  1RWY A;  1NSH A;  2Z6X A;  4NWS A;  4DXQ A;  3VRP A;  4RYS A;  4QJ3 B;  2JPT A;  1SL9 A;  2F3Z A;  4Q04 A;  2LVK A;  1SBJ A;  1H4B A;  3SIA A;  3TUY B;  5KTY A;  1WLZ A;  1ZGQ A;  2FOT A;  1YVH A;  1F70 A;  4W6S A;  3SVC A;  2Z6Z A;  3VHT B;  2ZRS A;  1M31 A;  4EUL A;  4B30 A;  1RTP 1;  4XJK A;  2I18 A;  3P8U A;  2HJO A;  1Y6W A;  3SS0 A;  3LSA A;  1SR6 C;  1FBV A;  1KFU L;  4W6T A;  1IJ6 A;  4CPV A;  1YTZ C;  3PAL A;  3CD1 A;  4MRY A;  4LJB A;  2F8P A;  2HQ8 A;  1PAL A;  2JT8 A;  2KAX A;  3K21 A;  4MEW A;  2HPW A;  1UHJ A;  2QRF A;  5BQL A;  1BFP A;  4ORC B;  1CMG A;  1KYR A;  4TZG A;  1XK4 C;  3U8P A;  1QLS A;  4LJC A;  1AHR A;  2VZX A;  1SK6 D;  2V53 A;  3AKB A;  4R6B A;  3OX6 A;  4H3M A;  2WIS A;  1GJY A;  1F4O A;  1V1F A;  2LAN A;  3MGF A;  1B8R A;  3DQI A;  4W73 A;  3RLZ A;  5CSF A;  1TOP A;  1GGZ A;  5HZU A;  1NCZ A;  1CFD A;  1R6P A;  3DQ9 A;  4D1E A;  3SJS A;  4JPZ B;  4MBE A;  3OHM B;  5JJG A;  2LCP A;  2BKH B;  2WHS A;  2LNK A;  4ORN A;  1MWN A;  2PAS A;  4U8D A;  4A4B A;  1BT6 A;  1B9C A;  1IRJ A;  3DQE A;  2BL0 B;  3DQU A;  1E8A A;  1M45 A;  2VVH A;  3V3D A;  1WLM A;  2HQZ A;  2LMT A;  1CDP A;  3I19 A;  1CMF A;  3FIA A;  1KYP A;  4YI8 A;  3ST4 A;  1OMV A;  2FJU B;  4KW4 A;  4GBA A;  1XFU O;  1EG4 A;  3SVN A; 
#chains in the Genus database with same CATH topology
 1W9Z A;  1YRU B;  3SVR A;  4PE7 A;  3LF4 B;  2QLG A;  5F6T A;  1RMM A;  2LAP A;  3PN7 B;  4H48 A;  2GX2 A;  2K60 A;  1EMB A;  3S0A A;  1DEL A;  3I5G C;  3SVO A;  4DXI A;  4AQJ A;  3NSO A;  4Z4M A;  3SVE A;  3VGO A;  2M7L A;  1K96 A;  1A4P A;  2AH8 A;  5LTP A;  1K95 A;  1KSM A;  2RGI A;  2EC6 C;  4UTS A;  3H1R A;  2JWW A;  5ER4 X;  4PE0 A;  4IK3 A;  5J3X A;  3NED A;  4AS8 A;  5HKY A;  1QS7 A;  1F8H A;  1ODB A;  3K1K A;  2KAY A;  1FI5 A;  5EB7 A;  3CZ2 A;  4BDU A;  1B7T Y;  2BTJ A;  1XK4 A;  5KU1 A;  2JAD A;  5DU0 A;  2QLE A;  5EXB A;  2CCM A;  3BUX B;  2A46 A;  5FVG A;  3DYE A;  1A2X A;  4OQW A;  3WLC A;  3I5H C;  2HGY A;  1CDN A;  1Y0V H;  4JGE A;  1J1E A;  2L50 A;  3DXL A;  2VRG A;  4W6N A;  1PRW A;  4GF6 B;  2WUR A;  3SSV A;  1KFX S;  4PDZ A;  3RZS A;  4MZL A;  3SVU A;  1CLM A;  1REC A;  1S5G Y;  1QAT A;  3GEX A;  2H5P A;  4GGN A;  4WQ2 A;  1IQ3 A;  2L2C A;  3SG5 A;  1RFJ A;  4P5O E;  2YE0 A;  1IIO A;  1TWO A;  1KP5 A;  2QPT A;  2WSN A;  5LTR A;  4ZIN A;  1QV1 A;  1J7R A;  5AXI A;  3VHT A;  2YE1 A;  1XYD A;  3PN7 C;  4W7R A;  4L1I A;  1MOV A;  2MHH A;  2KI4 B;  1BJF A;  2L98 A;  3ICB A;  3PLF B;  3GB3 A;  4JEO A;  1DJW A;  1WY9 A;  3JTD B;  2PAL A;  2PQL A;  5T3I A;  1U5I A;  5EXU A;  2B3Q A;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  1YZW A;  1DF0 B;  3UFZ A;  1KCY A;  2KOT A;  4DUQ A;  2L2E A;  1B8L A;  4JRB A;  2AWK A;  1S6C A;  1AUI B;  3D75 A;  1A75 B;  4I5L B;  3O77 A;  3D10 A;  1FPW A;  3DY9 A;  1IQ5 A;  3R72 A;  4H3L A;  1TNW A;  2KHN A;  2GX0 A;  1TNX A;  3HCM A;  1QV0 A;  4AR7 A;  2ICR A;  2MJW B;  4OGS A;  3OGO A;  4KGF A;  1CDL A;  3LA1 A;  1JC2 A;  5DKR A;  5EXC I;  4B30 B;  1XFW O;  2M1K B;  5DQM A;  2ZND A;  1YFP A;  2YFP A;  1ALW A;  2M29 A;  2WCM A;  3S0E A;  5AAN A;  3LVA A;  2GGM A;  4GAO A;  2FJY A;  1WDC C;  4ZF4 A;  5H87 A;  2JNF A;  2KBI A;  1A03 A;  1CV7 A;  5AER A;  4XYN A;  3FWB A;  3CDN A;  4ZCV A;  1F0B A;  3SRY A;  2ZRT A;  2LMV A;  2PSR A;  1XO5 A;  2LVJ A;  3DQM A;  1JF2 A;  4YI9 A;  1YHI A;  1WRK A;  2EMD A;  1BLQ A;  2QLH A;  2A48 A;  4HRG A;  1ZUX A;  3D77 A;  3A8S A;  4IK9 A;  2A47 A;  2F2P A;  4NQG A;  1JC1 A;  3KCT A;  1PK0 D;  1L2O B;  3QRX A;  1QVI Y;  1YUT A;  4W6G A;  1G7K A;  1YX8 A;  5DTX A;  4W6J A;  1W7J B;  4YGA A;  3TMR A;  5DPH A;  1H8B A;  1AVS A;  1EME A;  3SSH A;  2I7A A;  3EKJ A;  1AJ4 A;  1A29 A;  3PJ7 A;  1UIS A;  3BUM B;  3ZNI A;  3S0F A;  3OGN A;  3ST2 A;  4J89 A;  1BR1 B;  1S6I A;  2BCX A;  3GK2 A;  3L4L A;  3CR4 X;  4KW8 A;  1LVC D;  2LMU A;  3CFH A;  1DJG A;  2JUL A;  4PPL A;  3FE9 A;  4Q7T A;  2WOR A;  3CGL A;  2K0J A;  4JFG A;  2ZN9 A;  1J7O A;  2I2R E;  4KGE A;  3R1V A;  3KEV A;  3VK1 A;  3DQ2 A;  1ORG A;  5DRF A;  4NDB A;  2JZI A;  1QLK A;  1BOC A;  1KFX L;  1QIV A;  2LLS A;  1SCM C;  1EXR A;  3DQA A;  3EVU A;  4M2P A;  1YX7 A;  2JTT A;  5I2Q A;  4DXP A;  1K2H A;  1SR6 B;  2Y1N A;  5DPG A;  1MF8 B;  1KWO C;  2H2K A;  1JFK A;  1B9A A;  1UHK A;  3NEZ A;  1YUU A;  3JVT C;  1QYF A;  3DQ4 A;  4HRH A;  4GNK B;  3SST A;  2LE9 B;  1DEK A;  4GPL B;  4I5N B;  3CGA A;  2H5R A;  5DKN A;  5D69 A;  2LP3 A;  1NYA A;  3OP0 A;  5DY6 A;  3AI4 A;  4PHJ A;  1MYW A;  3MSE B;  1HUY A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  3VB1 A;  1EJ3 A;  4MLW A;  1DJY A;  4ANJ A;  3K1E A;  1S3P A;  3Q8I A;  2L5Y A;  3EVP A;  3SSY A;  1SYM A;  4PHN A;  1IGV A;  3VIC A;  3SS4 A;  5BT0 A;  3E5T A;  2BBM A;  1A75 A;  2Z1O A;  1AJ5 A;  2Z6Y A;  2KAV A;  3BOW B;  3CLN A;  1EMG A;  4DRW A;  1OOF A;  2QZ0 A;  1K9U A;  4W6M A;  4NDC A;  3I5I C;  4HVF A;  5IBW A;  1SCV A;  1M39 A;  3SG6 A;  4JD9 A;  1OOJ A;  5CSJ A;  1LIN A;  1JF0 A;  4EN1 A;  2K7D A;  4N1G A;  4HSZ A;  4W7A A;  4A4C A;  2LUC A;  2KPH A;  1B1G A;  2K7C A;  2LC5 A;  3WLD A;  4L9M A;  1Q4D A;  1F55 A;  1U5I B;  3ED8 A;  2GGZ A;  2AUC A;  2OGR A;  1J7P A;  1XA5 A;  2H61 C;  4KA9 A;  1SSE B;  1QAS A;  2NCO A;  1NX3 A;  4OVN F;  3DQ1 A;  4DXO A;  3O2P A;  3PJ5 A;  3PSR A;  4W6I A;  3O4Y A;  1QX5 B;  1MXE A;  2Y4Q A;  2WOS A;  1W7T A;  1XQM A;  4DS7 A;  1Y1A A;  1TCO B;  2G3O A;  2HCG A;  2DDC A;  5HL1 A;  3I5G B;  3QME A;  1EMK A;  3LF3 A;  1RK9 A;  3NXA A;  2KYF A;  2WIQ A;  1CNP A;  2EHB A;  3SG4 A;  2O2B A;  1M63 B;  3CS1 A;  2EC6 B;  3KHE A;  2MLF C;  2KQ6 A;  1HT9 A;  2JU0 A;  5TNC A;  3CAB A;  3AKO A;  1NP8 A;  2ISD A;  3TS5 B;  4DIR A;  2Q91 A;  2L5X B;  3PFV A;  2OS8 B;  4CID A;  2G2B A;  1Q4A A;  4XL5 A;  1B7T Z;  5I8N A;  5HZO A;  3LS3 A;  4W7D A;  2DD7 A;  3I5H B;  4P2Y B;  2OJK A;  1YR5 A;  4GUK A;  3U8C A;  3GJ2 A;  5BTT A;  2H5Q A;  2ZNE A;  1Y1X A;  5FYX A;  5LK4 A;  3TDU A;  3IVT A;  2PVB A;  1S5G Z;  2QU1 A;  2GW3 A;  3F45 A;  1TUJ A;  2JRF A;  2EMN A;  4MVF A;  4IK8 A;  3DVE A;  1ZOT B;  3CFA A;  5GQQ C;  3CD9 A;  2HFC A;  4JC2 A;  3LK0 A;  2G5Z B;  2M0R A;  2V4E C;  1IKU A;  4J8A A;  3NSL A;  4W6U A;  1BR4 B;  1H6R A;  1K94 A;  1M46 A;  3SG3 A;  2KFH A;  2KNE A;  1NX1 A;  3BXC A;  3O6B A;  1DGU A;  2Q57 A;  3AAK A;  1XMZ A;  5DQB A;  3NT3 A;  2A4J A;  3WHT B;  3BYA A;  3FE8 A;  2H61 A;  4ZBL A;  3UG0 A;  1B8C A;  5DTZ A;  1C3Y A;  2OKY A;  1DGV A;  1CFP A;  2L4H A;  2E30 A;  5BPJ A;  4FQO A;  3TS5 C;  5EB6 A;  1JBY A;  2OS8 C;  5DKQ A;  2LVV A;  2C9I A;  4F0Z B;  4Q7U A;  5HYD A;  3B87 A;  4PE4 A;  3M24 A;  3AAJ A;  2M9G A;  3L4A A;  4Q9W A;  2FCE A;  2F3Y A;  2AHA A;  2JT3 A;  1K90 D;  2KDH A;  2C9J A;  1Q80 A;  2PXW A;  2OTE A;  1NX2 A;  1QXT A;  2L4I A;  4RYW A;  3BOW A;  3EKH A;  1K8U A;  3TMT A;  3E5V A;  3SVD A;  4EDO A;  3I5F B;  4HQ8 A;  1HCJ A;  1ZAC A;  3GJ1 A;  5AQB B;  1WDC B;  3SS3 A;  3IR8 A;  1NIW A;  2ZMW A;  4MRX A;  2BCA A;  1TUZ A;  2QEB A;  1OZS A;  1TTX A;  3SV5 A;  4KEX A;  4IK1 A;  4FTG A;  4R6D A;  3SG7 A;  4KPI A;  4GGF C;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  2ZKM X;  2HET A;  1OOG A;  1KSO A;  2K7B A;  4BY4 A;  4FQT A;  3NT9 A;  4W7X A;  5FI7 A;  2BEC A;  2CNP A;  5I2O A;  1SRA A;  1CM1 A;  5HKW A;  1QVI Z;  1YVL A;  3DQ5 A;  4J88 A;  3DPX A;  3BUO B;  4MZK A;  4AOM A;  5DTL A;  2V4E A;  1GM0 A;  1KYS A;  4ORB B;  3BJH A;  2ARL A;  2KLE A;  1MOU A;  1XFR A;  4OKH A;  2HQW A;  4TNC A;  2I94 A;  1XFZ O;  4W76 A;  2LM5 A;  3ZTF A;  3BXA A;  2H5O A;  3BFH A;  3M0W A;  2PRU A;  3DVK A;  2B1U A;  4CLN A;  1PVA A;  1KK7 Y;  2MAZ A;  1Q4E A;  4YGB B;  1XFX O;  4ZIO A;  4WQ3 A;  3I5F C;  1OXF A;  3W1C A;  3G9A A;  4KAG A;  2P71 A;  3LCP C;  4KF4 A;  2ZFD A;  3CTN A;  3NSK A;  3DQC A;  4OCI A;  3CR5 X;  1QX7 A;  1SCM B;  2KGR A;  3LK1 A;  2A54 B;  1OW4 A;  2LHL A;  1YHG A;  1B47 A;  5HBD A;  2G16 B;  4PT1 A;  4W6R A;  2CTN A;  4JWQ A;  3W1D A;  1KWO B;  2JC2 A;  1W7U A;  1MR8 A;  1P28 A;  2MRD A;  1KQV A;  1GGX A;  5HZS A;  1Q73 A;  2B3P A;  1C4F A;  1F54 A;  1S6J A;  2ZO6 A;  3OX5 A;  1YJF A;  1F4Q A;  3JVT B;  4PPJ A;  3DPW A;  4PFE A;  1DJZ A;  1TNP A;  1W7S A;  4RTC A;  1OOI X;  3IQO A;  5K89 A;  5HKZ A;  1QY3 A;  1YUS A;  2FZU A;  3ZWH A;  1DQE A;  4GGF A;  4W72 A;  3PJI A;  1S36 A;  5DPI A;  3DQ7 A;  1CKK A;  3ZUJ A;  1C7V A;  1S26 D;  2LLT A;  3CR2 A;  4HQC A;  4W7F A;  2OPO A;  4QJ5 B;  2KI6 D;  3VRO A;  1QYO A;  3BXB A;  4YGE B;  4C0J A;  2P4M A;  5BTT B;  4CFQ A;  1EH2 A;  3D74 A;  4Z4K A;  2ERB A;  3DQL A;  5H88 A;  4W7E A;  4HE4 A;  4QJ4 B;  1W7I B;  2YDZ A;  3ZUF A;  1C07 A;  3AKA A;  1LKJ A;  3I5I B;  4YBH B;  4L12 A;  2IB5 A;  3CZT X;  1KK8 C;  1QIW A;  1KQM C;  1BMO A;  3VRQ A;  2WHU A;  5PAL A;  3SVB A;  1Z1Q A;  1RM9 A;  3WXA A;  4P1Q A;  2QAC A;  3HX4 A;  1Q4C A;  4MZJ A;  3BXK A;  1SKT A;  2MLE C;  4PE1 A;  2JOJ A;  4W7C A;  3N7H A;  2R2I A;  4DKM A;  2QLI A;  2BCB A;  4LW5 A;  4ETO A;  3DQ6 A;  4KW9 A;  2VVJ A;  1S6Z A;  3E5W A;  4W6D A;  1MQ1 A;  1BF5 A;  1CLB A;  1OMD A;  4CFR A;  2GW4 B;  2Y1M A;  2L51 A;  4DKN A;  1WRZ A;  3TZ1 A;  3ADF A;  1NCX A;  1TRF A;  1SW8 A;  2NXQ A;  1OOH A;  1EL4 A;  2LVI A;  1JWD A;  3B88 A;  4I2Y A;  2KFF A;  3CFF A;  2LLU A;  3VRR A;  5FVF A;  4IL1 A;  2PXS A;  4IK4 A;  4PPK A;  2D8N A;  2VVI A;  2IB6 A;  2H8V A;  2KQY A;  4Q9X A;  3OBV A;  1CFF A;  2ZN8 A;  2SAS A;  1AK8 A;  4W6O A;  2AWJ A;  2O60 A;  3EVR A;  2JQ6 A;  2L0P A;  2KBM A;  1TIZ A;  3FWC A;  3DQK A;  5CSI A;  2K7O A;  2WHT A;  1YHH A;  1XSS A;  2G6E A;  2HF5 A;  1Q4B A;  3H4S E;  4H47 A;  3S0D A;  5HLO A;  3D0Y A;  5EL2 A;  2Y5I A;  2HQK A;  3U0L A;  3E3R A;  1Y1U A;  4M2Q A;  3KF9 A;  1OSA A;  3SG2 A;  1OMR A;  2DUG A;  1J55 A;  1RJV A;  2K8M B;  1SNL A;  4DXM A;  1PVB A;  2ZMU A;  4KF5 C;  2M49 B;  1ZMZ A;  2TN4 A;  2V4E B;  3DPZ A;  4JQ0 D;  1IWQ A;  1NPQ A;  3S0G A;  2LV7 A;  2FCD A;  2DUE A;  4W6B A;  5DPJ A;  3ZUL A;  4W75 A;  2WCE A;  2M3W A;  1EMF A;  1LA3 A;  3DQO A;  4YRU A;  3GK1 A;  3CBE A;  2G6Y A;  4XOV A;  1QWV A;  1BG1 A;  1IJ5 A;  1DMO A;  4IZN A;  3WCK A;  2GV5 A;  3IF7 A;  4OZD A;  3DD4 A;  4P76 A;  1ZUZ A;  4E68 A;  1SMG A;  1CM4 A;  4WRI A;  1XFV O;  1SY9 A;  5DIC A;  4W6F A;  4XVP A;  5HW9 A;  2KSP A;  3LVD A;  4JKT A;  1ZFS A;  1UHN A;  4EMQ A;  5ER5 A;  2Q4U A;  2SCP A;  3PAT A;  1EML A;  3DQN A;  3B7A A;  2DOQ A;  2K2A A;  2OTG B;  2CT9 A;  2OTB A;  3SSL A;  4BY5 A;  1SL8 A;  1FI6 A;  4PAL A;  3TUY C;  3DVM A;  1RRO A;  1UHI A;  1DC1 A;  1N65 A;  1DJI A;  2OKW A;  2COL B;  2KLD A;  2AMI A;  4W6L A;  2A53 B;  1XFY O;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  1G4Y R;  1UHH A;  4L13 A;  2A52 B;  4OY4 A;  1JUO A;  2E6W A;  2G2S B;  1DJX A;  2DUH A;  4PHK A;  4ZCU A;  5AEQ A;  5KSZ A;  1H4U A;  4W6C A;  1B4C A;  2POX A;  4AQI A;  1HQV A;  1XAE A;  1CDM A;  1LS8 A;  1Z2C B;  4Q7R A;  3DVJ A;  4U2V A;  3EK8 A;  3U0K A;  1UP5 A;  2M8U A;  1CTR A;  4KF5 A;  3OB1 B;  3DQH A;  1BOD A;  3H1O A;  3WNX B;  2KI6 C;  3GK4 X;  1XVJ A;  3OSR A;  2A56 B;  2BE4 A;  4UPG A;  2Q6P A;  2K61 A;  2OTG C;  2H8Q A;  1XA9 A;  1NUB A;  2PMY A;  3U0N A;  3ST0 A;  1GGW A;  4YGC B;  2CXJ A;  1SL7 A;  3TDZ A;  1EMC A;  5H89 A;  4HRE E;  4GES B;  2YGU A;  4JF9 A;  3PM2 A;  1CLL A;  1JFJ A;  1RMO A;  1S1E A;  3OB2 B;  1Z1P A;  2NLN A;  4ZB1 A;  3DF0 B;  1OXD A;  3V2L A;  3WHU B;  1KK7 Z;  4ORA B;  2BL0 C;  2KYC A;  4ZFS A;  3D76 A;  4YGD B;  1D1O A;  2F33 A;  2WSO A;  3PIB A;  3RM1 A;  1EMM A;  4IK5 A;  4LQU A;  3M22 A;  1F09 A;  5JOL A;  2WC8 A;  4I5J A;  3EK4 A;  5D3O A;  4ZF3 A;  3AI5 A;  1AP4 A;  3UNW A;  1RMP A;  2AWM A;  1TN4 A;  1LA0 A;  1J7Q A;  2F2O A;  2LP2 A;  2P6B B;  4W6P A;  3KO0 A;  3NSI A;  4PCW A;  2KGB C;  1QJT A;  3A8R A;  1PSR A;  2EGD A;  1OXE A;  4H3N A;  4PHM A;  2QEH A;  2BAP A;  1EMA A;  1QYQ A;  5EHU A;  5AFP A;  2JNX A;  1J1D A;  2NZ0 A;  3NF0 A;  2AWL A;  2ZO7 A;  1UUR A;  2BKI B;  4ICB A;  1GQM A;  4DXN A;  2RH7 A;  2M97 A;  2MBX A;  4F7F A;  2PYQ A;  3TDI A;  2DUF A;  2NCP A;  3BUN B;  3D0Y B;  4LJD C;  3EK7 A;  3OSQ A;  3O78 A;  1WRL A;  1K9K A;  5HGE A;  4W69 A;  3B86 A;  3CB9 A;  3DQF A;  3FE6 A;  4XJK B;  1SPY A;  4KYN A;  2JT0 A;  1NCY A;  5LTQ A;  2QT2 A;  1OZO A;  1K9P A;  1YRT B;  2WND A;  3DZT A;  1KK8 B;  1MUX A;  1GL4 A;  1G8I A;  1OE9 B;  1KQM B;  5F9G A;  1NX0 A;  3KPX A;  1CFC A;  5D7F A;  3DQ3 A;  1QXP A;  4W6A A;  5EJU A;  5FHV A;  3CYZ A;  5B8I B;  3SVS A;  1KFU S;  1PUL A;  2QEO A;  3BFA A;  2JTZ A;  2LUX A;  2IOV A;  4XGY A;  2BBN A;  2KI4 C;  2LHI A;  4XOW A;  4OR9 B;  3JTD C;  3P28 A;  1CB1 A;  2FL1 A;  2WC5 A;  4MN0 A;  2O24 A;  3O4X A;  1DTL A;  2O5G A;  3NHT A;  1MHO A;  2WCF A;  2WCJ A;  1JSA A;  2Y0G A;  2DUI A;  3BQ3 A;  3SSP A;  3SSK A;  3D78 A;  2JXL A;  4DCK A;  5FVI A;  2MA2 A;  1Z4H A;  2QDI A;  1DVI A;  3PM8 A;  4GOB A;  2EMO A;  2IS9 A;  4OHS A;  3BUW B;  1T14 A;  4INX A;  2G3D B;  1JBA A;  2O29 A;  2M7N A;  3CZ0 A;  2IE2 A;  4C0L A;  1TCF A;  4USL A;  3RWA A;  2VAD A;  4W6H A;  4N3D A;  4NDD A;  2K2F A;  4N5X A;  4INW A;  3SIB A;  3A4U B;  4M2O A;  1DT7 B;  4LQT A;  3DQ8 A;  1C7W A;  3C1V A;  3U0M A;  3UO9 A;  1ZGP A;  4HQ9 A;  4IJ7 A;  1R2U A;  3GL4 A;  3KCS A;  5DTY A;  5I94 A;  3RWT A;  5G08 A;  3DQD A;  1JBZ A;  2KFG A;  1IG5 A;  1EG3 A;  4GFT A;  5FI2 A;  1ALV A;  3EVV A;  3LL8 B;  2HRS A;  5KTG A;  3S05 A;  3CZ1 A;  1YUR A;  2WCB A;  2FWQ A;  2CBL A;  3LVC A;  4EDS A;  3EG5 B;  4W6K A;  3DQJ A;  3DF0 A;  4R1E A;  3PJB A;  4OV2 A;  4LJD A;  1ZGO A;  2H6V A;  1X02 A;  1G33 A;  5HZT A;  4OJ0 A;  2QLG B;  4W74 A;  2HGD A;  1TNQ A;  1L7Z A;  2DDD A;  1RRX A;  3GOF A;  5EBJ A;  2VAE A;  4N1F A;  3FS7 A;  2WCK A;  5J2O A;  3IQQ A;  3U8A A;  1L2O C;  1GFL A;  3BFB A;  3IP2 A;  2DD9 A;  1DJH A;  2WCH A;  4C0K A;  4W77 A;  2G6X A;  1VRK A;  2A50 B;  1YJ2 A;  1UWO A;  1FF1 A;  2P70 A;  5CSN A;  2M1U A;  3VRN A;  4TZA A;  3ST3 A;  1QTX A;  4I5K A;  2G9B A;  4ZF5 A;  3LLE A;  1OQP A;  1N2D A;  1F71 A;  1JC0 A;  2H9W A;  5DRG A;  3CWG A;  2JXC A;  1DF0 A;  3BX9 A;  1IH0 A;  4B5Y A;  1UUS A;  2JPO A;  1NWD A;  1RWY A;  2BNX A;  1NSH A;  2Z6X A;  4NWS A;  4DXQ A;  3VRP A;  4RYS A;  2WC6 A;  4QJ3 B;  2JPT A;  3NGV A;  1SL9 A;  2F3Z A;  4Q04 A;  2LVK A;  1SBJ A;  1H4B A;  3SIA A;  3TUY B;  5KTY A;  3NHI A;  1WLZ A;  1ZGQ A;  2FOT A;  1YVH A;  1F70 A;  4W6S A;  3SVC A;  2Z6Z A;  3VHT B;  3S0B A;  2ZRS A;  1M31 A;  4EUL A;  4B30 A;  1RTP 1;  4XJK A;  2I18 A;  3P8U A;  2HJO A;  1Y6W A;  3SS0 A;  1C3Z A;  3LSA A;  1SR6 C;  1FBV A;  1KFU L;  3SS5 A;  4W6T A;  1IJ6 A;  3B6X A;  4CPV A;  1YTZ C;  3PAL A;  3CD1 A;  4MRY A;  4LJB A;  2F8P A;  2HQ8 A;  1PAL A;  2JT8 A;  2KAX A;  3K21 A;  4MEW A;  2HPW A;  1UHJ A;  2QRF A;  5BQL A;  1BFP A;  4ORC B;  1CMG A;  1KYR A;  4TZG A;  1XK4 C;  3U8P A;  1QLS A;  4LJC A;  1AHR A;  2VZX A;  1SK6 D;  2V53 A;  3AKB A;  4R6B A;  3OX6 A;  4H3M A;  2WIS A;  1GJY A;  1F4O A;  1V1F A;  2LAN A;  3MGF A;  1B8R A;  3DQI A;  4W73 A;  3RLZ A;  2GTE A;  5CSF A;  2QEV A;  3D73 A;  1TOP A;  1GGZ A;  5HZU A;  1NCZ A;  3R1O A;  1CFD A;  1R6P A;  5FI6 A;  3DQ9 A;  4D1E A;  3SJS A;  4JPZ B;  4MBE A;  3OHM B;  5JJG A;  2LCP A;  2BKH B;  2WHS A;  2LNK A;  4ORN A;  1MWN A;  2PAS A;  4U8D A;  4A4B A;  1BT6 A;  1B9C A;  1IRJ A;  3DQE A;  2BL0 B;  3DQU A;  1E8A A;  1M45 A;  2VVH A;  3V3D A;  3R1P A;  1WLM A;  2HQZ A;  2LMT A;  1CDP A;  3I19 A;  1CMF A;  3FIA A;  1KYP A;  4YI8 A;  3ST4 A;  1OMV A;  3L47 A;  2FJU B;  4KW4 A;  4GBA A;  1XFU O;  1EG4 A;  2WCL A;  3SVN A; 
#chains in the Genus database with same CATH homology
 1YRU B;  3SVR A;  4PE7 A;  3LF4 B;  2QLG A;  5F6T A;  1RMM A;  2LAP A;  3PN7 B;  4H48 A;  2GX2 A;  1EMB A;  3I5G C;  3SVO A;  4DXI A;  4AQJ A;  3NSO A;  4Z4M A;  3SVE A;  3VGO A;  2M7L A;  1K96 A;  1A4P A;  2AH8 A;  5LTP A;  1K95 A;  1KSM A;  2RGI A;  2EC6 C;  4UTS A;  3H1R A;  2JWW A;  5ER4 X;  4PE0 A;  4IK3 A;  5J3X A;  3NED A;  4AS8 A;  5HKY A;  1QS7 A;  1F8H A;  1ODB A;  3K1K A;  2KAY A;  1FI5 A;  5EB7 A;  4BDU A;  1B7T Y;  2BTJ A;  1XK4 A;  5KU1 A;  2JAD A;  5DU0 A;  2QLE A;  5EXB A;  2CCM A;  3BUX B;  2A46 A;  5FVG A;  1A2X A;  4OQW A;  3WLC A;  3I5H C;  2HGY A;  1CDN A;  1Y0V H;  4JGE A;  1J1E A;  2L50 A;  2VRG A;  4W6N A;  1PRW A;  4GF6 B;  2WUR A;  3SSV A;  1KFX S;  4PDZ A;  4MZL A;  3SVU A;  1CLM A;  1REC A;  1S5G Y;  1QAT A;  3GEX A;  2H5P A;  4GGN A;  4WQ2 A;  1IQ3 A;  3SG5 A;  1RFJ A;  4P5O E;  2YE0 A;  1KP5 A;  2QPT A;  2WSN A;  5LTR A;  4ZIN A;  1QV1 A;  1J7R A;  5AXI A;  3VHT A;  2YE1 A;  1XYD A;  3PN7 C;  4W7R A;  4L1I A;  1MOV A;  2MHH A;  2KI4 B;  1BJF A;  2L98 A;  3ICB A;  3PLF B;  3GB3 A;  4JEO A;  1DJW A;  1WY9 A;  3JTD B;  2PAL A;  5T3I A;  1U5I A;  5EXU A;  2B3Q A;  5CPV A;  2AAO A;  4MSP A;  2BE6 A;  1YZW A;  1DF0 B;  3UFZ A;  1KCY A;  2KOT A;  4DUQ A;  2L2E A;  1B8L A;  4JRB A;  2AWK A;  1S6C A;  1AUI B;  1A75 B;  4I5L B;  3O77 A;  3D10 A;  1FPW A;  1IQ5 A;  4H3L A;  1TNW A;  2KHN A;  2GX0 A;  1TNX A;  3HCM A;  1QV0 A;  4AR7 A;  2ICR A;  2MJW B;  4OGS A;  3OGO A;  4KGF A;  1CDL A;  3LA1 A;  1JC2 A;  5DKR A;  5EXC I;  4B30 B;  1XFW O;  2M1K B;  5DQM A;  2ZND A;  1YFP A;  2YFP A;  1ALW A;  2M29 A;  5AAN A;  3LVA A;  2GGM A;  4GAO A;  1WDC C;  4ZF4 A;  5H87 A;  2JNF A;  2KBI A;  1A03 A;  1CV7 A;  5AER A;  4XYN A;  3FWB A;  4ZCV A;  1F0B A;  3SRY A;  2ZRT A;  2LMV A;  2PSR A;  1XO5 A;  2LVJ A;  3DQM A;  1JF2 A;  4YI9 A;  1YHI A;  1WRK A;  2EMD A;  1BLQ A;  2QLH A;  2A48 A;  4HRG A;  1ZUX A;  3A8S A;  4IK9 A;  2A47 A;  2F2P A;  4NQG A;  1JC1 A;  3KCT A;  1PK0 D;  1L2O B;  3QRX A;  1QVI Y;  1YUT A;  4W6G A;  1G7K A;  1YX8 A;  5DTX A;  4W6J A;  1W7J B;  4YGA A;  3TMR A;  5DPH A;  1H8B A;  1AVS A;  1EME A;  3SSH A;  2I7A A;  3EKJ A;  1AJ4 A;  1A29 A;  3PJ7 A;  1UIS A;  3BUM B;  3ZNI A;  3ST2 A;  4J89 A;  1BR1 B;  1S6I A;  2BCX A;  3GK2 A;  3CR4 X;  4KW8 A;  1LVC D;  2LMU A;  3CFH A;  1DJG A;  2JUL A;  4PPL A;  4Q7T A;  2WOR A;  3CGL A;  2K0J A;  4JFG A;  2ZN9 A;  1J7O A;  2I2R E;  4KGE A;  3KEV A;  3VK1 A;  3DQ2 A;  5DRF A;  4NDB A;  2JZI A;  1QLK A;  1BOC A;  1KFX L;  1QIV A;  2LLS A;  1SCM C;  1EXR A;  3DQA A;  3EVU A;  4M2P A;  1YX7 A;  2JTT A;  5I2Q A;  4DXP A;  1K2H A;  1SR6 B;  2Y1N A;  5DPG A;  1MF8 B;  1KWO C;  2H2K A;  1JFK A;  1B9A A;  1UHK A;  3NEZ A;  1YUU A;  3JVT C;  1QYF A;  3DQ4 A;  4HRH A;  4GNK B;  3SST A;  2LE9 B;  4GPL B;  4I5N B;  3CGA A;  2H5R A;  5DKN A;  5D69 A;  2LP3 A;  1NYA A;  3OP0 A;  5DY6 A;  3AI4 A;  4PHJ A;  1MYW A;  3MSE B;  1HUY A;  1BU3 A;  1MXL C;  1FW4 A;  1V1G A;  1EJ3 A;  4MLW A;  1DJY A;  4ANJ A;  1S3P A;  3EVP A;  3SSY A;  1SYM A;  4PHN A;  1IGV A;  3VIC A;  5BT0 A;  3E5T A;  2BBM A;  1A75 A;  2Z1O A;  1AJ5 A;  2Z6Y A;  2KAV A;  3BOW B;  3CLN A;  1EMG A;  4DRW A;  2QZ0 A;  1K9U A;  4W6M A;  4NDC A;  3I5I C;  4HVF A;  5IBW A;  1SCV A;  1M39 A;  3SG6 A;  1OOJ A;  5CSJ A;  1LIN A;  1JF0 A;  4EN1 A;  2K7D A;  4N1G A;  4HSZ A;  4W7A A;  4A4C A;  2LUC A;  1B1G A;  2K7C A;  2LC5 A;  3WLD A;  4L9M A;  1Q4D A;  1F55 A;  1U5I B;  3ED8 A;  2GGZ A;  2AUC A;  2OGR A;  1J7P A;  1XA5 A;  2H61 C;  4KA9 A;  1QAS A;  2NCO A;  1NX3 A;  4OVN F;  3DQ1 A;  4DXO A;  3O2P A;  3PJ5 A;  3PSR A;  4W6I A;  3O4Y A;  1QX5 B;  1MXE A;  2Y4Q A;  2WOS A;  1W7T A;  1XQM A;  4DS7 A;  1Y1A A;  1TCO B;  2G3O A;  2HCG A;  2DDC A;  3I5G B;  1EMK A;  3LF3 A;  1RK9 A;  3NXA A;  2KYF A;  2WIQ A;  1CNP A;  2EHB A;  3SG4 A;  2O2B A;  1M63 B;  3CS1 A;  2EC6 B;  3KHE A;  2MLF C;  2KQ6 A;  1HT9 A;  2JU0 A;  5TNC A;  3AKO A;  1NP8 A;  2ISD A;  3TS5 B;  4DIR A;  2Q91 A;  2L5X B;  3PFV A;  2OS8 B;  4CID A;  2G2B A;  1Q4A A;  4XL5 A;  1B7T Z;  5I8N A;  5HZO A;  3LS3 A;  4W7D A;  2DD7 A;  3I5H B;  4P2Y B;  2OJK A;  1YR5 A;  4GUK A;  3U8C A;  3GJ2 A;  5BTT A;  2H5Q A;  2ZNE A;  1Y1X A;  5FYX A;  5LK4 A;  3TDU A;  2PVB A;  1S5G Z;  2QU1 A;  2GW3 A;  3F45 A;  2JRF A;  2EMN A;  4MVF A;  4IK8 A;  3DVE A;  1ZOT B;  3CFA A;  5GQQ C;  3CD9 A;  2HFC A;  4JC2 A;  3LK0 A;  2G5Z B;  2M0R A;  2V4E C;  1IKU A;  4J8A A;  3NSL A;  4W6U A;  1BR4 B;  1H6R A;  1K94 A;  1M46 A;  3SG3 A;  2KFH A;  2KNE A;  1NX1 A;  3BXC A;  3O6B A;  1DGU A;  2Q57 A;  3AAK A;  1XMZ A;  5DQB A;  3NT3 A;  2A4J A;  3WHT B;  3BYA A;  2H61 A;  4ZBL A;  3UG0 A;  1B8C A;  5DTZ A;  2OKY A;  1DGV A;  1CFP A;  2L4H A;  2E30 A;  5BPJ A;  4FQO A;  3TS5 C;  5EB6 A;  1JBY A;  2OS8 C;  5DKQ A;  2LVV A;  2C9I A;  4F0Z B;  4Q7U A;  5HYD A;  4PE4 A;  3M24 A;  3AAJ A;  2M9G A;  4Q9W A;  2FCE A;  2F3Y A;  2AHA A;  2JT3 A;  1K90 D;  2KDH A;  2C9J A;  1Q80 A;  2PXW A;  2OTE A;  1NX2 A;  1QXT A;  2L4I A;  4RYW A;  3BOW A;  3EKH A;  1K8U A;  3TMT A;  3E5V A;  3SVD A;  4EDO A;  3I5F B;  4HQ8 A;  1HCJ A;  1ZAC A;  3GJ1 A;  5AQB B;  1WDC B;  3IR8 A;  1NIW A;  2ZMW A;  4MRX A;  2BCA A;  1OZS A;  1TTX A;  3SV5 A;  4KEX A;  4IK1 A;  4FTG A;  4R6D A;  3SG7 A;  4KPI A;  4GGF C;  1K93 D;  5I2L A;  1N0Y A;  2HPS A;  2ZKM X;  2HET A;  1KSO A;  2K7B A;  4BY4 A;  3NT9 A;  4W7X A;  2BEC A;  2CNP A;  5I2O A;  1SRA A;  1CM1 A;  5HKW A;  1QVI Z;  1YVL A;  3DQ5 A;  4J88 A;  3DPX A;  3BUO B;  4MZK A;  4AOM A;  5DTL A;  2V4E A;  1KYS A;  4ORB B;  2ARL A;  1MOU A;  4OKH A;  2HQW A;  4TNC A;  2I94 A;  1XFZ O;  4W76 A;  2LM5 A;  3ZTF A;  3BXA A;  2H5O A;  3M0W A;  2PRU A;  3DVK A;  2B1U A;  4CLN A;  1PVA A;  1KK7 Y;  2MAZ A;  1Q4E A;  4YGB B;  1XFX O;  4ZIO A;  4WQ3 A;  3I5F C;  1OXF A;  3W1C A;  3G9A A;  4KAG A;  3LCP C;  4KF4 A;  2ZFD A;  3CTN A;  3NSK A;  3DQC A;  4OCI A;  3CR5 X;  1QX7 A;  1SCM B;  2KGR A;  3LK1 A;  2A54 B;  2LHL A;  1YHG A;  1B47 A;  5HBD A;  2G16 B;  4W6R A;  2CTN A;  4JWQ A;  3W1D A;  1KWO B;  2JC2 A;  1W7U A;  1MR8 A;  2MRD A;  1KQV A;  1GGX A;  5HZS A;  1Q73 A;  2B3P A;  1C4F A;  1F54 A;  1S6J A;  2ZO6 A;  3OX5 A;  1YJF A;  1F4Q A;  3JVT B;  4PPJ A;  3DPW A;  4PFE A;  1DJZ A;  1TNP A;  1W7S A;  4RTC A;  3IQO A;  5K89 A;  5HKZ A;  1QY3 A;  1YUS A;  2FZU A;  3ZWH A;  4GGF A;  4W72 A;  1S36 A;  5DPI A;  3DQ7 A;  1CKK A;  3ZUJ A;  1C7V A;  1S26 D;  2LLT A;  3CR2 A;  4HQC A;  4W7F A;  2OPO A;  4QJ5 B;  2KI6 D;  3VRO A;  1QYO A;  3BXB A;  4YGE B;  4C0J A;  2P4M A;  5BTT B;  4CFQ A;  1EH2 A;  4Z4K A;  3DQL A;  5H88 A;  4W7E A;  4HE4 A;  4QJ4 B;  1W7I B;  2YDZ A;  3ZUF A;  1C07 A;  3AKA A;  1LKJ A;  3I5I B;  4YBH B;  4L12 A;  2IB5 A;  3CZT X;  1KK8 C;  1QIW A;  1KQM C;  1BMO A;  3VRQ A;  2WHU A;  5PAL A;  3SVB A;  1Z1Q A;  1RM9 A;  3WXA A;  4P1Q A;  2QAC A;  3HX4 A;  1Q4C A;  4MZJ A;  3BXK A;  1SKT A;  2MLE C;  4PE1 A;  2JOJ A;  4W7C A;  2R2I A;  4DKM A;  2QLI A;  2BCB A;  4LW5 A;  4ETO A;  3DQ6 A;  4KW9 A;  2VVJ A;  1S6Z A;  3E5W A;  4W6D A;  1MQ1 A;  1BF5 A;  1CLB A;  1OMD A;  4CFR A;  2GW4 B;  2Y1M A;  2L51 A;  4DKN A;  1WRZ A;  3TZ1 A;  3ADF A;  1NCX A;  1TRF A;  1SW8 A;  2NXQ A;  1EL4 A;  2LVI A;  1JWD A;  4I2Y A;  2KFF A;  3CFF A;  2LLU A;  3VRR A;  5FVF A;  4IL1 A;  2PXS A;  4IK4 A;  4PPK A;  2D8N A;  2VVI A;  2IB6 A;  2KQY A;  4Q9X A;  1CFF A;  2ZN8 A;  2SAS A;  1AK8 A;  4W6O A;  2AWJ A;  2O60 A;  3EVR A;  2JQ6 A;  2L0P A;  2KBM A;  1TIZ A;  3FWC A;  3DQK A;  5CSI A;  2K7O A;  2WHT A;  1YHH A;  1XSS A;  2G6E A;  2HF5 A;  1Q4B A;  3H4S E;  4H47 A;  5HLO A;  3D0Y A;  2Y5I A;  2HQK A;  3U0L A;  3E3R A;  1Y1U A;  4M2Q A;  3KF9 A;  1OSA A;  3SG2 A;  1OMR A;  2DUG A;  1J55 A;  1RJV A;  2K8M B;  1SNL A;  4DXM A;  1PVB A;  2ZMU A;  4KF5 C;  2M49 B;  1ZMZ A;  2TN4 A;  2V4E B;  3DPZ A;  4JQ0 D;  1IWQ A;  1NPQ A;  2LV7 A;  2FCD A;  2DUE A;  4W6B A;  5DPJ A;  3ZUL A;  4W75 A;  2WCE A;  2M3W A;  1EMF A;  1LA3 A;  3DQO A;  4YRU A;  3GK1 A;  3CBE A;  2G6Y A;  4XOV A;  1BG1 A;  1IJ5 A;  1DMO A;  4IZN A;  3WCK A;  2GV5 A;  3IF7 A;  3DD4 A;  4P76 A;  1ZUZ A;  4E68 A;  1SMG A;  1CM4 A;  4WRI A;  1XFV O;  1SY9 A;  4W6F A;  4XVP A;  5HW9 A;  2KSP A;  3LVD A;  1ZFS A;  1UHN A;  4EMQ A;  5ER5 A;  2Q4U A;  2SCP A;  3PAT A;  1EML A;  3DQN A;  2DOQ A;  2K2A A;  2OTG B;  2CT9 A;  2OTB A;  3SSL A;  4BY5 A;  1SL8 A;  1FI6 A;  4PAL A;  3TUY C;  3DVM A;  1RRO A;  1UHI A;  1N65 A;  1DJI A;  2OKW A;  2COL B;  2AMI A;  4W6L A;  2A53 B;  1XFY O;  1PSB A;  5HLV A;  1LXF C;  1QX2 A;  1G4Y R;  1UHH A;  4L13 A;  2A52 B;  4OY4 A;  1JUO A;  2E6W A;  2G2S B;  1DJX A;  2DUH A;  4PHK A;  4ZCU A;  5AEQ A;  5KSZ A;  1H4U A;  4W6C A;  1B4C A;  2POX A;  4AQI A;  1HQV A;  1XAE A;  1CDM A;  4Q7R A;  3DVJ A;  4U2V A;  3EK8 A;  3U0K A;  1UP5 A;  2M8U A;  1CTR A;  4KF5 A;  3OB1 B;  3DQH A;  1BOD A;  3H1O A;  3WNX B;  2KI6 C;  3GK4 X;  1XVJ A;  3OSR A;  2A56 B;  2BE4 A;  4UPG A;  2Q6P A;  2K61 A;  2OTG C;  2H8Q A;  1XA9 A;  1NUB A;  2PMY A;  3U0N A;  3ST0 A;  1GGW A;  4YGC B;  2CXJ A;  1SL7 A;  3TDZ A;  1EMC A;  5H89 A;  4HRE E;  4GES B;  4JF9 A;  1CLL A;  1JFJ A;  1RMO A;  1S1E A;  3OB2 B;  1Z1P A;  2NLN A;  4ZB1 A;  3DF0 B;  1OXD A;  3WHU B;  1KK7 Z;  4ORA B;  2BL0 C;  2KYC A;  4ZFS A;  4YGD B;  1D1O A;  2F33 A;  2WSO A;  3PIB A;  3RM1 A;  1EMM A;  4IK5 A;  4LQU A;  3M22 A;  1F09 A;  5JOL A;  2WC8 A;  4I5J A;  3EK4 A;  4ZF3 A;  3AI5 A;  1AP4 A;  1RMP A;  2AWM A;  1TN4 A;  1LA0 A;  1J7Q A;  2F2O A;  2LP2 A;  2P6B B;  4W6P A;  3KO0 A;  3NSI A;  4PCW A;  2KGB C;  1QJT A;  3A8R A;  1PSR A;  2EGD A;  1OXE A;  4H3N A;  4PHM A;  1EMA A;  1QYQ A;  5EHU A;  5AFP A;  2JNX A;  1J1D A;  2NZ0 A;  3NF0 A;  2AWL A;  2ZO7 A;  1UUR A;  2BKI B;  4ICB A;  1GQM A;  4DXN A;  2RH7 A;  2M97 A;  2MBX A;  3TDI A;  2DUF A;  2NCP A;  3BUN B;  3D0Y B;  4LJD C;  3EK7 A;  3OSQ A;  3O78 A;  1WRL A;  1K9K A;  5HGE A;  4W69 A;  3CB9 A;  3DQF A;  4XJK B;  1SPY A;  2JT0 A;  1NCY A;  5LTQ A;  2QT2 A;  1OZO A;  1K9P A;  1YRT B;  2WND A;  1KK8 B;  1MUX A;  1GL4 A;  1G8I A;  1OE9 B;  1KQM B;  5F9G A;  1NX0 A;  3KPX A;  1CFC A;  5D7F A;  3DQ3 A;  1QXP A;  4W6A A;  5EJU A;  5FHV A;  5B8I B;  3SVS A;  1KFU S;  1PUL A;  2JTZ A;  2LUX A;  2IOV A;  4XGY A;  2BBN A;  2KI4 C;  2LHI A;  4XOW A;  4OR9 B;  3JTD C;  3P28 A;  1CB1 A;  2FL1 A;  4MN0 A;  2O24 A;  1DTL A;  2O5G A;  1MHO A;  2WCF A;  1JSA A;  2Y0G A;  2DUI A;  3BQ3 A;  3SSP A;  3SSK A;  2JXL A;  4DCK A;  5FVI A;  2MA2 A;  1DVI A;  3PM8 A;  4GOB A;  2EMO A;  2IS9 A;  4OHS A;  3BUW B;  2G3D B;  1JBA A;  2O29 A;  2M7N A;  2IE2 A;  4C0L A;  1TCF A;  4USL A;  3RWA A;  2VAD A;  4W6H A;  4N3D A;  4NDD A;  2K2F A;  4N5X A;  3SIB A;  3A4U B;  4M2O A;  1DT7 B;  4LQT A;  3DQ8 A;  1C7W A;  3C1V A;  3U0M A;  1ZGP A;  4HQ9 A;  1R2U A;  3GL4 A;  3KCS A;  5DTY A;  3RWT A;  5G08 A;  3DQD A;  1JBZ A;  2KFG A;  1IG5 A;  1EG3 A;  4GFT A;  1ALV A;  3EVV A;  3LL8 B;  2HRS A;  5KTG A;  3S05 A;  1YUR A;  2WCB A;  2FWQ A;  2CBL A;  3LVC A;  4EDS A;  4W6K A;  3DQJ A;  3DF0 A;  4R1E A;  3PJB A;  4OV2 A;  4LJD A;  1ZGO A;  2H6V A;  1X02 A;  1G33 A;  5HZT A;  4OJ0 A;  2QLG B;  4W74 A;  2HGD A;  1TNQ A;  1L7Z A;  2DDD A;  1RRX A;  3GOF A;  5EBJ A;  2VAE A;  4N1F A;  3FS7 A;  5J2O A;  3IQQ A;  3U8A A;  1L2O C;  1GFL A;  3IP2 A;  2DD9 A;  1DJH A;  4C0K A;  4W77 A;  2G6X A;  1VRK A;  2A50 B;  1YJ2 A;  1UWO A;  1FF1 A;  5CSN A;  2M1U A;  3VRN A;  4TZA A;  3ST3 A;  1QTX A;  4I5K A;  2G9B A;  4ZF5 A;  3LLE A;  1OQP A;  1N2D A;  1F71 A;  1JC0 A;  2H9W A;  5DRG A;  3CWG A;  2JXC A;  1DF0 A;  3BX9 A;  1IH0 A;  4B5Y A;  1UUS A;  1NWD A;  1RWY A;  1NSH A;  2Z6X A;  4NWS A;  4DXQ A;  3VRP A;  4RYS A;  4QJ3 B;  2JPT A;  1SL9 A;  2F3Z A;  4Q04 A;  2LVK A;  1SBJ A;  1H4B A;  3SIA A;  3TUY B;  5KTY A;  1WLZ A;  1ZGQ A;  2FOT A;  1YVH A;  1F70 A;  4W6S A;  3SVC A;  2Z6Z A;  3VHT B;  2ZRS A;  1M31 A;  4EUL A;  4B30 A;  1RTP 1;  4XJK A;  2I18 A;  3P8U A;  2HJO A;  1Y6W A;  3SS0 A;  3LSA A;  1SR6 C;  1FBV A;  1KFU L;  4W6T A;  1IJ6 A;  4CPV A;  1YTZ C;  3PAL A;  3CD1 A;  4MRY A;  4LJB A;  2F8P A;  2HQ8 A;  1PAL A;  2JT8 A;  2KAX A;  3K21 A;  4MEW A;  2HPW A;  1UHJ A;  2QRF A;  5BQL A;  1BFP A;  4ORC B;  1CMG A;  1KYR A;  4TZG A;  1XK4 C;  3U8P A;  1QLS A;  4LJC A;  1AHR A;  2VZX A;  1SK6 D;  2V53 A;  3AKB A;  4R6B A;  3OX6 A;  4H3M A;  2WIS A;  1GJY A;  1F4O A;  1V1F A;  2LAN A;  3MGF A;  1B8R A;  3DQI A;  4W73 A;  3RLZ A;  5CSF A;  1TOP A;  1GGZ A;  5HZU A;  1NCZ A;  1CFD A;  1R6P A;  3DQ9 A;  4D1E A;  3SJS A;  4JPZ B;  4MBE A;  3OHM B;  5JJG A;  2LCP A;  2BKH B;  2WHS A;  2LNK A;  4ORN A;  1MWN A;  2PAS A;  4U8D A;  4A4B A;  1BT6 A;  1B9C A;  1IRJ A;  3DQE A;  2BL0 B;  3DQU A;  1E8A A;  1M45 A;  2VVH A;  3V3D A;  1WLM A;  2HQZ A;  2LMT A;  1CDP A;  3I19 A;  1CMF A;  3FIA A;  1KYP A;  4YI8 A;  3ST4 A;  1OMV A;  2FJU B;  4KW4 A;  4GBA A;  1XFU O;  1EG4 A;  3SVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...