3SG4A

Crystal structure of gcamp3-d380y, lp(linker 2)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
total genus 133
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg4A02
2FCDA 3IR8A 4GESB 3V3DA 5H87A 2KFHA 1JSAA 5KU1A 3LVDA 1AVSA 2QZ0A 1A75B 2JU0A 1A75A 4W77A 1DMOA 2A48A 1QTXA 2BBMA 1G7KA 2JXCA 1QVIY 3PN7B 4CLNA 5DQMA 3U8CA 1JBYA 4W6OA 3LK0A 4ZB1A 2KDHA 5FHVA 1JBAA 2MHHA 3ZUJA 5HLOA 1EMMA 1KP5A 3KEVA 1ZOTB 4LJCA 1E8AA 1KK7Y 2PVBA 1WRZA 3SVEA 4YGAA 5FVIA 3ST4A 3DQFA 1XMZA 3I5FB 4A4CA 1W7IB 4JEOA 4P1QA 5PALA 5D69A 1N65A 1W7TA 3U0MA 4EULA 4H3MA 1Y1UA 1XFWO 4CIDA 1FBVA 1WDCB 3LK1A 3QRXA 1NCZA 2Z6XA 3E5WA 2SASA 2PALA 2O24A 1M45A 2KI6D 2R2IA 4R1EA 4HRGA 1ZUZA 4GGFC 4I5JA 4AQJA 1TIZA 5ER5A 4IK1A 3CTNA 3CD9A 3MGFA 1SK6D 5T3IA 1XA5A 3DQIA 4DS7A 4DRWA 1XO5A 1XFUO 2LAPA 2Y1NA 5F6TA 2AUCA 2BCAA 4P5OE 4YGEB 1CMFA 3ICBA 2QACA 2L4IA 2RH7A 4WQ2A 2ZMUA 4KEXA 1YUSA 3D10A 2LMTA 2L50A 2Y1MA 2RGIA 3O78A 2VVIA 1CV7A 3BUXB 1H4BA 2M7NA 4L13A 4EDOA 2VRGA 1YRTB 2G2BA 4XOWA 1NSHA 1QY3A 1ALVA 1FI6A 5CSNA 1RWYA 1BOCA 4JRBA 1SCVA 1XA9A 3LA1A 2EMOA 3O2PA 1S5GZ 4W6MA 1IG5A 3SS0A 1JFJA 3H1RA 4W73A 2EC6B 4MRYA 3WLDA 4AQIA 3DQ3A 1S3PA 4PHMA 2IS9A 4U2VA 4YI9A 3PIBA 2KAVA 4LQUA 1FF1A 1PULA 3I5IB 2YDZA 1IRJA 4ORCB 4D1EA 3SSVA 2H5QA 1H8BA 1YUTA 4W6UA 1NIWA 3NT9A 4TZAA 4RYSA 1YHHA 3ZULA 3U8PA 1SMGA 4YGCB 1B9AA 2A47A 1MQ1A 1QASA 2QU1A 2BL0B 4ZF3A 4XJKB 3RM1A 4JQ0D 4XJKA 2F2PA 3BQ3A 4W6BA 4W6TA 2NLNA 2H61A 3K21A 4LW5A 3WLCA 2EMDA 4L9MA 4I5KA 4PE0A 4ORBB 4QJ5B 4XYNA 1K95A 2WIQA 4KW8A 1M31A 4PPLA 3I5GB 4W6SA 3SIBA 1SRAA 2KBIA 4HE4A 2OS8B 2AAOA 5KTYA 3PALA 2BKHB 4E68A 3SG2A 5ER4X 1FI5A 1KYPA 1AP4A 1OXEA 2CT9A 3NT3A 3BXCA 1K93D 5DRGA 1MF8B 1YJFA 1RMPA 2ZNEA 5DKQA 2GGZA 5LK4A 2HQKA 2V53A 1F4QA 4L12A 2LE9B 1EMLA 2Q91A 4EN1A 2CTNA 2CNPA 3ST0A 3EVVA 3SSTA 1DTLA 5EXUA 2H5RA 1PALA 1EMAA 3HCMA 1F09A 3BXAA 3CBEA 1DGVA 5LTRA 4LJDA 3SG7A 1UP5A 4USLA 3OGOA 1XYDA 2QPTA 4XVPA 1PSBA 2ICRA 2KGRA 1S6ZA 2JWWA 3NXAA 2LLTA 2F33A 3PATA 1UHHA 2OGRA 4W6FA 1IWQA 4KPIA 1CFDA 1VRKA 5HKYA 2HCGA 2VVJA 4EDSA 4TZGA 4HQ8A 2A52B 1G8IA 3W1DA 1NUBA 3SG4A 4OJ0A 2VADA 3ED8A 4PE7A 1YURA 1QS7A 3TZ1A 3BUOB 5CPVA 3H4SE 4I5LB 4DIRA 2C9JA 2WSNA 1B8RA 2M97A 2L4HA 2BKIB 1S26D 2HQ8A 4HQ9A 3IQOA 1B1GA 4YI8A 1QLKA 1SPYA 4W75A 2PXSA 3DQ5A 4DKMA 3AKOA 3CR5X 1KCYA 1W7SA 3DQEA 2KBMA 4AS8A 2I2RE 5DRFA 1EMCA 1J7OA 1N2DA 4C0JA 1DVIA 1QV0A 3SVDA 3ZUFA 4GNKB 2QLGB 1A03A 2HJOA 5AANA 3GK4X 2QLGA 2M0RA 1K2HA 1OQPA 4GFTA 3DVKA 2QLHA 5EB7A 2JNXA 5AEQA 2Z1OA 4JF9A 1U5IB 2F3YA 4GGFA 5CSFA 1J55A 1U5IA 2OTGC 5HZUA 2K7DA 1JUOA 2LNKA 3DQKA 1OZOA 3W1CA 1DJGA 3BXKA 3H1OA 1GL4A 2AWKA 1EH2A 3DVEA 4Q9WA 1K96A 1QYQA 2KAYA 3SVCA 1YX7A 4AR7A 5AERA 4IK8A 3WXAA 2SCPA 2LANA 2JXLA 3GJ2A 2Z6YA 4OVNF 3A8SA 2QLEA 4Q04A 3NSKA 4W6JA 5DPGA 1SL9A 4W6PA 3GJ1A 5DTLA 2Q6PA 2DD9A 3CS1A 4JPZB 4QJ3B 3DQMA 4UTSA 1S6CA 1S5GY 1MOUA 1WLMA 1PVBA 4RYWA 5GQQC 1CMGA 3GK1A 2WCFA 2ZRSA 2JQ6A 4I5NB 3EKJA 2COLB 1HT9A 3AKBA 4IZNA 1S36A 4PHJA 3PFVA 2LM5A 2KQ6A 2B3QA 4OHSA 4N1FA 4OKHA 3NSOA 3DQ7A 4ZFSA 4DXPA 3PLFB 3O4YA 3KHEA 5DTXA 4PALA 3U0LA 4OV2A 5BT0A 1XFYO 1MXEA 4J88A 4ZINA 4W7EA 1NCXA 2M9GA 2GX0A 2KAXA 4Q7RA 2G9BA 3SVOA 1D1OA 1CM4A 3DQ4A 2JOJA 3JVTC 3ZWHA 4P2YB 1PRWA 1DJHA 2LVIA 2A4JA 3SSYA 2K2FA 2HRSA 2LP2A 1JBZA 2CCMA 4W7CA 1NX2A 5HZSA 3SG3A 1EL4A 1AUIB 3SSPA 4MZLA 4CPVA 3VRPA 4DXOA 3DQUA 1KFUL 3U0NA 1A4PA 3D0YB 3AI5A 2M29A 3D0YA 3ZNIA 2IB5A 3BX9A 2IE2A 2M1UA 5DTZA 4MSPA 5HW9A 4ZF4A 2MLFC 2B3PA 4MZJA 3NSLA 4PDZA 1OMDA 1YR5A 2L51A 4J89A 1IJ5A 5DY6A 4H3LA 4IK9A 1RRXA 1YVLA 1F71A 4ANJA 1HCJA 1RROA 2JT3A 2LHIA 2QT2A 1RMOA 1MR8A 2IOVA 2L0PA 3WHUB 3LF4B 3GK2A 2LP3A 2JZIA 4HVFA 2I7AA 2EMNA 2ZO7A 1IGVA 3AKAA 2JADA 3E5TA 1SR6C 5J2OA 4BY5A 2MBXA 4ORNA 1C7WA 4PE1A 5DU0A 1OMVA 2JNFA 2KI6C 2M1KB 3BYAA 2DDDA 2O29A 1A29A 5HYDA 1F4OA 1SCMC 5EXBA 2HPSA 3DVJA 4WRIA 2V4EC 3KCTA 1K90D 3KPXA 1L2OC 4PE4A 2HF5A 5HLVA 1HUYA 2Y5IA 4YRUA 4W6DA 1EXRA 1DJIA 4PHKA 1TTXA 1RM9A 1K9UA 3LVCA 1YTZC 1BR1B 1CLLA 2NXQA 2JPTA 2LCPA 1YHIA 1J7QA 3JTDC 5AXIA 2NCPA 1QIWA 1NX0A 4ZCUA 5F9GA 2HPWA 4MEWA 1J7RA 1IQ3A 3OB1B 3NEDA 3VK1A 2M49B 1JF2A 3OHMB 1UISA 1J1DA 3RLZA 4GUKA 3K1KA 2GGMA 2GX2A 3SSLA 1Y6WA 3E3RA 4W6HA 3CFHA 1OE9B 1CLBA 2Q4UA 3IP2A 2ISDA 4H48A 1BR4B 4Q9XA 2KOTA 5DKRA 2Z6ZA 1CLMA 3OSQA 1Q4CA 3VRQA 4HREE 4GOBA 3WNXB 4W6AA 3DQCA 2YE1A 3OX5A 1YJ2A 2WSOA 1LINA 2H6VA 3TDZA 1KWOC 2WURA 3I5HB 3FWCA 2KNEA 2A53B 2OTGB 5HKWA 4KF5C 1BU3A 4OQWA 1WRLA 1H6RA 4IL1A 2E30A 1K9KA 3O77A 4ETOA 2DOQA 2BECA 1UHKA 4NWSA 1XK4A 2L5XB 1IQ5A 5I2QA 3SVUA 3RWTA 1ZACA 1QYOA 3M22A 4W76A 4MZKA 3LCPC 4JFGA 2KI4C 2IB6A 1TNQA 3OX6A 2ZNDA 3VHTB 2K2AA 4C0KA 3BXBA 3VHTA 1GGZA 1K94A 3TMRA 4A4BA 2ZKMX 1XFVO 5CSIA 3GOFA 1TOPA 3LS3A 3A4UB 4W7FA 3I5FC 2E6WA 2QRFA 2G6EA 1Z1QA 1C07A 2G2SB 1JC0A 3HX4A 2AHAA 3SJSA 3PM8A 1WDCC 1RJVA 4OR9B 3OB2B 1NP8A 4FTGA 4N1GA 2G5ZB 2ZN8A 3FIAA 4CFRA 1ZUXA 3CB9A 1NX1A 3GEXA 2F8PA 5KSZA 2H8QA 1EG4A 1SYMA 2JT8A 2KFGA 2JRFA 1M63B 2LUCA 3NF0A 2O2BA 3PJ7A 3KCSA 2ZN9A 3SVSA 2LVVA 1R6PA 3DPXA 1KYSA 4DXNA 3JVTB 4N5XA 3GL4A 3SG6A 2WHUA 1B9CA 4NDCA 2DUIA 4RTCA 4MBEA 3EK4A 5I8NA 3VRNA 3P8UA 4LJBA 3S05A 1Y1XA 4M2PA 1QX2A 3M0WA 4JWQA 3VRRA 2DUHA 2POXA 1JFKA 1CDNA 4JGEA 2BCBA 5EXCI 3TS5C 4ICBA 2I94A 2LC5A 1CDMA 1M46A 2KGBC 1UHJA 4DUQA 1JC1A 2BBNA 4TNCA 3BUNB 3A8RA 3SSKA 2YFPA 5B8IB 2LV7A 1K8UA 1BJFA 3TUYC 3DQ9A 1KQMC 2ZFDA 3WHTB 2DUFA 1KFUS 1F0BA 2A54B 5DPIA 4Z4MA 3PJ5A 3WCKA 1IKUA 1TCOB 3LF3A 3I5IC 3CGLA 1S6IA 1UHIA 3SIAA 1BODA 4W6CA 4BDUA 1DJYA 1B8CA 1ODBA 2F2OA 2FCEA 3VGOA 2TN4A 2VZXA 2F3ZA 5H88A 5G08A 1MWNA 1ZGOA 2WHSA 1FW4A 4JC2A 2H2KA 3CR2A 1SR6B 2K7BA 3M24A 4W6LA 2FJUB 1Q4EA 1GGXA 3SV5A 5KTGA 4IK3A 2JULA 5LTQA 5FYXA 1SCMB 1X02A 2K8MB 4MLWA 2PXWA 2V4EB 3CFFA 4W6GA 3EK8A 2V4EA 2P6BB 4OGSA 1KQVA 2DUEA 4NDDA 1BLQA 1L2OB 1NYAA 1OXDA 1S6JA 1DJWA 3LSAA 3DF0B 3DF0A 4PCWA 1UURA 3LL8B 4KGEA 1CDLA 3JTDB 1F70A 3DQDA 1RFJA 4MRXA 5BPJA 2H5OA 1RECA 5DTYA 2K61A 1LA3A 1J7PA 2HFCA 2LLUA 5DPHA 2M3WA 5CSJA 1WLZA 1GJYA 3CGAA 1YHGA 3OP0A 3DQ6A 2WNDA 4DXMA 2JC2A 2HGYA 1IH0A 4ZIOA 2O5GA 2GW4B 1QIVA 2MAZA 4R6BA 4MN0A 1HQVA 1ZGQA 1TNWA 1QX7A 3TDUA 3DPWA 4OCIA 1KFXS 4B5YA 4P76A 3ST2A 2A50B 1OOJA 1EG3A 5FVGA 4LJDC 1KWOB 5JJGA 1N0YA 1XQMA 5IBWA 1B47A 3EK7A 3P28A 4KF4A 1A2XA 5BQLA 4AOMA 3F45A 1LVCD 1Y1AA 4KF5A 1OMRA 3DQAA 2LMUA 5I2LA 1Q73A 4BY4A 4L1IA 1KSMA 2I18A 1J1EA 4Q7UA 1GGWA 2M7LA 1DJXA 1EJ3A 2PSRA 1NCYA 1BT6A 1SKTA 2ZO6A 4W7RA 3SVNA 1PVAA 4W69A 1TRFA 1SW8A 2KI4B 4KW9A 3SG5A 3BUMB 1MUXA 1MXLC 1ALWA 1DJZA 4U8DA 2HQWA 3G9AA 1Y0VH 1IJ6A 2HQZA 3SVBA 1ZGPA 3ADFA 1PSRA 2KFFA 1KK8C 1EMGA 3CR4X 4UPGA 3MSEB 5JOLA 1RK9A 2NZ0A 2FOTA 1BMOA 2AMIA 4I2YA 3EVPA 1B7TZ 3I19A 2JTTA 1SL7A 2YE0A 5HKZA 5D7FA 2VVHA 2ARLA 3FWBA 4KAGA 5HBDA 3DQOA 4KGFA 3CWGA 2AWLA 1XVJA 5LTPA 4ZCVA 2AH8A 1LA0A 2D8NA 1SBJA 3E5VA 1RMMA 4ZF5A 3EVUA 2Q57A 5H89A 3CLNA 2CBLA 2DUGA 4XGYA 2MJWB 1SY9A 4NQGA 1YVHA 2BCXA 5FVFA 3RWAA 3AAKA 5EB6A 3U8AA 2G16B 1F55A 3UFZA 2G6XA 1MHOA 1KYRA 3TS5B 1YRUB 2B1UA 3DQJA 3ZTFA 2LHLA 1DT7B 2FZUA 2KYCA 3DVMA 1QXPA 4PHNA 5EHUA 4PPKA 1KSOA 2BE4A 3TUYB 2HGDA 1SNLA 1KFXL 1V1FA 4OY4A 1KQMB 5DPJA 2ZRTA 5TNCA 2HETA 1F54A 1UHNA 1LKJA 2WOSA 1CFCA 1EMFA 2WCBA 1WY9A 2H9WA 3DQNA 5AFPA 4N3DA 3ST3A 1TN4A 2NCOA 4Q7TA 4GF6B 1QX5B 2FWQA 1JC2A 5BTTB 4LQTA 1B4CA 5BTTA 2PRUA 4C0LA 2KYFA 1QV1A 1W7JB 2C9IA 3DQ8A 1BFPA 2L98A 2K7CA 1W7UA 4XL5A 2ZMWA 3UG0A 1CM1A 1EMEA 2H5PA 1XAEA 1V1GA 1EMBA 4PPJA 3PN7C 2OPOA 3PSRA 2CXJA 2LLSA 1QVIZ 4M2OA 4W6KA 3IQQA 5EBJA 1QXTA 4H3NA 2AWJA 2WCEA 5AQBB 4ORAB 1K9PA 2P4MA 2DDCA 1JF0A 2K7OA 2KHNA 1Q4AA 3AI4A 4GBAA 1R2UA 1KK7Z 3SSHA 2G3DB 3EVRA 3C1VA 4HSZA 1ZFSA 5DKNA 1M39A 2VAEA 4MVFA 4GGNA 1CKKA 1OSAA 4IK5A 4R6DA 3TDIA 4QJ4B 1QJTA 3CD1A 1Z1PA 1GQMA 4YGDB 3DQLA 2JTZA 4CFQA 1B8LA 5HGEA 1DGUA 3O6BA 2WORA 3DD4A 2EGDA 4M2QA 4KW4A 1EMKA 4PFEA 1PK0D 3DQ2A 1LXFC 3DQ1A 1TCFA 3NSIA 4KA9A 2Y4QA 5HZOA 1QLSA 3BUWB 1C4FA 1JWDA 1G4YR 1Q80A 3GB3A 2MLEC 2LVJA 1UWOA 2WC8A 2LVKA 1NX3A 1TNXA 2OKWA 3BOWB 3BOWA 2G6YA 3VROA 1BF5A 1UUSA 3FS7A 3IF7A 4W74A 1YFPA 1XSSA 1S1EA 3LVAA 2OTEA 1BG1A 4YBHB 4GPLB 1OZSA 3SRYA 2OJKA 4DKNA 1CNPA 3PJBA 4GAOA 2OKYA 4F0ZB 2FL1A 1NWDA 2EC6C 1CFPA 4W7DA 3U0KA 1G33A 1F8HA 2A46A 1XFZO 3KF9A 1WRKA 2M8UA 3CZTX 3DPZA 2A56B 1SL8A 2KQYA 2GW3A 2WHTA 1CTRA 1ZMZA 1KK8B 2BTJA 2WISA 1CB1A 1B7TY 1YX8A 4W7AA 3CFAA 4EMQA 3VICA 1XFXO 4W7XA 3OSRA 2LUXA 1YUUA 3NEZA 2BE6A 3SVRA 1CDPA 3I5HC 1FPWA 3LLEA 2K0JA 2KSPA 2BL0C 1OXFA 4FQOA 2H61C 4W6IA 4DXIA 2AWMA 4XOVA 2L2EA 1TNPA 1AJ5A 2G3OA 3DQHA 2MRDA 3I5GC 2GV5A 4H47A 3TMTA 5EJUA 2DD7A 4DCKA 1XK4C 4IK4A 4DXQA 2OS8C 3EKHA 1GFLA 5HZTA 4HRHA 4Z4KA 4W72A 2PMYA 5K89A 5J3XA 2EHBA 4J8AA 2O60A 2OTBA 1YZWA 1QATA 1MYWA 4NDBA 1Q4DA 2Y0GA 1C7VA 2JT0A 1AK8A 1AHRA 1RTP1 4YGBB 3KO0A 4WQ3A 5I2OA 1Q4BA 1QYFA 2LMVA 4B30B 1CFFA 4W6NA 4B30A 3AAJA 1MOVA 5DQBA 1AJ4A 4ZBLA 4W6RA 1H4UA 2QLIA 1L7ZA 4HQCA 2PASA 1DF0B 1NPQA 2MA2A 1DF0A
chains in the Genus database with same CATH superfamily
2FCDA 3IR8A 4GESB 3V3DA 5H87A 2KFHA 4KYNA 1JSAA 5KU1A 3LVDA 1AVSA 2QZ0A 1A75B 2JU0A 1A75A 4W77A 1DMOA 2QEVA 2A48A 1QTXA 2BBMA 1G7KA 2JXCA 3B86A 1TWOA 1QVIY 3PN7B 4CLNA 3L4AA 5DQMA 3U8CA 1JBYA 4W6OA 3LK0A 4ZB1A 2KDHA 2QDIA 5FHVA 1JBAA 2MHHA 3ZUJA 5HLOA 1EMMA 1KP5A 3KEVA 1ZOTB 4LJCA 1E8AA 1KK7Y 2PVBA 1WRZA 3SVEA 4YGAA 5FVIA 3ST4A 3DQFA 1XMZA 3I5FB 4A4CA 2H8VA 1W7IB 4JEOA 4P1QA 5PALA 5D69A 1N65A 1W7TA 3U0MA 4EULA 4H3MA 1Y1UA 1XFWO 4CIDA 1FBVA 1WDCB 1DC1A 3LK1A 1W9ZA 3QRXA 3CZ2A 1NCZA 2Z6XA 3E5WA 2SASA 2PALA 2O24A 5HL1A 1M45A 2KI6D 2R2IA 4R1EA 4HRGA 1ZUZA 3CZ0A 4GGFC 4I5JA 4AQJA 1TIZA 5ER5A 4IK1A 3CTNA 3CD9A 3MGFA 1SK6D 3CABA 5T3IA 1XA5A 3DQIA 4DS7A 4DRWA 3BFHA 1XO5A 3R1OA 1XFUO 2LAPA 2Y1NA 2PYQA 3D78A 5F6TA 2AUCA 2BCAA 4P5OE 4YGEB 1CMFA 3ICBA 2QACA 2L4IA 2RH7A 4WQ2A 2ZMUA 4KEXA 1YUSA 3D10A 2LMTA 2L50A 2Y1MA 2RGIA 3O78A 2VVIA 1CV7A 3BUXB 1H4BA 2M7NA 4L13A 4EDOA 2VRGA 1YRTB 2G2BA 4XOWA 1NSHA 1QY3A 1ALVA 2BAPA 1FI6A 5CSNA 1RWYA 1BOCA 4JRBA 1SCVA 1XA9A 3LA1A 2EMOA 3O2PA 1S5GZ 4W6MA 1IG5A 3SS0A 1JFJA 3H1RA 4W73A 2EC6B 4MRYA 3WLDA 4AQIA 3DQ3A 1S3PA 4PHMA 2IS9A 4U2VA 4YI9A 3PIBA 2KAVA 4LQUA 1FF1A 4F7FA 1PULA 3I5IB 2YDZA 1IRJA 4ORCB 4D1EA 3SSVA 2H5QA 1H8BA 1YUTA 4W6UA 3D75A 1NIWA 2L5YA 3OGNA 3NT9A 4TZAA 4RYSA 1YHHA 3ZULA 3U8PA 1SMGA 4YGCB 1B9AA 3S0BA 2A47A 1MQ1A 1QASA 2QU1A 2BL0B 4ZF3A 4XJKB 3RM1A 4JQ0D 4XJKA 2F2PA 3BQ3A 4W6BA 4W6TA 2NLNA 2H61A 3K21A 4LW5A 3WLCA 2EMDA 4L9MA 4I5KA 4PE0A 4ORBB 4QJ5B 4XYNA 1K95A 2WIQA 4KW8A 5FI7A 1M31A 4PPLA 3FE6A 3I5GB 4W6SA 3SIBA 1SRAA 2KBIA 4HE4A 5DICA 3Q8IA 2OS8B 2AAOA 5KTYA 3PALA 2BKHB 4E68A 3SG2A 5ER4X 1FI5A 1KYPA 1AP4A 1OXEA 3D76A 2CT9A 3NT3A 3BXCA 1K93D 5DRGA 1MF8B 1YJFA 1RMPA 2ZNEA 5DKQA 2GGZA 5LK4A 2HQKA 2V53A 1F4QA 4L12A 1C3ZA 2LE9B 1EMLA 2Q91A 4EN1A 2CTNA 4PT1A 2CNPA 3ST0A 3EVVA 3SSTA 1DTLA 5EXUA 2H5RA 1PALA 1EMAA 3HCMA 1F09A 3BXAA 3S0DA 3CBEA 1DGVA 5LTRA 4LJDA 3SG7A 4JD9A 1UP5A 4USLA 3OGOA 1XYDA 2QPTA 4XVPA 1PSBA 2ICRA 2KGRA 2ERBA 1S6ZA 2JWWA 3NXAA 2LLTA 2F33A 3PATA 1UHHA 2OGRA 4W6FA 1IWQA 1Z4HA 4KPIA 1CFDA 1VRKA 5HKYA 2HCGA 2VVJA 4EDSA 4TZGA 4HQ8A 2A52B 1G8IA 3W1DA 1NUBA 3SG4A 4OJ0A 2VADA 3ED8A 4PE7A 1YURA 1QS7A 3TZ1A 3BUOB 3PM2A 5CPVA 3H4SE 4I5LB 4DIRA 2C9JA 2WSNA 1B8RA 2M97A 2L4HA 2BKIB 1S26D 2HQ8A 4HQ9A 3IQOA 1B1GA 4YI8A 1QLKA 1SPYA 4W75A 2PXSA 3DQ5A 4DKMA 3AKOA 3CR5X 1KCYA 1W7SA 3DQEA 2KBMA 4AS8A 2I2RE 5DRFA 1EMCA 1J7OA 1N2DA 4C0JA 1DVIA 1QV0A 3SVDA 3ZUFA 4GNKB 2QLGB 1A03A 2HJOA 5AANA 3GK4X 2QLGA 2M0RA 1K2HA 3SS3A 1OQPA 4GFTA 3DVKA 2QLHA 5EB7A 2JNXA 5AEQA 2Z1OA 4JF9A 1U5IB 2F3YA 4GGFA 5CSFA 1J55A 1U5IA 2OTGC 5HZUA 3S0AA 2K7DA 1JUOA 2LNKA 3DQKA 1OZOA 3W1CA 1DJGA 3BXKA 3H1OA 1GL4A 2AWKA 1EH2A 1P28A 3DVEA 4Q9WA 1K96A 1QYQA 2KAYA 3SVCA 1YX7A 4AR7A 5AERA 4IK8A 3WXAA 3DY9A 2SCPA 2LANA 2JXLA 3GJ2A 2Z6YA 4OVNF 1DQEA 3A8SA 2QLEA 4Q04A 3NSKA 4W6JA 5DPGA 1SL9A 4W6PA 3GJ1A 5DTLA 2Q6PA 2DD9A 3CS1A 4JPZB 4QJ3B 3DQMA 4UTSA 1S6CA 1S5GY 1MOUA 1WLMA 1PVBA 2KPHA 5GQQC 4RYWA 1CMGA 3GK1A 2WCFA 2ZRSA 2JQ6A 4I5NB 3EKJA 2COLB 1HT9A 3AKBA 4IZNA 1S36A 4PHJA 3PFVA 2LM5A 2KQ6A 2B3QA 4OHSA 4N1FA 4OKHA 3NSOA 3DQ7A 4ZFSA 4DXPA 3PLFB 3O4YA 3KHEA 5DTXA 4PALA 3U0LA 4OV2A 5BT0A 1XFYO 1MXEA 4J88A 4ZINA 4W7EA 1NCXA 2M9GA 2GX0A 2KAXA 4Q7RA 2G9BA 3SVOA 1D1OA 1CM4A 3DQ4A 2JOJA 3JVTC 3ZWHA 4P2YB 1PRWA 1DJHA 2LVIA 2A4JA 3SSYA 3DXLA 2K2FA 2HRSA 2LP2A 1JBZA 4FQTA 2WC6A 5I94A 2CCMA 4W7CA 1NX2A 5HZSA 3SG3A 1EL4A 1AUIB 3SSPA 4MZLA 4CPVA 3VRPA 4DXOA 2KLDA 3DQUA 1KFUL 3U0NA 1A4PA 3D0YB 3AI5A 2M29A 3D0YA 3ZNIA 2IB5A 3BX9A 2IE2A 2M1UA 5DTZA 4MSPA 5HW9A 4ZF4A 2MLFC 2B3PA 4MZJA 3NSLA 4PDZA 1OMDA 1YR5A 2L51A 4J89A 1IJ5A 1DELA 5DY6A 4H3LA 4IK9A 1RRXA 1YVLA 1F71A 4ANJA 4OZDA 1HCJA 1RROA 2JT3A 2LHIA 2QT2A 1RMOA 1MR8A 2IOVA 2L0PA 3WHUB 3LF4B 3GK2A 2LP3A 2JZIA 4HVFA 2I7AA 2EMNA 2ZO7A 1IGVA 3AKAA 2JADA 3E5TA 4INXA 1SR6C 5J2OA 3BJHA 4BY5A 2MBXA 3CDNA 4ORNA 1C7WA 4PE1A 5DU0A 1OMVA 2JNFA 2KI6C 2M1KB 3BYAA 2DDDA 2O29A 1A29A 5HYDA 1F4OA 1SCMC 1IIOA 5EXBA 2HPSA 3DVJA 4WRIA 2V4EC 3KCTA 1K90D 4INWA 3KPXA 1L2OC 5EL2A 3N7HA 4PE4A 2HF5A 5HLVA 1HUYA 2Y5IA 4YRUA 4W6DA 1EXRA 1DJIA 4PHKA 1TTXA 1RM9A 1K9UA 3LVCA 1YTZC 1BR1B 1CLLA 2NXQA 2QEBA 3RZSA 3SS5A 2JPTA 2LCPA 1YHIA 1J7QA 3JTDC 3PJIA 5AXIA 2NCPA 1QIWA 1NX0A 4ZCUA 5F9GA 2HPWA 4MEWA 1J7RA 1IQ3A 3OB1B 3NEDA 3VK1A 2M49B 3NHTA 1JF2A 3OHMB 1UISA 1J1DA 3RLZA 4GUKA 3K1KA 2GGMA 2GX2A 3SSLA 1Y6WA 3E3RA 4W6HA 3CFHA 1OE9B 1CLBA 2Q4UA 3IP2A 3UNWA 2ISDA 4H48A 1BR4B 4JKTA 4Q9XA 2KOTA 5DKRA 2Z6ZA 1CLMA 3OSQA 1Q4CA 3VRQA 4HREE 4GOBA 3WNXB 4W6AA 3DQCA 2YE1A 3OX5A 1YJ2A 2WSOA 1LINA 1OOGA 2H6VA 3TDZA 1KWOC 2WURA 3I5HB 3FWCA 2KNEA 2A53B 2OTGB 5HKWA 4KF5C 1BU3A 4OQWA 1WRLA 1H6RA 3CZ1A 4IL1A 2E30A 1K9KA 3O77A 4ETOA 2DOQA 2BECA 1UHKA 4NWSA 1XK4A 2L5XB 1IQ5A 5I2QA 3SVUA 2WCJA 3RWTA 1ZACA 1QYOA 3M22A 4W76A 4MZKA 3D74A 3LCPC 4JFGA 2KI4C 2IB6A 1TNQA 3OX6A 2ZNDA 3R1PA 3VHTB 2K2AA 4C0KA 3BXBA 3VHTA 1GGZA 1K94A 2WCLA 3TMRA 4A4BA 2ZKMX 1XFVO 3R1VA 5CSIA 3GOFA 1TOPA 3LS3A 3A4UB 4W7FA 3S0GA 3I5FC 2E6WA 2QRFA 2G6EA 1Z1QA 1C07A 2G2SB 1JC0A 3HX4A 2AHAA 3SJSA 3PM8A 1WDCC 1RJVA 4OR9B 3OB2B 1NP8A 4FTGA 4N1GA 2G5ZB 2ZN8A 3FIAA 4CFRA 1ZUXA 3CB9A 1NX1A 3GEXA 2F8PA 3NGVA 5KSZA 2H8QA 1EG4A 1SYMA 2QEHA 2JT8A 2KFGA 2JRFA 1M63B 2LUCA 3NF0A 2O2BA 3PJ7A 3KCSA 2ZN9A 3SVSA 2LVVA 1R6PA 3DPXA 1KYSA 4DXNA 3JVTB 4N5XA 2QEOA 3GL4A 3SG6A 2WHUA 1B9CA 4NDCA 2DUIA 4RTCA 4MBEA 3EK4A 5I8NA 3V2LA 3VRNA 3P8UA 4LJBA 3S05A 1Y1XA 4M2PA 1QX2A 2KLEA 3M0WA 4JWQA 3VRRA 2DUHA 2POXA 1JFKA 1CDNA 4JGEA 2BCBA 5EXCI 3TS5C 4ICBA 2I94A 2LC5A 1CDMA 1M46A 2KGBC 1UHJA 4DUQA 3S0FA 1JC1A 2BBNA 4TNCA 2WCKA 3BUNB 3A8RA 3SSKA 2YFPA 5B8IB 2LV7A 1K8UA 1BJFA 3TUYC 3DQ9A 1KQMC 2ZFDA 3WHTB 2DUFA 3CYZA 1KFUS 1F0BA 2A54B 5DPIA 4Z4MA 1SSEB 3PJ5A 3WCKA 1IKUA 3DYEA 1TCOB 3LF3A 3I5IC 3CGLA 1S6IA 1UHIA 3SIAA 1BODA 4W6CA 4BDUA 2YGUA 1DJYA 1B8CA 1ODBA 2F2OA 2FCEA 3VGOA 2TN4A 2PQLA 2VZXA 2F3ZA 5H88A 5G08A 1MWNA 1ZGOA 2WHSA 1FW4A 4JC2A 2H2KA 3CR2A 1SR6B 2K7BA 3M24A 4W6LA 2FJUB 1Q4EA 1GGXA 3SV5A 5KTGA 4IK3A 2JULA 5LTQA 5FYXA 1SCMB 1X02A 2K8MB 4MLWA 2PXWA 2V4EB 3CFFA 4W6GA 3EK8A 2V4EA 2P6BB 4OGSA 1KQVA 2DUEA 1OW4A 4NDDA 1BLQA 1L2OB 5FI2A 3OBVA 1NYAA 1OXDA 1S6JA 1DJWA 3LSAA 3DF0B 3D77A 3DF0A 4PCWA 1UURA 3LL8B 4KGEA 1CDLA 3JTDB 1F70A 3DQDA 1RFJA 4MRXA 5BPJA 2H5OA 1RECA 5DTYA 2K61A 1LA3A 1J7PA 2HFCA 2LLUA 5DPHA 1LS8A 2M3WA 5CSJA 1WLZA 1GJYA 3CGAA 1YHGA 3OP0A 3DQ6A 2WNDA 4DXMA 2JC2A 2HGYA 1IH0A 4ZIOA 2O5GA 2GW4B 1QIVA 2MAZA 4R6BA 4MN0A 1HQVA 1C3YA 1ZGQA 1TNWA 1QX7A 3TDUA 3DPWA 2JPOA 4OCIA 1KFXS 4B5YA 5FI6A 4P76A 2P70A 3ST2A 2A50B 1OOJA 1EG3A 5FVGA 4LJDC 1KWOB 5JJGA 1N0YA 3B7AA 1XQMA 5IBWA 1B47A 3EK7A 3P28A 2FJYA 4KF4A 1A2XA 3K1EA 5BQLA 3B87A 4AOMA 3F45A 1LVCD 1Y1AA 4KF5A 1OMRA 3DQAA 3L47A 2LMUA 5I2LA 1Q73A 4BY4A 4L1IA 1KSMA 2I18A 1J1EA 4Q7UA 2BNXA 3SS4A 1GGWA 2M7LA 1DJXA 1EJ3A 2PSRA 1NCYA 1BT6A 1SKTA 2ZO6A 4W7RA 3SVNA 1PVAA 4W69A 1TRFA 1SW8A 2KI4B 2L2CA 4KW9A 3SG5A 3BUMB 1MUXA 1MXLC 1ALWA 1DJZA 4U8DA 2HQWA 3G9AA 1Y0VH 1IJ6A 2HQZA 3SVBA 1ZGPA 3ADFA 1PSRA 2KFFA 1KK8C 1EMGA 3CR4X 4UPGA 3MSEB 5JOLA 1RK9A 2NZ0A 2FOTA 1BMOA 2AMIA 4I2YA 3EVPA 1B7TZ 3I19A 2JTTA 1SL7A 2YE0A 5HKZA 5D7FA 3FE9A 2VVHA 2ARLA 3FWBA 4KAGA 5HBDA 3DQOA 4KGFA 3CWGA 4IJ7A 2AWLA 1XVJA 5LTPA 4ZCVA 2AH8A 1LA0A 2D8NA 1SBJA 3E5VA 1RMMA 4ZF5A 2WC5A 3EVUA 2Q57A 5H89A 3BFBA 3CLNA 2CBLA 2DUGA 4XGYA 2MJWB 1SY9A 4NQGA 1YVHA 2BCXA 1T14A 5FVFA 3RWAA 3AAKA 5EB6A 3U8AA 2G16B 1F55A 3UFZA 3QMEA 1MHOA 1KYRA 2G6XA 3VB1A 3TS5B 1YRUB 2B1UA 3DQJA 3ZTFA 2LHLA 1DT7B 2FZUA 2KYCA 3DVMA 1QXPA 4PHNA 5EHUA 4PPKA 1KSOA 2BE4A 3TUYB 2HGDA 1SNLA 1KFXL 1V1FA 4OY4A 1KQMB 5DPJA 2ZRTA 5TNCA 2HETA 1F54A 1UHNA 1LKJA 2WOSA 1CFCA 1EMFA 2WCBA 1WY9A 2H9WA 3DQNA 5AFPA 4N3DA 1OOFA 3S0EA 3ST3A 1TN4A 2NCOA 4Q7TA 4GF6B 1QX5B 2FWQA 1JC2A 5BTTB 4LQTA 1B4CA 5BTTA 2PRUA 3DZTA 4C0LA 2KYFA 1QV1A 1W7JB 2C9IA 3DQ8A 1BFPA 1TUJA 3IVTA 2L98A 2K7CA 1W7UA 4XL5A 2ZMWA 3UG0A 1CM1A 1EMEA 2H5PA 1XAEA 1V1GA 1EMBA 4PPJA 3PN7C 1TUZA 2OPOA 3PSRA 2CXJA 2LLSA 1QVIZ 4M2OA 4W6KA 3IQQA 5EBJA 1QXTA 4H3NA 2AWJA 2WCEA 1OOIX 5AQBB 4ORAB 1XFRA 1K9PA 3O4XA 2P4MA 2DDCA 1JF0A 2K7OA 1ORGA 2KHNA 1Q4AA 3AI4A 4GBAA 1R2UA 1KK7Z 3SSHA 2G3DB 3EVRA 3C1VA 4HSZA 1ZFSA 5DKNA 1M39A 2VAEA 4MVFA 4GGNA 1CKKA 2WCHA 1OSAA 4IK5A 4R6DA 3TDIA 4QJ4B 1QJTA 3CD1A 1Z1PA 1GQMA 4YGDB 3DQLA 2JTZA 4CFQA 1B8LA 3BFAA 5HGEA 1DGUA 3O6BA 2P71A 1DEKA 2WORA 3DD4A 2EGDA 4M2QA 4KW4A 1EMKA 4PFEA 1PK0D 3DQ2A 1LXFC 3DQ1A 1TCFA 3NSIA 1OOHA 4KA9A 2Y4QA 5HZOA 1QLSA 3BUWB 1C4FA 1JWDA 1G4YR 1Q80A 3GB3A 2WCMA 2MLEC 2LVJA 1UWOA 3NHIA 2WC8A 2LVKA 1NX3A 1TNXA 2OKWA 3BOWB 3BOWA 2G6YA 3VROA 1BF5A 1UUSA 3FS7A 3IF7A 4W74A 3B88A 1YFPA 1XSSA 1S1EA 3L4LA 3LVAA 2OTEA 1BG1A 4YBHB 4GPLB 1OZSA 3SRYA 2OJKA 4DKNA 1CNPA 3PJBA 4GAOA 2OKYA 4F0ZB 2FL1A 1NWDA 2EC6C 1CFPA 4W7DA 3U0KA 1G33A 1F8HA 2A46A 1XFZO 3KF9A 1WRKA 2M8UA 3CZTX 3DPZA 2A56B 1SL8A 2KQYA 2GW3A 2WHTA 1CTRA 1ZMZA 1KK8B 1Z2CB 2BTJA 2WISA 1CB1A 1B7TY 1YX8A 4W7AA 3CFAA 4EMQA 3VICA 1XFXO 4W7XA 3OSRA 2LUXA 1YUUA 3FE8A 3NEZA 2BE6A 3SVRA 1CDPA 3I5HC 1FPWA 3LLEA 2K0JA 2KSPA 2BL0C 1OXFA 4FQOA 2H61C 4W6IA 4DXIA 2AWMA 4XOVA 2L2EA 1TNPA 1AJ5A 2G3OA 3DQHA 2MRDA 3I5GC 2GV5A 4H47A 3TMTA 5EJUA 2DD7A 4DCKA 1XK4C 4IK4A 4DXQA 2OS8C 3EKHA 3R72A 1GFLA 5HZTA 4HRHA 4Z4KA 4W72A 2GTEA 2PMYA 5K89A 5J3XA 2EHBA 4J8AA 2O60A 2OTBA 1YZWA 1QATA 3UO9A 1MYWA 4NDBA 1Q4DA 2Y0GA 1C7VA 3EG5B 3D73A 2JT0A 1AK8A 1AHRA 1RTP1 4YGBB 3KO0A 2K60A 4WQ3A 5I2OA 3B6XA 1Q4BA 1QYFA 2LMVA 4B30B 1QWVA 1CFFA 4W6NA 4B30A 3AAJA 1MOVA 5DQBA 1AJ4A 1GM0A 4ZBLA 4W6RA 1H4UA 2QLIA 1L7ZA 5D3OA 4HQCA 2PASA 1DF0B 1NPQA 2MA2A 1DF0A
chains in the Genus database with same CATH topology
2FCDA 3IR8A 4GESB 3V3DA 5H87A 2KFHA 1JSAA 5KU1A 3LVDA 1AVSA 2QZ0A 1A75B 2JU0A 1A75A 4W77A 1DMOA 2A48A 1QTXA 2BBMA 1G7KA 2JXCA 1QVIY 3PN7B 4CLNA 5DQMA 3U8CA 1JBYA 4W6OA 3LK0A 4ZB1A 2KDHA 5FHVA 1JBAA 2MHHA 3ZUJA 5HLOA 1EMMA 1KP5A 3KEVA 1ZOTB 4LJCA 1E8AA 1KK7Y 2PVBA 1WRZA 3SVEA 4YGAA 5FVIA 3ST4A 3DQFA 1XMZA 3I5FB 4A4CA 1W7IB 4JEOA 4P1QA 5PALA 5D69A 1N65A 1W7TA 3U0MA 4EULA 4H3MA 1Y1UA 1XFWO 4CIDA 1FBVA 1WDCB 3LK1A 3QRXA 1NCZA 2Z6XA 3E5WA 2SASA 2PALA 2O24A 1M45A 2KI6D 2R2IA 4R1EA 4HRGA 1ZUZA 4GGFC 4I5JA 4AQJA 1TIZA 5ER5A 4IK1A 3CTNA 3CD9A 3MGFA 1SK6D 5T3IA 1XA5A 3DQIA 4DS7A 4DRWA 1XO5A 1XFUO 2LAPA 2Y1NA 5F6TA 2AUCA 2BCAA 4P5OE 4YGEB 1CMFA 3ICBA 2QACA 2L4IA 2RH7A 4WQ2A 2ZMUA 4KEXA 1YUSA 3D10A 2LMTA 2L50A 2Y1MA 2RGIA 3O78A 2VVIA 1CV7A 3BUXB 1H4BA 2M7NA 4L13A 4EDOA 2VRGA 1YRTB 2G2BA 4XOWA 1NSHA 1QY3A 1ALVA 1FI6A 5CSNA 1RWYA 1BOCA 4JRBA 1SCVA 1XA9A 3LA1A 2EMOA 3O2PA 1S5GZ 4W6MA 1IG5A 3SS0A 1JFJA 3H1RA 4W73A 2EC6B 4MRYA 3WLDA 4AQIA 3DQ3A 1S3PA 4PHMA 2IS9A 4U2VA 4YI9A 3PIBA 2KAVA 4LQUA 1FF1A 1PULA 3I5IB 2YDZA 1IRJA 4ORCB 4D1EA 3SSVA 2H5QA 1H8BA 1YUTA 4W6UA 1NIWA 3NT9A 4TZAA 4RYSA 1YHHA 3ZULA 3U8PA 1SMGA 4YGCB 1B9AA 2A47A 1MQ1A 1QASA 2QU1A 2BL0B 4ZF3A 4XJKB 3RM1A 4JQ0D 4XJKA 2F2PA 3BQ3A 4W6BA 4W6TA 2NLNA 2H61A 3K21A 4LW5A 3WLCA 2EMDA 4L9MA 4I5KA 4PE0A 4ORBB 4QJ5B 4XYNA 1K95A 2WIQA 4KW8A 1M31A 4PPLA 3I5GB 4W6SA 3SIBA 1SRAA 2KBIA 4HE4A 2OS8B 2AAOA 5KTYA 3PALA 2BKHB 4E68A 3SG2A 5ER4X 1FI5A 1KYPA 1AP4A 1OXEA 2CT9A 3NT3A 3BXCA 1K93D 5DRGA 1MF8B 1YJFA 1RMPA 2ZNEA 5DKQA 2GGZA 5LK4A 2HQKA 2V53A 1F4QA 4L12A 2LE9B 1EMLA 2Q91A 4EN1A 2CTNA 2CNPA 3ST0A 3EVVA 3SSTA 1DTLA 5EXUA 2H5RA 1PALA 1EMAA 3HCMA 1F09A 3BXAA 3CBEA 1DGVA 5LTRA 4LJDA 3SG7A 1UP5A 4USLA 3OGOA 1XYDA 2QPTA 4XVPA 1PSBA 2ICRA 2KGRA 1S6ZA 2JWWA 3NXAA 2LLTA 2F33A 3PATA 1UHHA 2OGRA 4W6FA 1IWQA 4KPIA 1CFDA 1VRKA 5HKYA 2HCGA 2VVJA 4EDSA 4TZGA 4HQ8A 2A52B 1G8IA 3W1DA 1NUBA 3SG4A 4OJ0A 2VADA 3ED8A 4PE7A 1YURA 1QS7A 3TZ1A 3BUOB 5CPVA 3H4SE 4I5LB 4DIRA 2C9JA 2WSNA 1B8RA 2M97A 2L4HA 2BKIB 1S26D 2HQ8A 4HQ9A 3IQOA 1B1GA 4YI8A 1QLKA 1SPYA 4W75A 2PXSA 3DQ5A 4DKMA 3AKOA 3CR5X 1KCYA 1W7SA 3DQEA 2KBMA 4AS8A 2I2RE 5DRFA 1EMCA 1J7OA 1N2DA 4C0JA 1DVIA 1QV0A 3SVDA 3ZUFA 4GNKB 2QLGB 1A03A 2HJOA 5AANA 3GK4X 2QLGA 2M0RA 1K2HA 1OQPA 4GFTA 3DVKA 2QLHA 5EB7A 2JNXA 5AEQA 2Z1OA 4JF9A 1U5IB 2F3YA 4GGFA 5CSFA 1J55A 1U5IA 2OTGC 5HZUA 2K7DA 1JUOA 2LNKA 3DQKA 1OZOA 3W1CA 1DJGA 3BXKA 3H1OA 1GL4A 2AWKA 1EH2A 3DVEA 4Q9WA 1K96A 1QYQA 2KAYA 3SVCA 1YX7A 4AR7A 5AERA 4IK8A 3WXAA 2SCPA 2LANA 2JXLA 3GJ2A 2Z6YA 4OVNF 3A8SA 2QLEA 4Q04A 3NSKA 4W6JA 5DPGA 1SL9A 4W6PA 3GJ1A 5DTLA 2Q6PA 2DD9A 3CS1A 4JPZB 4QJ3B 3DQMA 4UTSA 1S6CA 1S5GY 1MOUA 1WLMA 1PVBA 4RYWA 5GQQC 1CMGA 3GK1A 2WCFA 2ZRSA 2JQ6A 4I5NB 3EKJA 2COLB 1HT9A 3AKBA 4IZNA 1S36A 4PHJA 3PFVA 2LM5A 2KQ6A 2B3QA 4OHSA 4N1FA 4OKHA 3NSOA 3DQ7A 4ZFSA 4DXPA 3PLFB 3O4YA 3KHEA 5DTXA 4PALA 3U0LA 4OV2A 5BT0A 1XFYO 1MXEA 4J88A 4ZINA 4W7EA 1NCXA 2M9GA 2GX0A 2KAXA 4Q7RA 2G9BA 3SVOA 1D1OA 1CM4A 3DQ4A 2JOJA 3JVTC 3ZWHA 4P2YB 1PRWA 1DJHA 2LVIA 2A4JA 3SSYA 2K2FA 2HRSA 2LP2A 1JBZA 2CCMA 4W7CA 1NX2A 5HZSA 3SG3A 1EL4A 1AUIB 3SSPA 4MZLA 4CPVA 3VRPA 4DXOA 3DQUA 1KFUL 3U0NA 1A4PA 3D0YB 3AI5A 2M29A 3D0YA 3ZNIA 2IB5A 3BX9A 2IE2A 2M1UA 5DTZA 4MSPA 5HW9A 4ZF4A 2MLFC 2B3PA 4MZJA 3NSLA 4PDZA 1OMDA 1YR5A 2L51A 4J89A 1IJ5A 5DY6A 4H3LA 4IK9A 1RRXA 1YVLA 1F71A 4ANJA 1HCJA 1RROA 2JT3A 2LHIA 2QT2A 1RMOA 1MR8A 2IOVA 2L0PA 3WHUB 3LF4B 3GK2A 2LP3A 2JZIA 4HVFA 2I7AA 2EMNA 2ZO7A 1IGVA 3AKAA 2JADA 3E5TA 1SR6C 5J2OA 4BY5A 2MBXA 4ORNA 1C7WA 4PE1A 5DU0A 1OMVA 2JNFA 2KI6C 2M1KB 3BYAA 2DDDA 2O29A 1A29A 5HYDA 1F4OA 1SCMC 5EXBA 2HPSA 3DVJA 4WRIA 2V4EC 3KCTA 1K90D 3KPXA 1L2OC 4PE4A 2HF5A 5HLVA 1HUYA 2Y5IA 4YRUA 4W6DA 1EXRA 1DJIA 4PHKA 1TTXA 1RM9A 1K9UA 3LVCA 1YTZC 1BR1B 1CLLA 2NXQA 2JPTA 2LCPA 1YHIA 1J7QA 3JTDC 5AXIA 2NCPA 1QIWA 1NX0A 4ZCUA 5F9GA 2HPWA 4MEWA 1J7RA 1IQ3A 3OB1B 3NEDA 3VK1A 2M49B 1JF2A 3OHMB 1UISA 1J1DA 3RLZA 4GUKA 3K1KA 2GGMA 2GX2A 3SSLA 1Y6WA 3E3RA 4W6HA 3CFHA 1OE9B 1CLBA 2Q4UA 3IP2A 2ISDA 4H48A 1BR4B 4Q9XA 2KOTA 5DKRA 2Z6ZA 1CLMA 3OSQA 1Q4CA 3VRQA 4HREE 4GOBA 3WNXB 4W6AA 3DQCA 2YE1A 3OX5A 1YJ2A 2WSOA 1LINA 2H6VA 3TDZA 1KWOC 2WURA 3I5HB 3FWCA 2KNEA 2A53B 2OTGB 5HKWA 4KF5C 1BU3A 4OQWA 1WRLA 1H6RA 4IL1A 2E30A 1K9KA 3O77A 4ETOA 2DOQA 2BECA 1UHKA 4NWSA 1XK4A 2L5XB 1IQ5A 5I2QA 3SVUA 3RWTA 1ZACA 1QYOA 3M22A 4W76A 4MZKA 3LCPC 4JFGA 2KI4C 2IB6A 1TNQA 3OX6A 2ZNDA 3VHTB 2K2AA 4C0KA 3BXBA 3VHTA 1GGZA 1K94A 3TMRA 4A4BA 2ZKMX 1XFVO 5CSIA 3GOFA 1TOPA 3LS3A 3A4UB 4W7FA 3I5FC 2E6WA 2QRFA 2G6EA 1Z1QA 1C07A 2G2SB 1JC0A 3HX4A 2AHAA 3SJSA 3PM8A 1WDCC 1RJVA 4OR9B 3OB2B 1NP8A 4FTGA 4N1GA 2G5ZB 2ZN8A 3FIAA 4CFRA 1ZUXA 3CB9A 1NX1A 3GEXA 2F8PA 5KSZA 2H8QA 1EG4A 1SYMA 2JT8A 2KFGA 2JRFA 1M63B 2LUCA 3NF0A 2O2BA 3PJ7A 3KCSA 2ZN9A 3SVSA 2LVVA 1R6PA 3DPXA 1KYSA 4DXNA 3JVTB 4N5XA 3GL4A 3SG6A 2WHUA 1B9CA 4NDCA 2DUIA 4RTCA 4MBEA 3EK4A 5I8NA 3VRNA 3P8UA 4LJBA 3S05A 1Y1XA 4M2PA 1QX2A 3M0WA 4JWQA 3VRRA 2DUHA 2POXA 1JFKA 1CDNA 4JGEA 2BCBA 5EXCI 3TS5C 4ICBA 2I94A 2LC5A 1CDMA 1M46A 2KGBC 1UHJA 4DUQA 1JC1A 2BBNA 4TNCA 3BUNB 3A8RA 3SSKA 2YFPA 5B8IB 2LV7A 1K8UA 1BJFA 3TUYC 3DQ9A 1KQMC 2ZFDA 3WHTB 2DUFA 1KFUS 1F0BA 2A54B 5DPIA 4Z4MA 3PJ5A 3WCKA 1IKUA 1TCOB 3LF3A 3I5IC 3CGLA 1S6IA 1UHIA 3SIAA 1BODA 4W6CA 4BDUA 1DJYA 1B8CA 1ODBA 2F2OA 2FCEA 3VGOA 2TN4A 2VZXA 2F3ZA 5H88A 5G08A 1MWNA 1ZGOA 2WHSA 1FW4A 4JC2A 2H2KA 3CR2A 1SR6B 2K7BA 3M24A 4W6LA 2FJUB 1Q4EA 1GGXA 3SV5A 5KTGA 4IK3A 2JULA 5LTQA 5FYXA 1SCMB 1X02A 2K8MB 4MLWA 2PXWA 2V4EB 3CFFA 4W6GA 3EK8A 2V4EA 2P6BB 4OGSA 1KQVA 2DUEA 4NDDA 1BLQA 1L2OB 1NYAA 1OXDA 1S6JA 1DJWA 3LSAA 3DF0B 3DF0A 4PCWA 1UURA 3LL8B 4KGEA 1CDLA 3JTDB 1F70A 3DQDA 1RFJA 4MRXA 5BPJA 2H5OA 1RECA 5DTYA 2K61A 1LA3A 1J7PA 2HFCA 2LLUA 5DPHA 2M3WA 5CSJA 1WLZA 1GJYA 3CGAA 1YHGA 3OP0A 3DQ6A 2WNDA 4DXMA 2JC2A 2HGYA 1IH0A 4ZIOA 2O5GA 2GW4B 1QIVA 2MAZA 4R6BA 4MN0A 1HQVA 1ZGQA 1TNWA 1QX7A 3TDUA 3DPWA 4OCIA 1KFXS 4B5YA 4P76A 3ST2A 2A50B 1OOJA 1EG3A 5FVGA 4LJDC 1KWOB 5JJGA 1N0YA 1XQMA 5IBWA 1B47A 3EK7A 3P28A 4KF4A 1A2XA 5BQLA 4AOMA 3F45A 1LVCD 1Y1AA 4KF5A 1OMRA 3DQAA 2LMUA 5I2LA 1Q73A 4BY4A 4L1IA 1KSMA 2I18A 1J1EA 4Q7UA 1GGWA 2M7LA 1DJXA 1EJ3A 2PSRA 1NCYA 1BT6A 1SKTA 2ZO6A 4W7RA 3SVNA 1PVAA 4W69A 1TRFA 1SW8A 2KI4B 4KW9A 3SG5A 3BUMB 1MUXA 1MXLC 1ALWA 1DJZA 4U8DA 2HQWA 3G9AA 1Y0VH 1IJ6A 2HQZA 3SVBA 1ZGPA 3ADFA 1PSRA 2KFFA 1KK8C 1EMGA 3CR4X 4UPGA 3MSEB 5JOLA 1RK9A 2NZ0A 2FOTA 1BMOA 2AMIA 4I2YA 3EVPA 1B7TZ 3I19A 2JTTA 1SL7A 2YE0A 5HKZA 5D7FA 2VVHA 2ARLA 3FWBA 4KAGA 5HBDA 3DQOA 4KGFA 3CWGA 2AWLA 1XVJA 5LTPA 4ZCVA 2AH8A 1LA0A 2D8NA 1SBJA 3E5VA 1RMMA 4ZF5A 3EVUA 2Q57A 5H89A 3CLNA 2CBLA 2DUGA 4XGYA 2MJWB 1SY9A 4NQGA 1YVHA 2BCXA 5FVFA 3RWAA 3AAKA 5EB6A 3U8AA 2G16B 1F55A 3UFZA 2G6XA 1MHOA 1KYRA 3TS5B 1YRUB 2B1UA 3DQJA 3ZTFA 2LHLA 1DT7B 2FZUA 2KYCA 3DVMA 1QXPA 4PHNA 5EHUA 4PPKA 1KSOA 2BE4A 3TUYB 2HGDA 1SNLA 1KFXL 1V1FA 4OY4A 1KQMB 5DPJA 2ZRTA 5TNCA 2HETA 1F54A 1UHNA 1LKJA 2WOSA 1CFCA 1EMFA 2WCBA 1WY9A 2H9WA 3DQNA 5AFPA 4N3DA 3ST3A 1TN4A 2NCOA 4Q7TA 4GF6B 1QX5B 2FWQA 1JC2A 5BTTB 4LQTA 1B4CA 5BTTA 2PRUA 4C0LA 2KYFA 1QV1A 1W7JB 2C9IA 3DQ8A 1BFPA 2L98A 2K7CA 1W7UA 4XL5A 2ZMWA 3UG0A 1CM1A 1EMEA 2H5PA 1XAEA 1V1GA 1EMBA 4PPJA 3PN7C 2OPOA 3PSRA 2CXJA 2LLSA 1QVIZ 4M2OA 4W6KA 3IQQA 5EBJA 1QXTA 4H3NA 2AWJA 2WCEA 5AQBB 4ORAB 1K9PA 2P4MA 2DDCA 1JF0A 2K7OA 2KHNA 1Q4AA 3AI4A 4GBAA 1R2UA 1KK7Z 3SSHA 2G3DB 3EVRA 3C1VA 4HSZA 1ZFSA 5DKNA 1M39A 2VAEA 4MVFA 4GGNA 1CKKA 1OSAA 4IK5A 4R6DA 3TDIA 4QJ4B 1QJTA 3CD1A 1Z1PA 1GQMA 4YGDB 3DQLA 2JTZA 4CFQA 1B8LA 5HGEA 1DGUA 3O6BA 2WORA 3DD4A 2EGDA 4M2QA 4KW4A 1EMKA 4PFEA 1PK0D 3DQ2A 1LXFC 3DQ1A 1TCFA 3NSIA 4KA9A 2Y4QA 5HZOA 1QLSA 3BUWB 1C4FA 1JWDA 1G4YR 1Q80A 3GB3A 2MLEC 2LVJA 1UWOA 2WC8A 2LVKA 1NX3A 1TNXA 2OKWA 3BOWB 3BOWA 2G6YA 3VROA 1BF5A 1UUSA 3FS7A 3IF7A 4W74A 1YFPA 1XSSA 1S1EA 3LVAA 2OTEA 1BG1A 4YBHB 4GPLB 1OZSA 3SRYA 2OJKA 4DKNA 1CNPA 3PJBA 4GAOA 2OKYA 4F0ZB 2FL1A 1NWDA 2EC6C 1CFPA 4W7DA 3U0KA 1G33A 1F8HA 2A46A 1XFZO 3KF9A 1WRKA 2M8UA 3CZTX 3DPZA 2A56B 1SL8A 2KQYA 2GW3A 2WHTA 1CTRA 1ZMZA 1KK8B 2BTJA 2WISA 1CB1A 1B7TY 1YX8A 4W7AA 3CFAA 4EMQA 3VICA 1XFXO 4W7XA 3OSRA 2LUXA 1YUUA 3NEZA 2BE6A 3SVRA 1CDPA 3I5HC 1FPWA 3LLEA 2K0JA 2KSPA 2BL0C 1OXFA 4FQOA 2H61C 4W6IA 4DXIA 2AWMA 4XOVA 2L2EA 1TNPA 1AJ5A 2G3OA 3DQHA 2MRDA 3I5GC 2GV5A 4H47A 3TMTA 5EJUA 2DD7A 4DCKA 1XK4C 4IK4A 4DXQA 2OS8C 3EKHA 1GFLA 5HZTA 4HRHA 4Z4KA 4W72A 2PMYA 5K89A 5J3XA 2EHBA 4J8AA 2O60A 2OTBA 1YZWA 1QATA 1MYWA 4NDBA 1Q4DA 2Y0GA 1C7VA 2JT0A 1AK8A 1AHRA 1RTP1 4YGBB 3KO0A 4WQ3A 5I2OA 1Q4BA 1QYFA 2LMVA 4B30B 1CFFA 4W6NA 4B30A 3AAJA 1MOVA 5DQBA 1AJ4A 4ZBLA 4W6RA 1H4UA 2QLIA 1L7ZA 4HQCA 2PASA 1DF0B 1NPQA 2MA2A 1DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCD A;  3IR8 A;  4GES B;  3V3D A;  5H87 A;  2KFH A;  1JSA A;  5KU1 A;  3LVD A;  1AVS A;  2QZ0 A;  1A75 B;  2JU0 A;  1A75 A;  4W77 A;  1DMO A;  2A48 A;  1QTX A;  2BBM A;  1G7K A;  2JXC A;  1QVI Y;  3PN7 B;  4CLN A;  5DQM A;  3U8C A;  1JBY A;  4W6O A;  3LK0 A;  4ZB1 A;  2KDH A;  5FHV A;  1JBA A;  2MHH A;  3ZUJ A;  5HLO A;  1EMM A;  1KP5 A;  3KEV A;  1ZOT B;  4LJC A;  1E8A A;  1KK7 Y;  2PVB A;  1WRZ A;  3SVE A;  4YGA A;  5FVI A;  3ST4 A;  3DQF A;  1XMZ A;  3I5F B;  4A4C A;  1W7I B;  4JEO A;  4P1Q A;  5PAL A;  5D69 A;  1N65 A;  1W7T A;  3U0M A;  4EUL A;  4H3M A;  1Y1U A;  1XFW O;  4CID A;  1FBV A;  1WDC B;  3LK1 A;  3QRX A;  1NCZ A;  2Z6X A;  3E5W A;  2SAS A;  2PAL A;  2O24 A;  1M45 A;  2KI6 D;  2R2I A;  4R1E A;  4HRG A;  1ZUZ A;  4GGF C;  4I5J A;  4AQJ A;  1TIZ A;  5ER5 A;  4IK1 A;  3CTN A;  3CD9 A;  3MGF A;  1SK6 D;  5T3I A;  1XA5 A;  3DQI A;  4DS7 A;  4DRW A;  1XO5 A;  1XFU O;  2LAP A;  2Y1N A;  5F6T A;  2AUC A;  2BCA A;  4P5O E;  4YGE B;  1CMF A;  3ICB A;  2QAC A;  2L4I A;  2RH7 A;  4WQ2 A;  2ZMU A;  4KEX A;  1YUS A;  3D10 A;  2LMT A;  2L50 A;  2Y1M A;  2RGI A;  3O78 A;  2VVI A;  1CV7 A;  3BUX B;  1H4B A;  2M7N A;  4L13 A;  4EDO A;  2VRG A;  1YRT B;  2G2B A;  4XOW A;  1NSH A;  1QY3 A;  1ALV A;  1FI6 A;  5CSN A;  1RWY A;  1BOC A;  4JRB A;  1SCV A;  1XA9 A;  3LA1 A;  2EMO A;  3O2P A;  1S5G Z;  4W6M A;  1IG5 A;  3SS0 A;  1JFJ A;  3H1R A;  4W73 A;  2EC6 B;  4MRY A;  3WLD A;  4AQI A;  3DQ3 A;  1S3P A;  4PHM A;  2IS9 A;  4U2V A;  4YI9 A;  3PIB A;  2KAV A;  4LQU A;  1FF1 A;  1PUL A;  3I5I B;  2YDZ A;  1IRJ A;  4ORC B;  4D1E A;  3SSV A;  2H5Q A;  1H8B A;  1YUT A;  4W6U A;  1NIW A;  3NT9 A;  4TZA A;  4RYS A;  1YHH A;  3ZUL A;  3U8P A;  1SMG A;  4YGC B;  1B9A A;  2A47 A;  1MQ1 A;  1QAS A;  2QU1 A;  2BL0 B;  4ZF3 A;  4XJK B;  3RM1 A;  4JQ0 D;  4XJK A;  2F2P A;  3BQ3 A;  4W6B A;  4W6T A;  2NLN A;  2H61 A;  3K21 A;  4LW5 A;  3WLC A;  2EMD A;  4L9M A;  4I5K A;  4PE0 A;  4ORB B;  4QJ5 B;  4XYN A;  1K95 A;  2WIQ A;  4KW8 A;  1M31 A;  4PPL A;  3I5G B;  4W6S A;  3SIB A;  1SRA A;  2KBI A;  4HE4 A;  2OS8 B;  2AAO A;  5KTY A;  3PAL A;  2BKH B;  4E68 A;  3SG2 A;  5ER4 X;  1FI5 A;  1KYP A;  1AP4 A;  1OXE A;  2CT9 A;  3NT3 A;  3BXC A;  1K93 D;  5DRG A;  1MF8 B;  1YJF A;  1RMP A;  2ZNE A;  5DKQ A;  2GGZ A;  5LK4 A;  2HQK A;  2V53 A;  1F4Q A;  4L12 A;  2LE9 B;  1EML A;  2Q91 A;  4EN1 A;  2CTN A;  2CNP A;  3ST0 A;  3EVV A;  3SST A;  1DTL A;  5EXU A;  2H5R A;  1PAL A;  1EMA A;  3HCM A;  1F09 A;  3BXA A;  3CBE A;  1DGV A;  5LTR A;  4LJD A;  3SG7 A;  1UP5 A;  4USL A;  3OGO A;  1XYD A;  2QPT A;  4XVP A;  1PSB A;  2ICR A;  2KGR A;  1S6Z A;  2JWW A;  3NXA A;  2LLT A;  2F33 A;  3PAT A;  1UHH A;  2OGR A;  4W6F A;  1IWQ A;  4KPI A;  1CFD A;  1VRK A;  5HKY A;  2HCG A;  2VVJ A;  4EDS A;  4TZG A;  4HQ8 A;  2A52 B;  1G8I A;  3W1D A;  1NUB A;  3SG4 A;  4OJ0 A;  2VAD A;  3ED8 A;  4PE7 A;  1YUR A;  1QS7 A;  3TZ1 A;  3BUO B;  5CPV A;  3H4S E;  4I5L B;  4DIR A;  2C9J A;  2WSN A;  1B8R A;  2M97 A;  2L4H A;  2BKI B;  1S26 D;  2HQ8 A;  4HQ9 A;  3IQO A;  1B1G A;  4YI8 A;  1QLK A;  1SPY A;  4W75 A;  2PXS A;  3DQ5 A;  4DKM A;  3AKO A;  3CR5 X;  1KCY A;  1W7S A;  3DQE A;  2KBM A;  4AS8 A;  2I2R E;  5DRF A;  1EMC A;  1J7O A;  1N2D A;  4C0J A;  1DVI A;  1QV0 A;  3SVD A;  3ZUF A;  4GNK B;  2QLG B;  1A03 A;  2HJO A;  5AAN A;  3GK4 X;  2QLG A;  2M0R A;  1K2H A;  1OQP A;  4GFT A;  3DVK A;  2QLH A;  5EB7 A;  2JNX A;  5AEQ A;  2Z1O A;  4JF9 A;  1U5I B;  2F3Y A;  4GGF A;  5CSF A;  1J55 A;  1U5I A;  2OTG C;  5HZU A;  2K7D A;  1JUO A;  2LNK A;  3DQK A;  1OZO A;  3W1C A;  1DJG A;  3BXK A;  3H1O A;  1GL4 A;  2AWK A;  1EH2 A;  3DVE A;  4Q9W A;  1K96 A;  1QYQ A;  2KAY A;  3SVC A;  1YX7 A;  4AR7 A;  5AER A;  4IK8 A;  3WXA A;  2SCP A;  2LAN A;  2JXL A;  3GJ2 A;  2Z6Y A;  4OVN F;  3A8S A;  2QLE A;  4Q04 A;  3NSK A;  4W6J A;  5DPG A;  1SL9 A;  4W6P A;  3GJ1 A;  5DTL A;  2Q6P A;  2DD9 A;  3CS1 A;  4JPZ B;  4QJ3 B;  3DQM A;  4UTS A;  1S6C A;  1S5G Y;  1MOU A;  1WLM A;  1PVB A;  4RYW A;  5GQQ C;  1CMG A;  3GK1 A;  2WCF A;  2ZRS A;  2JQ6 A;  4I5N B;  3EKJ A;  2COL B;  1HT9 A;  3AKB A;  4IZN A;  1S36 A;  4PHJ A;  3PFV A;  2LM5 A;  2KQ6 A;  2B3Q A;  4OHS A;  4N1F A;  4OKH A;  3NSO A;  3DQ7 A;  4ZFS A;  4DXP A;  3PLF B;  3O4Y A;  3KHE A;  5DTX A;  4PAL A;  3U0L A;  4OV2 A;  5BT0 A;  1XFY O;  1MXE A;  4J88 A;  4ZIN A;  4W7E A;  1NCX A;  2M9G A;  2GX0 A;  2KAX A;  4Q7R A;  2G9B A;  3SVO A;  1D1O A;  1CM4 A;  3DQ4 A;  2JOJ A;  3JVT C;  3ZWH A;  4P2Y B;  1PRW A;  1DJH A;  2LVI A;  2A4J A;  3SSY A;  2K2F A;  2HRS A;  2LP2 A;  1JBZ A;  2CCM A;  4W7C A;  1NX2 A;  5HZS A;  3SG3 A;  1EL4 A;  1AUI B;  3SSP A;  4MZL A;  4CPV A;  3VRP A;  4DXO A;  3DQU A;  1KFU L;  3U0N A;  1A4P A;  3D0Y B;  3AI5 A;  2M29 A;  3D0Y A;  3ZNI A;  2IB5 A;  3BX9 A;  2IE2 A;  2M1U A;  5DTZ A;  4MSP A;  5HW9 A;  4ZF4 A;  2MLF C;  2B3P A;  4MZJ A;  3NSL A;  4PDZ A;  1OMD A;  1YR5 A;  2L51 A;  4J89 A;  1IJ5 A;  5DY6 A;  4H3L A;  4IK9 A;  1RRX A;  1YVL A;  1F71 A;  4ANJ A;  1HCJ A;  1RRO A;  2JT3 A;  2LHI A;  2QT2 A;  1RMO A;  1MR8 A;  2IOV A;  2L0P A;  3WHU B;  3LF4 B;  3GK2 A;  2LP3 A;  2JZI A;  4HVF A;  2I7A A;  2EMN A;  2ZO7 A;  1IGV A;  3AKA A;  2JAD A;  3E5T A;  1SR6 C;  5J2O A;  4BY5 A;  2MBX A;  4ORN A;  1C7W A;  4PE1 A;  5DU0 A;  1OMV A;  2JNF A;  2KI6 C;  2M1K B;  3BYA A;  2DDD A;  2O29 A;  1A29 A;  5HYD A;  1F4O A;  1SCM C;  5EXB A;  2HPS A;  3DVJ A;  4WRI A;  2V4E C;  3KCT A;  1K90 D;  3KPX A;  1L2O C;  4PE4 A;  2HF5 A;  5HLV A;  1HUY A;  2Y5I A;  4YRU A;  4W6D A;  1EXR A;  1DJI A;  4PHK A;  1TTX A;  1RM9 A;  1K9U A;  3LVC A;  1YTZ C;  1BR1 B;  1CLL A;  2NXQ A;  2JPT A;  2LCP A;  1YHI A;  1J7Q A;  3JTD C;  5AXI A;  2NCP A;  1QIW A;  1NX0 A;  4ZCU A;  5F9G A;  2HPW A;  4MEW A;  1J7R A;  1IQ3 A;  3OB1 B;  3NED A;  3VK1 A;  2M49 B;  1JF2 A;  3OHM B;  1UIS A;  1J1D A;  3RLZ A;  4GUK A;  3K1K A;  2GGM A;  2GX2 A;  3SSL A;  1Y6W A;  3E3R A;  4W6H A;  3CFH A;  1OE9 B;  1CLB A;  2Q4U A;  3IP2 A;  2ISD A;  4H48 A;  1BR4 B;  4Q9X A;  2KOT A;  5DKR A;  2Z6Z A;  1CLM A;  3OSQ A;  1Q4C A;  3VRQ A;  4HRE E;  4GOB A;  3WNX B;  4W6A A;  3DQC A;  2YE1 A;  3OX5 A;  1YJ2 A;  2WSO A;  1LIN A;  2H6V A;  3TDZ A;  1KWO C;  2WUR A;  3I5H B;  3FWC A;  2KNE A;  2A53 B;  2OTG B;  5HKW A;  4KF5 C;  1BU3 A;  4OQW A;  1WRL A;  1H6R A;  4IL1 A;  2E30 A;  1K9K A;  3O77 A;  4ETO A;  2DOQ A;  2BEC A;  1UHK A;  4NWS A;  1XK4 A;  2L5X B;  1IQ5 A;  5I2Q A;  3SVU A;  3RWT A;  1ZAC A;  1QYO A;  3M22 A;  4W76 A;  4MZK A;  3LCP C;  4JFG A;  2KI4 C;  2IB6 A;  1TNQ A;  3OX6 A;  2ZND A;  3VHT B;  2K2A A;  4C0K A;  3BXB A;  3VHT A;  1GGZ A;  1K94 A;  3TMR A;  4A4B A;  2ZKM X;  1XFV O;  5CSI A;  3GOF A;  1TOP A;  3LS3 A;  3A4U B;  4W7F A;  3I5F C;  2E6W A;  2QRF A;  2G6E A;  1Z1Q A;  1C07 A;  2G2S B;  1JC0 A;  3HX4 A;  2AHA A;  3SJS A;  3PM8 A;  1WDC C;  1RJV A;  4OR9 B;  3OB2 B;  1NP8 A;  4FTG A;  4N1G A;  2G5Z B;  2ZN8 A;  3FIA A;  4CFR A;  1ZUX A;  3CB9 A;  1NX1 A;  3GEX A;  2F8P A;  5KSZ A;  2H8Q A;  1EG4 A;  1SYM A;  2JT8 A;  2KFG A;  2JRF A;  1M63 B;  2LUC A;  3NF0 A;  2O2B A;  3PJ7 A;  3KCS A;  2ZN9 A;  3SVS A;  2LVV A;  1R6P A;  3DPX A;  1KYS A;  4DXN A;  3JVT B;  4N5X A;  3GL4 A;  3SG6 A;  2WHU A;  1B9C A;  4NDC A;  2DUI A;  4RTC A;  4MBE A;  3EK4 A;  5I8N A;  3VRN A;  3P8U A;  4LJB A;  3S05 A;  1Y1X A;  4M2P A;  1QX2 A;  3M0W A;  4JWQ A;  3VRR A;  2DUH A;  2POX A;  1JFK A;  1CDN A;  4JGE A;  2BCB A;  5EXC I;  3TS5 C;  4ICB A;  2I94 A;  2LC5 A;  1CDM A;  1M46 A;  2KGB C;  1UHJ A;  4DUQ A;  1JC1 A;  2BBN A;  4TNC A;  3BUN B;  3A8R A;  3SSK A;  2YFP A;  5B8I B;  2LV7 A;  1K8U A;  1BJF A;  3TUY C;  3DQ9 A;  1KQM C;  2ZFD A;  3WHT B;  2DUF A;  1KFU S;  1F0B A;  2A54 B;  5DPI A;  4Z4M A;  3PJ5 A;  3WCK A;  1IKU A;  1TCO B;  3LF3 A;  3I5I C;  3CGL A;  1S6I A;  1UHI A;  3SIA A;  1BOD A;  4W6C A;  4BDU A;  1DJY A;  1B8C A;  1ODB A;  2F2O A;  2FCE A;  3VGO A;  2TN4 A;  2VZX A;  2F3Z A;  5H88 A;  5G08 A;  1MWN A;  1ZGO A;  2WHS A;  1FW4 A;  4JC2 A;  2H2K A;  3CR2 A;  1SR6 B;  2K7B A;  3M24 A;  4W6L A;  2FJU B;  1Q4E A;  1GGX A;  3SV5 A;  5KTG A;  4IK3 A;  2JUL A;  5LTQ A;  5FYX A;  1SCM B;  1X02 A;  2K8M B;  4MLW A;  2PXW A;  2V4E B;  3CFF A;  4W6G A;  3EK8 A;  2V4E A;  2P6B B;  4OGS A;  1KQV A;  2DUE A;  4NDD A;  1BLQ A;  1L2O B;  1NYA A;  1OXD A;  1S6J A;  1DJW A;  3LSA A;  3DF0 B;  3DF0 A;  4PCW A;  1UUR A;  3LL8 B;  4KGE A;  1CDL A;  3JTD B;  1F70 A;  3DQD A;  1RFJ A;  4MRX A;  5BPJ A;  2H5O A;  1REC A;  5DTY A;  2K61 A;  1LA3 A;  1J7P A;  2HFC A;  2LLU A;  5DPH A;  2M3W A;  5CSJ A;  1WLZ A;  1GJY A;  3CGA A;  1YHG A;  3OP0 A;  3DQ6 A;  2WND A;  4DXM A;  2JC2 A;  2HGY A;  1IH0 A;  4ZIO A;  2O5G A;  2GW4 B;  1QIV A;  2MAZ A;  4R6B A;  4MN0 A;  1HQV A;  1ZGQ A;  1TNW A;  1QX7 A;  3TDU A;  3DPW A;  4OCI A;  1KFX S;  4B5Y A;  4P76 A;  3ST2 A;  2A50 B;  1OOJ A;  1EG3 A;  5FVG A;  4LJD C;  1KWO B;  5JJG A;  1N0Y A;  1XQM A;  5IBW A;  1B47 A;  3EK7 A;  3P28 A;  4KF4 A;  1A2X A;  5BQL A;  4AOM A;  3F45 A;  1LVC D;  1Y1A A;  4KF5 A;  1OMR A;  3DQA A;  2LMU A;  5I2L A;  1Q73 A;  4BY4 A;  4L1I A;  1KSM A;  2I18 A;  1J1E A;  4Q7U A;  1GGW A;  2M7L A;  1DJX A;  1EJ3 A;  2PSR A;  1NCY A;  1BT6 A;  1SKT A;  2ZO6 A;  4W7R A;  3SVN A;  1PVA A;  4W69 A;  1TRF A;  1SW8 A;  2KI4 B;  4KW9 A;  3SG5 A;  3BUM B;  1MUX A;  1MXL C;  1ALW A;  1DJZ A;  4U8D A;  2HQW A;  3G9A A;  1Y0V H;  1IJ6 A;  2HQZ A;  3SVB A;  1ZGP A;  3ADF A;  1PSR A;  2KFF A;  1KK8 C;  1EMG A;  3CR4 X;  4UPG A;  3MSE B;  5JOL A;  1RK9 A;  2NZ0 A;  2FOT A;  1BMO A;  2AMI A;  4I2Y A;  3EVP A;  1B7T Z;  3I19 A;  2JTT A;  1SL7 A;  2YE0 A;  5HKZ A;  5D7F A;  2VVH A;  2ARL A;  3FWB A;  4KAG A;  5HBD A;  3DQO A;  4KGF A;  3CWG A;  2AWL A;  1XVJ A;  5LTP A;  4ZCV A;  2AH8 A;  1LA0 A;  2D8N A;  1SBJ A;  3E5V A;  1RMM A;  4ZF5 A;  3EVU A;  2Q57 A;  5H89 A;  3CLN A;  2CBL A;  2DUG A;  4XGY A;  2MJW B;  1SY9 A;  4NQG A;  1YVH A;  2BCX A;  5FVF A;  3RWA A;  3AAK A;  5EB6 A;  3U8A A;  2G16 B;  1F55 A;  3UFZ A;  2G6X A;  1MHO A;  1KYR A;  3TS5 B;  1YRU B;  2B1U A;  3DQJ A;  3ZTF A;  2LHL A;  1DT7 B;  2FZU A;  2KYC A;  3DVM A;  1QXP A;  4PHN A;  5EHU A;  4PPK A;  1KSO A;  2BE4 A;  3TUY B;  2HGD A;  1SNL A;  1KFX L;  1V1F A;  4OY4 A;  1KQM B;  5DPJ A;  2ZRT A;  5TNC A;  2HET A;  1F54 A;  1UHN A;  1LKJ A;  2WOS A;  1CFC A;  1EMF A;  2WCB A;  1WY9 A;  2H9W A;  3DQN A;  5AFP A;  4N3D A;  3ST3 A;  1TN4 A;  2NCO A;  4Q7T A;  4GF6 B;  1QX5 B;  2FWQ A;  1JC2 A;  5BTT B;  4LQT A;  1B4C A;  5BTT A;  2PRU A;  4C0L A;  2KYF A;  1QV1 A;  1W7J B;  2C9I A;  3DQ8 A;  1BFP A;  2L98 A;  2K7C A;  1W7U A;  4XL5 A;  2ZMW A;  3UG0 A;  1CM1 A;  1EME A;  2H5P A;  1XAE A;  1V1G A;  1EMB A;  4PPJ A;  3PN7 C;  2OPO A;  3PSR A;  2CXJ A;  2LLS A;  1QVI Z;  4M2O A;  4W6K A;  3IQQ A;  5EBJ A;  1QXT A;  4H3N A;  2AWJ A;  2WCE A;  5AQB B;  4ORA B;  1K9P A;  2P4M A;  2DDC A;  1JF0 A;  2K7O A;  2KHN A;  1Q4A A;  3AI4 A;  4GBA A;  1R2U A;  1KK7 Z;  3SSH A;  2G3D B;  3EVR A;  3C1V A;  4HSZ A;  1ZFS A;  5DKN A;  1M39 A;  2VAE A;  4MVF A;  4GGN A;  1CKK A;  1OSA A;  4IK5 A;  4R6D A;  3TDI A;  4QJ4 B;  1QJT A;  3CD1 A;  1Z1P A;  1GQM A;  4YGD B;  3DQL A;  2JTZ A;  4CFQ A;  1B8L A;  5HGE A;  1DGU A;  3O6B A;  2WOR A;  3DD4 A;  2EGD A;  4M2Q A;  4KW4 A;  1EMK A;  4PFE A;  1PK0 D;  3DQ2 A;  1LXF C;  3DQ1 A;  1TCF A;  3NSI A;  4KA9 A;  2Y4Q A;  5HZO A;  1QLS A;  3BUW B;  1C4F A;  1JWD A;  1G4Y R;  1Q80 A;  3GB3 A;  2MLE C;  2LVJ A;  1UWO A;  2WC8 A;  2LVK A;  1NX3 A;  1TNX A;  2OKW A;  3BOW B;  3BOW A;  2G6Y A;  3VRO A;  1BF5 A;  1UUS A;  3FS7 A;  3IF7 A;  4W74 A;  1YFP A;  1XSS A;  1S1E A;  3LVA A;  2OTE A;  1BG1 A;  4YBH B;  4GPL B;  1OZS A;  3SRY A;  2OJK A;  4DKN A;  1CNP A;  3PJB A;  4GAO A;  2OKY A;  4F0Z B;  2FL1 A;  1NWD A;  2EC6 C;  1CFP A;  4W7D A;  3U0K A;  1G33 A;  1F8H A;  2A46 A;  1XFZ O;  3KF9 A;  1WRK A;  2M8U A;  3CZT X;  3DPZ A;  2A56 B;  1SL8 A;  2KQY A;  2GW3 A;  2WHT A;  1CTR A;  1ZMZ A;  1KK8 B;  2BTJ A;  2WIS A;  1CB1 A;  1B7T Y;  1YX8 A;  4W7A A;  3CFA A;  4EMQ A;  3VIC A;  1XFX O;  4W7X A;  3OSR A;  2LUX A;  1YUU A;  3NEZ A;  2BE6 A;  3SVR A;  1CDP A;  3I5H C;  1FPW A;  3LLE A;  2K0J A;  2KSP A;  2BL0 C;  1OXF A;  4FQO A;  2H61 C;  4W6I A;  4DXI A;  2AWM A;  4XOV A;  2L2E A;  1TNP A;  1AJ5 A;  2G3O A;  3DQH A;  2MRD A;  3I5G C;  2GV5 A;  4H47 A;  3TMT A;  5EJU A;  2DD7 A;  4DCK A;  1XK4 C;  4IK4 A;  4DXQ A;  2OS8 C;  3EKH A;  1GFL A;  5HZT A;  4HRH A;  4Z4K A;  4W72 A;  2PMY A;  5K89 A;  5J3X A;  2EHB A;  4J8A A;  2O60 A;  2OTB A;  1YZW A;  1QAT A;  1MYW A;  4NDB A;  1Q4D A;  2Y0G A;  1C7V A;  2JT0 A;  1AK8 A;  1AHR A;  1RTP 1;  4YGB B;  3KO0 A;  4WQ3 A;  5I2O A;  1Q4B A;  1QYF A;  2LMV A;  4B30 B;  1CFF A;  4W6N A;  4B30 A;  3AAJ A;  1MOV A;  5DQB A;  1AJ4 A;  4ZBL A;  4W6R A;  1H4U A;  2QLI A;  1L7Z A;  4HQC A;  2PAS A;  1DF0 B;  1NPQ A;  2MA2 A;  1DF0 A; 
#chains in the Genus database with same CATH topology
 2FCD A;  3IR8 A;  4GES B;  3V3D A;  5H87 A;  2KFH A;  4KYN A;  1JSA A;  5KU1 A;  3LVD A;  1AVS A;  2QZ0 A;  1A75 B;  2JU0 A;  1A75 A;  4W77 A;  1DMO A;  2QEV A;  2A48 A;  1QTX A;  2BBM A;  1G7K A;  2JXC A;  3B86 A;  1TWO A;  1QVI Y;  3PN7 B;  4CLN A;  3L4A A;  5DQM A;  3U8C A;  1JBY A;  4W6O A;  3LK0 A;  4ZB1 A;  2KDH A;  2QDI A;  5FHV A;  1JBA A;  2MHH A;  3ZUJ A;  5HLO A;  1EMM A;  1KP5 A;  3KEV A;  1ZOT B;  4LJC A;  1E8A A;  1KK7 Y;  2PVB A;  1WRZ A;  3SVE A;  4YGA A;  5FVI A;  3ST4 A;  3DQF A;  1XMZ A;  3I5F B;  4A4C A;  2H8V A;  1W7I B;  4JEO A;  4P1Q A;  5PAL A;  5D69 A;  1N65 A;  1W7T A;  3U0M A;  4EUL A;  4H3M A;  1Y1U A;  1XFW O;  4CID A;  1FBV A;  1WDC B;  1DC1 A;  3LK1 A;  1W9Z A;  3QRX A;  3CZ2 A;  1NCZ A;  2Z6X A;  3E5W A;  2SAS A;  2PAL A;  2O24 A;  5HL1 A;  1M45 A;  2KI6 D;  2R2I A;  4R1E A;  4HRG A;  1ZUZ A;  3CZ0 A;  4GGF C;  4I5J A;  4AQJ A;  1TIZ A;  5ER5 A;  4IK1 A;  3CTN A;  3CD9 A;  3MGF A;  1SK6 D;  3CAB A;  5T3I A;  1XA5 A;  3DQI A;  4DS7 A;  4DRW A;  3BFH A;  1XO5 A;  3R1O A;  1XFU O;  2LAP A;  2Y1N A;  2PYQ A;  3D78 A;  5F6T A;  2AUC A;  2BCA A;  4P5O E;  4YGE B;  1CMF A;  3ICB A;  2QAC A;  2L4I A;  2RH7 A;  4WQ2 A;  2ZMU A;  4KEX A;  1YUS A;  3D10 A;  2LMT A;  2L50 A;  2Y1M A;  2RGI A;  3O78 A;  2VVI A;  1CV7 A;  3BUX B;  1H4B A;  2M7N A;  4L13 A;  4EDO A;  2VRG A;  1YRT B;  2G2B A;  4XOW A;  1NSH A;  1QY3 A;  1ALV A;  2BAP A;  1FI6 A;  5CSN A;  1RWY A;  1BOC A;  4JRB A;  1SCV A;  1XA9 A;  3LA1 A;  2EMO A;  3O2P A;  1S5G Z;  4W6M A;  1IG5 A;  3SS0 A;  1JFJ A;  3H1R A;  4W73 A;  2EC6 B;  4MRY A;  3WLD A;  4AQI A;  3DQ3 A;  1S3P A;  4PHM A;  2IS9 A;  4U2V A;  4YI9 A;  3PIB A;  2KAV A;  4LQU A;  1FF1 A;  4F7F A;  1PUL A;  3I5I B;  2YDZ A;  1IRJ A;  4ORC B;  4D1E A;  3SSV A;  2H5Q A;  1H8B A;  1YUT A;  4W6U A;  3D75 A;  1NIW A;  2L5Y A;  3OGN A;  3NT9 A;  4TZA A;  4RYS A;  1YHH A;  3ZUL A;  3U8P A;  1SMG A;  4YGC B;  1B9A A;  3S0B A;  2A47 A;  1MQ1 A;  1QAS A;  2QU1 A;  2BL0 B;  4ZF3 A;  4XJK B;  3RM1 A;  4JQ0 D;  4XJK A;  2F2P A;  3BQ3 A;  4W6B A;  4W6T A;  2NLN A;  2H61 A;  3K21 A;  4LW5 A;  3WLC A;  2EMD A;  4L9M A;  4I5K A;  4PE0 A;  4ORB B;  4QJ5 B;  4XYN A;  1K95 A;  2WIQ A;  4KW8 A;  5FI7 A;  1M31 A;  4PPL A;  3FE6 A;  3I5G B;  4W6S A;  3SIB A;  1SRA A;  2KBI A;  4HE4 A;  5DIC A;  3Q8I A;  2OS8 B;  2AAO A;  5KTY A;  3PAL A;  2BKH B;  4E68 A;  3SG2 A;  5ER4 X;  1FI5 A;  1KYP A;  1AP4 A;  1OXE A;  3D76 A;  2CT9 A;  3NT3 A;  3BXC A;  1K93 D;  5DRG A;  1MF8 B;  1YJF A;  1RMP A;  2ZNE A;  5DKQ A;  2GGZ A;  5LK4 A;  2HQK A;  2V53 A;  1F4Q A;  4L12 A;  1C3Z A;  2LE9 B;  1EML A;  2Q91 A;  4EN1 A;  2CTN A;  4PT1 A;  2CNP A;  3ST0 A;  3EVV A;  3SST A;  1DTL A;  5EXU A;  2H5R A;  1PAL A;  1EMA A;  3HCM A;  1F09 A;  3BXA A;  3S0D A;  3CBE A;  1DGV A;  5LTR A;  4LJD A;  3SG7 A;  4JD9 A;  1UP5 A;  4USL A;  3OGO A;  1XYD A;  2QPT A;  4XVP A;  1PSB A;  2ICR A;  2KGR A;  2ERB A;  1S6Z A;  2JWW A;  3NXA A;  2LLT A;  2F33 A;  3PAT A;  1UHH A;  2OGR A;  4W6F A;  1IWQ A;  1Z4H A;  4KPI A;  1CFD A;  1VRK A;  5HKY A;  2HCG A;  2VVJ A;  4EDS A;  4TZG A;  4HQ8 A;  2A52 B;  1G8I A;  3W1D A;  1NUB A;  3SG4 A;  4OJ0 A;  2VAD A;  3ED8 A;  4PE7 A;  1YUR A;  1QS7 A;  3TZ1 A;  3BUO B;  3PM2 A;  5CPV A;  3H4S E;  4I5L B;  4DIR A;  2C9J A;  2WSN A;  1B8R A;  2M97 A;  2L4H A;  2BKI B;  1S26 D;  2HQ8 A;  4HQ9 A;  3IQO A;  1B1G A;  4YI8 A;  1QLK A;  1SPY A;  4W75 A;  2PXS A;  3DQ5 A;  4DKM A;  3AKO A;  3CR5 X;  1KCY A;  1W7S A;  3DQE A;  2KBM A;  4AS8 A;  2I2R E;  5DRF A;  1EMC A;  1J7O A;  1N2D A;  4C0J A;  1DVI A;  1QV0 A;  3SVD A;  3ZUF A;  4GNK B;  2QLG B;  1A03 A;  2HJO A;  5AAN A;  3GK4 X;  2QLG A;  2M0R A;  1K2H A;  3SS3 A;  1OQP A;  4GFT A;  3DVK A;  2QLH A;  5EB7 A;  2JNX A;  5AEQ A;  2Z1O A;  4JF9 A;  1U5I B;  2F3Y A;  4GGF A;  5CSF A;  1J55 A;  1U5I A;  2OTG C;  5HZU A;  3S0A A;  2K7D A;  1JUO A;  2LNK A;  3DQK A;  1OZO A;  3W1C A;  1DJG A;  3BXK A;  3H1O A;  1GL4 A;  2AWK A;  1EH2 A;  1P28 A;  3DVE A;  4Q9W A;  1K96 A;  1QYQ A;  2KAY A;  3SVC A;  1YX7 A;  4AR7 A;  5AER A;  4IK8 A;  3WXA A;  3DY9 A;  2SCP A;  2LAN A;  2JXL A;  3GJ2 A;  2Z6Y A;  4OVN F;  1DQE A;  3A8S A;  2QLE A;  4Q04 A;  3NSK A;  4W6J A;  5DPG A;  1SL9 A;  4W6P A;  3GJ1 A;  5DTL A;  2Q6P A;  2DD9 A;  3CS1 A;  4JPZ B;  4QJ3 B;  3DQM A;  4UTS A;  1S6C A;  1S5G Y;  1MOU A;  1WLM A;  1PVB A;  2KPH A;  5GQQ C;  4RYW A;  1CMG A;  3GK1 A;  2WCF A;  2ZRS A;  2JQ6 A;  4I5N B;  3EKJ A;  2COL B;  1HT9 A;  3AKB A;  4IZN A;  1S36 A;  4PHJ A;  3PFV A;  2LM5 A;  2KQ6 A;  2B3Q A;  4OHS A;  4N1F A;  4OKH A;  3NSO A;  3DQ7 A;  4ZFS A;  4DXP A;  3PLF B;  3O4Y A;  3KHE A;  5DTX A;  4PAL A;  3U0L A;  4OV2 A;  5BT0 A;  1XFY O;  1MXE A;  4J88 A;  4ZIN A;  4W7E A;  1NCX A;  2M9G A;  2GX0 A;  2KAX A;  4Q7R A;  2G9B A;  3SVO A;  1D1O A;  1CM4 A;  3DQ4 A;  2JOJ A;  3JVT C;  3ZWH A;  4P2Y B;  1PRW A;  1DJH A;  2LVI A;  2A4J A;  3SSY A;  3DXL A;  2K2F A;  2HRS A;  2LP2 A;  1JBZ A;  4FQT A;  2WC6 A;  5I94 A;  2CCM A;  4W7C A;  1NX2 A;  5HZS A;  3SG3 A;  1EL4 A;  1AUI B;  3SSP A;  4MZL A;  4CPV A;  3VRP A;  4DXO A;  2KLD A;  3DQU A;  1KFU L;  3U0N A;  1A4P A;  3D0Y B;  3AI5 A;  2M29 A;  3D0Y A;  3ZNI A;  2IB5 A;  3BX9 A;  2IE2 A;  2M1U A;  5DTZ A;  4MSP A;  5HW9 A;  4ZF4 A;  2MLF C;  2B3P A;  4MZJ A;  3NSL A;  4PDZ A;  1OMD A;  1YR5 A;  2L51 A;  4J89 A;  1IJ5 A;  1DEL A;  5DY6 A;  4H3L A;  4IK9 A;  1RRX A;  1YVL A;  1F71 A;  4ANJ A;  4OZD A;  1HCJ A;  1RRO A;  2JT3 A;  2LHI A;  2QT2 A;  1RMO A;  1MR8 A;  2IOV A;  2L0P A;  3WHU B;  3LF4 B;  3GK2 A;  2LP3 A;  2JZI A;  4HVF A;  2I7A A;  2EMN A;  2ZO7 A;  1IGV A;  3AKA A;  2JAD A;  3E5T A;  4INX A;  1SR6 C;  5J2O A;  3BJH A;  4BY5 A;  2MBX A;  3CDN A;  4ORN A;  1C7W A;  4PE1 A;  5DU0 A;  1OMV A;  2JNF A;  2KI6 C;  2M1K B;  3BYA A;  2DDD A;  2O29 A;  1A29 A;  5HYD A;  1F4O A;  1SCM C;  1IIO A;  5EXB A;  2HPS A;  3DVJ A;  4WRI A;  2V4E C;  3KCT A;  1K90 D;  4INW A;  3KPX A;  1L2O C;  5EL2 A;  3N7H A;  4PE4 A;  2HF5 A;  5HLV A;  1HUY A;  2Y5I A;  4YRU A;  4W6D A;  1EXR A;  1DJI A;  4PHK A;  1TTX A;  1RM9 A;  1K9U A;  3LVC A;  1YTZ C;  1BR1 B;  1CLL A;  2NXQ A;  2QEB A;  3RZS A;  3SS5 A;  2JPT A;  2LCP A;  1YHI A;  1J7Q A;  3JTD C;  3PJI A;  5AXI A;  2NCP A;  1QIW A;  1NX0 A;  4ZCU A;  5F9G A;  2HPW A;  4MEW A;  1J7R A;  1IQ3 A;  3OB1 B;  3NED A;  3VK1 A;  2M49 B;  3NHT A;  1JF2 A;  3OHM B;  1UIS A;  1J1D A;  3RLZ A;  4GUK A;  3K1K A;  2GGM A;  2GX2 A;  3SSL A;  1Y6W A;  3E3R A;  4W6H A;  3CFH A;  1OE9 B;  1CLB A;  2Q4U A;  3IP2 A;  3UNW A;  2ISD A;  4H48 A;  1BR4 B;  4JKT A;  4Q9X A;  2KOT A;  5DKR A;  2Z6Z A;  1CLM A;  3OSQ A;  1Q4C A;  3VRQ A;  4HRE E;  4GOB A;  3WNX B;  4W6A A;  3DQC A;  2YE1 A;  3OX5 A;  1YJ2 A;  2WSO A;  1LIN A;  1OOG A;  2H6V A;  3TDZ A;  1KWO C;  2WUR A;  3I5H B;  3FWC A;  2KNE A;  2A53 B;  2OTG B;  5HKW A;  4KF5 C;  1BU3 A;  4OQW A;  1WRL A;  1H6R A;  3CZ1 A;  4IL1 A;  2E30 A;  1K9K A;  3O77 A;  4ETO A;  2DOQ A;  2BEC A;  1UHK A;  4NWS A;  1XK4 A;  2L5X B;  1IQ5 A;  5I2Q A;  3SVU A;  2WCJ A;  3RWT A;  1ZAC A;  1QYO A;  3M22 A;  4W76 A;  4MZK A;  3D74 A;  3LCP C;  4JFG A;  2KI4 C;  2IB6 A;  1TNQ A;  3OX6 A;  2ZND A;  3R1P A;  3VHT B;  2K2A A;  4C0K A;  3BXB A;  3VHT A;  1GGZ A;  1K94 A;  2WCL A;  3TMR A;  4A4B A;  2ZKM X;  1XFV O;  3R1V A;  5CSI A;  3GOF A;  1TOP A;  3LS3 A;  3A4U B;  4W7F A;  3S0G A;  3I5F C;  2E6W A;  2QRF A;  2G6E A;  1Z1Q A;  1C07 A;  2G2S B;  1JC0 A;  3HX4 A;  2AHA A;  3SJS A;  3PM8 A;  1WDC C;  1RJV A;  4OR9 B;  3OB2 B;  1NP8 A;  4FTG A;  4N1G A;  2G5Z B;  2ZN8 A;  3FIA A;  4CFR A;  1ZUX A;  3CB9 A;  1NX1 A;  3GEX A;  2F8P A;  3NGV A;  5KSZ A;  2H8Q A;  1EG4 A;  1SYM A;  2QEH A;  2JT8 A;  2KFG A;  2JRF A;  1M63 B;  2LUC A;  3NF0 A;  2O2B A;  3PJ7 A;  3KCS A;  2ZN9 A;  3SVS A;  2LVV A;  1R6P A;  3DPX A;  1KYS A;  4DXN A;  3JVT B;  4N5X A;  2QEO A;  3GL4 A;  3SG6 A;  2WHU A;  1B9C A;  4NDC A;  2DUI A;  4RTC A;  4MBE A;  3EK4 A;  5I8N A;  3V2L A;  3VRN A;  3P8U A;  4LJB A;  3S05 A;  1Y1X A;  4M2P A;  1QX2 A;  2KLE A;  3M0W A;  4JWQ A;  3VRR A;  2DUH A;  2POX A;  1JFK A;  1CDN A;  4JGE A;  2BCB A;  5EXC I;  3TS5 C;  4ICB A;  2I94 A;  2LC5 A;  1CDM A;  1M46 A;  2KGB C;  1UHJ A;  4DUQ A;  3S0F A;  1JC1 A;  2BBN A;  4TNC A;  2WCK A;  3BUN B;  3A8R A;  3SSK A;  2YFP A;  5B8I B;  2LV7 A;  1K8U A;  1BJF A;  3TUY C;  3DQ9 A;  1KQM C;  2ZFD A;  3WHT B;  2DUF A;  3CYZ A;  1KFU S;  1F0B A;  2A54 B;  5DPI A;  4Z4M A;  1SSE B;  3PJ5 A;  3WCK A;  1IKU A;  3DYE A;  1TCO B;  3LF3 A;  3I5I C;  3CGL A;  1S6I A;  1UHI A;  3SIA A;  1BOD A;  4W6C A;  4BDU A;  2YGU A;  1DJY A;  1B8C A;  1ODB A;  2F2O A;  2FCE A;  3VGO A;  2TN4 A;  2PQL A;  2VZX A;  2F3Z A;  5H88 A;  5G08 A;  1MWN A;  1ZGO A;  2WHS A;  1FW4 A;  4JC2 A;  2H2K A;  3CR2 A;  1SR6 B;  2K7B A;  3M24 A;  4W6L A;  2FJU B;  1Q4E A;  1GGX A;  3SV5 A;  5KTG A;  4IK3 A;  2JUL A;  5LTQ A;  5FYX A;  1SCM B;  1X02 A;  2K8M B;  4MLW A;  2PXW A;  2V4E B;  3CFF A;  4W6G A;  3EK8 A;  2V4E A;  2P6B B;  4OGS A;  1KQV A;  2DUE A;  1OW4 A;  4NDD A;  1BLQ A;  1L2O B;  5FI2 A;  3OBV A;  1NYA A;  1OXD A;  1S6J A;  1DJW A;  3LSA A;  3DF0 B;  3D77 A;  3DF0 A;  4PCW A;  1UUR A;  3LL8 B;  4KGE A;  1CDL A;  3JTD B;  1F70 A;  3DQD A;  1RFJ A;  4MRX A;  5BPJ A;  2H5O A;  1REC A;  5DTY A;  2K61 A;  1LA3 A;  1J7P A;  2HFC A;  2LLU A;  5DPH A;  1LS8 A;  2M3W A;  5CSJ A;  1WLZ A;  1GJY A;  3CGA A;  1YHG A;  3OP0 A;  3DQ6 A;  2WND A;  4DXM A;  2JC2 A;  2HGY A;  1IH0 A;  4ZIO A;  2O5G A;  2GW4 B;  1QIV A;  2MAZ A;  4R6B A;  4MN0 A;  1HQV A;  1C3Y A;  1ZGQ A;  1TNW A;  1QX7 A;  3TDU A;  3DPW A;  2JPO A;  4OCI A;  1KFX S;  4B5Y A;  5FI6 A;  4P76 A;  2P70 A;  3ST2 A;  2A50 B;  1OOJ A;  1EG3 A;  5FVG A;  4LJD C;  1KWO B;  5JJG A;  1N0Y A;  3B7A A;  1XQM A;  5IBW A;  1B47 A;  3EK7 A;  3P28 A;  2FJY A;  4KF4 A;  1A2X A;  3K1E A;  5BQL A;  3B87 A;  4AOM A;  3F45 A;  1LVC D;  1Y1A A;  4KF5 A;  1OMR A;  3DQA A;  3L47 A;  2LMU A;  5I2L A;  1Q73 A;  4BY4 A;  4L1I A;  1KSM A;  2I18 A;  1J1E A;  4Q7U A;  2BNX A;  3SS4 A;  1GGW A;  2M7L A;  1DJX A;  1EJ3 A;  2PSR A;  1NCY A;  1BT6 A;  1SKT A;  2ZO6 A;  4W7R A;  3SVN A;  1PVA A;  4W69 A;  1TRF A;  1SW8 A;  2KI4 B;  2L2C A;  4KW9 A;  3SG5 A;  3BUM B;  1MUX A;  1MXL C;  1ALW A;  1DJZ A;  4U8D A;  2HQW A;  3G9A A;  1Y0V H;  1IJ6 A;  2HQZ A;  3SVB A;  1ZGP A;  3ADF A;  1PSR A;  2KFF A;  1KK8 C;  1EMG A;  3CR4 X;  4UPG A;  3MSE B;  5JOL A;  1RK9 A;  2NZ0 A;  2FOT A;  1BMO A;  2AMI A;  4I2Y A;  3EVP A;  1B7T Z;  3I19 A;  2JTT A;  1SL7 A;  2YE0 A;  5HKZ A;  5D7F A;  3FE9 A;  2VVH A;  2ARL A;  3FWB A;  4KAG A;  5HBD A;  3DQO A;  4KGF A;  3CWG A;  4IJ7 A;  2AWL A;  1XVJ A;  5LTP A;  4ZCV A;  2AH8 A;  1LA0 A;  2D8N A;  1SBJ A;  3E5V A;  1RMM A;  4ZF5 A;  2WC5 A;  3EVU A;  2Q57 A;  5H89 A;  3BFB A;  3CLN A;  2CBL A;  2DUG A;  4XGY A;  2MJW B;  1SY9 A;  4NQG A;  1YVH A;  2BCX A;  1T14 A;  5FVF A;  3RWA A;  3AAK A;  5EB6 A;  3U8A A;  2G16 B;  1F55 A;  3UFZ A;  3QME A;  1MHO A;  1KYR A;  2G6X A;  3VB1 A;  3TS5 B;  1YRU B;  2B1U A;  3DQJ A;  3ZTF A;  2LHL A;  1DT7 B;  2FZU A;  2KYC A;  3DVM A;  1QXP A;  4PHN A;  5EHU A;  4PPK A;  1KSO A;  2BE4 A;  3TUY B;  2HGD A;  1SNL A;  1KFX L;  1V1F A;  4OY4 A;  1KQM B;  5DPJ A;  2ZRT A;  5TNC A;  2HET A;  1F54 A;  1UHN A;  1LKJ A;  2WOS A;  1CFC A;  1EMF A;  2WCB A;  1WY9 A;  2H9W A;  3DQN A;  5AFP A;  4N3D A;  1OOF A;  3S0E A;  3ST3 A;  1TN4 A;  2NCO A;  4Q7T A;  4GF6 B;  1QX5 B;  2FWQ A;  1JC2 A;  5BTT B;  4LQT A;  1B4C A;  5BTT A;  2PRU A;  3DZT A;  4C0L A;  2KYF A;  1QV1 A;  1W7J B;  2C9I A;  3DQ8 A;  1BFP A;  1TUJ A;  3IVT A;  2L98 A;  2K7C A;  1W7U A;  4XL5 A;  2ZMW A;  3UG0 A;  1CM1 A;  1EME A;  2H5P A;  1XAE A;  1V1G A;  1EMB A;  4PPJ A;  3PN7 C;  1TUZ A;  2OPO A;  3PSR A;  2CXJ A;  2LLS A;  1QVI Z;  4M2O A;  4W6K A;  3IQQ A;  5EBJ A;  1QXT A;  4H3N A;  2AWJ A;  2WCE A;  1OOI X;  5AQB B;  4ORA B;  1XFR A;  1K9P A;  3O4X A;  2P4M A;  2DDC A;  1JF0 A;  2K7O A;  1ORG A;  2KHN A;  1Q4A A;  3AI4 A;  4GBA A;  1R2U A;  1KK7 Z;  3SSH A;  2G3D B;  3EVR A;  3C1V A;  4HSZ A;  1ZFS A;  5DKN A;  1M39 A;  2VAE A;  4MVF A;  4GGN A;  1CKK A;  2WCH A;  1OSA A;  4IK5 A;  4R6D A;  3TDI A;  4QJ4 B;  1QJT A;  3CD1 A;  1Z1P A;  1GQM A;  4YGD B;  3DQL A;  2JTZ A;  4CFQ A;  1B8L A;  3BFA A;  5HGE A;  1DGU A;  3O6B A;  2P71 A;  1DEK A;  2WOR A;  3DD4 A;  2EGD A;  4M2Q A;  4KW4 A;  1EMK A;  4PFE A;  1PK0 D;  3DQ2 A;  1LXF C;  3DQ1 A;  1TCF A;  3NSI A;  1OOH A;  4KA9 A;  2Y4Q A;  5HZO A;  1QLS A;  3BUW B;  1C4F A;  1JWD A;  1G4Y R;  1Q80 A;  3GB3 A;  2WCM A;  2MLE C;  2LVJ A;  1UWO A;  3NHI A;  2WC8 A;  2LVK A;  1NX3 A;  1TNX A;  2OKW A;  3BOW B;  3BOW A;  2G6Y A;  3VRO A;  1BF5 A;  1UUS A;  3FS7 A;  3IF7 A;  4W74 A;  3B88 A;  1YFP A;  1XSS A;  1S1E A;  3L4L A;  3LVA A;  2OTE A;  1BG1 A;  4YBH B;  4GPL B;  1OZS A;  3SRY A;  2OJK A;  4DKN A;  1CNP A;  3PJB A;  4GAO A;  2OKY A;  4F0Z B;  2FL1 A;  1NWD A;  2EC6 C;  1CFP A;  4W7D A;  3U0K A;  1G33 A;  1F8H A;  2A46 A;  1XFZ O;  3KF9 A;  1WRK A;  2M8U A;  3CZT X;  3DPZ A;  2A56 B;  1SL8 A;  2KQY A;  2GW3 A;  2WHT A;  1CTR A;  1ZMZ A;  1KK8 B;  1Z2C B;  2BTJ A;  2WIS A;  1CB1 A;  1B7T Y;  1YX8 A;  4W7A A;  3CFA A;  4EMQ A;  3VIC A;  1XFX O;  4W7X A;  3OSR A;  2LUX A;  1YUU A;  3FE8 A;  3NEZ A;  2BE6 A;  3SVR A;  1CDP A;  3I5H C;  1FPW A;  3LLE A;  2K0J A;  2KSP A;  2BL0 C;  1OXF A;  4FQO A;  2H61 C;  4W6I A;  4DXI A;  2AWM A;  4XOV A;  2L2E A;  1TNP A;  1AJ5 A;  2G3O A;  3DQH A;  2MRD A;  3I5G C;  2GV5 A;  4H47 A;  3TMT A;  5EJU A;  2DD7 A;  4DCK A;  1XK4 C;  4IK4 A;  4DXQ A;  2OS8 C;  3EKH A;  3R72 A;  1GFL A;  5HZT A;  4HRH A;  4Z4K A;  4W72 A;  2GTE A;  2PMY A;  5K89 A;  5J3X A;  2EHB A;  4J8A A;  2O60 A;  2OTB A;  1YZW A;  1QAT A;  3UO9 A;  1MYW A;  4NDB A;  1Q4D A;  2Y0G A;  1C7V A;  3EG5 B;  3D73 A;  2JT0 A;  1AK8 A;  1AHR A;  1RTP 1;  4YGB B;  3KO0 A;  2K60 A;  4WQ3 A;  5I2O A;  3B6X A;  1Q4B A;  1QYF A;  2LMV A;  4B30 B;  1QWV A;  1CFF A;  4W6N A;  4B30 A;  3AAJ A;  1MOV A;  5DQB A;  1AJ4 A;  1GM0 A;  4ZBL A;  4W6R A;  1H4U A;  2QLI A;  1L7Z A;  5D3O A;  4HQC A;  2PAS A;  1DF0 B;  1NPQ A;  2MA2 A;  1DF0 A; 
#chains in the Genus database with same CATH homology
 2FCD A;  3IR8 A;  4GES B;  3V3D A;  5H87 A;  2KFH A;  1JSA A;  5KU1 A;  3LVD A;  1AVS A;  2QZ0 A;  1A75 B;  2JU0 A;  1A75 A;  4W77 A;  1DMO A;  2A48 A;  1QTX A;  2BBM A;  1G7K A;  2JXC A;  1QVI Y;  3PN7 B;  4CLN A;  5DQM A;  3U8C A;  1JBY A;  4W6O A;  3LK0 A;  4ZB1 A;  2KDH A;  5FHV A;  1JBA A;  2MHH A;  3ZUJ A;  5HLO A;  1EMM A;  1KP5 A;  3KEV A;  1ZOT B;  4LJC A;  1E8A A;  1KK7 Y;  2PVB A;  1WRZ A;  3SVE A;  4YGA A;  5FVI A;  3ST4 A;  3DQF A;  1XMZ A;  3I5F B;  4A4C A;  1W7I B;  4JEO A;  4P1Q A;  5PAL A;  5D69 A;  1N65 A;  1W7T A;  3U0M A;  4EUL A;  4H3M A;  1Y1U A;  1XFW O;  4CID A;  1FBV A;  1WDC B;  3LK1 A;  3QRX A;  1NCZ A;  2Z6X A;  3E5W A;  2SAS A;  2PAL A;  2O24 A;  1M45 A;  2KI6 D;  2R2I A;  4R1E A;  4HRG A;  1ZUZ A;  4GGF C;  4I5J A;  4AQJ A;  1TIZ A;  5ER5 A;  4IK1 A;  3CTN A;  3CD9 A;  3MGF A;  1SK6 D;  5T3I A;  1XA5 A;  3DQI A;  4DS7 A;  4DRW A;  1XO5 A;  1XFU O;  2LAP A;  2Y1N A;  5F6T A;  2AUC A;  2BCA A;  4P5O E;  4YGE B;  1CMF A;  3ICB A;  2QAC A;  2L4I A;  2RH7 A;  4WQ2 A;  2ZMU A;  4KEX A;  1YUS A;  3D10 A;  2LMT A;  2L50 A;  2Y1M A;  2RGI A;  3O78 A;  2VVI A;  1CV7 A;  3BUX B;  1H4B A;  2M7N A;  4L13 A;  4EDO A;  2VRG A;  1YRT B;  2G2B A;  4XOW A;  1NSH A;  1QY3 A;  1ALV A;  1FI6 A;  5CSN A;  1RWY A;  1BOC A;  4JRB A;  1SCV A;  1XA9 A;  3LA1 A;  2EMO A;  3O2P A;  1S5G Z;  4W6M A;  1IG5 A;  3SS0 A;  1JFJ A;  3H1R A;  4W73 A;  2EC6 B;  4MRY A;  3WLD A;  4AQI A;  3DQ3 A;  1S3P A;  4PHM A;  2IS9 A;  4U2V A;  4YI9 A;  3PIB A;  2KAV A;  4LQU A;  1FF1 A;  1PUL A;  3I5I B;  2YDZ A;  1IRJ A;  4ORC B;  4D1E A;  3SSV A;  2H5Q A;  1H8B A;  1YUT A;  4W6U A;  1NIW A;  3NT9 A;  4TZA A;  4RYS A;  1YHH A;  3ZUL A;  3U8P A;  1SMG A;  4YGC B;  1B9A A;  2A47 A;  1MQ1 A;  1QAS A;  2QU1 A;  2BL0 B;  4ZF3 A;  4XJK B;  3RM1 A;  4JQ0 D;  4XJK A;  2F2P A;  3BQ3 A;  4W6B A;  4W6T A;  2NLN A;  2H61 A;  3K21 A;  4LW5 A;  3WLC A;  2EMD A;  4L9M A;  4I5K A;  4PE0 A;  4ORB B;  4QJ5 B;  4XYN A;  1K95 A;  2WIQ A;  4KW8 A;  1M31 A;  4PPL A;  3I5G B;  4W6S A;  3SIB A;  1SRA A;  2KBI A;  4HE4 A;  2OS8 B;  2AAO A;  5KTY A;  3PAL A;  2BKH B;  4E68 A;  3SG2 A;  5ER4 X;  1FI5 A;  1KYP A;  1AP4 A;  1OXE A;  2CT9 A;  3NT3 A;  3BXC A;  1K93 D;  5DRG A;  1MF8 B;  1YJF A;  1RMP A;  2ZNE A;  5DKQ A;  2GGZ A;  5LK4 A;  2HQK A;  2V53 A;  1F4Q A;  4L12 A;  2LE9 B;  1EML A;  2Q91 A;  4EN1 A;  2CTN A;  2CNP A;  3ST0 A;  3EVV A;  3SST A;  1DTL A;  5EXU A;  2H5R A;  1PAL A;  1EMA A;  3HCM A;  1F09 A;  3BXA A;  3CBE A;  1DGV A;  5LTR A;  4LJD A;  3SG7 A;  1UP5 A;  4USL A;  3OGO A;  1XYD A;  2QPT A;  4XVP A;  1PSB A;  2ICR A;  2KGR A;  1S6Z A;  2JWW A;  3NXA A;  2LLT A;  2F33 A;  3PAT A;  1UHH A;  2OGR A;  4W6F A;  1IWQ A;  4KPI A;  1CFD A;  1VRK A;  5HKY A;  2HCG A;  2VVJ A;  4EDS A;  4TZG A;  4HQ8 A;  2A52 B;  1G8I A;  3W1D A;  1NUB A;  3SG4 A;  4OJ0 A;  2VAD A;  3ED8 A;  4PE7 A;  1YUR A;  1QS7 A;  3TZ1 A;  3BUO B;  5CPV A;  3H4S E;  4I5L B;  4DIR A;  2C9J A;  2WSN A;  1B8R A;  2M97 A;  2L4H A;  2BKI B;  1S26 D;  2HQ8 A;  4HQ9 A;  3IQO A;  1B1G A;  4YI8 A;  1QLK A;  1SPY A;  4W75 A;  2PXS A;  3DQ5 A;  4DKM A;  3AKO A;  3CR5 X;  1KCY A;  1W7S A;  3DQE A;  2KBM A;  4AS8 A;  2I2R E;  5DRF A;  1EMC A;  1J7O A;  1N2D A;  4C0J A;  1DVI A;  1QV0 A;  3SVD A;  3ZUF A;  4GNK B;  2QLG B;  1A03 A;  2HJO A;  5AAN A;  3GK4 X;  2QLG A;  2M0R A;  1K2H A;  1OQP A;  4GFT A;  3DVK A;  2QLH A;  5EB7 A;  2JNX A;  5AEQ A;  2Z1O A;  4JF9 A;  1U5I B;  2F3Y A;  4GGF A;  5CSF A;  1J55 A;  1U5I A;  2OTG C;  5HZU A;  2K7D A;  1JUO A;  2LNK A;  3DQK A;  1OZO A;  3W1C A;  1DJG A;  3BXK A;  3H1O A;  1GL4 A;  2AWK A;  1EH2 A;  3DVE A;  4Q9W A;  1K96 A;  1QYQ A;  2KAY A;  3SVC A;  1YX7 A;  4AR7 A;  5AER A;  4IK8 A;  3WXA A;  2SCP A;  2LAN A;  2JXL A;  3GJ2 A;  2Z6Y A;  4OVN F;  3A8S A;  2QLE A;  4Q04 A;  3NSK A;  4W6J A;  5DPG A;  1SL9 A;  4W6P A;  3GJ1 A;  5DTL A;  2Q6P A;  2DD9 A;  3CS1 A;  4JPZ B;  4QJ3 B;  3DQM A;  4UTS A;  1S6C A;  1S5G Y;  1MOU A;  1WLM A;  1PVB A;  4RYW A;  5GQQ C;  1CMG A;  3GK1 A;  2WCF A;  2ZRS A;  2JQ6 A;  4I5N B;  3EKJ A;  2COL B;  1HT9 A;  3AKB A;  4IZN A;  1S36 A;  4PHJ A;  3PFV A;  2LM5 A;  2KQ6 A;  2B3Q A;  4OHS A;  4N1F A;  4OKH A;  3NSO A;  3DQ7 A;  4ZFS A;  4DXP A;  3PLF B;  3O4Y A;  3KHE A;  5DTX A;  4PAL A;  3U0L A;  4OV2 A;  5BT0 A;  1XFY O;  1MXE A;  4J88 A;  4ZIN A;  4W7E A;  1NCX A;  2M9G A;  2GX0 A;  2KAX A;  4Q7R A;  2G9B A;  3SVO A;  1D1O A;  1CM4 A;  3DQ4 A;  2JOJ A;  3JVT C;  3ZWH A;  4P2Y B;  1PRW A;  1DJH A;  2LVI A;  2A4J A;  3SSY A;  2K2F A;  2HRS A;  2LP2 A;  1JBZ A;  2CCM A;  4W7C A;  1NX2 A;  5HZS A;  3SG3 A;  1EL4 A;  1AUI B;  3SSP A;  4MZL A;  4CPV A;  3VRP A;  4DXO A;  3DQU A;  1KFU L;  3U0N A;  1A4P A;  3D0Y B;  3AI5 A;  2M29 A;  3D0Y A;  3ZNI A;  2IB5 A;  3BX9 A;  2IE2 A;  2M1U A;  5DTZ A;  4MSP A;  5HW9 A;  4ZF4 A;  2MLF C;  2B3P A;  4MZJ A;  3NSL A;  4PDZ A;  1OMD A;  1YR5 A;  2L51 A;  4J89 A;  1IJ5 A;  5DY6 A;  4H3L A;  4IK9 A;  1RRX A;  1YVL A;  1F71 A;  4ANJ A;  1HCJ A;  1RRO A;  2JT3 A;  2LHI A;  2QT2 A;  1RMO A;  1MR8 A;  2IOV A;  2L0P A;  3WHU B;  3LF4 B;  3GK2 A;  2LP3 A;  2JZI A;  4HVF A;  2I7A A;  2EMN A;  2ZO7 A;  1IGV A;  3AKA A;  2JAD A;  3E5T A;  1SR6 C;  5J2O A;  4BY5 A;  2MBX A;  4ORN A;  1C7W A;  4PE1 A;  5DU0 A;  1OMV A;  2JNF A;  2KI6 C;  2M1K B;  3BYA A;  2DDD A;  2O29 A;  1A29 A;  5HYD A;  1F4O A;  1SCM C;  5EXB A;  2HPS A;  3DVJ A;  4WRI A;  2V4E C;  3KCT A;  1K90 D;  3KPX A;  1L2O C;  4PE4 A;  2HF5 A;  5HLV A;  1HUY A;  2Y5I A;  4YRU A;  4W6D A;  1EXR A;  1DJI A;  4PHK A;  1TTX A;  1RM9 A;  1K9U A;  3LVC A;  1YTZ C;  1BR1 B;  1CLL A;  2NXQ A;  2JPT A;  2LCP A;  1YHI A;  1J7Q A;  3JTD C;  5AXI A;  2NCP A;  1QIW A;  1NX0 A;  4ZCU A;  5F9G A;  2HPW A;  4MEW A;  1J7R A;  1IQ3 A;  3OB1 B;  3NED A;  3VK1 A;  2M49 B;  1JF2 A;  3OHM B;  1UIS A;  1J1D A;  3RLZ A;  4GUK A;  3K1K A;  2GGM A;  2GX2 A;  3SSL A;  1Y6W A;  3E3R A;  4W6H A;  3CFH A;  1OE9 B;  1CLB A;  2Q4U A;  3IP2 A;  2ISD A;  4H48 A;  1BR4 B;  4Q9X A;  2KOT A;  5DKR A;  2Z6Z A;  1CLM A;  3OSQ A;  1Q4C A;  3VRQ A;  4HRE E;  4GOB A;  3WNX B;  4W6A A;  3DQC A;  2YE1 A;  3OX5 A;  1YJ2 A;  2WSO A;  1LIN A;  2H6V A;  3TDZ A;  1KWO C;  2WUR A;  3I5H B;  3FWC A;  2KNE A;  2A53 B;  2OTG B;  5HKW A;  4KF5 C;  1BU3 A;  4OQW A;  1WRL A;  1H6R A;  4IL1 A;  2E30 A;  1K9K A;  3O77 A;  4ETO A;  2DOQ A;  2BEC A;  1UHK A;  4NWS A;  1XK4 A;  2L5X B;  1IQ5 A;  5I2Q A;  3SVU A;  3RWT A;  1ZAC A;  1QYO A;  3M22 A;  4W76 A;  4MZK A;  3LCP C;  4JFG A;  2KI4 C;  2IB6 A;  1TNQ A;  3OX6 A;  2ZND A;  3VHT B;  2K2A A;  4C0K A;  3BXB A;  3VHT A;  1GGZ A;  1K94 A;  3TMR A;  4A4B A;  2ZKM X;  1XFV O;  5CSI A;  3GOF A;  1TOP A;  3LS3 A;  3A4U B;  4W7F A;  3I5F C;  2E6W A;  2QRF A;  2G6E A;  1Z1Q A;  1C07 A;  2G2S B;  1JC0 A;  3HX4 A;  2AHA A;  3SJS A;  3PM8 A;  1WDC C;  1RJV A;  4OR9 B;  3OB2 B;  1NP8 A;  4FTG A;  4N1G A;  2G5Z B;  2ZN8 A;  3FIA A;  4CFR A;  1ZUX A;  3CB9 A;  1NX1 A;  3GEX A;  2F8P A;  5KSZ A;  2H8Q A;  1EG4 A;  1SYM A;  2JT8 A;  2KFG A;  2JRF A;  1M63 B;  2LUC A;  3NF0 A;  2O2B A;  3PJ7 A;  3KCS A;  2ZN9 A;  3SVS A;  2LVV A;  1R6P A;  3DPX A;  1KYS A;  4DXN A;  3JVT B;  4N5X A;  3GL4 A;  3SG6 A;  2WHU A;  1B9C A;  4NDC A;  2DUI A;  4RTC A;  4MBE A;  3EK4 A;  5I8N A;  3VRN A;  3P8U A;  4LJB A;  3S05 A;  1Y1X A;  4M2P A;  1QX2 A;  3M0W A;  4JWQ A;  3VRR A;  2DUH A;  2POX A;  1JFK A;  1CDN A;  4JGE A;  2BCB A;  5EXC I;  3TS5 C;  4ICB A;  2I94 A;  2LC5 A;  1CDM A;  1M46 A;  2KGB C;  1UHJ A;  4DUQ A;  1JC1 A;  2BBN A;  4TNC A;  3BUN B;  3A8R A;  3SSK A;  2YFP A;  5B8I B;  2LV7 A;  1K8U A;  1BJF A;  3TUY C;  3DQ9 A;  1KQM C;  2ZFD A;  3WHT B;  2DUF A;  1KFU S;  1F0B A;  2A54 B;  5DPI A;  4Z4M A;  3PJ5 A;  3WCK A;  1IKU A;  1TCO B;  3LF3 A;  3I5I C;  3CGL A;  1S6I A;  1UHI A;  3SIA A;  1BOD A;  4W6C A;  4BDU A;  1DJY A;  1B8C A;  1ODB A;  2F2O A;  2FCE A;  3VGO A;  2TN4 A;  2VZX A;  2F3Z A;  5H88 A;  5G08 A;  1MWN A;  1ZGO A;  2WHS A;  1FW4 A;  4JC2 A;  2H2K A;  3CR2 A;  1SR6 B;  2K7B A;  3M24 A;  4W6L A;  2FJU B;  1Q4E A;  1GGX A;  3SV5 A;  5KTG A;  4IK3 A;  2JUL A;  5LTQ A;  5FYX A;  1SCM B;  1X02 A;  2K8M B;  4MLW A;  2PXW A;  2V4E B;  3CFF A;  4W6G A;  3EK8 A;  2V4E A;  2P6B B;  4OGS A;  1KQV A;  2DUE A;  4NDD A;  1BLQ A;  1L2O B;  1NYA A;  1OXD A;  1S6J A;  1DJW A;  3LSA A;  3DF0 B;  3DF0 A;  4PCW A;  1UUR A;  3LL8 B;  4KGE A;  1CDL A;  3JTD B;  1F70 A;  3DQD A;  1RFJ A;  4MRX A;  5BPJ A;  2H5O A;  1REC A;  5DTY A;  2K61 A;  1LA3 A;  1J7P A;  2HFC A;  2LLU A;  5DPH A;  2M3W A;  5CSJ A;  1WLZ A;  1GJY A;  3CGA A;  1YHG A;  3OP0 A;  3DQ6 A;  2WND A;  4DXM A;  2JC2 A;  2HGY A;  1IH0 A;  4ZIO A;  2O5G A;  2GW4 B;  1QIV A;  2MAZ A;  4R6B A;  4MN0 A;  1HQV A;  1ZGQ A;  1TNW A;  1QX7 A;  3TDU A;  3DPW A;  4OCI A;  1KFX S;  4B5Y A;  4P76 A;  3ST2 A;  2A50 B;  1OOJ A;  1EG3 A;  5FVG A;  4LJD C;  1KWO B;  5JJG A;  1N0Y A;  1XQM A;  5IBW A;  1B47 A;  3EK7 A;  3P28 A;  4KF4 A;  1A2X A;  5BQL A;  4AOM A;  3F45 A;  1LVC D;  1Y1A A;  4KF5 A;  1OMR A;  3DQA A;  2LMU A;  5I2L A;  1Q73 A;  4BY4 A;  4L1I A;  1KSM A;  2I18 A;  1J1E A;  4Q7U A;  1GGW A;  2M7L A;  1DJX A;  1EJ3 A;  2PSR A;  1NCY A;  1BT6 A;  1SKT A;  2ZO6 A;  4W7R A;  3SVN A;  1PVA A;  4W69 A;  1TRF A;  1SW8 A;  2KI4 B;  4KW9 A;  3SG5 A;  3BUM B;  1MUX A;  1MXL C;  1ALW A;  1DJZ A;  4U8D A;  2HQW A;  3G9A A;  1Y0V H;  1IJ6 A;  2HQZ A;  3SVB A;  1ZGP A;  3ADF A;  1PSR A;  2KFF A;  1KK8 C;  1EMG A;  3CR4 X;  4UPG A;  3MSE B;  5JOL A;  1RK9 A;  2NZ0 A;  2FOT A;  1BMO A;  2AMI A;  4I2Y A;  3EVP A;  1B7T Z;  3I19 A;  2JTT A;  1SL7 A;  2YE0 A;  5HKZ A;  5D7F A;  2VVH A;  2ARL A;  3FWB A;  4KAG A;  5HBD A;  3DQO A;  4KGF A;  3CWG A;  2AWL A;  1XVJ A;  5LTP A;  4ZCV A;  2AH8 A;  1LA0 A;  2D8N A;  1SBJ A;  3E5V A;  1RMM A;  4ZF5 A;  3EVU A;  2Q57 A;  5H89 A;  3CLN A;  2CBL A;  2DUG A;  4XGY A;  2MJW B;  1SY9 A;  4NQG A;  1YVH A;  2BCX A;  5FVF A;  3RWA A;  3AAK A;  5EB6 A;  3U8A A;  2G16 B;  1F55 A;  3UFZ A;  2G6X A;  1MHO A;  1KYR A;  3TS5 B;  1YRU B;  2B1U A;  3DQJ A;  3ZTF A;  2LHL A;  1DT7 B;  2FZU A;  2KYC A;  3DVM A;  1QXP A;  4PHN A;  5EHU A;  4PPK A;  1KSO A;  2BE4 A;  3TUY B;  2HGD A;  1SNL A;  1KFX L;  1V1F A;  4OY4 A;  1KQM B;  5DPJ A;  2ZRT A;  5TNC A;  2HET A;  1F54 A;  1UHN A;  1LKJ A;  2WOS A;  1CFC A;  1EMF A;  2WCB A;  1WY9 A;  2H9W A;  3DQN A;  5AFP A;  4N3D A;  3ST3 A;  1TN4 A;  2NCO A;  4Q7T A;  4GF6 B;  1QX5 B;  2FWQ A;  1JC2 A;  5BTT B;  4LQT A;  1B4C A;  5BTT A;  2PRU A;  4C0L A;  2KYF A;  1QV1 A;  1W7J B;  2C9I A;  3DQ8 A;  1BFP A;  2L98 A;  2K7C A;  1W7U A;  4XL5 A;  2ZMW A;  3UG0 A;  1CM1 A;  1EME A;  2H5P A;  1XAE A;  1V1G A;  1EMB A;  4PPJ A;  3PN7 C;  2OPO A;  3PSR A;  2CXJ A;  2LLS A;  1QVI Z;  4M2O A;  4W6K A;  3IQQ A;  5EBJ A;  1QXT A;  4H3N A;  2AWJ A;  2WCE A;  5AQB B;  4ORA B;  1K9P A;  2P4M A;  2DDC A;  1JF0 A;  2K7O A;  2KHN A;  1Q4A A;  3AI4 A;  4GBA A;  1R2U A;  1KK7 Z;  3SSH A;  2G3D B;  3EVR A;  3C1V A;  4HSZ A;  1ZFS A;  5DKN A;  1M39 A;  2VAE A;  4MVF A;  4GGN A;  1CKK A;  1OSA A;  4IK5 A;  4R6D A;  3TDI A;  4QJ4 B;  1QJT A;  3CD1 A;  1Z1P A;  1GQM A;  4YGD B;  3DQL A;  2JTZ A;  4CFQ A;  1B8L A;  5HGE A;  1DGU A;  3O6B A;  2WOR A;  3DD4 A;  2EGD A;  4M2Q A;  4KW4 A;  1EMK A;  4PFE A;  1PK0 D;  3DQ2 A;  1LXF C;  3DQ1 A;  1TCF A;  3NSI A;  4KA9 A;  2Y4Q A;  5HZO A;  1QLS A;  3BUW B;  1C4F A;  1JWD A;  1G4Y R;  1Q80 A;  3GB3 A;  2MLE C;  2LVJ A;  1UWO A;  2WC8 A;  2LVK A;  1NX3 A;  1TNX A;  2OKW A;  3BOW B;  3BOW A;  2G6Y A;  3VRO A;  1BF5 A;  1UUS A;  3FS7 A;  3IF7 A;  4W74 A;  1YFP A;  1XSS A;  1S1E A;  3LVA A;  2OTE A;  1BG1 A;  4YBH B;  4GPL B;  1OZS A;  3SRY A;  2OJK A;  4DKN A;  1CNP A;  3PJB A;  4GAO A;  2OKY A;  4F0Z B;  2FL1 A;  1NWD A;  2EC6 C;  1CFP A;  4W7D A;  3U0K A;  1G33 A;  1F8H A;  2A46 A;  1XFZ O;  3KF9 A;  1WRK A;  2M8U A;  3CZT X;  3DPZ A;  2A56 B;  1SL8 A;  2KQY A;  2GW3 A;  2WHT A;  1CTR A;  1ZMZ A;  1KK8 B;  2BTJ A;  2WIS A;  1CB1 A;  1B7T Y;  1YX8 A;  4W7A A;  3CFA A;  4EMQ A;  3VIC A;  1XFX O;  4W7X A;  3OSR A;  2LUX A;  1YUU A;  3NEZ A;  2BE6 A;  3SVR A;  1CDP A;  3I5H C;  1FPW A;  3LLE A;  2K0J A;  2KSP A;  2BL0 C;  1OXF A;  4FQO A;  2H61 C;  4W6I A;  4DXI A;  2AWM A;  4XOV A;  2L2E A;  1TNP A;  1AJ5 A;  2G3O A;  3DQH A;  2MRD A;  3I5G C;  2GV5 A;  4H47 A;  3TMT A;  5EJU A;  2DD7 A;  4DCK A;  1XK4 C;  4IK4 A;  4DXQ A;  2OS8 C;  3EKH A;  1GFL A;  5HZT A;  4HRH A;  4Z4K A;  4W72 A;  2PMY A;  5K89 A;  5J3X A;  2EHB A;  4J8A A;  2O60 A;  2OTB A;  1YZW A;  1QAT A;  1MYW A;  4NDB A;  1Q4D A;  2Y0G A;  1C7V A;  2JT0 A;  1AK8 A;  1AHR A;  1RTP 1;  4YGB B;  3KO0 A;  4WQ3 A;  5I2O A;  1Q4B A;  1QYF A;  2LMV A;  4B30 B;  1CFF A;  4W6N A;  4B30 A;  3AAJ A;  1MOV A;  5DQB A;  1AJ4 A;  4ZBL A;  4W6R A;  1H4U A;  2QLI A;  1L7Z A;  4HQC A;  2PAS A;  1DF0 B;  1NPQ A;  2MA2 A;  1DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...