3SG4A

Crystal structure of gcamp3-d380y, lp(linker 2)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
409
structure length
394
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 133
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg4A02
1LINA 1GGXA 2QLIA 5DU0A 1NX3A 4W6HA 1JFKA 3OB1B 2TN4A 2ZN8A 2WHTA 2KQYA 1KQVA 1OOJA 2DUFA 3K21A 3RWTA 1HT9A 3TZ1A 2QU1A 4Q9XA 1WRLA 5DY6A 2ZFDA 5G08A 2Z6YA 4TZGA 4KGFA 4OQWA 4W6BA 1HUYA 2ZRSA 1XA9A 3SSPA 4LJBA 3GB3A 1MF8B 4AS8A 1Y1AA 2QZ0A 1CFDA 2GW3A 4IL1A 4Z4MA 2PSRA 2K7CA 2E30A 1F70A 2G16B 5LTPA 1B8LA 1JC0A 2H61A 2KFGA 1DF0B 1AP4A 2F2OA 3DVKA 2ZMUA 3U0NA 3O4YA 2V4EB 1TNWA 4UTSA 1DF0A 3TMTA 1SYMA 2JADA 2V4EA 1CMGA 3NSLA 3SIAA 3BXCA 3SVEA 2POXA 1MXEA 2DD9A 3SVNA 3O77A 3DQ1A 2KAXA 2QT2A 1IWQA 4AQJA 3DVJA 1YRUB 5HW9A 4YGBB 3I5HB 1EMFA 3WXAA 2DD7A 4IK3A 3OB2B 4JFGA 1BG1A 4ORNA 1V1GA 2BE4A 2H9WA 4LJDC 1EMCA 2HPWA 1Y1XA 2ZN9A 1PRWA 2CT9A 3CGAA 4DKNA 1FI5A 1CLMA 1BJFA 2G9BA 2M7LA 1W7SA 3PSRA 4W76A 1KSOA 2OGRA 5DKRA 1S5GZ 2G3DB 2CXJA 2AWMA 3C1VA 3VGOA 5AFPA 1CKKA 1XFZO 2A48A 1QTXA 4H48A 4I2YA 4DS7A 4W6KA 2WCBA 2MBXA 3GJ2A 4JF9A 3SV5A 4DKMA 4W6OA 1K9KA 3SG2A 5T3IA 4GESB 4ZCVA 4H3LA 1SNLA 4W7EA 4LW5A 3ST4A 2LNKA 4OJ0A 2HETA 3DQFA 1RM9A 3SSLA 2OPOA 4GGFA 1Z1QA 1SKTA 2I7AA 4HQ8A 5EXBA 5AQBB 3LK0A 2BBNA 2RH7A 2OS8B 1MR8A 5D69A 1KFXL 1TN4A 4GPLB 2JULA 1R6PA 1Q4CA 3EVUA 1OMDA 1JC2A 4MEWA 1K95A 4RYWA 1G33A 1KYSA 1HQVA 2FJUB 5DTXA 3DPXA 1WRKA 3DQCA 5EBJA 3CBEA 3SG6A 5DQBA 4HSZA 5FVFA 3LVAA 3ED8A 2WISA 2WNDA 2C9IA 2YFPA 4NDCA 2GX2A 4DXMA 1F4OA 4PHJA 3ST2A 4WQ2A 1EMBA 4W6CA 3DQ6A 2P6BB 1PULA 2MLEC 4PCWA 1SW8A 1OZOA 4ZINA 3WHTB 4MLWA 1BT6A 1UWOA 4WQ3A 2L0PA 2LUXA 4C0KA 1MQ1A 2LP2A 1ZMZA 3SVRA 4MSPA 4LJDA 2A56B 1B9AA 2WC8A 4H47A 4W6RA 2B3PA 2C9JA 3DPZA 2B3QA 4W7AA 2MRDA 2I94A 3LLEA 1GFLA 3EK8A 3VRNA 1Y6WA 5HKZA 2M97A 1EL4A 1EJ3A 1JSAA 3KPXA 2MA2A 2PVBA 2HRSA 1XYDA 2NCPA 1E8AA 2F33A 4MZLA 2EC6B 1QYQA 3CGLA 2DOQA 4HQCA 1TNPA 4H3MA 4XL5A 4PFEA 3M0WA 5EB6A 1LA0A 1YURA 3O2PA 5KTYA 4MRYA 4MBEA 5TNCA 3SJSA 3V3DA 3I5GC 3DQOA 4D1EA 2HQZA 3U8AA 1WRZA 1MUXA 2KFHA 3TS5C 3VHTA 2VVHA 2M1UA 3H1RA 1S36A 4EDSA 5KTGA 1AVSA 1EXRA 4OY4A 1AJ5A 2LVVA 1F71A 5DPIA 4DIRA 2H5PA 4PHMA 3PFVA 4P2YB 1DMOA 3LCPC 2L50A 2LE9B 4FTGA 1Q4DA 3CFFA 3SSVA 1OSAA 2K2AA 1EG3A 3A4UB 4TZAA 3NF0A 3LS3A 4IK4A 2KFFA 1J7QA 4EDOA 1K9PA 1FF1A 3I5FC 4DXOA 3A8SA 1N2DA 3VK1A 4W7CA 1W7IB 2O24A 1PVBA 1G7KA 2MAZA 1S1EA 1UHJA 5DPJA 3ST0A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 4QJ5B 2OTGC 2E6WA 1MXLC 1BU3A 1FBVA 2ZMWA 4BDUA 2LMVA 5LK4A 3ZULA 4JQ0D 3E5WA 4DXIA 1XAEA 4JRBA 1IG5A 4NWSA 2CTNA 1NCYA 1S3PA 3P8UA 1FI6A 3BUWB 1Y0VH 3DQEA 1VRKA 1BR4B 4I5NB 2IOVA 1KFXS 1K9UA 3GK2A 2MJWB 4PE4A 3E3RA 1IH0A 2JTZA 2FL1A 3DQ7A 2QLHA 1SRAA 1H4UA 3SG4A 5FHVA 3VRRA 1IJ5A 3I5GB 4XOVA 2EHBA 3CS1A 2OTEA 2JNXA 1F55A 3DQHA 1EMEA 2EMOA 1KFUL 4PDZA 2DUEA 4N1FA 4Q04A 1BF5A 4KF5C 5IBWA 1D1OA 5HGEA 4IZNA 1Q73A 5HZOA 3SG3A 3SSKA 4OHSA 4ETOA 4XYNA 1UHHA 1NCZA 4YGEB 1QXTA 2EGDA 4MN0A 2AUCA 3O78A 1NX1A 4W6NA 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 3VROA 1MHOA 2CNPA 2IS9A 3H4SE 3I5FB 3DQ3A 2BKIB 3GJ1A 4ZCUA 2MLFC 3AI5A 1M31A 5EB7A 1NUBA 4JGEA 4DCKA 5HKYA 1NX2A 4NDDA 4ZBLA 5DQMA 4W6JA 2F8PA 3JVTC 4KGEA 2I2RE 2LANA 2OTGB 4GGFC 4W75A 1J7OA 1S26D 4JPZB 3SVBA 2JT3A 5LTQA 3SG5A 2M0RA 4W69A 4DRWA 4LQUA 3IF7A 1ZACA 1W7UA 1K96A 3BQ3A 2HGDA 4B30B 1B8RA 1OQPA 4W6DA 1CM1A 4B30A 2OS8C 2IB5A 2OJKA 1DTLA 1YVHA 4XVPA 5DPGA 4GUKA 4A4BA 4W77A 3F45A 4ANJA 1U5IB 3ZNIA 4B5YA 4W6MA 1F09A 2COLB 4GGNA 5CSIA 1CFCA 1U5IA 4W6AA 2KDHA 3NEZA 1KCYA 2JOJA 2Y4QA 1TOPA 1YHIA 2GW4B 3KO0A 3CR5X 4Q7TA 5DTZA 3DQUA 1JF0A 1F4QA 2F2PA 3OHMB 4P1QA 2JNFA 5DKNA 1OXDA 4YI9A 5BPJA 1F0BA 1C7VA 1TRFA 2P4MA 4PE7A 3SVUA 4ICBA 4ZF5A 1YJFA 2H2KA 1EMMA 4I5LB 2K7BA 1MOVA 2H8QA 4FQOA 4YGDB 1N0YA 2ZNEA 1AUIB 4KF5A 5EXUA 1TIZA 1CM4A 1OE9B 4N1GA 1QY3A 3ST3A 4ZFSA 1DGUA 4ORAB 2H5OA 1QV1A 1QX2A 3LL8B 2L4HA 1IQ3A 3PATA 1DJWA 1TNQA 1NP8A 3AKAA 3CD9A 1J1EA 4YGCB 2VVJA 2PMYA 1EMAA 3BYAA 1ALWA 3OSQA 3JVTB 5DRFA 1KSMA 4W6IA 3WLDA 1J7PA 3HX4A 4OV2A 4M2QA 2L51A 3DD4A 2NCOA 5H89A 2EC6C 1JBAA 1B7TY 3FWBA 1ZGQA 4W7XA 1JC1A 1IKUA 1DJXA 4PE0A 1A29A 1H4BA 3U0LA 3AKOA 2G6YA 1CB1A 2AWKA 1NPQA 4W72A 3PN7C 1YX8A 1B1GA 5HLVA 3NXAA 2BBMA 1YR5A 1SMGA 3LVDA 2M49B 3KHEA 1G4YR 1Q4EA 4ORCB 1PALA 3WLCA 1KFUS 1QASA 2Y1MA 4KW4A 2VADA 1A4PA 2A54B 3BOWB 3ZUFA 3EKHA 4I5KA 2KNEA 5HZSA 3BOWA 1GL4A 2QACA 2YE0A 1YFPA 5I8NA 2JQ6A 3AAJA 5K89A 2FWQA 5JOLA 1PVAA 4M2OA 4OCIA 3PJBA 2LVJA 5HKWA 2JT8A 4OKHA 2NLNA 1JF2A 1W7TA 4A4CA 4R6DA 1XFYO 4J89A 2KSPA 2WCFA 1CFFA 2DDDA 1K90D 3CZTX 3OP0A 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 4YGAA 4AOMA 2WHUA 1B9CA 2JWWA 1KK7Y 3NSOA 1YUSA 2SASA 1XSSA 3ZUJA 4U8DA 1KK8C 1JBYA 2KGRA 5FYXA 2H5QA 3LSAA 5EHUA 1F8HA 1CDMA 1KP5A 2EMDA 1XFUO 3LF4B 1LXFC 1UP5A 3ICBA 2LMUA 2AH8A 4U2VA 4GBAA 1J1DA 1M45A 2LLTA 2EMNA 2G2SB 4LJCA 2K61A 2Z1OA 1AJ4A 1F54A 2K2FA 4HVFA 1KQMC 2PALA 4YRUA 2ZO7A 4F0ZB 5CSJA 1UURA 1H8BA 1UHNA 3VRPA 4PPKA 2LM5A 1SL8A 1CDNA 1ZFSA 3PN7B 3VHTB 4CFQA 3CWGA 3LVCA 3H1OA 3DQ2A 5DTYA 2A53B 5KSZA 4W6TA 2YDZA 3IR8A 4IK8A 1SY9A 5AXIA 3IP2A 2Q4UA 2OKWA 1XQMA 1WLMA 1NWDA 4OVNF 1KWOC 4KA9A 1PSRA 2LV7A 2GX0A 4EMQA 1RECA 5B8IB 2PRUA 1SK6D 2NXQA 1GGWA 2KOTA 1H6RA 1QX7A 1DJHA 4KAGA 4AR7A 1HCJA 1SCMC 2O29A 4DXQA 2LVIA 2KHNA 2L4IA 3NEDA 4NQGA 2YE1A 4W6FA 2QRFA 3GEXA 1YHHA 3A8RA 3SRYA 1LA3A 1WLZA 2CCMA 1WDCC 2SCPA 4L13A 1XFXO 1SCVA 1RJVA 2L5XB 4DXPA 2A50B 3AAKA 1EG4A 1KK8B 1SBJA 2BCAA 2K8MB 2M8UA 2O5GA 3VRQA 4KPIA 2LHIA 2Q6PA 4RYSA 1ZUZA 2JRFA 1C4FA 1TTXA 3DQMA 1K2HA 1AHRA 4HREE 1YRTB 2VRGA 1Z1PA 2ZO6A 1KQMB 2KI6D 4USLA 1FPWA 2LMTA 5J3XA 3BXAA 4L1IA 3I19A 5DTLA 1OMVA 3PJ7A 3DQLA 4W6SA 2CBLA 1RROA 4BY4A 5I2OA 4HRHA 4R6BA 4XJKB 2LP3A 4ZIOA 4XJKA 1SR6C 1S6CA 1Q4BA 5KU1A 1IRJA 1YUUA 3DQ8A 2LVKA 4CIDA 1MOUA 2WSNA 4PHNA 1KWOB 3NT9A 4W6LA 4AQIA 1QIVA 1L7ZA 3S05A 4E68A 2BL0C 1YZWA 1YUTA 1RWYA 1S6ZA 3IQOA 4PPJA 3BUNB 2KAVA 4W6GA 3SVOA 1UUSA 2LLSA 1ALVA 2JT0A 3EVRA 1EMGA 1LVCD 2VAEA 1B4CA 3CFAA 4NDBA 1BMOA 1SCMB 4GOBA 3DQNA 4OGSA 4Q7UA 1A2XA 3KF9A 3BXKA 5BQLA 3K1KA 3SG7A 1ZGPA 3DVEA 2NZ0A 2A52B 1RRXA 4CPVA 5DPHA 3CB9A 1CFPA 1BFPA 4I5JA 1WDCB 3BXBA 3DQIA 1XK4C 2BCXA 2AWLA 5F9GA 4CFRA 2G3OA 5HLOA 3SVDA 3EVVA 3TUYC 3MGFA 1YTZC 3PM8A 2K0JA 2KBMA 5CSFA 4GNKB 1R2UA 2WHSA 5ER4X 5AERA 2IE2A 3TDZA 3UG0A 3DQAA 5LTRA 1MYWA 5J2OA 5PALA 5F6TA 1IJ6A 3ZWHA 3NSIA 3EK7A 4ZB1A 4XGYA 1OZSA 5CSNA 3QRXA 2A46A 1L2OC 2PXSA 2HF5A 3BUMB 4PALA 5HZUA 1SL9A 2BE6A 2Z6XA 1OMRA 1SR6B 1S5GY 3EK4A 3EKJA 2KI4C 4P5OE 4KEXA 2Q91A 3KCTA 2VZXA 4R1EA 2IB6A 1PSBA 1QJTA 4Q7RA 2DUGA 4L12A 2BECA 2G2BA 3WCKA 3VICA 1N65A 4LQTA 1J55A 2LLUA 5I2LA 2KBIA 4GF6B 2WSOA 2VVIA 2JXLA 4RTCA 2BL0B 2OKYA 3GOFA 4EN1A 2LHLA 3BUOB 5GQQC 3KEVA 3CD1A 4N5XA 3BX9A 2Y0GA 4YBHB 3U0KA 2JTTA 3FWCA 5FVGA 4L9MA 4CLNA 1QLKA 2JZIA 3ADFA 4OR9B 1EMKA 3PJ5A 4XOWA 2DUIA 1TCFA 3LF3A 1RK9A 2GGMA 2JXCA 4PPLA 2H6VA 1A75B 5FVIA 2M29A 1PK0D 3U8CA 2G6EA 2HQKA 3CFHA 1A75A 2ISDA 1NYAA 1XK4A 3TUYB 4IK5A 4DUQA 3LA1A 4N3DA 2LAPA 3DQJA 2QLEA 2HFCA 1CDLA 2ZKMX 3DF0B 2RGIA 2HCGA 1BODA 3DF0A 5EJUA 3NSKA 1B47A 3BUXB 3M24A 1Q80A 1SPYA 2GGZA 3I5IC 4PHKA 1M63B 1SL7A 1CTRA 4ORBB 2V53A 2LCPA 4DXNA 1CDPA 2JU0A 3DQKA 2H5RA 1MWNA 3NT3A 3EVPA 2GV5A 1JWDA 2O60A 2B1UA 3TMRA 2HGYA 4IK9A 1L2OB 1GJYA 4JEOA 3SVCA 1B7TZ 2A47A 2AHAA 4J8AA 2FCEA 5HZTA 2Q57A 3OGOA 1NX0A 4ZF4A 1ZOTB 1RTP1 3PALA 2KI4B 3CR2A 1J7RA 2HQWA 2KGBC 4W7RA 2KAYA 3W1DA 5AANA 1OXFA 1EH2A 1X02A 3G9AA 5D7FA 2HJOA 4TNCA 3SVSA 3CR4X 3PLFB 4KW9A 1DJZA 1QV0A 3DQ5A 4ZF3A 2M1KB 5BTTB 3JTDC 3AKBA 2O2BA 2PASA 1CV7A 4PE1A 5BTTA 1Y1UA 1LKJA 1CLLA 1UHIA 4IK1A 3E5TA 5BT0A 3UFZA 1RMOA 2PXWA 5I2QA 2R2IA 2K7OA 3D10A 1QS7A 4QJ4B 2F3YA 1CMFA 2BTJA 1KYRA 4JC2A 1JFJA 4MZKA 4EULA 3OX6A 4H3NA 1RMPA 1QXPA 1NIWA 1FW4A 3SSYA 2WORA 3AI4A 1ZGOA 1YX7A 1GQMA 5HYDA 1QVIZ 1UISA 1QYFA 2L2EA 1KK7Z 1DJGA 2MHHA 3OSRA 1YVLA 2Y1NA 1RMMA 3I5IB 4J88A 3DQDA 1XFWO 4MRXA 4P76A 1XA5A 3D0YB 3GL4A 4C0JA 1QYOA 3WNXB 4HRGA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2FZUA 5DKQA 3U8PA 4Q9WA 1W7JB 3LK1A 1M46A 2WCEA 1IGVA 2AWJA 4KF4A 1JBZA 2DUHA 3E5VA 5EXCI 1UHKA 1S6IA 2I18A 5HBDA 1DJIA 3TDIA 2G6XA 3SS0A 5H87A 1EMLA 1QATA 1B8CA 1NSHA 3ZTFA 1TNXA 2FOTA 1DGVA 3RWAA 3RLZA 4W74A 3IQQA 3U0MA 1DVIA 4Z4KA 4W6UA 1BR1B 3O6BA 2JC2A 3DQ4A 1KYPA 1CNPA 4BY5A 4JWQA 3JTDB 1K93D 3SSTA 4HE4A 2ZNDA 4GFTA 4QJ3B 4GAOA 4KW8A 1C07A 4W7FA 3DPWA 4WRIA 2LUCA 1CLBA 4C0LA 1Q4AA 2DDCA 2QPTA 3KCSA 2WOSA 1RFJA 1IQ5A 2QLGB 2K7DA 3SIBA 2A4JA 3P28A 2H61C 1BOCA 2QLGA 1G8IA 1YHGA 1XMZA 3M22A 2M3WA 1V1FA 1ODBA 1GGZA 3TDUA 2V4EC 2D8NA 3FIAA 2G5ZB 1K94A 3WHUB 2ZRTA 3PIBA 3DVMA 1XO5A 5DRGA 3MSEB 1S6JA 1YJ2A 2LC5A 2FCDA 1QLSA 5CPVA 4W6PA 2HPSA 5ER5A 1C7WA 1DT7B 1NCXA 1BLQA 1M39A 2KQ6A 5H88A 2KI6C 1ZUXA 1JUOA 1A03A 3SSHA 4HQ9A 4W7DA 3CLNA 3GK4X 3TS5B 3DQ9A 5AEQA 3I5HC 3OX5A 2OTBA 2M9GA 1WY9A 3CTNA 2WIQA 2BCBA 2HQ8A 2ICRA 2BKHB 1OXEA 2Z6ZA 1K8UA 2WURA 2ARLA 3GK1A 4W73A 3FS7A 4M2PA 3RM1A 4UPGA 2M7NA 1QIWA 1QX5B 3W1CA
chains in the Genus database with same CATH superfamily
4PT1A 1LINA 1GGXA 2QLIA 5DU0A 1NX3A 4W6HA 1JFKA 3OB1B 2TN4A 2ZN8A 2WHTA 2KQYA 1KQVA 1OOJA 2DUFA 3K21A 3RWTA 1HT9A 3TZ1A 2QU1A 4Q9XA 1WRLA 5DY6A 2ZFDA 3DXLA 5G08A 2Z6YA 4TZGA 3S0GA 4KGFA 2WCKA 4OQWA 4W6BA 1HUYA 2ZRSA 1XA9A 3SSPA 4LJBA 3GB3A 1MF8B 4AS8A 1Y1AA 2QZ0A 1CFDA 2YGUA 2GW3A 4IL1A 4Z4MA 2PSRA 2K7CA 2E30A 1F70A 3S0AA 2G16B 5LTPA 1B8LA 1JC0A 5HL1A 2H61A 2KFGA 1DF0B 1AP4A 2F2OA 3DVKA 2ZMUA 3U0NA 3O4YA 2V4EB 1TNWA 4UTSA 1DF0A 3TMTA 1SYMA 2JADA 2V4EA 1CMGA 3NSLA 3SIAA 3BXCA 3SVEA 2POXA 1MXEA 2DD9A 3SVNA 3O77A 3DQ1A 2KAXA 2QT2A 1IWQA 4AQJA 2BNXA 3DVJA 1YRUB 5HW9A 3SS3A 4YGBB 3I5HB 1EMFA 4INWA 3WXAA 2DD7A 4IK3A 3OB2B 4JFGA 1BG1A 2PQLA 4ORNA 1V1GA 2BE4A 2P70A 2H9WA 4LJDC 1EMCA 2HPWA 1Y1XA 2ZN9A 1PRWA 2CT9A 3CGAA 4DKNA 1FI5A 1CLMA 1BJFA 2G9BA 2M7LA 1W7SA 3PSRA 4W76A 1KSOA 2OGRA 5DKRA 1S5GZ 2G3DB 2CXJA 2AWMA 3C1VA 3VGOA 5AFPA 1CKKA 1XFZO 2A48A 1QTXA 4H48A 4I2YA 4DS7A 4W6KA 2WCBA 2MBXA 3GJ2A 4JF9A 3UO9A 3SV5A 4DKMA 4W6OA 1K9KA 3SG2A 5T3IA 4GESB 3L4AA 4ZCVA 4H3LA 2KLEA 1SNLA 4W7EA 4LW5A 2QEBA 3ST4A 2LNKA 4OJ0A 2HETA 3DQFA 1RM9A 3SSLA 2OPOA 4GGFA 1Z1QA 1QWVA 1SKTA 2I7AA 4HQ8A 5EXBA 5AQBB 3LK0A 2BBNA 2RH7A 3R1OA 2OS8B 1MR8A 5D69A 1KFXL 1TN4A 4GPLB 2JULA 1R6PA 1Q4CA 3EVUA 1OMDA 1JC2A 4MEWA 1K95A 4RYWA 1G33A 3UNWA 1KYSA 1HQVA 2FJUB 5DTXA 3DPXA 1WRKA 1DEKA 3DQCA 5EBJA 3CBEA 3SG6A 5DQBA 4HSZA 5FVFA 3LVAA 3ED8A 2WISA 2WNDA 2C9IA 2YFPA 3BFAA 4NDCA 2GX2A 4DXMA 1F4OA 4PHJA 3ST2A 4WQ2A 1EMBA 4W6CA 3D76A 3R1PA 3DQ6A 2P6BB 1PULA 2MLEC 4PCWA 1SW8A 1OZOA 4ZINA 3WHTB 1T14A 4MLWA 1BT6A 1UWOA 4WQ3A 2L0PA 2LUXA 4C0KA 3NHIA 1MQ1A 2LP2A 1ZMZA 3SVRA 4MSPA 4LJDA 2A56B 1B9AA 3D73A 2WC8A 4H47A 4W6RA 2B3PA 2C9JA 3DPZA 2B3QA 4W7AA 2MRDA 2L5YA 2I94A 3LLEA 1GFLA 2WC5A 3EK8A 3VRNA 1Y6WA 5HKZA 2M97A 1EL4A 1EJ3A 1JSAA 3KPXA 2MA2A 2PVBA 3K1EA 2HRSA 1XYDA 2NCPA 1E8AA 2F33A 4MZLA 2EC6B 1QYQA 3CGLA 2DOQA 4HQCA 1TNPA 4H3MA 4XL5A 4PFEA 3M0WA 5EB6A 1LA0A 1YURA 3O2PA 5KTYA 4MRYA 4MBEA 5TNCA 3SJSA 3V3DA 3I5GC 3DQOA 4D1EA 2HQZA 3U8AA 1WRZA 1MUXA 2KFHA 3TS5C 3S0FA 3L4LA 3VHTA 2VVHA 2M1UA 3FE9A 3H1RA 1S36A 1OOIX 4EDSA 5KTGA 1AVSA 1EXRA 4OY4A 1AJ5A 2LVVA 1F71A 5DPIA 3CZ2A 4DIRA 2H5PA 3S0EA 4PHMA 3PFVA 4P2YB 1DMOA 3LCPC 2L50A 2BAPA 2LE9B 3CFFA 1Q4DA 4FTGA 3VB1A 3SSVA 1OSAA 3CYZA 2K2AA 1EG3A 3A4UB 3OBVA 4TZAA 3NF0A 3LS3A 4IK4A 2KFFA 1J7QA 1XFRA 4EDOA 1K9PA 1FF1A 3I5FC 4DXOA 3A8SA 1N2DA 3VK1A 4W7CA 3CABA 1W7IB 2O24A 1PVBA 1G7KA 2MAZA 1S1EA 1UHJA 1TWOA 5DPJA 3ST0A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 4QJ5B 2OTGC 2E6WA 1MXLC 1BU3A 1FBVA 2ZMWA 4BDUA 2LMVA 5LK4A 3ZULA 4JQ0D 3E5WA 4DXIA 1XAEA 4JRBA 1IG5A 4NWSA 2CTNA 1NCYA 1OOFA 1S3PA 3P8UA 1FI6A 4F7FA 3BUWB 1Y0VH 3RZSA 3DQEA 1VRKA 1BR4B 4I5NB 2IOVA 1KFXS 1K9UA 3OGNA 3GK2A 2MJWB 4PE4A 3E3RA 1IH0A 5EL2A 2JTZA 2FL1A 3DY9A 3DQ7A 3V2LA 2QLHA 1SRAA 1H4UA 3SG4A 5FHVA 3VRRA 1IJ5A 3I5GB 4XOVA 2EHBA 3CS1A 2OTEA 2JNXA 1F55A 3DQHA 1EMEA 2EMOA 1KFUL 4PDZA 2DUEA 4N1FA 3CDNA 4Q04A 1BF5A 4KF5C 5IBWA 1D1OA 5HGEA 4IZNA 1Q73A 5HZOA 1DQEA 3SG3A 3SSKA 4OHSA 4ETOA 4XYNA 1UHHA 1W9ZA 1NCZA 4YGEB 1QXTA 2EGDA 4MN0A 2AUCA 3O78A 1NX1A 4W6NA 3NGVA 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 3VROA 1MHOA 2CNPA 2IS9A 3H4SE 3I5FB 3DQ3A 2BKIB 3GJ1A 2K60A 4ZCUA 2MLFC 3AI5A 1M31A 2QEHA 5EB7A 1NUBA 4JGEA 4DCKA 5HKYA 1NX2A 4NDDA 4ZBLA 5DQMA 4W6JA 2F8PA 3JVTC 4KGEA 2I2RE 2LANA 2OTGB 4GGFC 4W75A 1J7OA 1S26D 4JPZB 3SVBA 2JT3A 5LTQA 3SG5A 2M0RA 3D78A 4W69A 4DRWA 3DZTA 4LQUA 3IF7A 1ZACA 1W7UA 1K96A 3BQ3A 2HGDA 4B30B 1B8RA 1OQPA 4W6DA 1CM1A 4B30A 2OS8C 2IB5A 2OJKA 1DTLA 3CZ1A 1YVHA 4IJ7A 4XVPA 5DPGA 4GUKA 4A4BA 4W77A 3F45A 4ANJA 1U5IB 3ZNIA 4B5YA 4W6MA 4OZDA 1F09A 2COLB 4GGNA 5CSIA 1CFCA 1U5IA 4W6AA 2KDHA 3NEZA 1KCYA 2JOJA 3B87A 2Y4QA 1TOPA 1YHIA 2GW4B 3KO0A 3CR5X 4Q7TA 5DTZA 3DQUA 3EG5B 1JF0A 1F4QA 2F2PA 3OHMB 4P1QA 2JNFA 5DKNA 1OXDA 4YI9A 5BPJA 1F0BA 1TUZA 3FE6A 1C7VA 1TRFA 2P4MA 4PE7A 3SVUA 2L2CA 4ICBA 4ZF5A 1YJFA 2H2KA 1EMMA 4I5LB 2K7BA 1MOVA 2H8QA 4FQOA 4INXA 4YGDB 1N0YA 2ZNEA 1AUIB 4KF5A 5EXUA 1TIZA 3QMEA 1CM4A 1OE9B 4N1GA 1QY3A 3ST3A 4ZFSA 1DGUA 4ORAB 2H5OA 1QV1A 1QX2A 3LL8B 2L4HA 1IQ3A 3PATA 1DJWA 1TNQA 3D75A 1NP8A 3AKAA 3CD9A 1J1EA 4YGCB 2VVJA 2PMYA 1EMAA 3BYAA 1ALWA 3OSQA 3JVTB 5DRFA 1KSMA 4W6IA 3WLDA 1J7PA 3HX4A 4OV2A 4M2QA 2L51A 3DD4A 2NCOA 5H89A 2EC6C 1JBAA 1B7TY 3FWBA 1ZGQA 4W7XA 1JC1A 1IKUA 1DJXA 4PE0A 1A29A 1H4BA 3U0LA 3AKOA 2G6YA 1CB1A 2AWKA 1NPQA 4W72A 3PN7C 1YX8A 1B1GA 5HLVA 3NXAA 2BBMA 1YR5A 1SMGA 3LVDA 2M49B 3KHEA 1G4YR 1Q4EA 4ORCB 1PALA 3B6XA 3WLCA 1KFUS 1QASA 2Y1MA 4KW4A 2VADA 1A4PA 2A54B 3BOWB 3ZUFA 3EKHA 4I5KA 2KNEA 5HZSA 3BOWA 1GL4A 2QACA 2YE0A 1YFPA 5I8NA 2JPOA 2JQ6A 3D77A 3S0BA 3AAJA 5K89A 2FWQA 5JOLA 1PVAA 4M2OA 4OCIA 3PJBA 2LVJA 5HKWA 2JT8A 4OKHA 2NLNA 1JF2A 1W7TA 4A4CA 4R6DA 1XFYO 4J89A 2KSPA 2WCFA 1CFFA 2DDDA 1K90D 3CZTX 3OP0A 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 4YGAA 4AOMA 2WHUA 1B9CA 2JWWA 1KK7Y 3NSOA 3Q8IA 1YUSA 2SASA 1XSSA 3ZUJA 4U8DA 1KK8C 1JBYA 2KGRA 5FYXA 2H5QA 3LSAA 5EHUA 1F8HA 1CDMA 1KP5A 2EMDA 1XFUO 5I94A 1DELA 3LF4B 1LXFC 1UP5A 3ICBA 2LMUA 2AH8A 4U2VA 4GBAA 1J1DA 1M45A 2LLTA 2EMNA 2WCMA 2G2SB 4LJCA 2K61A 4KYNA 2Z1OA 1AJ4A 1F54A 2K2FA 3B88A 4HVFA 1KQMC 1OOHA 3S0DA 1LS8A 3FE8A 2PALA 4YRUA 2ZO7A 4F0ZB 5CSJA 1UURA 1H8BA 1UHNA 3VRPA 5DICA 1C3ZA 1IIOA 4PPKA 2LM5A 1SL8A 1CDNA 1ZFSA 3PN7B 3SS5A 3VHTB 4CFQA 3CWGA 3LVCA 3H1OA 3DQ2A 5DTYA 2A53B 1C3YA 5KSZA 4W6TA 2YDZA 2H8VA 3IR8A 4IK8A 1SY9A 5AXIA 3IP2A 2Q4UA 2OKWA 1XQMA 1WLMA 1NWDA 4OVNF 1KWOC 4KA9A 3R1VA 1PSRA 2LV7A 2GX0A 2FJYA 4EMQA 1RECA 5B8IB 2PRUA 1SK6D 2NXQA 1GGWA 2KOTA 1H6RA 1QX7A 1DJHA 4KAGA 4AR7A 1HCJA 1SCMC 2O29A 2GTEA 4DXQA 2LVIA 2KHNA 2L4IA 3NEDA 4NQGA 2YE1A 4W6FA 2QRFA 3GEXA 1YHHA 3A8RA 3SRYA 1LA3A 1WLZA 2CCMA 1WDCC 2SCPA 4L13A 1XFXO 1SCVA 1RJVA 2L5XB 4DXPA 2A50B 3AAKA 1EG4A 1KK8B 1SBJA 2BCAA 2ERBA 2K8MB 1P28A 2M8UA 2O5GA 3VRQA 4KPIA 2LHIA 2Q6PA 4RYSA 1ZUZA 2JRFA 1C4FA 1TTXA 3DQMA 1K2HA 1AHRA 4HREE 1YRTB 2VRGA 1Z1PA 2ZO6A 1KQMB 2KI6D 4USLA 1FPWA 2LMTA 5J3XA 3BXAA 4L1IA 3I19A 5DTLA 1OMVA 3PJ7A 3DQLA 4W6SA 2CBLA 1RROA 4BY4A 5I2OA 4HRHA 4R6BA 4XJKB 2LP3A 2WCLA 4ZIOA 4XJKA 1SR6C 1S6CA 1Q4BA 5KU1A 1IRJA 1YUUA 3DQ8A 2LVKA 4CIDA 1MOUA 1DC1A 1Z4HA 2WSNA 4PHNA 1KWOB 3NT9A 4W6LA 4AQIA 1QIVA 1L7ZA 5D3OA 3S05A 4E68A 2BL0C 1YZWA 1YUTA 1RWYA 1S6ZA 3IQOA 4PPJA 3BUNB 2KAVA 4W6GA 5FI6A 3SVOA 1UUSA 2LLSA 1ALVA 2JT0A 3EVRA 3BFHA 1EMGA 1LVCD 2VAEA 1B4CA 3CFAA 4NDBA 1BMOA 1SCMB 4GOBA 3DQNA 4OGSA 4Q7UA 1A2XA 3KF9A 3BXKA 5BQLA 3K1KA 3SG7A 1GM0A 1ZGPA 3DVEA 2NZ0A 2A52B 1RRXA 4CPVA 5DPHA 3CB9A 1CFPA 1BFPA 4I5JA 1WDCB 3BXBA 3DQIA 1XK4C 2BCXA 2AWLA 5F9GA 4CFRA 2G3OA 5HLOA 3SVDA 2PYQA 3EVVA 3TUYC 3MGFA 2WCJA 1YTZC 1ORGA 3PM8A 2K0JA 2KBMA 5CSFA 4GNKB 1R2UA 2QEOA 2WHSA 5ER4X 5AERA 2IE2A 3TDZA 3UG0A 3DQAA 5LTRA 1MYWA 5J2OA 2WCHA 5PALA 5F6TA 1IJ6A 3ZWHA 3NSIA 3EK7A 4ZB1A 4XGYA 1OZSA 5FI7A 5CSNA 3QRXA 2A46A 1L2OC 2PXSA 1TUJA 2HF5A 3BUMB 4PALA 5HZUA 1SL9A 1OOGA 2BE6A 2Z6XA 1OMRA 1SR6B 1S5GY 3EK4A 3EKJA 2KI4C 4P5OE 4KEXA 2Q91A 3KCTA 2VZXA 4R1EA 2IB6A 1PSBA 1QJTA 4Q7RA 2DUGA 4L12A 2BECA 2G2BA 3WCKA 3VICA 1N65A 5FI2A 4LQTA 1J55A 2LLUA 5I2LA 2KBIA 4GF6B 2WSOA 2VVIA 2JXLA 4RTCA 2BL0B 2OKYA 3GOFA 4EN1A 2LHLA 3BUOB 3BFBA 5GQQC 3KEVA 3CD1A 4N5XA 3BX9A 2Y0GA 4YBHB 3U0KA 2JTTA 3FWCA 3IVTA 5FVGA 4L9MA 4CLNA 1QLKA 2JZIA 3ADFA 4OR9B 1EMKA 2QEVA 3PJ5A 1OW4A 4XOWA 2DUIA 1TCFA 3LF3A 1RK9A 2GGMA 2JXCA 4PPLA 2H6VA 1A75B 5FVIA 2M29A 1PK0D 3U8CA 2G6EA 2HQKA 3CFHA 1A75A 2ISDA 1NYAA 1XK4A 3TUYB 4IK5A 4DUQA 3LA1A 4N3DA 2LAPA 3DQJA 2QLEA 2HFCA 1CDLA 2ZKMX 3DF0B 2RGIA 2HCGA 1BODA 3DF0A 5EJUA 3NSKA 1B47A 3BUXB 1SSEB 3M24A 1Q80A 1SPYA 2GGZA 3I5IC 4PHKA 1M63B 1SL7A 1CTRA 4ORBB 2V53A 4JKTA 2LCPA 4DXNA 1CDPA 2JU0A 3DQKA 2H5RA 1MWNA 3NT3A 3EVPA 2GV5A 1JWDA 2O60A 2B1UA 3N7HA 3TMRA 2HGYA 4IK9A 1L2OB 3CZ0A 1GJYA 2KPHA 4JEOA 3SVCA 1B7TZ 2A47A 2AHAA 4J8AA 2FCEA 2WC6A 5HZTA 2Q57A 3OGOA 3R72A 1NX0A 4ZF4A 1ZOTB 1RTP1 3PALA 2KI4B 3CR2A 1J7RA 2HQWA 2KGBC 4W7RA 2KAYA 3W1DA 5AANA 1OXFA 1EH2A 1X02A 3G9AA 5D7FA 2HJOA 4TNCA 4JD9A 3SVSA 3CR4X 3PLFB 4KW9A 1DJZA 1QV0A 3DQ5A 4ZF3A 2M1KB 5BTTB 3JTDC 3AKBA 2O2BA 3SS4A 2PASA 1CV7A 4PE1A 5BTTA 1Y1UA 1LKJA 3D74A 1CLLA 1UHIA 4IK1A 3PM2A 3E5TA 5BT0A 3UFZA 1RMOA 2PXWA 5I2QA 2R2IA 2P71A 2K7OA 3D10A 1QS7A 4QJ4B 2F3YA 1CMFA 2BTJA 1KYRA 4JC2A 1JFJA 4MZKA 4EULA 3OX6A 4H3NA 1RMPA 1QXPA 1NIWA 3BJHA 1FW4A 3SSYA 4FQTA 2WORA 3AI4A 1ZGOA 1YX7A 1GQMA 5HYDA 1QVIZ 1UISA 1QYFA 2L2EA 1KK7Z 1DJGA 2MHHA 3OSRA 3O4XA 1YVLA 2Y1NA 1RMMA 3I5IB 4J88A 3DQDA 1XFWO 4MRXA 4P76A 1XA5A 3D0YB 3GL4A 4C0JA 1QYOA 3WNXB 4HRGA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2FZUA 5DKQA 3U8PA 4Q9WA 1W7JB 3LK1A 1M46A 2WCEA 1IGVA 2AWJA 4KF4A 1JBZA 2DUHA 3E5VA 5EXCI 1UHKA 3L47A 1S6IA 2I18A 5HBDA 1DJIA 3TDIA 2G6XA 3SS0A 3PJIA 5H87A 1EMLA 1QATA 1B8CA 1NSHA 3ZTFA 1TNXA 2FOTA 1DGVA 3RWAA 3RLZA 4W74A 3IQQA 3U0MA 1DVIA 4Z4KA 4W6UA 1BR1B 3O6BA 2JC2A 3DQ4A 1KYPA 1CNPA 3B7AA 4BY5A 4JWQA 3JTDB 1K93D 3SSTA 4HE4A 2ZNDA 4GFTA 4QJ3B 4GAOA 4KW8A 1C07A 4W7FA 3DPWA 4WRIA 2LUCA 1CLBA 4C0LA 1Q4AA 2DDCA 2QPTA 3KCSA 2WOSA 1RFJA 1IQ5A 3NHTA 2QLGB 2K7DA 3SIBA 2A4JA 3P28A 2H61C 1Z2CB 1BOCA 2QLGA 1G8IA 1YHGA 1XMZA 3M22A 2M3WA 1V1FA 1ODBA 1GGZA 3TDUA 2V4EC 2D8NA 3FIAA 2G5ZB 1K94A 3WHUB 2KLDA 2ZRTA 3PIBA 3DVMA 1XO5A 2QDIA 3DYEA 3MSEB 5DRGA 1S6JA 1YJ2A 2LC5A 2FCDA 1QLSA 5CPVA 4W6PA 2HPSA 5ER5A 1C7WA 1DT7B 1NCXA 1BLQA 1M39A 2KQ6A 5H88A 2KI6C 1ZUXA 1JUOA 1A03A 3SSHA 4HQ9A 3CLNA 3GK4X 3DQ9A 3TS5B 4W7DA 5AEQA 3I5HC 3OX5A 2OTBA 2M9GA 1WY9A 3CTNA 2WIQA 2BCBA 2HQ8A 2ICRA 2BKHB 1OXEA 2Z6ZA 3B86A 1K8UA 2WURA 2ARLA 3GK1A 4W73A 3FS7A 4M2PA 3RM1A 4UPGA 2M7NA 1QIWA 1QX5B 3W1CA
chains in the Genus database with same CATH topology
1LINA 1GGXA 2QLIA 5DU0A 1NX3A 4W6HA 1JFKA 3OB1B 2TN4A 2ZN8A 2WHTA 2KQYA 1KQVA 1OOJA 2DUFA 3K21A 3RWTA 1HT9A 3TZ1A 2QU1A 4Q9XA 1WRLA 5DY6A 2ZFDA 5G08A 2Z6YA 4TZGA 4KGFA 4OQWA 4W6BA 1HUYA 2ZRSA 1XA9A 3SSPA 4LJBA 3GB3A 1MF8B 4AS8A 1Y1AA 2QZ0A 1CFDA 2GW3A 4IL1A 4Z4MA 2PSRA 2K7CA 2E30A 1F70A 2G16B 5LTPA 1B8LA 1JC0A 2H61A 2KFGA 1DF0B 1AP4A 2F2OA 3DVKA 2ZMUA 3U0NA 3O4YA 2V4EB 1TNWA 4UTSA 1DF0A 3TMTA 1SYMA 2JADA 2V4EA 1CMGA 3NSLA 3SIAA 3BXCA 3SVEA 2POXA 1MXEA 2DD9A 3SVNA 3O77A 3DQ1A 2KAXA 2QT2A 1IWQA 4AQJA 3DVJA 1YRUB 5HW9A 4YGBB 3I5HB 1EMFA 3WXAA 2DD7A 4IK3A 3OB2B 4JFGA 1BG1A 4ORNA 1V1GA 2BE4A 2H9WA 4LJDC 1EMCA 2HPWA 1Y1XA 2ZN9A 1PRWA 2CT9A 3CGAA 4DKNA 1FI5A 1CLMA 1BJFA 2G9BA 2M7LA 1W7SA 3PSRA 4W76A 1KSOA 2OGRA 5DKRA 1S5GZ 2G3DB 2CXJA 2AWMA 3C1VA 3VGOA 5AFPA 1CKKA 1XFZO 2A48A 1QTXA 4H48A 4I2YA 4DS7A 4W6KA 2WCBA 2MBXA 3GJ2A 4JF9A 3SV5A 4DKMA 4W6OA 1K9KA 3SG2A 5T3IA 4GESB 4ZCVA 4H3LA 1SNLA 4W7EA 4LW5A 3ST4A 2LNKA 4OJ0A 2HETA 3DQFA 1RM9A 3SSLA 2OPOA 4GGFA 1Z1QA 1SKTA 2I7AA 4HQ8A 5EXBA 5AQBB 3LK0A 2BBNA 2RH7A 2OS8B 1MR8A 5D69A 1KFXL 1TN4A 4GPLB 2JULA 1R6PA 1Q4CA 3EVUA 1OMDA 1JC2A 4MEWA 1K95A 4RYWA 1G33A 1KYSA 1HQVA 2FJUB 5DTXA 3DPXA 1WRKA 3DQCA 5EBJA 3CBEA 3SG6A 5DQBA 4HSZA 5FVFA 3LVAA 3ED8A 2WISA 2WNDA 2C9IA 2YFPA 4NDCA 2GX2A 4DXMA 1F4OA 4PHJA 3ST2A 4WQ2A 1EMBA 4W6CA 3DQ6A 2P6BB 1PULA 2MLEC 4PCWA 1SW8A 1OZOA 4ZINA 3WHTB 4MLWA 1BT6A 1UWOA 4WQ3A 2L0PA 2LUXA 4C0KA 1MQ1A 2LP2A 1ZMZA 3SVRA 4MSPA 4LJDA 2A56B 1B9AA 2WC8A 4H47A 4W6RA 2B3PA 2C9JA 3DPZA 2B3QA 4W7AA 2MRDA 2I94A 3LLEA 1GFLA 3EK8A 3VRNA 1Y6WA 5HKZA 2M97A 1EL4A 1EJ3A 1JSAA 3KPXA 2MA2A 2PVBA 2HRSA 1XYDA 2NCPA 1E8AA 2F33A 4MZLA 2EC6B 1QYQA 3CGLA 2DOQA 4HQCA 1TNPA 4H3MA 4XL5A 4PFEA 3M0WA 5EB6A 1LA0A 1YURA 3O2PA 5KTYA 4MRYA 4MBEA 5TNCA 3SJSA 3V3DA 3I5GC 3DQOA 4D1EA 2HQZA 3U8AA 1WRZA 1MUXA 2KFHA 3TS5C 3VHTA 2VVHA 2M1UA 3H1RA 1S36A 4EDSA 5KTGA 1AVSA 1EXRA 4OY4A 1AJ5A 2LVVA 1F71A 5DPIA 4DIRA 2H5PA 4PHMA 3PFVA 4P2YB 1DMOA 3LCPC 2L50A 2LE9B 4FTGA 1Q4DA 3CFFA 3SSVA 1OSAA 2K2AA 1EG3A 3A4UB 4TZAA 3NF0A 3LS3A 4IK4A 2KFFA 1J7QA 4EDOA 1K9PA 1FF1A 3I5FC 4DXOA 3A8SA 1N2DA 3VK1A 4W7CA 1W7IB 2O24A 1PVBA 1G7KA 2MAZA 1S1EA 1UHJA 5DPJA 3ST0A 2AMIA 2L98A 2KYCA 5JJGA 1XFVO 4QJ5B 2OTGC 2E6WA 1MXLC 1BU3A 1FBVA 2ZMWA 4BDUA 2LMVA 5LK4A 3ZULA 4JQ0D 3E5WA 4DXIA 1XAEA 4JRBA 1IG5A 4NWSA 2CTNA 1NCYA 1S3PA 3P8UA 1FI6A 3BUWB 1Y0VH 3DQEA 1VRKA 1BR4B 4I5NB 2IOVA 1KFXS 1K9UA 3GK2A 2MJWB 4PE4A 3E3RA 1IH0A 2JTZA 2FL1A 3DQ7A 2QLHA 1SRAA 1H4UA 3SG4A 5FHVA 3VRRA 1IJ5A 3I5GB 4XOVA 2EHBA 3CS1A 2OTEA 2JNXA 1F55A 3DQHA 1EMEA 2EMOA 1KFUL 4PDZA 2DUEA 4N1FA 4Q04A 1BF5A 4KF5C 5IBWA 1D1OA 5HGEA 4IZNA 1Q73A 5HZOA 3SG3A 3SSKA 4OHSA 4ETOA 4XYNA 1UHHA 1NCZA 4YGEB 1QXTA 2EGDA 4MN0A 2AUCA 3O78A 1NX1A 4W6NA 2KYFA 1XVJA 2Y5IA 1TCOB 3HCMA 3VROA 1MHOA 2CNPA 2IS9A 3H4SE 3I5FB 3DQ3A 2BKIB 3GJ1A 4ZCUA 2MLFC 3AI5A 1M31A 5EB7A 1NUBA 4JGEA 4DCKA 5HKYA 1NX2A 4NDDA 4ZBLA 5DQMA 4W6JA 2F8PA 3JVTC 4KGEA 2I2RE 2LANA 2OTGB 4GGFC 4W75A 1J7OA 1S26D 4JPZB 3SVBA 2JT3A 5LTQA 3SG5A 2M0RA 4W69A 4DRWA 4LQUA 3IF7A 1ZACA 1W7UA 1K96A 3BQ3A 2HGDA 4B30B 1B8RA 1OQPA 4W6DA 1CM1A 4B30A 2OS8C 2IB5A 2OJKA 1DTLA 1YVHA 4XVPA 5DPGA 4GUKA 4A4BA 4W77A 3F45A 4ANJA 1U5IB 3ZNIA 4B5YA 4W6MA 1F09A 2COLB 4GGNA 5CSIA 1CFCA 1U5IA 4W6AA 2KDHA 3NEZA 1KCYA 2JOJA 2Y4QA 1TOPA 1YHIA 2GW4B 3KO0A 3CR5X 4Q7TA 5DTZA 3DQUA 1JF0A 1F4QA 2F2PA 3OHMB 4P1QA 2JNFA 5DKNA 1OXDA 4YI9A 5BPJA 1F0BA 1C7VA 1TRFA 2P4MA 4PE7A 3SVUA 4ICBA 4ZF5A 1YJFA 2H2KA 1EMMA 4I5LB 2K7BA 1MOVA 2H8QA 4FQOA 4YGDB 1N0YA 2ZNEA 1AUIB 4KF5A 5EXUA 1TIZA 1CM4A 1OE9B 4N1GA 1QY3A 3ST3A 4ZFSA 1DGUA 4ORAB 2H5OA 1QV1A 1QX2A 3LL8B 2L4HA 1IQ3A 3PATA 1DJWA 1TNQA 1NP8A 3AKAA 3CD9A 1J1EA 4YGCB 2VVJA 2PMYA 1EMAA 3BYAA 1ALWA 3OSQA 3JVTB 5DRFA 1KSMA 4W6IA 3WLDA 1J7PA 3HX4A 4OV2A 4M2QA 2L51A 3DD4A 2NCOA 5H89A 2EC6C 1JBAA 1B7TY 3FWBA 1ZGQA 4W7XA 1JC1A 1IKUA 1DJXA 4PE0A 1A29A 1H4BA 3U0LA 3AKOA 2G6YA 1CB1A 2AWKA 1NPQA 4W72A 3PN7C 1YX8A 1B1GA 5HLVA 3NXAA 2BBMA 1YR5A 1SMGA 3LVDA 2M49B 3KHEA 1G4YR 1Q4EA 4ORCB 1PALA 3WLCA 1KFUS 1QASA 2Y1MA 4KW4A 2VADA 1A4PA 2A54B 3BOWB 3ZUFA 3EKHA 4I5KA 2KNEA 5HZSA 3BOWA 1GL4A 2QACA 2YE0A 1YFPA 5I8NA 2JQ6A 3AAJA 5K89A 2FWQA 5JOLA 1PVAA 4M2OA 4OCIA 3PJBA 2LVJA 5HKWA 2JT8A 4OKHA 2NLNA 1JF2A 1W7TA 4A4CA 4R6DA 1XFYO 4J89A 2KSPA 2WCFA 1CFFA 2DDDA 1K90D 3CZTX 3OP0A 4MVFA 1QVIY 2JPTA 1DJYA 4YI8A 4YGAA 4AOMA 2WHUA 1B9CA 2JWWA 1KK7Y 3NSOA 1YUSA 2SASA 1XSSA 3ZUJA 4U8DA 1KK8C 1JBYA 2KGRA 5FYXA 2H5QA 3LSAA 5EHUA 1F8HA 1CDMA 1KP5A 2EMDA 1XFUO 3LF4B 1LXFC 1UP5A 3ICBA 2LMUA 2AH8A 4U2VA 4GBAA 1J1DA 1M45A 2LLTA 2EMNA 2G2SB 4LJCA 2K61A 2Z1OA 1AJ4A 1F54A 2K2FA 4HVFA 1KQMC 2PALA 4YRUA 2ZO7A 4F0ZB 5CSJA 1UURA 1H8BA 1UHNA 3VRPA 4PPKA 2LM5A 1SL8A 1CDNA 1ZFSA 3PN7B 3VHTB 4CFQA 3CWGA 3LVCA 3H1OA 3DQ2A 5DTYA 2A53B 5KSZA 4W6TA 2YDZA 3IR8A 4IK8A 1SY9A 5AXIA 3IP2A 2Q4UA 2OKWA 1XQMA 1WLMA 1NWDA 4OVNF 1KWOC 4KA9A 1PSRA 2LV7A 2GX0A 4EMQA 1RECA 5B8IB 2PRUA 1SK6D 2NXQA 1GGWA 2KOTA 1H6RA 1QX7A 1DJHA 4KAGA 4AR7A 1HCJA 1SCMC 2O29A 4DXQA 2LVIA 2KHNA 2L4IA 3NEDA 4NQGA 2YE1A 4W6FA 2QRFA 3GEXA 1YHHA 3A8RA 3SRYA 1LA3A 1WLZA 2CCMA 1WDCC 2SCPA 4L13A 1XFXO 1SCVA 1RJVA 2L5XB 4DXPA 2A50B 3AAKA 1EG4A 1KK8B 1SBJA 2BCAA 2K8MB 2M8UA 2O5GA 3VRQA 4KPIA 2LHIA 2Q6PA 4RYSA 1ZUZA 2JRFA 1C4FA 1TTXA 3DQMA 1K2HA 1AHRA 4HREE 1YRTB 2VRGA 1Z1PA 2ZO6A 1KQMB 2KI6D 4USLA 1FPWA 2LMTA 5J3XA 3BXAA 4L1IA 3I19A 5DTLA 1OMVA 3PJ7A 3DQLA 4W6SA 2CBLA 1RROA 4BY4A 5I2OA 4HRHA 4R6BA 4XJKB 2LP3A 4ZIOA 4XJKA 1SR6C 1S6CA 1Q4BA 5KU1A 1IRJA 1YUUA 3DQ8A 2LVKA 4CIDA 1MOUA 2WSNA 4PHNA 1KWOB 3NT9A 4W6LA 4AQIA 1QIVA 1L7ZA 3S05A 4E68A 2BL0C 1YZWA 1YUTA 1RWYA 1S6ZA 3IQOA 4PPJA 3BUNB 2KAVA 4W6GA 3SVOA 1UUSA 2LLSA 1ALVA 2JT0A 3EVRA 1EMGA 1LVCD 2VAEA 1B4CA 3CFAA 4NDBA 1BMOA 1SCMB 4GOBA 3DQNA 4OGSA 4Q7UA 1A2XA 3KF9A 3BXKA 5BQLA 3K1KA 3SG7A 1ZGPA 3DVEA 2NZ0A 2A52B 1RRXA 4CPVA 5DPHA 3CB9A 1CFPA 1BFPA 4I5JA 1WDCB 3BXBA 3DQIA 1XK4C 2BCXA 2AWLA 5F9GA 4CFRA 2G3OA 5HLOA 3SVDA 3EVVA 3TUYC 3MGFA 1YTZC 3PM8A 2K0JA 2KBMA 5CSFA 4GNKB 1R2UA 2WHSA 5ER4X 5AERA 2IE2A 3TDZA 3UG0A 3DQAA 5LTRA 1MYWA 5J2OA 5PALA 5F6TA 1IJ6A 3ZWHA 3NSIA 3EK7A 4ZB1A 4XGYA 1OZSA 5CSNA 3QRXA 2A46A 1L2OC 2PXSA 2HF5A 3BUMB 4PALA 5HZUA 1SL9A 2BE6A 2Z6XA 1OMRA 1SR6B 1S5GY 3EK4A 3EKJA 2KI4C 4P5OE 4KEXA 2Q91A 3KCTA 2VZXA 4R1EA 2IB6A 1PSBA 1QJTA 4Q7RA 2DUGA 4L12A 2BECA 2G2BA 3WCKA 3VICA 1N65A 4LQTA 1J55A 2LLUA 5I2LA 2KBIA 4GF6B 2WSOA 2VVIA 2JXLA 4RTCA 2BL0B 2OKYA 3GOFA 4EN1A 2LHLA 3BUOB 5GQQC 3KEVA 3CD1A 4N5XA 3BX9A 2Y0GA 4YBHB 3U0KA 2JTTA 3FWCA 5FVGA 4L9MA 4CLNA 1QLKA 2JZIA 3ADFA 4OR9B 1EMKA 3PJ5A 4XOWA 2DUIA 1TCFA 3LF3A 1RK9A 2GGMA 2JXCA 4PPLA 2H6VA 1A75B 5FVIA 2M29A 1PK0D 3U8CA 2G6EA 2HQKA 3CFHA 1A75A 2ISDA 1NYAA 1XK4A 3TUYB 4IK5A 4DUQA 3LA1A 4N3DA 2LAPA 3DQJA 2QLEA 2HFCA 1CDLA 2ZKMX 3DF0B 2RGIA 2HCGA 1BODA 3DF0A 5EJUA 3NSKA 1B47A 3BUXB 3M24A 1Q80A 1SPYA 2GGZA 3I5IC 4PHKA 1M63B 1SL7A 1CTRA 4ORBB 2V53A 2LCPA 4DXNA 1CDPA 2JU0A 3DQKA 2H5RA 1MWNA 3NT3A 3EVPA 2GV5A 1JWDA 2O60A 2B1UA 3TMRA 2HGYA 4IK9A 1L2OB 1GJYA 4JEOA 3SVCA 1B7TZ 2A47A 2AHAA 4J8AA 2FCEA 5HZTA 2Q57A 3OGOA 1NX0A 4ZF4A 1ZOTB 1RTP1 3PALA 2KI4B 3CR2A 1J7RA 2HQWA 2KGBC 4W7RA 2KAYA 3W1DA 5AANA 1OXFA 1EH2A 1X02A 3G9AA 5D7FA 2HJOA 4TNCA 3SVSA 3CR4X 3PLFB 4KW9A 1DJZA 1QV0A 3DQ5A 4ZF3A 2M1KB 5BTTB 3JTDC 3AKBA 2O2BA 2PASA 1CV7A 4PE1A 5BTTA 1Y1UA 1LKJA 1CLLA 1UHIA 4IK1A 3E5TA 5BT0A 3UFZA 1RMOA 2PXWA 5I2QA 2R2IA 2K7OA 3D10A 1QS7A 4QJ4B 2F3YA 1CMFA 2BTJA 1KYRA 4JC2A 1JFJA 4MZKA 4EULA 3OX6A 4H3NA 1RMPA 1QXPA 1NIWA 1FW4A 3SSYA 2WORA 3AI4A 1ZGOA 1YX7A 1GQMA 5HYDA 1QVIZ 1UISA 1QYFA 2L2EA 1KK7Z 1DJGA 2MHHA 3OSRA 1YVLA 2Y1NA 1RMMA 3I5IB 4J88A 3DQDA 1XFWO 4MRXA 4P76A 1XA5A 3D0YB 3GL4A 4C0JA 1QYOA 3WNXB 4HRGA 3D0YA 4MZJA 2F3ZA 1AK8A 2AAOA 2FZUA 5DKQA 3U8PA 4Q9WA 1W7JB 3LK1A 1M46A 2WCEA 1IGVA 2AWJA 4KF4A 1JBZA 2DUHA 3E5VA 5EXCI 1UHKA 1S6IA 2I18A 5HBDA 1DJIA 3TDIA 2G6XA 3SS0A 5H87A 1EMLA 1QATA 1B8CA 1NSHA 3ZTFA 1TNXA 2FOTA 1DGVA 3RWAA 3RLZA 4W74A 3IQQA 3U0MA 1DVIA 4Z4KA 4W6UA 1BR1B 3O6BA 2JC2A 3DQ4A 1KYPA 1CNPA 4BY5A 4JWQA 3JTDB 1K93D 3SSTA 4HE4A 2ZNDA 4GFTA 4QJ3B 4GAOA 4KW8A 1C07A 4W7FA 3DPWA 4WRIA 2LUCA 1CLBA 4C0LA 1Q4AA 2DDCA 2QPTA 3KCSA 2WOSA 1RFJA 1IQ5A 2QLGB 2K7DA 3SIBA 2A4JA 3P28A 2H61C 1BOCA 2QLGA 1G8IA 1YHGA 1XMZA 3M22A 2M3WA 1V1FA 1ODBA 1GGZA 3TDUA 2V4EC 2D8NA 3FIAA 2G5ZB 1K94A 3WHUB 2ZRTA 3PIBA 3DVMA 1XO5A 5DRGA 3MSEB 1S6JA 1YJ2A 2LC5A 2FCDA 1QLSA 5CPVA 4W6PA 2HPSA 5ER5A 1C7WA 1DT7B 1NCXA 1BLQA 1M39A 2KQ6A 5H88A 2KI6C 1ZUXA 1JUOA 1A03A 3SSHA 4HQ9A 4W7DA 3CLNA 3GK4X 3TS5B 3DQ9A 5AEQA 3I5HC 3OX5A 2OTBA 2M9GA 1WY9A 3CTNA 2WIQA 2BCBA 2HQ8A 2ICRA 2BKHB 1OXEA 2Z6ZA 1K8UA 2WURA 2ARLA 3GK1A 4W73A 3FS7A 4M2PA 3RM1A 4UPGA 2M7NA 1QIWA 1QX5B 3W1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIN A;  1GGX A;  2QLI A;  5DU0 A;  1NX3 A;  4W6H A;  1JFK A;  3OB1 B;  2TN4 A;  2ZN8 A;  2WHT A;  2KQY A;  1KQV A;  1OOJ A;  2DUF A;  3K21 A;  3RWT A;  1HT9 A;  3TZ1 A;  2QU1 A;  4Q9X A;  1WRL A;  5DY6 A;  2ZFD A;  5G08 A;  2Z6Y A;  4TZG A;  4KGF A;  4OQW A;  4W6B A;  1HUY A;  2ZRS A;  1XA9 A;  3SSP A;  4LJB A;  3GB3 A;  1MF8 B;  4AS8 A;  1Y1A A;  2QZ0 A;  1CFD A;  2GW3 A;  4IL1 A;  4Z4M A;  2PSR A;  2K7C A;  2E30 A;  1F70 A;  2G16 B;  5LTP A;  1B8L A;  1JC0 A;  2H61 A;  2KFG A;  1DF0 B;  1AP4 A;  2F2O A;  3DVK A;  2ZMU A;  3U0N A;  3O4Y A;  2V4E B;  1TNW A;  4UTS A;  1DF0 A;  3TMT A;  1SYM A;  2JAD A;  2V4E A;  1CMG A;  3NSL A;  3SIA A;  3BXC A;  3SVE A;  2POX A;  1MXE A;  2DD9 A;  3SVN A;  3O77 A;  3DQ1 A;  2KAX A;  2QT2 A;  1IWQ A;  4AQJ A;  3DVJ A;  1YRU B;  5HW9 A;  4YGB B;  3I5H B;  1EMF A;  3WXA A;  2DD7 A;  4IK3 A;  3OB2 B;  4JFG A;  1BG1 A;  4ORN A;  1V1G A;  2BE4 A;  2H9W A;  4LJD C;  1EMC A;  2HPW A;  1Y1X A;  2ZN9 A;  1PRW A;  2CT9 A;  3CGA A;  4DKN A;  1FI5 A;  1CLM A;  1BJF A;  2G9B A;  2M7L A;  1W7S A;  3PSR A;  4W76 A;  1KSO A;  2OGR A;  5DKR A;  1S5G Z;  2G3D B;  2CXJ A;  2AWM A;  3C1V A;  3VGO A;  5AFP A;  1CKK A;  1XFZ O;  2A48 A;  1QTX A;  4H48 A;  4I2Y A;  4DS7 A;  4W6K A;  2WCB A;  2MBX A;  3GJ2 A;  4JF9 A;  3SV5 A;  4DKM A;  4W6O A;  1K9K A;  3SG2 A;  5T3I A;  4GES B;  4ZCV A;  4H3L A;  1SNL A;  4W7E A;  4LW5 A;  3ST4 A;  2LNK A;  4OJ0 A;  2HET A;  3DQF A;  1RM9 A;  3SSL A;  2OPO A;  4GGF A;  1Z1Q A;  1SKT A;  2I7A A;  4HQ8 A;  5EXB A;  5AQB B;  3LK0 A;  2BBN A;  2RH7 A;  2OS8 B;  1MR8 A;  5D69 A;  1KFX L;  1TN4 A;  4GPL B;  2JUL A;  1R6P A;  1Q4C A;  3EVU A;  1OMD A;  1JC2 A;  4MEW A;  1K95 A;  4RYW A;  1G33 A;  1KYS A;  1HQV A;  2FJU B;  5DTX A;  3DPX A;  1WRK A;  3DQC A;  5EBJ A;  3CBE A;  3SG6 A;  5DQB A;  4HSZ A;  5FVF A;  3LVA A;  3ED8 A;  2WIS A;  2WND A;  2C9I A;  2YFP A;  4NDC A;  2GX2 A;  4DXM A;  1F4O A;  4PHJ A;  3ST2 A;  4WQ2 A;  1EMB A;  4W6C A;  3DQ6 A;  2P6B B;  1PUL A;  2MLE C;  4PCW A;  1SW8 A;  1OZO A;  4ZIN A;  3WHT B;  4MLW A;  1BT6 A;  1UWO A;  4WQ3 A;  2L0P A;  2LUX A;  4C0K A;  1MQ1 A;  2LP2 A;  1ZMZ A;  3SVR A;  4MSP A;  4LJD A;  2A56 B;  1B9A A;  2WC8 A;  4H47 A;  4W6R A;  2B3P A;  2C9J A;  3DPZ A;  2B3Q A;  4W7A A;  2MRD A;  2I94 A;  3LLE A;  1GFL A;  3EK8 A;  3VRN A;  1Y6W A;  5HKZ A;  2M97 A;  1EL4 A;  1EJ3 A;  1JSA A;  3KPX A;  2MA2 A;  2PVB A;  2HRS A;  1XYD A;  2NCP A;  1E8A A;  2F33 A;  4MZL A;  2EC6 B;  1QYQ A;  3CGL A;  2DOQ A;  4HQC A;  1TNP A;  4H3M A;  4XL5 A;  4PFE A;  3M0W A;  5EB6 A;  1LA0 A;  1YUR A;  3O2P A;  5KTY A;  4MRY A;  4MBE A;  5TNC A;  3SJS A;  3V3D A;  3I5G C;  3DQO A;  4D1E A;  2HQZ A;  3U8A A;  1WRZ A;  1MUX A;  2KFH A;  3TS5 C;  3VHT A;  2VVH A;  2M1U A;  3H1R A;  1S36 A;  4EDS A;  5KTG A;  1AVS A;  1EXR A;  4OY4 A;  1AJ5 A;  2LVV A;  1F71 A;  5DPI A;  4DIR A;  2H5P A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  3LCP C;  2L50 A;  2LE9 B;  4FTG A;  1Q4D A;  3CFF A;  3SSV A;  1OSA A;  2K2A A;  1EG3 A;  3A4U B;  4TZA A;  3NF0 A;  3LS3 A;  4IK4 A;  2KFF A;  1J7Q A;  4EDO A;  1K9P A;  1FF1 A;  3I5F C;  4DXO A;  3A8S A;  1N2D A;  3VK1 A;  4W7C A;  1W7I B;  2O24 A;  1PVB A;  1G7K A;  2MAZ A;  1S1E A;  1UHJ A;  5DPJ A;  3ST0 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  4QJ5 B;  2OTG C;  2E6W A;  1MXL C;  1BU3 A;  1FBV A;  2ZMW A;  4BDU A;  2LMV A;  5LK4 A;  3ZUL A;  4JQ0 D;  3E5W A;  4DXI A;  1XAE A;  4JRB A;  1IG5 A;  4NWS A;  2CTN A;  1NCY A;  1S3P A;  3P8U A;  1FI6 A;  3BUW B;  1Y0V H;  3DQE A;  1VRK A;  1BR4 B;  4I5N B;  2IOV A;  1KFX S;  1K9U A;  3GK2 A;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  2JTZ A;  2FL1 A;  3DQ7 A;  2QLH A;  1SRA A;  1H4U A;  3SG4 A;  5FHV A;  3VRR A;  1IJ5 A;  3I5G B;  4XOV A;  2EHB A;  3CS1 A;  2OTE A;  2JNX A;  1F55 A;  3DQH A;  1EME A;  2EMO A;  1KFU L;  4PDZ A;  2DUE A;  4N1F A;  4Q04 A;  1BF5 A;  4KF5 C;  5IBW A;  1D1O A;  5HGE A;  4IZN A;  1Q73 A;  5HZO A;  3SG3 A;  3SSK A;  4OHS A;  4ETO A;  4XYN A;  1UHH A;  1NCZ A;  4YGE B;  1QXT A;  2EGD A;  4MN0 A;  2AUC A;  3O78 A;  1NX1 A;  4W6N A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  3VRO A;  1MHO A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3DQ3 A;  2BKI B;  3GJ1 A;  4ZCU A;  2MLF C;  3AI5 A;  1M31 A;  5EB7 A;  1NUB A;  4JGE A;  4DCK A;  5HKY A;  1NX2 A;  4NDD A;  4ZBL A;  5DQM A;  4W6J A;  2F8P A;  3JVT C;  4KGE A;  2I2R E;  2LAN A;  2OTG B;  4GGF C;  4W75 A;  1J7O A;  1S26 D;  4JPZ B;  3SVB A;  2JT3 A;  5LTQ A;  3SG5 A;  2M0R A;  4W69 A;  4DRW A;  4LQU A;  3IF7 A;  1ZAC A;  1W7U A;  1K96 A;  3BQ3 A;  2HGD A;  4B30 B;  1B8R A;  1OQP A;  4W6D A;  1CM1 A;  4B30 A;  2OS8 C;  2IB5 A;  2OJK A;  1DTL A;  1YVH A;  4XVP A;  5DPG A;  4GUK A;  4A4B A;  4W77 A;  3F45 A;  4ANJ A;  1U5I B;  3ZNI A;  4B5Y A;  4W6M A;  1F09 A;  2COL B;  4GGN A;  5CSI A;  1CFC A;  1U5I A;  4W6A A;  2KDH A;  3NEZ A;  1KCY A;  2JOJ A;  2Y4Q A;  1TOP A;  1YHI A;  2GW4 B;  3KO0 A;  3CR5 X;  4Q7T A;  5DTZ A;  3DQU A;  1JF0 A;  1F4Q A;  2F2P A;  3OHM B;  4P1Q A;  2JNF A;  5DKN A;  1OXD A;  4YI9 A;  5BPJ A;  1F0B A;  1C7V A;  1TRF A;  2P4M A;  4PE7 A;  3SVU A;  4ICB A;  4ZF5 A;  1YJF A;  2H2K A;  1EMM A;  4I5L B;  2K7B A;  1MOV A;  2H8Q A;  4FQO A;  4YGD B;  1N0Y A;  2ZNE A;  1AUI B;  4KF5 A;  5EXU A;  1TIZ A;  1CM4 A;  1OE9 B;  4N1G A;  1QY3 A;  3ST3 A;  4ZFS A;  1DGU A;  4ORA B;  2H5O A;  1QV1 A;  1QX2 A;  3LL8 B;  2L4H A;  1IQ3 A;  3PAT A;  1DJW A;  1TNQ A;  1NP8 A;  3AKA A;  3CD9 A;  1J1E A;  4YGC B;  2VVJ A;  2PMY A;  1EMA A;  3BYA A;  1ALW A;  3OSQ A;  3JVT B;  5DRF A;  1KSM A;  4W6I A;  3WLD A;  1J7P A;  3HX4 A;  4OV2 A;  4M2Q A;  2L51 A;  3DD4 A;  2NCO A;  5H89 A;  2EC6 C;  1JBA A;  1B7T Y;  3FWB A;  1ZGQ A;  4W7X A;  1JC1 A;  1IKU A;  1DJX A;  4PE0 A;  1A29 A;  1H4B A;  3U0L A;  3AKO A;  2G6Y A;  1CB1 A;  2AWK A;  1NPQ A;  4W72 A;  3PN7 C;  1YX8 A;  1B1G A;  5HLV A;  3NXA A;  2BBM A;  1YR5 A;  1SMG A;  3LVD A;  2M49 B;  3KHE A;  1G4Y R;  1Q4E A;  4ORC B;  1PAL A;  3WLC A;  1KFU S;  1QAS A;  2Y1M A;  4KW4 A;  2VAD A;  1A4P A;  2A54 B;  3BOW B;  3ZUF A;  3EKH A;  4I5K A;  2KNE A;  5HZS A;  3BOW A;  1GL4 A;  2QAC A;  2YE0 A;  1YFP A;  5I8N A;  2JQ6 A;  3AAJ A;  5K89 A;  2FWQ A;  5JOL A;  1PVA A;  4M2O A;  4OCI A;  3PJB A;  2LVJ A;  5HKW A;  2JT8 A;  4OKH A;  2NLN A;  1JF2 A;  1W7T A;  4A4C A;  4R6D A;  1XFY O;  4J89 A;  2KSP A;  2WCF A;  1CFF A;  2DDD A;  1K90 D;  3CZT X;  3OP0 A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  4YGA A;  4AOM A;  2WHU A;  1B9C A;  2JWW A;  1KK7 Y;  3NSO A;  1YUS A;  2SAS A;  1XSS A;  3ZUJ A;  4U8D A;  1KK8 C;  1JBY A;  2KGR A;  5FYX A;  2H5Q A;  3LSA A;  5EHU A;  1F8H A;  1CDM A;  1KP5 A;  2EMD A;  1XFU O;  3LF4 B;  1LXF C;  1UP5 A;  3ICB A;  2LMU A;  2AH8 A;  4U2V A;  4GBA A;  1J1D A;  1M45 A;  2LLT A;  2EMN A;  2G2S B;  4LJC A;  2K61 A;  2Z1O A;  1AJ4 A;  1F54 A;  2K2F A;  4HVF A;  1KQM C;  2PAL A;  4YRU A;  2ZO7 A;  4F0Z B;  5CSJ A;  1UUR A;  1H8B A;  1UHN A;  3VRP A;  4PPK A;  2LM5 A;  1SL8 A;  1CDN A;  1ZFS A;  3PN7 B;  3VHT B;  4CFQ A;  3CWG A;  3LVC A;  3H1O A;  3DQ2 A;  5DTY A;  2A53 B;  5KSZ A;  4W6T A;  2YDZ A;  3IR8 A;  4IK8 A;  1SY9 A;  5AXI A;  3IP2 A;  2Q4U A;  2OKW A;  1XQM A;  1WLM A;  1NWD A;  4OVN F;  1KWO C;  4KA9 A;  1PSR A;  2LV7 A;  2GX0 A;  4EMQ A;  1REC A;  5B8I B;  2PRU A;  1SK6 D;  2NXQ A;  1GGW A;  2KOT A;  1H6R A;  1QX7 A;  1DJH A;  4KAG A;  4AR7 A;  1HCJ A;  1SCM C;  2O29 A;  4DXQ A;  2LVI A;  2KHN A;  2L4I A;  3NED A;  4NQG A;  2YE1 A;  4W6F A;  2QRF A;  3GEX A;  1YHH A;  3A8R A;  3SRY A;  1LA3 A;  1WLZ A;  2CCM A;  1WDC C;  2SCP A;  4L13 A;  1XFX O;  1SCV A;  1RJV A;  2L5X B;  4DXP A;  2A50 B;  3AAK A;  1EG4 A;  1KK8 B;  1SBJ A;  2BCA A;  2K8M B;  2M8U A;  2O5G A;  3VRQ A;  4KPI A;  2LHI A;  2Q6P A;  4RYS A;  1ZUZ A;  2JRF A;  1C4F A;  1TTX A;  3DQM A;  1K2H A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  1Z1P A;  2ZO6 A;  1KQM B;  2KI6 D;  4USL A;  1FPW A;  2LMT A;  5J3X A;  3BXA A;  4L1I A;  3I19 A;  5DTL A;  1OMV A;  3PJ7 A;  3DQL A;  4W6S A;  2CBL A;  1RRO A;  4BY4 A;  5I2O A;  4HRH A;  4R6B A;  4XJK B;  2LP3 A;  4ZIO A;  4XJK A;  1SR6 C;  1S6C A;  1Q4B A;  5KU1 A;  1IRJ A;  1YUU A;  3DQ8 A;  2LVK A;  4CID A;  1MOU A;  2WSN A;  4PHN A;  1KWO B;  3NT9 A;  4W6L A;  4AQI A;  1QIV A;  1L7Z A;  3S05 A;  4E68 A;  2BL0 C;  1YZW A;  1YUT A;  1RWY A;  1S6Z A;  3IQO A;  4PPJ A;  3BUN B;  2KAV A;  4W6G A;  3SVO A;  1UUS A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  1EMG A;  1LVC D;  2VAE A;  1B4C A;  3CFA A;  4NDB A;  1BMO A;  1SCM B;  4GOB A;  3DQN A;  4OGS A;  4Q7U A;  1A2X A;  3KF9 A;  3BXK A;  5BQL A;  3K1K A;  3SG7 A;  1ZGP A;  3DVE A;  2NZ0 A;  2A52 B;  1RRX A;  4CPV A;  5DPH A;  3CB9 A;  1CFP A;  1BFP A;  4I5J A;  1WDC B;  3BXB A;  3DQI A;  1XK4 C;  2BCX A;  2AWL A;  5F9G A;  4CFR A;  2G3O A;  5HLO A;  3SVD A;  3EVV A;  3TUY C;  3MGF A;  1YTZ C;  3PM8 A;  2K0J A;  2KBM A;  5CSF A;  4GNK B;  1R2U A;  2WHS A;  5ER4 X;  5AER A;  2IE2 A;  3TDZ A;  3UG0 A;  3DQA A;  5LTR A;  1MYW A;  5J2O A;  5PAL A;  5F6T A;  1IJ6 A;  3ZWH A;  3NSI A;  3EK7 A;  4ZB1 A;  4XGY A;  1OZS A;  5CSN A;  3QRX A;  2A46 A;  1L2O C;  2PXS A;  2HF5 A;  3BUM B;  4PAL A;  5HZU A;  1SL9 A;  2BE6 A;  2Z6X A;  1OMR A;  1SR6 B;  1S5G Y;  3EK4 A;  3EKJ A;  2KI4 C;  4P5O E;  4KEX A;  2Q91 A;  3KCT A;  2VZX A;  4R1E A;  2IB6 A;  1PSB A;  1QJT A;  4Q7R A;  2DUG A;  4L12 A;  2BEC A;  2G2B A;  3WCK A;  3VIC A;  1N65 A;  4LQT A;  1J55 A;  2LLU A;  5I2L A;  2KBI A;  4GF6 B;  2WSO A;  2VVI A;  2JXL A;  4RTC A;  2BL0 B;  2OKY A;  3GOF A;  4EN1 A;  2LHL A;  3BUO B;  5GQQ C;  3KEV A;  3CD1 A;  4N5X A;  3BX9 A;  2Y0G A;  4YBH B;  3U0K A;  2JTT A;  3FWC A;  5FVG A;  4L9M A;  4CLN A;  1QLK A;  2JZI A;  3ADF A;  4OR9 B;  1EMK A;  3PJ5 A;  4XOW A;  2DUI A;  1TCF A;  3LF3 A;  1RK9 A;  2GGM A;  2JXC A;  4PPL A;  2H6V A;  1A75 B;  5FVI A;  2M29 A;  1PK0 D;  3U8C A;  2G6E A;  2HQK A;  3CFH A;  1A75 A;  2ISD A;  1NYA A;  1XK4 A;  3TUY B;  4IK5 A;  4DUQ A;  3LA1 A;  4N3D A;  2LAP A;  3DQJ A;  2QLE A;  2HFC A;  1CDL A;  2ZKM X;  3DF0 B;  2RGI A;  2HCG A;  1BOD A;  3DF0 A;  5EJU A;  3NSK A;  1B47 A;  3BUX B;  3M24 A;  1Q80 A;  1SPY A;  2GGZ A;  3I5I C;  4PHK A;  1M63 B;  1SL7 A;  1CTR A;  4ORB B;  2V53 A;  2LCP A;  4DXN A;  1CDP A;  2JU0 A;  3DQK A;  2H5R A;  1MWN A;  3NT3 A;  3EVP A;  2GV5 A;  1JWD A;  2O60 A;  2B1U A;  3TMR A;  2HGY A;  4IK9 A;  1L2O B;  1GJY A;  4JEO A;  3SVC A;  1B7T Z;  2A47 A;  2AHA A;  4J8A A;  2FCE A;  5HZT A;  2Q57 A;  3OGO A;  1NX0 A;  4ZF4 A;  1ZOT B;  1RTP 1;  3PAL A;  2KI4 B;  3CR2 A;  1J7R A;  2HQW A;  2KGB C;  4W7R A;  2KAY A;  3W1D A;  5AAN A;  1OXF A;  1EH2 A;  1X02 A;  3G9A A;  5D7F A;  2HJO A;  4TNC A;  3SVS A;  3CR4 X;  3PLF B;  4KW9 A;  1DJZ A;  1QV0 A;  3DQ5 A;  4ZF3 A;  2M1K B;  5BTT B;  3JTD C;  3AKB A;  2O2B A;  2PAS A;  1CV7 A;  4PE1 A;  5BTT A;  1Y1U A;  1LKJ A;  1CLL A;  1UHI A;  4IK1 A;  3E5T A;  5BT0 A;  3UFZ A;  1RMO A;  2PXW A;  5I2Q A;  2R2I A;  2K7O A;  3D10 A;  1QS7 A;  4QJ4 B;  2F3Y A;  1CMF A;  2BTJ A;  1KYR A;  4JC2 A;  1JFJ A;  4MZK A;  4EUL A;  3OX6 A;  4H3N A;  1RMP A;  1QXP A;  1NIW A;  1FW4 A;  3SSY A;  2WOR A;  3AI4 A;  1ZGO A;  1YX7 A;  1GQM A;  5HYD A;  1QVI Z;  1UIS A;  1QYF A;  2L2E A;  1KK7 Z;  1DJG A;  2MHH A;  3OSR A;  1YVL A;  2Y1N A;  1RMM A;  3I5I B;  4J88 A;  3DQD A;  1XFW O;  4MRX A;  4P76 A;  1XA5 A;  3D0Y B;  3GL4 A;  4C0J A;  1QYO A;  3WNX B;  4HRG A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2FZU A;  5DKQ A;  3U8P A;  4Q9W A;  1W7J B;  3LK1 A;  1M46 A;  2WCE A;  1IGV A;  2AWJ A;  4KF4 A;  1JBZ A;  2DUH A;  3E5V A;  5EXC I;  1UHK A;  1S6I A;  2I18 A;  5HBD A;  1DJI A;  3TDI A;  2G6X A;  3SS0 A;  5H87 A;  1EML A;  1QAT A;  1B8C A;  1NSH A;  3ZTF A;  1TNX A;  2FOT A;  1DGV A;  3RWA A;  3RLZ A;  4W74 A;  3IQQ A;  3U0M A;  1DVI A;  4Z4K A;  4W6U A;  1BR1 B;  3O6B A;  2JC2 A;  3DQ4 A;  1KYP A;  1CNP A;  4BY5 A;  4JWQ A;  3JTD B;  1K93 D;  3SST A;  4HE4 A;  2ZND A;  4GFT A;  4QJ3 B;  4GAO A;  4KW8 A;  1C07 A;  4W7F A;  3DPW A;  4WRI A;  2LUC A;  1CLB A;  4C0L A;  1Q4A A;  2DDC A;  2QPT A;  3KCS A;  2WOS A;  1RFJ A;  1IQ5 A;  2QLG B;  2K7D A;  3SIB A;  2A4J A;  3P28 A;  2H61 C;  1BOC A;  2QLG A;  1G8I A;  1YHG A;  1XMZ A;  3M22 A;  2M3W A;  1V1F A;  1ODB A;  1GGZ A;  3TDU A;  2V4E C;  2D8N A;  3FIA A;  2G5Z B;  1K94 A;  3WHU B;  2ZRT A;  3PIB A;  3DVM A;  1XO5 A;  5DRG A;  3MSE B;  1S6J A;  1YJ2 A;  2LC5 A;  2FCD A;  1QLS A;  5CPV A;  4W6P A;  2HPS A;  5ER5 A;  1C7W A;  1DT7 B;  1NCX A;  1BLQ A;  1M39 A;  2KQ6 A;  5H88 A;  2KI6 C;  1ZUX A;  1JUO A;  1A03 A;  3SSH A;  4HQ9 A;  4W7D A;  3CLN A;  3GK4 X;  3TS5 B;  3DQ9 A;  5AEQ A;  3I5H C;  3OX5 A;  2OTB A;  2M9G A;  1WY9 A;  3CTN A;  2WIQ A;  2BCB A;  2HQ8 A;  2ICR A;  2BKH B;  1OXE A;  2Z6Z A;  1K8U A;  2WUR A;  2ARL A;  3GK1 A;  4W73 A;  3FS7 A;  4M2P A;  3RM1 A;  4UPG A;  2M7N A;  1QIW A;  1QX5 B;  3W1C A; 
#chains in the Genus database with same CATH topology
 4PT1 A;  1LIN A;  1GGX A;  2QLI A;  5DU0 A;  1NX3 A;  4W6H A;  1JFK A;  3OB1 B;  2TN4 A;  2ZN8 A;  2WHT A;  2KQY A;  1KQV A;  1OOJ A;  2DUF A;  3K21 A;  3RWT A;  1HT9 A;  3TZ1 A;  2QU1 A;  4Q9X A;  1WRL A;  5DY6 A;  2ZFD A;  3DXL A;  5G08 A;  2Z6Y A;  4TZG A;  3S0G A;  4KGF A;  2WCK A;  4OQW A;  4W6B A;  1HUY A;  2ZRS A;  1XA9 A;  3SSP A;  4LJB A;  3GB3 A;  1MF8 B;  4AS8 A;  1Y1A A;  2QZ0 A;  1CFD A;  2YGU A;  2GW3 A;  4IL1 A;  4Z4M A;  2PSR A;  2K7C A;  2E30 A;  1F70 A;  3S0A A;  2G16 B;  5LTP A;  1B8L A;  1JC0 A;  5HL1 A;  2H61 A;  2KFG A;  1DF0 B;  1AP4 A;  2F2O A;  3DVK A;  2ZMU A;  3U0N A;  3O4Y A;  2V4E B;  1TNW A;  4UTS A;  1DF0 A;  3TMT A;  1SYM A;  2JAD A;  2V4E A;  1CMG A;  3NSL A;  3SIA A;  3BXC A;  3SVE A;  2POX A;  1MXE A;  2DD9 A;  3SVN A;  3O77 A;  3DQ1 A;  2KAX A;  2QT2 A;  1IWQ A;  4AQJ A;  2BNX A;  3DVJ A;  1YRU B;  5HW9 A;  3SS3 A;  4YGB B;  3I5H B;  1EMF A;  4INW A;  3WXA A;  2DD7 A;  4IK3 A;  3OB2 B;  4JFG A;  1BG1 A;  2PQL A;  4ORN A;  1V1G A;  2BE4 A;  2P70 A;  2H9W A;  4LJD C;  1EMC A;  2HPW A;  1Y1X A;  2ZN9 A;  1PRW A;  2CT9 A;  3CGA A;  4DKN A;  1FI5 A;  1CLM A;  1BJF A;  2G9B A;  2M7L A;  1W7S A;  3PSR A;  4W76 A;  1KSO A;  2OGR A;  5DKR A;  1S5G Z;  2G3D B;  2CXJ A;  2AWM A;  3C1V A;  3VGO A;  5AFP A;  1CKK A;  1XFZ O;  2A48 A;  1QTX A;  4H48 A;  4I2Y A;  4DS7 A;  4W6K A;  2WCB A;  2MBX A;  3GJ2 A;  4JF9 A;  3UO9 A;  3SV5 A;  4DKM A;  4W6O A;  1K9K A;  3SG2 A;  5T3I A;  4GES B;  3L4A A;  4ZCV A;  4H3L A;  2KLE A;  1SNL A;  4W7E A;  4LW5 A;  2QEB A;  3ST4 A;  2LNK A;  4OJ0 A;  2HET A;  3DQF A;  1RM9 A;  3SSL A;  2OPO A;  4GGF A;  1Z1Q A;  1QWV A;  1SKT A;  2I7A A;  4HQ8 A;  5EXB A;  5AQB B;  3LK0 A;  2BBN A;  2RH7 A;  3R1O A;  2OS8 B;  1MR8 A;  5D69 A;  1KFX L;  1TN4 A;  4GPL B;  2JUL A;  1R6P A;  1Q4C A;  3EVU A;  1OMD A;  1JC2 A;  4MEW A;  1K95 A;  4RYW A;  1G33 A;  3UNW A;  1KYS A;  1HQV A;  2FJU B;  5DTX A;  3DPX A;  1WRK A;  1DEK A;  3DQC A;  5EBJ A;  3CBE A;  3SG6 A;  5DQB A;  4HSZ A;  5FVF A;  3LVA A;  3ED8 A;  2WIS A;  2WND A;  2C9I A;  2YFP A;  3BFA A;  4NDC A;  2GX2 A;  4DXM A;  1F4O A;  4PHJ A;  3ST2 A;  4WQ2 A;  1EMB A;  4W6C A;  3D76 A;  3R1P A;  3DQ6 A;  2P6B B;  1PUL A;  2MLE C;  4PCW A;  1SW8 A;  1OZO A;  4ZIN A;  3WHT B;  1T14 A;  4MLW A;  1BT6 A;  1UWO A;  4WQ3 A;  2L0P A;  2LUX A;  4C0K A;  3NHI A;  1MQ1 A;  2LP2 A;  1ZMZ A;  3SVR A;  4MSP A;  4LJD A;  2A56 B;  1B9A A;  3D73 A;  2WC8 A;  4H47 A;  4W6R A;  2B3P A;  2C9J A;  3DPZ A;  2B3Q A;  4W7A A;  2MRD A;  2L5Y A;  2I94 A;  3LLE A;  1GFL A;  2WC5 A;  3EK8 A;  3VRN A;  1Y6W A;  5HKZ A;  2M97 A;  1EL4 A;  1EJ3 A;  1JSA A;  3KPX A;  2MA2 A;  2PVB A;  3K1E A;  2HRS A;  1XYD A;  2NCP A;  1E8A A;  2F33 A;  4MZL A;  2EC6 B;  1QYQ A;  3CGL A;  2DOQ A;  4HQC A;  1TNP A;  4H3M A;  4XL5 A;  4PFE A;  3M0W A;  5EB6 A;  1LA0 A;  1YUR A;  3O2P A;  5KTY A;  4MRY A;  4MBE A;  5TNC A;  3SJS A;  3V3D A;  3I5G C;  3DQO A;  4D1E A;  2HQZ A;  3U8A A;  1WRZ A;  1MUX A;  2KFH A;  3TS5 C;  3S0F A;  3L4L A;  3VHT A;  2VVH A;  2M1U A;  3FE9 A;  3H1R A;  1S36 A;  1OOI X;  4EDS A;  5KTG A;  1AVS A;  1EXR A;  4OY4 A;  1AJ5 A;  2LVV A;  1F71 A;  5DPI A;  3CZ2 A;  4DIR A;  2H5P A;  3S0E A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  3LCP C;  2L50 A;  2BAP A;  2LE9 B;  3CFF A;  1Q4D A;  4FTG A;  3VB1 A;  3SSV A;  1OSA A;  3CYZ A;  2K2A A;  1EG3 A;  3A4U B;  3OBV A;  4TZA A;  3NF0 A;  3LS3 A;  4IK4 A;  2KFF A;  1J7Q A;  1XFR A;  4EDO A;  1K9P A;  1FF1 A;  3I5F C;  4DXO A;  3A8S A;  1N2D A;  3VK1 A;  4W7C A;  3CAB A;  1W7I B;  2O24 A;  1PVB A;  1G7K A;  2MAZ A;  1S1E A;  1UHJ A;  1TWO A;  5DPJ A;  3ST0 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  4QJ5 B;  2OTG C;  2E6W A;  1MXL C;  1BU3 A;  1FBV A;  2ZMW A;  4BDU A;  2LMV A;  5LK4 A;  3ZUL A;  4JQ0 D;  3E5W A;  4DXI A;  1XAE A;  4JRB A;  1IG5 A;  4NWS A;  2CTN A;  1NCY A;  1OOF A;  1S3P A;  3P8U A;  1FI6 A;  4F7F A;  3BUW B;  1Y0V H;  3RZS A;  3DQE A;  1VRK A;  1BR4 B;  4I5N B;  2IOV A;  1KFX S;  1K9U A;  3OGN A;  3GK2 A;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  5EL2 A;  2JTZ A;  2FL1 A;  3DY9 A;  3DQ7 A;  3V2L A;  2QLH A;  1SRA A;  1H4U A;  3SG4 A;  5FHV A;  3VRR A;  1IJ5 A;  3I5G B;  4XOV A;  2EHB A;  3CS1 A;  2OTE A;  2JNX A;  1F55 A;  3DQH A;  1EME A;  2EMO A;  1KFU L;  4PDZ A;  2DUE A;  4N1F A;  3CDN A;  4Q04 A;  1BF5 A;  4KF5 C;  5IBW A;  1D1O A;  5HGE A;  4IZN A;  1Q73 A;  5HZO A;  1DQE A;  3SG3 A;  3SSK A;  4OHS A;  4ETO A;  4XYN A;  1UHH A;  1W9Z A;  1NCZ A;  4YGE B;  1QXT A;  2EGD A;  4MN0 A;  2AUC A;  3O78 A;  1NX1 A;  4W6N A;  3NGV A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  3VRO A;  1MHO A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3DQ3 A;  2BKI B;  3GJ1 A;  2K60 A;  4ZCU A;  2MLF C;  3AI5 A;  1M31 A;  2QEH A;  5EB7 A;  1NUB A;  4JGE A;  4DCK A;  5HKY A;  1NX2 A;  4NDD A;  4ZBL A;  5DQM A;  4W6J A;  2F8P A;  3JVT C;  4KGE A;  2I2R E;  2LAN A;  2OTG B;  4GGF C;  4W75 A;  1J7O A;  1S26 D;  4JPZ B;  3SVB A;  2JT3 A;  5LTQ A;  3SG5 A;  2M0R A;  3D78 A;  4W69 A;  4DRW A;  3DZT A;  4LQU A;  3IF7 A;  1ZAC A;  1W7U A;  1K96 A;  3BQ3 A;  2HGD A;  4B30 B;  1B8R A;  1OQP A;  4W6D A;  1CM1 A;  4B30 A;  2OS8 C;  2IB5 A;  2OJK A;  1DTL A;  3CZ1 A;  1YVH A;  4IJ7 A;  4XVP A;  5DPG A;  4GUK A;  4A4B A;  4W77 A;  3F45 A;  4ANJ A;  1U5I B;  3ZNI A;  4B5Y A;  4W6M A;  4OZD A;  1F09 A;  2COL B;  4GGN A;  5CSI A;  1CFC A;  1U5I A;  4W6A A;  2KDH A;  3NEZ A;  1KCY A;  2JOJ A;  3B87 A;  2Y4Q A;  1TOP A;  1YHI A;  2GW4 B;  3KO0 A;  3CR5 X;  4Q7T A;  5DTZ A;  3DQU A;  3EG5 B;  1JF0 A;  1F4Q A;  2F2P A;  3OHM B;  4P1Q A;  2JNF A;  5DKN A;  1OXD A;  4YI9 A;  5BPJ A;  1F0B A;  1TUZ A;  3FE6 A;  1C7V A;  1TRF A;  2P4M A;  4PE7 A;  3SVU A;  2L2C A;  4ICB A;  4ZF5 A;  1YJF A;  2H2K A;  1EMM A;  4I5L B;  2K7B A;  1MOV A;  2H8Q A;  4FQO A;  4INX A;  4YGD B;  1N0Y A;  2ZNE A;  1AUI B;  4KF5 A;  5EXU A;  1TIZ A;  3QME A;  1CM4 A;  1OE9 B;  4N1G A;  1QY3 A;  3ST3 A;  4ZFS A;  1DGU A;  4ORA B;  2H5O A;  1QV1 A;  1QX2 A;  3LL8 B;  2L4H A;  1IQ3 A;  3PAT A;  1DJW A;  1TNQ A;  3D75 A;  1NP8 A;  3AKA A;  3CD9 A;  1J1E A;  4YGC B;  2VVJ A;  2PMY A;  1EMA A;  3BYA A;  1ALW A;  3OSQ A;  3JVT B;  5DRF A;  1KSM A;  4W6I A;  3WLD A;  1J7P A;  3HX4 A;  4OV2 A;  4M2Q A;  2L51 A;  3DD4 A;  2NCO A;  5H89 A;  2EC6 C;  1JBA A;  1B7T Y;  3FWB A;  1ZGQ A;  4W7X A;  1JC1 A;  1IKU A;  1DJX A;  4PE0 A;  1A29 A;  1H4B A;  3U0L A;  3AKO A;  2G6Y A;  1CB1 A;  2AWK A;  1NPQ A;  4W72 A;  3PN7 C;  1YX8 A;  1B1G A;  5HLV A;  3NXA A;  2BBM A;  1YR5 A;  1SMG A;  3LVD A;  2M49 B;  3KHE A;  1G4Y R;  1Q4E A;  4ORC B;  1PAL A;  3B6X A;  3WLC A;  1KFU S;  1QAS A;  2Y1M A;  4KW4 A;  2VAD A;  1A4P A;  2A54 B;  3BOW B;  3ZUF A;  3EKH A;  4I5K A;  2KNE A;  5HZS A;  3BOW A;  1GL4 A;  2QAC A;  2YE0 A;  1YFP A;  5I8N A;  2JPO A;  2JQ6 A;  3D77 A;  3S0B A;  3AAJ A;  5K89 A;  2FWQ A;  5JOL A;  1PVA A;  4M2O A;  4OCI A;  3PJB A;  2LVJ A;  5HKW A;  2JT8 A;  4OKH A;  2NLN A;  1JF2 A;  1W7T A;  4A4C A;  4R6D A;  1XFY O;  4J89 A;  2KSP A;  2WCF A;  1CFF A;  2DDD A;  1K90 D;  3CZT X;  3OP0 A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  4YGA A;  4AOM A;  2WHU A;  1B9C A;  2JWW A;  1KK7 Y;  3NSO A;  3Q8I A;  1YUS A;  2SAS A;  1XSS A;  3ZUJ A;  4U8D A;  1KK8 C;  1JBY A;  2KGR A;  5FYX A;  2H5Q A;  3LSA A;  5EHU A;  1F8H A;  1CDM A;  1KP5 A;  2EMD A;  1XFU O;  5I94 A;  1DEL A;  3LF4 B;  1LXF C;  1UP5 A;  3ICB A;  2LMU A;  2AH8 A;  4U2V A;  4GBA A;  1J1D A;  1M45 A;  2LLT A;  2EMN A;  2WCM A;  2G2S B;  4LJC A;  2K61 A;  4KYN A;  2Z1O A;  1AJ4 A;  1F54 A;  2K2F A;  3B88 A;  4HVF A;  1KQM C;  1OOH A;  3S0D A;  1LS8 A;  3FE8 A;  2PAL A;  4YRU A;  2ZO7 A;  4F0Z B;  5CSJ A;  1UUR A;  1H8B A;  1UHN A;  3VRP A;  5DIC A;  1C3Z A;  1IIO A;  4PPK A;  2LM5 A;  1SL8 A;  1CDN A;  1ZFS A;  3PN7 B;  3SS5 A;  3VHT B;  4CFQ A;  3CWG A;  3LVC A;  3H1O A;  3DQ2 A;  5DTY A;  2A53 B;  1C3Y A;  5KSZ A;  4W6T A;  2YDZ A;  2H8V A;  3IR8 A;  4IK8 A;  1SY9 A;  5AXI A;  3IP2 A;  2Q4U A;  2OKW A;  1XQM A;  1WLM A;  1NWD A;  4OVN F;  1KWO C;  4KA9 A;  3R1V A;  1PSR A;  2LV7 A;  2GX0 A;  2FJY A;  4EMQ A;  1REC A;  5B8I B;  2PRU A;  1SK6 D;  2NXQ A;  1GGW A;  2KOT A;  1H6R A;  1QX7 A;  1DJH A;  4KAG A;  4AR7 A;  1HCJ A;  1SCM C;  2O29 A;  2GTE A;  4DXQ A;  2LVI A;  2KHN A;  2L4I A;  3NED A;  4NQG A;  2YE1 A;  4W6F A;  2QRF A;  3GEX A;  1YHH A;  3A8R A;  3SRY A;  1LA3 A;  1WLZ A;  2CCM A;  1WDC C;  2SCP A;  4L13 A;  1XFX O;  1SCV A;  1RJV A;  2L5X B;  4DXP A;  2A50 B;  3AAK A;  1EG4 A;  1KK8 B;  1SBJ A;  2BCA A;  2ERB A;  2K8M B;  1P28 A;  2M8U A;  2O5G A;  3VRQ A;  4KPI A;  2LHI A;  2Q6P A;  4RYS A;  1ZUZ A;  2JRF A;  1C4F A;  1TTX A;  3DQM A;  1K2H A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  1Z1P A;  2ZO6 A;  1KQM B;  2KI6 D;  4USL A;  1FPW A;  2LMT A;  5J3X A;  3BXA A;  4L1I A;  3I19 A;  5DTL A;  1OMV A;  3PJ7 A;  3DQL A;  4W6S A;  2CBL A;  1RRO A;  4BY4 A;  5I2O A;  4HRH A;  4R6B A;  4XJK B;  2LP3 A;  2WCL A;  4ZIO A;  4XJK A;  1SR6 C;  1S6C A;  1Q4B A;  5KU1 A;  1IRJ A;  1YUU A;  3DQ8 A;  2LVK A;  4CID A;  1MOU A;  1DC1 A;  1Z4H A;  2WSN A;  4PHN A;  1KWO B;  3NT9 A;  4W6L A;  4AQI A;  1QIV A;  1L7Z A;  5D3O A;  3S05 A;  4E68 A;  2BL0 C;  1YZW A;  1YUT A;  1RWY A;  1S6Z A;  3IQO A;  4PPJ A;  3BUN B;  2KAV A;  4W6G A;  5FI6 A;  3SVO A;  1UUS A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  3BFH A;  1EMG A;  1LVC D;  2VAE A;  1B4C A;  3CFA A;  4NDB A;  1BMO A;  1SCM B;  4GOB A;  3DQN A;  4OGS A;  4Q7U A;  1A2X A;  3KF9 A;  3BXK A;  5BQL A;  3K1K A;  3SG7 A;  1GM0 A;  1ZGP A;  3DVE A;  2NZ0 A;  2A52 B;  1RRX A;  4CPV A;  5DPH A;  3CB9 A;  1CFP A;  1BFP A;  4I5J A;  1WDC B;  3BXB A;  3DQI A;  1XK4 C;  2BCX A;  2AWL A;  5F9G A;  4CFR A;  2G3O A;  5HLO A;  3SVD A;  2PYQ A;  3EVV A;  3TUY C;  3MGF A;  2WCJ A;  1YTZ C;  1ORG A;  3PM8 A;  2K0J A;  2KBM A;  5CSF A;  4GNK B;  1R2U A;  2QEO A;  2WHS A;  5ER4 X;  5AER A;  2IE2 A;  3TDZ A;  3UG0 A;  3DQA A;  5LTR A;  1MYW A;  5J2O A;  2WCH A;  5PAL A;  5F6T A;  1IJ6 A;  3ZWH A;  3NSI A;  3EK7 A;  4ZB1 A;  4XGY A;  1OZS A;  5FI7 A;  5CSN A;  3QRX A;  2A46 A;  1L2O C;  2PXS A;  1TUJ A;  2HF5 A;  3BUM B;  4PAL A;  5HZU A;  1SL9 A;  1OOG A;  2BE6 A;  2Z6X A;  1OMR A;  1SR6 B;  1S5G Y;  3EK4 A;  3EKJ A;  2KI4 C;  4P5O E;  4KEX A;  2Q91 A;  3KCT A;  2VZX A;  4R1E A;  2IB6 A;  1PSB A;  1QJT A;  4Q7R A;  2DUG A;  4L12 A;  2BEC A;  2G2B A;  3WCK A;  3VIC A;  1N65 A;  5FI2 A;  4LQT A;  1J55 A;  2LLU A;  5I2L A;  2KBI A;  4GF6 B;  2WSO A;  2VVI A;  2JXL A;  4RTC A;  2BL0 B;  2OKY A;  3GOF A;  4EN1 A;  2LHL A;  3BUO B;  3BFB A;  5GQQ C;  3KEV A;  3CD1 A;  4N5X A;  3BX9 A;  2Y0G A;  4YBH B;  3U0K A;  2JTT A;  3FWC A;  3IVT A;  5FVG A;  4L9M A;  4CLN A;  1QLK A;  2JZI A;  3ADF A;  4OR9 B;  1EMK A;  2QEV A;  3PJ5 A;  1OW4 A;  4XOW A;  2DUI A;  1TCF A;  3LF3 A;  1RK9 A;  2GGM A;  2JXC A;  4PPL A;  2H6V A;  1A75 B;  5FVI A;  2M29 A;  1PK0 D;  3U8C A;  2G6E A;  2HQK A;  3CFH A;  1A75 A;  2ISD A;  1NYA A;  1XK4 A;  3TUY B;  4IK5 A;  4DUQ A;  3LA1 A;  4N3D A;  2LAP A;  3DQJ A;  2QLE A;  2HFC A;  1CDL A;  2ZKM X;  3DF0 B;  2RGI A;  2HCG A;  1BOD A;  3DF0 A;  5EJU A;  3NSK A;  1B47 A;  3BUX B;  1SSE B;  3M24 A;  1Q80 A;  1SPY A;  2GGZ A;  3I5I C;  4PHK A;  1M63 B;  1SL7 A;  1CTR A;  4ORB B;  2V53 A;  4JKT A;  2LCP A;  4DXN A;  1CDP A;  2JU0 A;  3DQK A;  2H5R A;  1MWN A;  3NT3 A;  3EVP A;  2GV5 A;  1JWD A;  2O60 A;  2B1U A;  3N7H A;  3TMR A;  2HGY A;  4IK9 A;  1L2O B;  3CZ0 A;  1GJY A;  2KPH A;  4JEO A;  3SVC A;  1B7T Z;  2A47 A;  2AHA A;  4J8A A;  2FCE A;  2WC6 A;  5HZT A;  2Q57 A;  3OGO A;  3R72 A;  1NX0 A;  4ZF4 A;  1ZOT B;  1RTP 1;  3PAL A;  2KI4 B;  3CR2 A;  1J7R A;  2HQW A;  2KGB C;  4W7R A;  2KAY A;  3W1D A;  5AAN A;  1OXF A;  1EH2 A;  1X02 A;  3G9A A;  5D7F A;  2HJO A;  4TNC A;  4JD9 A;  3SVS A;  3CR4 X;  3PLF B;  4KW9 A;  1DJZ A;  1QV0 A;  3DQ5 A;  4ZF3 A;  2M1K B;  5BTT B;  3JTD C;  3AKB A;  2O2B A;  3SS4 A;  2PAS A;  1CV7 A;  4PE1 A;  5BTT A;  1Y1U A;  1LKJ A;  3D74 A;  1CLL A;  1UHI A;  4IK1 A;  3PM2 A;  3E5T A;  5BT0 A;  3UFZ A;  1RMO A;  2PXW A;  5I2Q A;  2R2I A;  2P71 A;  2K7O A;  3D10 A;  1QS7 A;  4QJ4 B;  2F3Y A;  1CMF A;  2BTJ A;  1KYR A;  4JC2 A;  1JFJ A;  4MZK A;  4EUL A;  3OX6 A;  4H3N A;  1RMP A;  1QXP A;  1NIW A;  3BJH A;  1FW4 A;  3SSY A;  4FQT A;  2WOR A;  3AI4 A;  1ZGO A;  1YX7 A;  1GQM A;  5HYD A;  1QVI Z;  1UIS A;  1QYF A;  2L2E A;  1KK7 Z;  1DJG A;  2MHH A;  3OSR A;  3O4X A;  1YVL A;  2Y1N A;  1RMM A;  3I5I B;  4J88 A;  3DQD A;  1XFW O;  4MRX A;  4P76 A;  1XA5 A;  3D0Y B;  3GL4 A;  4C0J A;  1QYO A;  3WNX B;  4HRG A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2FZU A;  5DKQ A;  3U8P A;  4Q9W A;  1W7J B;  3LK1 A;  1M46 A;  2WCE A;  1IGV A;  2AWJ A;  4KF4 A;  1JBZ A;  2DUH A;  3E5V A;  5EXC I;  1UHK A;  3L47 A;  1S6I A;  2I18 A;  5HBD A;  1DJI A;  3TDI A;  2G6X A;  3SS0 A;  3PJI A;  5H87 A;  1EML A;  1QAT A;  1B8C A;  1NSH A;  3ZTF A;  1TNX A;  2FOT A;  1DGV A;  3RWA A;  3RLZ A;  4W74 A;  3IQQ A;  3U0M A;  1DVI A;  4Z4K A;  4W6U A;  1BR1 B;  3O6B A;  2JC2 A;  3DQ4 A;  1KYP A;  1CNP A;  3B7A A;  4BY5 A;  4JWQ A;  3JTD B;  1K93 D;  3SST A;  4HE4 A;  2ZND A;  4GFT A;  4QJ3 B;  4GAO A;  4KW8 A;  1C07 A;  4W7F A;  3DPW A;  4WRI A;  2LUC A;  1CLB A;  4C0L A;  1Q4A A;  2DDC A;  2QPT A;  3KCS A;  2WOS A;  1RFJ A;  1IQ5 A;  3NHT A;  2QLG B;  2K7D A;  3SIB A;  2A4J A;  3P28 A;  2H61 C;  1Z2C B;  1BOC A;  2QLG A;  1G8I A;  1YHG A;  1XMZ A;  3M22 A;  2M3W A;  1V1F A;  1ODB A;  1GGZ A;  3TDU A;  2V4E C;  2D8N A;  3FIA A;  2G5Z B;  1K94 A;  3WHU B;  2KLD A;  2ZRT A;  3PIB A;  3DVM A;  1XO5 A;  2QDI A;  3DYE A;  3MSE B;  5DRG A;  1S6J A;  1YJ2 A;  2LC5 A;  2FCD A;  1QLS A;  5CPV A;  4W6P A;  2HPS A;  5ER5 A;  1C7W A;  1DT7 B;  1NCX A;  1BLQ A;  1M39 A;  2KQ6 A;  5H88 A;  2KI6 C;  1ZUX A;  1JUO A;  1A03 A;  3SSH A;  4HQ9 A;  3CLN A;  3GK4 X;  3DQ9 A;  3TS5 B;  4W7D A;  5AEQ A;  3I5H C;  3OX5 A;  2OTB A;  2M9G A;  1WY9 A;  3CTN A;  2WIQ A;  2BCB A;  2HQ8 A;  2ICR A;  2BKH B;  1OXE A;  2Z6Z A;  3B86 A;  1K8U A;  2WUR A;  2ARL A;  3GK1 A;  4W73 A;  3FS7 A;  4M2P A;  3RM1 A;  4UPG A;  2M7N A;  1QIW A;  1QX5 B;  3W1C A; 
#chains in the Genus database with same CATH homology
 1LIN A;  1GGX A;  2QLI A;  5DU0 A;  1NX3 A;  4W6H A;  1JFK A;  3OB1 B;  2TN4 A;  2ZN8 A;  2WHT A;  2KQY A;  1KQV A;  1OOJ A;  2DUF A;  3K21 A;  3RWT A;  1HT9 A;  3TZ1 A;  2QU1 A;  4Q9X A;  1WRL A;  5DY6 A;  2ZFD A;  5G08 A;  2Z6Y A;  4TZG A;  4KGF A;  4OQW A;  4W6B A;  1HUY A;  2ZRS A;  1XA9 A;  3SSP A;  4LJB A;  3GB3 A;  1MF8 B;  4AS8 A;  1Y1A A;  2QZ0 A;  1CFD A;  2GW3 A;  4IL1 A;  4Z4M A;  2PSR A;  2K7C A;  2E30 A;  1F70 A;  2G16 B;  5LTP A;  1B8L A;  1JC0 A;  2H61 A;  2KFG A;  1DF0 B;  1AP4 A;  2F2O A;  3DVK A;  2ZMU A;  3U0N A;  3O4Y A;  2V4E B;  1TNW A;  4UTS A;  1DF0 A;  3TMT A;  1SYM A;  2JAD A;  2V4E A;  1CMG A;  3NSL A;  3SIA A;  3BXC A;  3SVE A;  2POX A;  1MXE A;  2DD9 A;  3SVN A;  3O77 A;  3DQ1 A;  2KAX A;  2QT2 A;  1IWQ A;  4AQJ A;  3DVJ A;  1YRU B;  5HW9 A;  4YGB B;  3I5H B;  1EMF A;  3WXA A;  2DD7 A;  4IK3 A;  3OB2 B;  4JFG A;  1BG1 A;  4ORN A;  1V1G A;  2BE4 A;  2H9W A;  4LJD C;  1EMC A;  2HPW A;  1Y1X A;  2ZN9 A;  1PRW A;  2CT9 A;  3CGA A;  4DKN A;  1FI5 A;  1CLM A;  1BJF A;  2G9B A;  2M7L A;  1W7S A;  3PSR A;  4W76 A;  1KSO A;  2OGR A;  5DKR A;  1S5G Z;  2G3D B;  2CXJ A;  2AWM A;  3C1V A;  3VGO A;  5AFP A;  1CKK A;  1XFZ O;  2A48 A;  1QTX A;  4H48 A;  4I2Y A;  4DS7 A;  4W6K A;  2WCB A;  2MBX A;  3GJ2 A;  4JF9 A;  3SV5 A;  4DKM A;  4W6O A;  1K9K A;  3SG2 A;  5T3I A;  4GES B;  4ZCV A;  4H3L A;  1SNL A;  4W7E A;  4LW5 A;  3ST4 A;  2LNK A;  4OJ0 A;  2HET A;  3DQF A;  1RM9 A;  3SSL A;  2OPO A;  4GGF A;  1Z1Q A;  1SKT A;  2I7A A;  4HQ8 A;  5EXB A;  5AQB B;  3LK0 A;  2BBN A;  2RH7 A;  2OS8 B;  1MR8 A;  5D69 A;  1KFX L;  1TN4 A;  4GPL B;  2JUL A;  1R6P A;  1Q4C A;  3EVU A;  1OMD A;  1JC2 A;  4MEW A;  1K95 A;  4RYW A;  1G33 A;  1KYS A;  1HQV A;  2FJU B;  5DTX A;  3DPX A;  1WRK A;  3DQC A;  5EBJ A;  3CBE A;  3SG6 A;  5DQB A;  4HSZ A;  5FVF A;  3LVA A;  3ED8 A;  2WIS A;  2WND A;  2C9I A;  2YFP A;  4NDC A;  2GX2 A;  4DXM A;  1F4O A;  4PHJ A;  3ST2 A;  4WQ2 A;  1EMB A;  4W6C A;  3DQ6 A;  2P6B B;  1PUL A;  2MLE C;  4PCW A;  1SW8 A;  1OZO A;  4ZIN A;  3WHT B;  4MLW A;  1BT6 A;  1UWO A;  4WQ3 A;  2L0P A;  2LUX A;  4C0K A;  1MQ1 A;  2LP2 A;  1ZMZ A;  3SVR A;  4MSP A;  4LJD A;  2A56 B;  1B9A A;  2WC8 A;  4H47 A;  4W6R A;  2B3P A;  2C9J A;  3DPZ A;  2B3Q A;  4W7A A;  2MRD A;  2I94 A;  3LLE A;  1GFL A;  3EK8 A;  3VRN A;  1Y6W A;  5HKZ A;  2M97 A;  1EL4 A;  1EJ3 A;  1JSA A;  3KPX A;  2MA2 A;  2PVB A;  2HRS A;  1XYD A;  2NCP A;  1E8A A;  2F33 A;  4MZL A;  2EC6 B;  1QYQ A;  3CGL A;  2DOQ A;  4HQC A;  1TNP A;  4H3M A;  4XL5 A;  4PFE A;  3M0W A;  5EB6 A;  1LA0 A;  1YUR A;  3O2P A;  5KTY A;  4MRY A;  4MBE A;  5TNC A;  3SJS A;  3V3D A;  3I5G C;  3DQO A;  4D1E A;  2HQZ A;  3U8A A;  1WRZ A;  1MUX A;  2KFH A;  3TS5 C;  3VHT A;  2VVH A;  2M1U A;  3H1R A;  1S36 A;  4EDS A;  5KTG A;  1AVS A;  1EXR A;  4OY4 A;  1AJ5 A;  2LVV A;  1F71 A;  5DPI A;  4DIR A;  2H5P A;  4PHM A;  3PFV A;  4P2Y B;  1DMO A;  3LCP C;  2L50 A;  2LE9 B;  4FTG A;  1Q4D A;  3CFF A;  3SSV A;  1OSA A;  2K2A A;  1EG3 A;  3A4U B;  4TZA A;  3NF0 A;  3LS3 A;  4IK4 A;  2KFF A;  1J7Q A;  4EDO A;  1K9P A;  1FF1 A;  3I5F C;  4DXO A;  3A8S A;  1N2D A;  3VK1 A;  4W7C A;  1W7I B;  2O24 A;  1PVB A;  1G7K A;  2MAZ A;  1S1E A;  1UHJ A;  5DPJ A;  3ST0 A;  2AMI A;  2L98 A;  2KYC A;  5JJG A;  1XFV O;  4QJ5 B;  2OTG C;  2E6W A;  1MXL C;  1BU3 A;  1FBV A;  2ZMW A;  4BDU A;  2LMV A;  5LK4 A;  3ZUL A;  4JQ0 D;  3E5W A;  4DXI A;  1XAE A;  4JRB A;  1IG5 A;  4NWS A;  2CTN A;  1NCY A;  1S3P A;  3P8U A;  1FI6 A;  3BUW B;  1Y0V H;  3DQE A;  1VRK A;  1BR4 B;  4I5N B;  2IOV A;  1KFX S;  1K9U A;  3GK2 A;  2MJW B;  4PE4 A;  3E3R A;  1IH0 A;  2JTZ A;  2FL1 A;  3DQ7 A;  2QLH A;  1SRA A;  1H4U A;  3SG4 A;  5FHV A;  3VRR A;  1IJ5 A;  3I5G B;  4XOV A;  2EHB A;  3CS1 A;  2OTE A;  2JNX A;  1F55 A;  3DQH A;  1EME A;  2EMO A;  1KFU L;  4PDZ A;  2DUE A;  4N1F A;  4Q04 A;  1BF5 A;  4KF5 C;  5IBW A;  1D1O A;  5HGE A;  4IZN A;  1Q73 A;  5HZO A;  3SG3 A;  3SSK A;  4OHS A;  4ETO A;  4XYN A;  1UHH A;  1NCZ A;  4YGE B;  1QXT A;  2EGD A;  4MN0 A;  2AUC A;  3O78 A;  1NX1 A;  4W6N A;  2KYF A;  1XVJ A;  2Y5I A;  1TCO B;  3HCM A;  3VRO A;  1MHO A;  2CNP A;  2IS9 A;  3H4S E;  3I5F B;  3DQ3 A;  2BKI B;  3GJ1 A;  4ZCU A;  2MLF C;  3AI5 A;  1M31 A;  5EB7 A;  1NUB A;  4JGE A;  4DCK A;  5HKY A;  1NX2 A;  4NDD A;  4ZBL A;  5DQM A;  4W6J A;  2F8P A;  3JVT C;  4KGE A;  2I2R E;  2LAN A;  2OTG B;  4GGF C;  4W75 A;  1J7O A;  1S26 D;  4JPZ B;  3SVB A;  2JT3 A;  5LTQ A;  3SG5 A;  2M0R A;  4W69 A;  4DRW A;  4LQU A;  3IF7 A;  1ZAC A;  1W7U A;  1K96 A;  3BQ3 A;  2HGD A;  4B30 B;  1B8R A;  1OQP A;  4W6D A;  1CM1 A;  4B30 A;  2OS8 C;  2IB5 A;  2OJK A;  1DTL A;  1YVH A;  4XVP A;  5DPG A;  4GUK A;  4A4B A;  4W77 A;  3F45 A;  4ANJ A;  1U5I B;  3ZNI A;  4B5Y A;  4W6M A;  1F09 A;  2COL B;  4GGN A;  5CSI A;  1CFC A;  1U5I A;  4W6A A;  2KDH A;  3NEZ A;  1KCY A;  2JOJ A;  2Y4Q A;  1TOP A;  1YHI A;  2GW4 B;  3KO0 A;  3CR5 X;  4Q7T A;  5DTZ A;  3DQU A;  1JF0 A;  1F4Q A;  2F2P A;  3OHM B;  4P1Q A;  2JNF A;  5DKN A;  1OXD A;  4YI9 A;  5BPJ A;  1F0B A;  1C7V A;  1TRF A;  2P4M A;  4PE7 A;  3SVU A;  4ICB A;  4ZF5 A;  1YJF A;  2H2K A;  1EMM A;  4I5L B;  2K7B A;  1MOV A;  2H8Q A;  4FQO A;  4YGD B;  1N0Y A;  2ZNE A;  1AUI B;  4KF5 A;  5EXU A;  1TIZ A;  1CM4 A;  1OE9 B;  4N1G A;  1QY3 A;  3ST3 A;  4ZFS A;  1DGU A;  4ORA B;  2H5O A;  1QV1 A;  1QX2 A;  3LL8 B;  2L4H A;  1IQ3 A;  3PAT A;  1DJW A;  1TNQ A;  1NP8 A;  3AKA A;  3CD9 A;  1J1E A;  4YGC B;  2VVJ A;  2PMY A;  1EMA A;  3BYA A;  1ALW A;  3OSQ A;  3JVT B;  5DRF A;  1KSM A;  4W6I A;  3WLD A;  1J7P A;  3HX4 A;  4OV2 A;  4M2Q A;  2L51 A;  3DD4 A;  2NCO A;  5H89 A;  2EC6 C;  1JBA A;  1B7T Y;  3FWB A;  1ZGQ A;  4W7X A;  1JC1 A;  1IKU A;  1DJX A;  4PE0 A;  1A29 A;  1H4B A;  3U0L A;  3AKO A;  2G6Y A;  1CB1 A;  2AWK A;  1NPQ A;  4W72 A;  3PN7 C;  1YX8 A;  1B1G A;  5HLV A;  3NXA A;  2BBM A;  1YR5 A;  1SMG A;  3LVD A;  2M49 B;  3KHE A;  1G4Y R;  1Q4E A;  4ORC B;  1PAL A;  3WLC A;  1KFU S;  1QAS A;  2Y1M A;  4KW4 A;  2VAD A;  1A4P A;  2A54 B;  3BOW B;  3ZUF A;  3EKH A;  4I5K A;  2KNE A;  5HZS A;  3BOW A;  1GL4 A;  2QAC A;  2YE0 A;  1YFP A;  5I8N A;  2JQ6 A;  3AAJ A;  5K89 A;  2FWQ A;  5JOL A;  1PVA A;  4M2O A;  4OCI A;  3PJB A;  2LVJ A;  5HKW A;  2JT8 A;  4OKH A;  2NLN A;  1JF2 A;  1W7T A;  4A4C A;  4R6D A;  1XFY O;  4J89 A;  2KSP A;  2WCF A;  1CFF A;  2DDD A;  1K90 D;  3CZT X;  3OP0 A;  4MVF A;  1QVI Y;  2JPT A;  1DJY A;  4YI8 A;  4YGA A;  4AOM A;  2WHU A;  1B9C A;  2JWW A;  1KK7 Y;  3NSO A;  1YUS A;  2SAS A;  1XSS A;  3ZUJ A;  4U8D A;  1KK8 C;  1JBY A;  2KGR A;  5FYX A;  2H5Q A;  3LSA A;  5EHU A;  1F8H A;  1CDM A;  1KP5 A;  2EMD A;  1XFU O;  3LF4 B;  1LXF C;  1UP5 A;  3ICB A;  2LMU A;  2AH8 A;  4U2V A;  4GBA A;  1J1D A;  1M45 A;  2LLT A;  2EMN A;  2G2S B;  4LJC A;  2K61 A;  2Z1O A;  1AJ4 A;  1F54 A;  2K2F A;  4HVF A;  1KQM C;  2PAL A;  4YRU A;  2ZO7 A;  4F0Z B;  5CSJ A;  1UUR A;  1H8B A;  1UHN A;  3VRP A;  4PPK A;  2LM5 A;  1SL8 A;  1CDN A;  1ZFS A;  3PN7 B;  3VHT B;  4CFQ A;  3CWG A;  3LVC A;  3H1O A;  3DQ2 A;  5DTY A;  2A53 B;  5KSZ A;  4W6T A;  2YDZ A;  3IR8 A;  4IK8 A;  1SY9 A;  5AXI A;  3IP2 A;  2Q4U A;  2OKW A;  1XQM A;  1WLM A;  1NWD A;  4OVN F;  1KWO C;  4KA9 A;  1PSR A;  2LV7 A;  2GX0 A;  4EMQ A;  1REC A;  5B8I B;  2PRU A;  1SK6 D;  2NXQ A;  1GGW A;  2KOT A;  1H6R A;  1QX7 A;  1DJH A;  4KAG A;  4AR7 A;  1HCJ A;  1SCM C;  2O29 A;  4DXQ A;  2LVI A;  2KHN A;  2L4I A;  3NED A;  4NQG A;  2YE1 A;  4W6F A;  2QRF A;  3GEX A;  1YHH A;  3A8R A;  3SRY A;  1LA3 A;  1WLZ A;  2CCM A;  1WDC C;  2SCP A;  4L13 A;  1XFX O;  1SCV A;  1RJV A;  2L5X B;  4DXP A;  2A50 B;  3AAK A;  1EG4 A;  1KK8 B;  1SBJ A;  2BCA A;  2K8M B;  2M8U A;  2O5G A;  3VRQ A;  4KPI A;  2LHI A;  2Q6P A;  4RYS A;  1ZUZ A;  2JRF A;  1C4F A;  1TTX A;  3DQM A;  1K2H A;  1AHR A;  4HRE E;  1YRT B;  2VRG A;  1Z1P A;  2ZO6 A;  1KQM B;  2KI6 D;  4USL A;  1FPW A;  2LMT A;  5J3X A;  3BXA A;  4L1I A;  3I19 A;  5DTL A;  1OMV A;  3PJ7 A;  3DQL A;  4W6S A;  2CBL A;  1RRO A;  4BY4 A;  5I2O A;  4HRH A;  4R6B A;  4XJK B;  2LP3 A;  4ZIO A;  4XJK A;  1SR6 C;  1S6C A;  1Q4B A;  5KU1 A;  1IRJ A;  1YUU A;  3DQ8 A;  2LVK A;  4CID A;  1MOU A;  2WSN A;  4PHN A;  1KWO B;  3NT9 A;  4W6L A;  4AQI A;  1QIV A;  1L7Z A;  3S05 A;  4E68 A;  2BL0 C;  1YZW A;  1YUT A;  1RWY A;  1S6Z A;  3IQO A;  4PPJ A;  3BUN B;  2KAV A;  4W6G A;  3SVO A;  1UUS A;  2LLS A;  1ALV A;  2JT0 A;  3EVR A;  1EMG A;  1LVC D;  2VAE A;  1B4C A;  3CFA A;  4NDB A;  1BMO A;  1SCM B;  4GOB A;  3DQN A;  4OGS A;  4Q7U A;  1A2X A;  3KF9 A;  3BXK A;  5BQL A;  3K1K A;  3SG7 A;  1ZGP A;  3DVE A;  2NZ0 A;  2A52 B;  1RRX A;  4CPV A;  5DPH A;  3CB9 A;  1CFP A;  1BFP A;  4I5J A;  1WDC B;  3BXB A;  3DQI A;  1XK4 C;  2BCX A;  2AWL A;  5F9G A;  4CFR A;  2G3O A;  5HLO A;  3SVD A;  3EVV A;  3TUY C;  3MGF A;  1YTZ C;  3PM8 A;  2K0J A;  2KBM A;  5CSF A;  4GNK B;  1R2U A;  2WHS A;  5ER4 X;  5AER A;  2IE2 A;  3TDZ A;  3UG0 A;  3DQA A;  5LTR A;  1MYW A;  5J2O A;  5PAL A;  5F6T A;  1IJ6 A;  3ZWH A;  3NSI A;  3EK7 A;  4ZB1 A;  4XGY A;  1OZS A;  5CSN A;  3QRX A;  2A46 A;  1L2O C;  2PXS A;  2HF5 A;  3BUM B;  4PAL A;  5HZU A;  1SL9 A;  2BE6 A;  2Z6X A;  1OMR A;  1SR6 B;  1S5G Y;  3EK4 A;  3EKJ A;  2KI4 C;  4P5O E;  4KEX A;  2Q91 A;  3KCT A;  2VZX A;  4R1E A;  2IB6 A;  1PSB A;  1QJT A;  4Q7R A;  2DUG A;  4L12 A;  2BEC A;  2G2B A;  3WCK A;  3VIC A;  1N65 A;  4LQT A;  1J55 A;  2LLU A;  5I2L A;  2KBI A;  4GF6 B;  2WSO A;  2VVI A;  2JXL A;  4RTC A;  2BL0 B;  2OKY A;  3GOF A;  4EN1 A;  2LHL A;  3BUO B;  5GQQ C;  3KEV A;  3CD1 A;  4N5X A;  3BX9 A;  2Y0G A;  4YBH B;  3U0K A;  2JTT A;  3FWC A;  5FVG A;  4L9M A;  4CLN A;  1QLK A;  2JZI A;  3ADF A;  4OR9 B;  1EMK A;  3PJ5 A;  4XOW A;  2DUI A;  1TCF A;  3LF3 A;  1RK9 A;  2GGM A;  2JXC A;  4PPL A;  2H6V A;  1A75 B;  5FVI A;  2M29 A;  1PK0 D;  3U8C A;  2G6E A;  2HQK A;  3CFH A;  1A75 A;  2ISD A;  1NYA A;  1XK4 A;  3TUY B;  4IK5 A;  4DUQ A;  3LA1 A;  4N3D A;  2LAP A;  3DQJ A;  2QLE A;  2HFC A;  1CDL A;  2ZKM X;  3DF0 B;  2RGI A;  2HCG A;  1BOD A;  3DF0 A;  5EJU A;  3NSK A;  1B47 A;  3BUX B;  3M24 A;  1Q80 A;  1SPY A;  2GGZ A;  3I5I C;  4PHK A;  1M63 B;  1SL7 A;  1CTR A;  4ORB B;  2V53 A;  2LCP A;  4DXN A;  1CDP A;  2JU0 A;  3DQK A;  2H5R A;  1MWN A;  3NT3 A;  3EVP A;  2GV5 A;  1JWD A;  2O60 A;  2B1U A;  3TMR A;  2HGY A;  4IK9 A;  1L2O B;  1GJY A;  4JEO A;  3SVC A;  1B7T Z;  2A47 A;  2AHA A;  4J8A A;  2FCE A;  5HZT A;  2Q57 A;  3OGO A;  1NX0 A;  4ZF4 A;  1ZOT B;  1RTP 1;  3PAL A;  2KI4 B;  3CR2 A;  1J7R A;  2HQW A;  2KGB C;  4W7R A;  2KAY A;  3W1D A;  5AAN A;  1OXF A;  1EH2 A;  1X02 A;  3G9A A;  5D7F A;  2HJO A;  4TNC A;  3SVS A;  3CR4 X;  3PLF B;  4KW9 A;  1DJZ A;  1QV0 A;  3DQ5 A;  4ZF3 A;  2M1K B;  5BTT B;  3JTD C;  3AKB A;  2O2B A;  2PAS A;  1CV7 A;  4PE1 A;  5BTT A;  1Y1U A;  1LKJ A;  1CLL A;  1UHI A;  4IK1 A;  3E5T A;  5BT0 A;  3UFZ A;  1RMO A;  2PXW A;  5I2Q A;  2R2I A;  2K7O A;  3D10 A;  1QS7 A;  4QJ4 B;  2F3Y A;  1CMF A;  2BTJ A;  1KYR A;  4JC2 A;  1JFJ A;  4MZK A;  4EUL A;  3OX6 A;  4H3N A;  1RMP A;  1QXP A;  1NIW A;  1FW4 A;  3SSY A;  2WOR A;  3AI4 A;  1ZGO A;  1YX7 A;  1GQM A;  5HYD A;  1QVI Z;  1UIS A;  1QYF A;  2L2E A;  1KK7 Z;  1DJG A;  2MHH A;  3OSR A;  1YVL A;  2Y1N A;  1RMM A;  3I5I B;  4J88 A;  3DQD A;  1XFW O;  4MRX A;  4P76 A;  1XA5 A;  3D0Y B;  3GL4 A;  4C0J A;  1QYO A;  3WNX B;  4HRG A;  3D0Y A;  4MZJ A;  2F3Z A;  1AK8 A;  2AAO A;  2FZU A;  5DKQ A;  3U8P A;  4Q9W A;  1W7J B;  3LK1 A;  1M46 A;  2WCE A;  1IGV A;  2AWJ A;  4KF4 A;  1JBZ A;  2DUH A;  3E5V A;  5EXC I;  1UHK A;  1S6I A;  2I18 A;  5HBD A;  1DJI A;  3TDI A;  2G6X A;  3SS0 A;  5H87 A;  1EML A;  1QAT A;  1B8C A;  1NSH A;  3ZTF A;  1TNX A;  2FOT A;  1DGV A;  3RWA A;  3RLZ A;  4W74 A;  3IQQ A;  3U0M A;  1DVI A;  4Z4K A;  4W6U A;  1BR1 B;  3O6B A;  2JC2 A;  3DQ4 A;  1KYP A;  1CNP A;  4BY5 A;  4JWQ A;  3JTD B;  1K93 D;  3SST A;  4HE4 A;  2ZND A;  4GFT A;  4QJ3 B;  4GAO A;  4KW8 A;  1C07 A;  4W7F A;  3DPW A;  4WRI A;  2LUC A;  1CLB A;  4C0L A;  1Q4A A;  2DDC A;  2QPT A;  3KCS A;  2WOS A;  1RFJ A;  1IQ5 A;  2QLG B;  2K7D A;  3SIB A;  2A4J A;  3P28 A;  2H61 C;  1BOC A;  2QLG A;  1G8I A;  1YHG A;  1XMZ A;  3M22 A;  2M3W A;  1V1F A;  1ODB A;  1GGZ A;  3TDU A;  2V4E C;  2D8N A;  3FIA A;  2G5Z B;  1K94 A;  3WHU B;  2ZRT A;  3PIB A;  3DVM A;  1XO5 A;  5DRG A;  3MSE B;  1S6J A;  1YJ2 A;  2LC5 A;  2FCD A;  1QLS A;  5CPV A;  4W6P A;  2HPS A;  5ER5 A;  1C7W A;  1DT7 B;  1NCX A;  1BLQ A;  1M39 A;  2KQ6 A;  5H88 A;  2KI6 C;  1ZUX A;  1JUO A;  1A03 A;  3SSH A;  4HQ9 A;  4W7D A;  3CLN A;  3GK4 X;  3TS5 B;  3DQ9 A;  5AEQ A;  3I5H C;  3OX5 A;  2OTB A;  2M9G A;  1WY9 A;  3CTN A;  2WIQ A;  2BCB A;  2HQ8 A;  2ICR A;  2BKH B;  1OXE A;  2Z6Z A;  1K8U A;  2WUR A;  2ARL A;  3GK1 A;  4W73 A;  3FS7 A;  4M2P A;  3RM1 A;  4UPG A;  2M7N A;  1QIW A;  1QX5 B;  3W1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...