3SG4A

Crystal structure of gcamp3-d380y, lp(linker 2)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKYTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 133
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg4A01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg4A02
2JADA 1AUIB 4HQ8A 3PN7C 2BE4A 1EMEA 2HQ8A 2WC8A 2KSPA 2NCOA 5H89A 3WHTB 1Q80A 2KAVA 3BX9A 4OHSA 5G08A 2NXQA 4H3LA 5AEQA 2PSRA 1J1EA 4GESB 1DGUA 3I5IC 4PE0A 2M8UA 3CZTX 2Y1MA 1S36A 3EVVA 3WHUB 2Q6PA 1QX7A 1JC0A 4JF9A 1EG3A 2BECA 1OXEA 1N65A 2AUCA 2RGIA 2ZRSA 3DVKA 1W7SA 1BT6A 1K93D 1QJTA 4CFRA 2GV5A 4W6FA 3ICBA 2WHUA 2QLEA 1XFUO 3ADFA 1PSRA 5DPJA 1PVBA 4GGNA 3AI4A 4W77A 3RWAA 1XFWO 1JFKA 3JTDC 1B4CA 1EJ3A 3O2PA 4DXQA 4IK3A 3GK4X 2AAOA 2A48A 2G6YA 2H6VA 1B9CA 3DQKA 4OQWA 1WDCB 1ALWA 1QYOA 3VROA 1R2UA 2Y4QA 1MXEA 2SASA 5DKQA 1JC2A 1NX0A 3CLNA 4UTSA 3TUYC 2O24A 4CLNA 2G5ZB 2IE2A 3EK7A 5HKYA 4W74A 2ZMUA 1OXFA 3VHTB 4ZCVA 3CR5X 1TNWA 1LA3A 2HJOA 4NDBA 4DKMA 2A54B 2QLHA 1EMGA 4ORBB 4YBHB 4I2YA 4XJKA 1BF5A 1TN4A 4NWSA 4GOBA 3AKAA 3WCKA 1LXFC 2Q57A 1KFUS 2DD7A 3NXAA 4IZNA 1RK9A 1FBVA 4DUQA 2DDCA 1DGVA 3I5GB 4U2VA 1YZWA 3W1CA 2L0PA 1OOJA 2JT0A 2JXLA 4QJ5B 1K8UA 2YDZA 2MLEC 2BKHB 2H61C 4LJBA 2L98A 2MA2A 1GJYA 1Y1XA 1WLMA 3ZWHA 5KSZA 5FYXA 2AWMA 4KAGA 1KK7Z 1QVIZ 1F0BA 3DQAA 3U0LA 1KFXS 1JF2A 5DRFA 1QATA 4W6RA 1JUOA 1CV7A 3VGOA 1VRKA 3BUOB 1B8CA 2I7AA 1V1GA 3OGOA 4W6SA 3CD1A 2L51A 4R1EA 2VADA 3VICA 2AHAA 4H3NA 4LJCA 3SG4A 2QLGB 2DUFA 4YGCB 3G9AA 1S3PA 1WDCC 3NSOA 1BLQA 1KWOB 1NSHA 3E3RA 2O29A 1SL7A 1QASA 2YFPA 3BOWB 2KFFA 1NYAA 1F09A 4W76A 4N3DA 2ZN8A 5EB6A 2D8NA 1AJ5A 1W7TA 1LA0A 1QXPA 1WRKA 2IOVA 1B47A 4MLWA 1RMMA 1A4PA 2OS8B 2QZ0A 3NEDA 2A52B 4GGFA 3SIBA 1OZSA 2LMVA 1DJGA 4YRUA 4YGBB 3EVRA 4AS8A 2A46A 1L7ZA 2CBLA 2K7CA 2FL1A 1L2OC 3E5VA 1QIWA 2KQYA 2LANA 1CMFA 1QYQA 4Z4MA 4AQIA 3GL4A 3BUMB 5EB7A 1DVIA 1WLZA 1CLMA 3SG5A 5LTQA 2KAYA 4KF5C 1JC1A 4P2YB 3SSHA 3SVEA 1TRFA 1RMPA 5AXIA 1K90D 3DQ3A 1GGWA 4J88A 1KQVA 3JVTB 2VZXA 3M22A 1KK7Y 1QVIY 5KTYA 2L4HA 1Z1PA 2QACA 2HQKA 1NCZA 3P8UA 1QTXA 1UUSA 1BR4B 2H9WA 2VRGA 4USLA 2BTJA 3BUNB 2BCBA 3M0WA 2M7NA 3PATA 1CDMA 4PHJA 2K2AA 2FCDA 4CPVA 3O77A 1EMAA 1UP5A 4PHMA 1BU3A 2M29A 3IQOA 3U8PA 4DXIA 5CPVA 3OSQA 4W6AA 4PHKA 1U5IB 1BODA 3ST0A 1EXRA 1JWDA 3BXCA 1ALVA 4W6NA 4GPLB 3LVDA 1NX3A 3GEXA 3E5TA 1FI5A 2JTTA 1ZFSA 5DTXA 4KA9A 3SRYA 2WHTA 2HGYA 4Q9WA 1PSBA 2OTGB 3DQ9A 1EH2A 3CD9A 5PALA 2QPTA 1OSAA 2Q4UA 1A29A 3SVBA 3I5FB 2OS8C 1K95A 2SCPA 2O2BA 2K8MB 1B1GA 1YX7A 1F54A 5CSNA 3SVCA 4MRXA 3NSLA 2LMTA 2WISA 2LV7A 1QV0A 2KNEA 1YUUA 2A56B 3GB3A 3E5WA 1E8AA 2KHNA 4DXOA 3I5HC 3KPXA 2CT9A 3NT3A 2BCAA 1J7QA 5BPJA 4Q9XA 1LINA 1F55A 5HKWA 2EGDA 1XYDA 3TS5C 4AQJA 3SS0A 2QRFA 4LJDC 4PE4A 5EHUA 3CBEA 5HGEA 2VAEA 4L9MA 4YGEB 4IK5A 1AK8A 3SG3A 1DT7B 3LVAA 2HQWA 4MBEA 3DQ5A 2P4MA 2NZ0A 1QX2A 2DUIA 1YJFA 1F71A 2V53A 3O78A 4A4CA 4OR9B 4XL5A 4P76A 1S6CA 2WIQA 1NWDA 2ZMWA 4CFQA 3VK1A 2KI6D 4B5YA 1K96A 3SG2A 4PPKA 1RM9A 1HQVA 1K9UA 2IB5A 3NSKA 2G16B 4KPIA 1OE9B 2GGMA 3CR2A 1MQ1A 1C07A 1KYRA 1FI6A 4PPJA 2M97A 3H1RA 1D1OA 4ANJA 1CLBA 1U5IA 4ZIOA 4IK8A 4W7EA 2AWKA 2KI4B 3GK1A 3DQOA 3V3DA 4GFTA 4QJ3B 2R2IA 1M39A 2OKWA 4H48A 4JFGA 4W6MA 4W6IA 1H4UA 2DD9A 3NF0A 2V4EB 4C0JA 4EN1A 2HRSA 3BXKA 4W6JA 3LA1A 2KFGA 3OX5A 1H8BA 3UFZA 2LUCA 3KEVA 5HW9A 1XQMA 1YVLA 3CTNA 5TNCA 2KYFA 3OB1B 3ST4A 1J7RA 1OMVA 2Q91A 1Q4CA 3NEZA 3A8SA 2BL0B 5D7FA 3PJ7A 2KAXA 4XJKB 2PASA 1ZUXA 2C9JA 5ER4X 5DKNA 1NP8A 4ZINA 2ZNDA 4M2OA 1CDNA 2JOJA 4HRGA 3MGFA 3SV5A 2LVKA 5B8IB 4PE7A 4EDSA 1NCYA 1MYWA 4I5LB 4W6GA 3MSEB 5J2OA 3OB2B 1QXTA 2K7OA 2GGZA 3LVCA 2E6WA 4W6CA 4W72A 1CNPA 3CFFA 3HCMA 4AR7A 4W6PA 1CFFA 5AERA 3TDIA 3TDZA 5FVGA 2BKIB 2MRDA 1CM4A 2O60A 3DQMA 4JC2A 4N5XA 4OVNF 4WRIA 4F0ZB 1GQMA 2L5XB 3KHEA 5GQQC 2LLSA 2EC6B 3DPZA 2V4EA 1QIVA 4DS7A 4YGDB 1GL4A 4MSPA 1YRUB 1ODBA 3PLFB 4NQGA 4D1EA 1CTRA 4LQUA 2M9GA 4A4BA 4ZB1A 2AMIA 4KW4A 3SVRA 2B3PA 1RRXA 4JQ0D 5IBWA 1EMKA 2JTZA 4ICBA 2MHHA 5EXCI 3H4SE 3SG7A 3LK1A 2KGBC 1TNXA 2G2BA 4R6DA 1JF0A 4Q04A 5EXUA 2Y0GA 5K89A 2JWWA 1XMZA 1K9PA 2KBIA 3PM8A 1SBJA 4KF4A 1X02A 5J3XA 1EMCA 2WOSA 3IQQA 4MRYA 4DKNA 3DQIA 1NIWA 1C7WA 5EXBA 4E68A 2PRUA 1EG4A 1YFPA 1SYMA 2B1UA 1DJXA 1RMOA 2QU1A 4L12A 5FVIA 1V1FA 3A8RA 1TNQA 4XOWA 4OCIA 2ZFDA 1QS7A 2H5RA 1IGVA 4OJ0A 3ST3A 3EVPA 4ZF3A 1IJ6A 2K2FA 4W75A 1OXDA 4I5JA 3BUWB 2EC6C 1XK4C 3VRPA 3CB9A 4W7XA 3DQHA 4ZCUA 3NT9A 2IB6A 2WURA 5BTTA 2OKYA 1UHNA 3SSPA 2ZRTA 5HLOA 1HT9A 2M3WA 2EMOA 2LHIA 4KGFA 2JT3A 1KCYA 5I2LA 2H5OA 2I18A 1NPQA 4ZBLA 1S6JA 3BYAA 2G6EA 3TMTA 4W6OA 3TMRA 5DPGA 2HETA 2F8PA 2KFHA 3DF0B 1H4BA 2WNDA 4W6UA 3AAJA 3HX4A 3WXAA 4BY5A 1MOVA 3LSAA 3UG0A 2DOQA 1XAEA 3BXAA 4DCKA 3SIAA 4IK9A 3VRNA 1Q4EA 4RTCA 4HQCA 1PRWA 3I5GC 5KTGA 5H88A 1QX5B 1CB1A 2K0JA 5HBDA 4W73A 3CR4X 3PJBA 2IS9A 5BQLA 1A75B 1J7PA 4EDOA 2GW3A 3BXBA 1SCVA 1LKJA 3M24A 5H87A 4RYWA 4LW5A 4ZFSA 5F9GA 2CXJA 5I2OA 2GX2A 2A47A 1GGXA 1NCXA 2Z6ZA 1KQMB 2MAZA 2LUXA 2JU0A 1QV1A 1BOCA 1G4YR 2LMUA 1YRTB 1QY3A 1Y1UA 4NDCA 2M1KB 5FHVA 3DQLA 4HQ9A 1KWOC 1BFPA 3LK0A 1M46A 2ZO6A 1XFXO 1YR5A 1AHRA 2CCMA 4ZF5A 3I19A 1MWNA 2A50B 4M2QA 1MXLC 1SW8A 3GK2A 4LQTA 4W7CA 4XYNA 2EMNA 1WRLA 1M31A 2C9IA 3DF0A 5DPHA 2H2KA 4DIRA 5CSFA 4J8AA 4EULA 1K2HA 3LS3A 1MOUA 1CFPA 1AVSA 5I2QA 2PALA 4TZAA 3U0KA 2K61A 1RJVA 2JT8A 1NUBA 1TTXA 4XOVA 3DQDA 1LVCD 3LL8B 3GJ2A 3ZULA 1CFDA 2LNKA 1IG5A 2YE1A 5CSJA 1CDPA 4J89A 1YHHA 1A75A 4N1FA 3GOFA 1CM1A 3JVTC 2ARLA 1YUSA 5LTPA 3KF9A 1MR8A 2BCXA 4JEOA 2WCFA 1J55A 1YURA 3OX6A 1UISA 4LJDA 3DVMA 1ZGOA 2VVHA 3PN7B 1QYFA 1MF8B 4HE4A 4B30A 1CMGA 1KP5A 1Q4DA 2PVBA 2BBMA 1Q4BA 1BG1A 1TCOB 2HCGA 4W6HA 4AOMA 5HZSA 3D0YA 2OGRA 3FIAA 1SCMB 1R6PA 1CKKA 4HRHA 2OTBA 2WSNA 2F2OA 4KGEA 1JBZA 4MVFA 2L50A 2CTNA 2OTGC 2LCPA 1GGZA 4BDUA 3FWCA 3D10A 5HZOA 1SNLA 5LK4A 3I5FC 5DPIA 1YHIA 1XO5A 4C0LA 2PXSA 3GJ1A 3WLDA 1RFJA 4DXNA 4HREE 2F3ZA 1A2XA 1XFYO 3NSIA 2HPWA 2DDDA 3SVDA 3JTDB 4JRBA 1SPYA 2WSOA 1DJZA 3BQ3A 2GW4B 3AI5A 1F4QA 3CGAA 1DJWA 1RROA 3K21A 3PSRA 1HCJA 4MEWA 1J7OA 2LM5A 4R6BA 2K7DA 2VVIA 2MLFC 3DQ7A 1FPWA 1S5GZ 5D69A 2Z1OA 2EHBA 2JZIA 1IWQA 4EMQA 2Z6XA 1YUTA 2H8QA 2VVJA 1EL4A 2JNXA 3RLZA 2JQ6A 1W7UA 1IKUA 1OZOA 1XSSA 1KFUL 3U0MA 4GUKA 1HUYA 2G9BA 3TZ1A 2DUEA 3FWBA 4ORAB 5F6TA 1JSAA 2HPSA 3ED8A 3IR8A 4MN0A 1TNPA 1SCMC 3BUXB 3KO0A 2JC2A 4IK4A 3K1KA 3ZNIA 2KI4C 1IQ3A 4TNCA 3DQEA 3LLEA 5DTYA 3DVJA 3SSYA 1XVJA 1KFXL 3WLCA 4ZF4A 1Q73A 2V4EC 3RM1A 3OHMB 5DQBA 2ZN9A 3EVUA 1JBYA 4JGEA 3DPWA 5BTTB 1K94A 1SY9A 1N2DA 4OV2A 1TIZA 1FF1A 4P1QA 5HZUA 4PFEA 2OTEA 1SL9A 4NDDA 1M63B 2AWJA 1S26D 2G3OA 1NX2A 1QLKA 4Q7UA 1A03A 4Q7TA 2HF5A 4PDZA 4ORCB 2OPOA 1UHKA 1TOPA 3U8AA 3DQ6A 4GF6B 4W7FA 1IQ5A 2BL0C 3FS7A 2KBMA 4H3MA 4YI9A 4L13A 5DKRA 4CIDA 3DQUA 2O5GA 1S5GY 2L2EA 1W7JB 2K7BA 3KCTA 1PK0D 2LLUA 2H5QA 3SVOA 3A4UB 3PIBA 4W6LA 1SL8A 5DRGA 2A4JA 4QJ4B 2M1UA 4KW8A 1OMRA 4ORNA 4FTGA 1WRZA 1S6ZA 4XVPA 5ER5A 1F70A 3SSTA 1ZUZA 1L2OB 1TCFA 5AQBB 2JXCA 3DQFA 4P5OE 3DQNA 2B3QA 1G33A 4PCWA 4OGSA 2G6XA 3EK8A 2WORA 1XA5A 1S1EA 2LVJA 1EMBA 2KYCA 2ZNEA 3O4YA 3EKJA 4FQOA 5DU0A 2FOTA 1B8LA 1DMOA 2H61A 2LC5A 2CNPA 3DPXA 4PHNA 3EK4A 2ICRA 2L4IA 5DY6A 4H47A 1SK6D 2ISDA 1SRAA 1Z1QA 3ST2A 4M2PA 1JFJA 3LF3A 5DQMA 3ZUJA 3ZUFA 4I5KA 2TN4A 1XK4A 1IJ5A 2Y1NA 3SVNA 1ZGPA 4Q7RA 4W6DA 4TZGA 2OJKA 4GNKB 5AFPA 4GGFC 2AH8A 4W69A 3EKHA 4RYSA 1H6RA 1QLSA 1F4OA 1KYSA 4KEXA 1YX8A 4W6KA 1S6IA 1BR1B 4GBAA 2E30A 5HKZA 2AWLA 3CWGA 3VHTA 2LVIA 3DQ1A 1Y1AA 3SJSA 2KI6C 2PMYA 4W6TA 1M45A 1RWYA 5I8NA 3VRRA 1XA9A 4HSZA 1IRJA 1K9KA 1SR6B 1B8RA 4C0KA 1BMOA 2WCEA 1EMLA 1KK8B 1AP4A 1XFVO 4GAOA 2A53B 1YJ2A 3I5HB 1KSOA 4BY4A 2KGRA 2JULA 5CSIA 2MBXA 3TS5B 1DF0B 2GX0A 1UHHA 1ZOTB 2FJUB 1PULA 1DTLA 4KF5A 1Q4AA 1YTZC 2P6BB 4B30B 2H5PA 1B9AA 1C4FA 1ZACA 5LTRA 3RWTA 5DTZA 1MHOA 2HFCA 3PJ5A 3D0YB 3IF7A 4ETOA 2DUGA 2KQ6A 1Y0VH 3WNXB 4HVFA 4IK1A 3W1DA 1IH0A 5T3IA 3QRXA 4OY4A 2QLGA 2G2SB 1UURA 4IL1A 3OSRA 3BOWA 5AANA 4DXMA 1DJHA 3VRQA 1B7TZ 4DRWA 2WHSA 3DQ8A 1XFZO 3F45A 5HLVA 1W7IB 1G8IA 5BT0A 1PVAA 2LHLA 3S05A 4PE1A 4WQ3A 1CDLA 4OKHA 2DUHA 5HYDA 3DQCA 4PPLA 2ZO7A 2M0RA 2BE6A 2JNFA 2LP2A 2NCPA 1OMDA 4U8DA 1SR6C 3ZTFA 3U0NA 1EMFA 2YE0A 2M49B 4W7RA 3SSLA 1Y6WA 2FCEA 2HQZA 1KK8C 2KDHA 1G7KA 3SG6A 2LVVA 3SSVA 2NLNA 2BBNA 1BJFA 3U8CA 1OQPA 2JPTA 5JJGA 1UHIA 3SSKA 1KQMC 5EBJA 2FWQA 1DF0A 3IP2A 2F3YA 1PALA 4UPGA 2MJWB 3AKBA 2Y5IA 1GFLA 3P28A 1UWOA 2WCBA 2F33A 1N0YA 3LF4B 1WY9A 2RH7A 3KCSA 2KOTA 2LAPA 3I5IB 3DQJA 4XGYA 2LLTA 4L1IA 5KU1A 3SVSA 1FW4A 3O6BA 2HGDA 3OP0A 3CFHA 3C1VA 4JWQA 3SVUA 3CS1A 2F2PA 3PALA 1KYPA 2JRFA 4W6BA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 3DQ2A 3CFAA 1MUXA 1C7VA 4YGAA 2FZUA 4MZKA 4MZLA 4KW9A 1ZGQA 2G3DB 2COLB 4MZJA 1RECA 1ZMZA 1DJIA 4I5NB 5FVFA 2LE9B 1AJ4A 1YHGA 1CLLA 3H1OA 1SKTA 1YVHA 3CGLA 1DJYA 1RTP1 1UHJA 2PXWA 2EMDA 4Z4KA 1J1DA 1EMMA 5JOLA 2QT2A 2LP3A 2I94A 4W7AA 3LCPC 2POXA 3DVEA 3TUYB 4YI8A 4JPZB 4WQ2A 1KSMA 3TDUA 4W7DA 1NX1A 1CFCA 4DXPA 2ZKMX 5EJUA 3DQ4A 1F8HA 3AKOA 4N1GA 3PFVA 2QLIA 3DD4A 1JBAA 5DTLA 5HZTA 2Z6YA
chains in the Genus database with same CATH superfamily
2JADA 1AUIB 4HQ8A 3PN7C 2BE4A 1EMEA 2HQ8A 2WC8A 2KSPA 2NCOA 5H89A 3WHTB 1Q80A 2KAVA 3BX9A 4OHSA 5G08A 1OOIX 2NXQA 4H3LA 5AEQA 2PSRA 1J1EA 3SS4A 4GESB 1DGUA 3I5IC 4PE0A 2M8UA 3CZTX 2Y1MA 1S36A 3EVVA 3WHUB 2Q6PA 1QX7A 1JC0A 4JF9A 1EG3A 2BECA 1OXEA 1N65A 2AUCA 2RGIA 2ZRSA 3DVKA 1W7SA 1BT6A 1K93D 1QJTA 4CFRA 2GV5A 4W6FA 3ICBA 2WHUA 2QLEA 1XFUO 3ADFA 1PSRA 5DPJA 1PVBA 3R1VA 4GGNA 3AI4A 4W77A 3RWAA 1XFWO 1JFKA 3JTDC 1B4CA 1EJ3A 3O2PA 4DXQA 4IK3A 3GK4X 2AAOA 2A48A 2H6VA 2G6YA 3V2LA 1B9CA 3DQKA 4OQWA 1WDCB 1ALWA 1QYOA 3VROA 1R2UA 2Y4QA 1MXEA 2SASA 2WC6A 5DKQA 1JC2A 1NX0A 3CLNA 4UTSA 3TUYC 2O24A 4CLNA 2G5ZB 2IE2A 3EK7A 5HKYA 4W74A 2ZMUA 1OXFA 3VHTB 4ZCVA 3CR5X 1TNWA 1LA3A 2HJOA 4NDBA 4DKMA 2A54B 2QLHA 1EMGA 4ORBB 4YBHB 4I2YA 4XJKA 1BF5A 1TN4A 4NWSA 4GOBA 3AKAA 3WCKA 1LXFC 2Q57A 1KFUS 1IIOA 2DD7A 3NXAA 4IZNA 1RK9A 1FBVA 4DUQA 2DDCA 1DGVA 3I5GB 4U2VA 1YZWA 3W1CA 2L0PA 1OOJA 2JT0A 2JXLA 4QJ5B 1K8UA 2YDZA 2MLEC 2BKHB 2H61C 4LJBA 1W9ZA 2L98A 2MA2A 1GJYA 1Y1XA 1WLMA 3ZWHA 5KSZA 5FYXA 2AWMA 4KAGA 1KK7Z 1QVIZ 1F0BA 3DQAA 4OZDA 3U0LA 1KFXS 1JF2A 5DRFA 1QATA 4W6RA 1JUOA 1CV7A 3VGOA 1VRKA 3BUOB 1B8CA 2I7AA 1V1GA 3OGOA 4W6SA 3CD1A 2L51A 4R1EA 2VADA 3VICA 2AHAA 4H3NA 4LJCA 3SG4A 2KPHA 2QLGB 2DUFA 4YGCB 3G9AA 1S3PA 1WDCC 3NSOA 1BLQA 1KWOB 1NSHA 3E3RA 2O29A 1SL7A 1QASA 2YFPA 3BOWB 2KFFA 1NYAA 1F09A 4W76A 1OOFA 4N3DA 2ZN8A 5EB6A 2D8NA 1AJ5A 1W7TA 3B87A 1LA0A 1QXPA 1WRKA 2IOVA 3S0EA 1B47A 2PQLA 3NHTA 4MLWA 1RMMA 1A4PA 1T14A 2OS8B 2QZ0A 3NEDA 2A52B 4GGFA 3SIBA 1OZSA 2LMVA 1DJGA 4YRUA 4YGBB 3EVRA 4AS8A 2A46A 1L7ZA 3DYEA 2CBLA 2K7CA 2FL1A 1L2OC 2ERBA 3E5VA 1QIWA 2PYQA 2KQYA 2LANA 1CMFA 1QYQA 4Z4MA 2QEVA 4AQIA 3GL4A 3BUMB 5EB7A 1DVIA 1WLZA 1CLMA 1GM0A 3SG5A 2BAPA 5LTQA 2KAYA 4KF5C 1JC1A 4P2YB 3SSHA 3SVEA 1TRFA 1RMPA 5AXIA 1K90D 3DQ3A 1GGWA 4J88A 1KQVA 3JVTB 2VZXA 3M22A 1KK7Y 1QVIY 5KTYA 2L4HA 1Z1PA 3L4AA 2QACA 2HQKA 1NCZA 5DICA 3P8UA 1QTXA 1UUSA 1BR4B 2H9WA 3CYZA 4USLA 2VRGA 3NHIA 2BTJA 3BUNB 2BCBA 3M0WA 2M7NA 3PATA 1CDMA 4PHJA 2K2AA 2FCDA 4CPVA 3O77A 1EMAA 1UP5A 4PHMA 3FE6A 1BU3A 2M29A 3IQOA 3U8PA 4DXIA 5CPVA 3OSQA 4W6AA 4PHKA 1U5IB 1BODA 3ST0A 1EXRA 1JWDA 3BXCA 1ALVA 4W6NA 4GPLB 3R72A 3LVDA 1NX3A 3GEXA 3E5TA 1FI5A 2JTTA 1ZFSA 1TUJA 5DTXA 4KA9A 3SRYA 2WHTA 2HGYA 4Q9WA 1PSBA 2OTGB 3DQ9A 1EH2A 3CD9A 5PALA 2QPTA 1OSAA 2Q4UA 1A29A 3SVBA 3I5FB 2OS8C 1K95A 2SCPA 2O2BA 2K8MB 1B1GA 1YX7A 1F54A 5CSNA 3SVCA 3B7AA 4MRXA 3NSLA 2LMTA 2WISA 2LV7A 2QDIA 1QV0A 2KNEA 1YUUA 2A56B 3GB3A 3SS3A 3E5WA 1E8AA 2KHNA 4DXOA 3I5HC 3KPXA 2CT9A 3NT3A 2BCAA 1J7QA 5BPJA 4Q9XA 3CZ1A 1LINA 1F55A 5HKWA 2EGDA 1XYDA 3TS5C 4AQJA 3SS0A 2QRFA 4LJDC 4PE4A 5EHUA 3CBEA 5HGEA 2VAEA 4L9MA 4YGEB 4IK5A 1AK8A 3SG3A 1DT7B 3LVAA 2HQWA 4MBEA 1DC1A 3DQ5A 2P4MA 2NZ0A 1QX2A 2DUIA 1YJFA 1F71A 2V53A 3O78A 4A4CA 4OR9B 4XL5A 4P76A 1S6CA 2WIQA 1NWDA 2ZMWA 4CFQA 3L4LA 3VK1A 2KI6D 4B5YA 1K96A 3SG2A 4PPKA 1RM9A 1HQVA 1K9UA 2IB5A 3NSKA 2G16B 4KPIA 1OE9B 2GGMA 3CR2A 1MQ1A 1C07A 1KYRA 1FI6A 4PPJA 2M97A 3H1RA 1D1OA 4ANJA 1CLBA 1U5IA 4ZIOA 4IK8A 4INWA 4W7EA 2AWKA 2KI4B 3GK1A 3DQOA 3V3DA 1C3YA 4GFTA 4QJ3B 2R2IA 1M39A 2OKWA 4H48A 4JFGA 4W6MA 4W6IA 1H4UA 2DD9A 2V4EB 3NF0A 2WCHA 4C0JA 4EN1A 2HRSA 3BXKA 4W6JA 3S0FA 2KFGA 3LA1A 3OX5A 3UNWA 1H8BA 3UFZA 2LUCA 3KEVA 5FI2A 5HW9A 1XQMA 1YVLA 3CTNA 5TNCA 2KYFA 3OB1B 3ST4A 1J7RA 1QWVA 1OMVA 2Q91A 1Q4CA 3NEZA 3A8SA 2BL0B 5D7FA 3PJ7A 2KAXA 4XJKB 2PASA 1ZUXA 2C9JA 5ER4X 4INXA 5DKNA 1NP8A 4ZINA 2ZNDA 4M2OA 3Q8IA 1CDNA 2JOJA 4HRGA 3MGFA 1TWOA 3SV5A 2LVKA 5B8IB 4PE7A 4EDSA 1NCYA 1MYWA 4I5LB 4W6GA 3MSEB 5J2OA 3OB2B 1QXTA 2K7OA 2GGZA 3LVCA 2E6WA 4W6CA 4W72A 3IVTA 1CNPA 3CFFA 3HCMA 4AR7A 4W6PA 1CFFA 5AERA 3TDIA 3TDZA 5FVGA 2BKIB 2MRDA 1CM4A 2O60A 3DQMA 4JC2A 4N5XA 4OVNF 4WRIA 4F0ZB 1GQMA 2L5XB 3KHEA 5GQQC 2LLSA 2EC6B 3DPZA 2V4EA 1QIVA 4DS7A 4YGDB 1GL4A 3N7HA 4MSPA 1YRUB 1ODBA 3PLFB 4NQGA 4D1EA 1CTRA 3D76A 4LQUA 2M9GA 4A4BA 4ZB1A 2AMIA 4KW4A 3SVRA 2B3PA 1RRXA 4JQ0D 5IBWA 1EMKA 2JTZA 4ICBA 2MHHA 5EXCI 3H4SE 3SG7A 3LK1A 2KGBC 1TNXA 2G2BA 4R6DA 1JF0A 4Q04A 5EXUA 2Y0GA 3CZ2A 5K89A 2JWWA 1XMZA 3D73A 1K9PA 2KBIA 3PM8A 1SBJA 4KF4A 1X02A 5J3XA 1EMCA 2WOSA 3IQQA 1XFRA 4MRYA 4DKNA 3DQIA 1NIWA 1C7WA 5EXBA 4E68A 2PRUA 2P71A 1EG4A 2WC5A 1YFPA 1SYMA 2B1UA 1DJXA 1RMOA 2QU1A 4L12A 5FVIA 1V1FA 3A8RA 1TNQA 4XOWA 4OCIA 2ZFDA 1QS7A 3S0BA 2H5RA 1IGVA 4OJ0A 3ST3A 3EVPA 4ZF3A 1IJ6A 2K2FA 4W75A 1OXDA 4I5JA 3BUWB 2EC6C 1XK4C 3VRPA 3CB9A 4W7XA 3DQHA 4ZCUA 3NT9A 2IB6A 2WURA 5BTTA 3S0DA 2OKYA 1UHNA 4FQTA 3SSPA 2ZRTA 5HLOA 5HL1A 1HT9A 2M3WA 2EMOA 2LHIA 4KGFA 2JT3A 1KCYA 5I2LA 2H5OA 2I18A 1NPQA 4ZBLA 1S6JA 3BYAA 2KLEA 2G6EA 3TMTA 4W6OA 3TMRA 5DPGA 2HETA 2F8PA 2KFHA 3SS5A 3OGNA 3DF0B 1H4BA 2WNDA 2WCJA 4W6UA 3AAJA 3HX4A 3WXAA 4BY5A 1MOVA 3LSAA 3UG0A 2DOQA 1XAEA 3BXAA 4DCKA 3SIAA 2K60A 4IK9A 3VRNA 1Q4EA 4RTCA 4HQCA 1PRWA 3I5GC 5KTGA 5H88A 1QX5B 1CB1A 2K0JA 5HBDA 4W73A 3CR4X 3PJBA 2IS9A 5BQLA 5EL2A 1A75B 1J7PA 4EDOA 2GW3A 3BXBA 1SCVA 1LKJA 3M24A 5H87A 4RYWA 4LW5A 4ZFSA 4PT1A 5F9GA 2CXJA 5I2OA 1LS8A 2GX2A 2A47A 1GGXA 1NCXA 2Z6ZA 1OW4A 1KQMB 2MAZA 2LUXA 2JU0A 1QV1A 1BOCA 1G4YR 2LMUA 1YRTB 1QY3A 1Y1UA 4NDCA 4F7FA 2M1KB 5FHVA 3DQLA 4HQ9A 1KWOC 1BFPA 3LK0A 1M46A 2ZO6A 1XFXO 1YR5A 1AHRA 2CCMA 4ZF5A 3I19A 1MWNA 2A50B 3VB1A 4JD9A 4M2QA 1MXLC 1SW8A 3GK2A 4LQTA 4W7CA 4XYNA 2EMNA 1WRLA 3OBVA 3CABA 1M31A 2C9IA 3DF0A 5DPHA 2H2KA 4DIRA 5CSFA 4J8AA 4EULA 1K2HA 3LS3A 1MOUA 1CFPA 1AVSA 4IJ7A 5I2QA 2PALA 4TZAA 3U0KA 3CDNA 2K61A 1RJVA 2JT8A 1NUBA 1TTXA 4XOVA 3DQDA 2L5YA 1LVCD 3LL8B 1DELA 3GJ2A 3ZULA 1CFDA 2LNKA 1IG5A 2YE1A 5CSJA 1CDPA 4J89A 1YHHA 1A75A 4N1FA 3GOFA 1CM1A 3JVTC 1TUZA 2ARLA 1YUSA 5LTPA 3KF9A 1MR8A 2BCXA 4JEOA 2WCFA 1J55A 1YURA 3OX6A 1UISA 4LJDA 3DVMA 1ZGOA 2VVHA 3PN7B 1QYFA 1MF8B 4HE4A 4B30A 1CMGA 1KP5A 1Q4DA 2JPOA 2YGUA 2PVBA 2BBMA 1Q4BA 1BG1A 1TCOB 2HCGA 4W6HA 4AOMA 2QEOA 5HZSA 3D0YA 2OGRA 3FIAA 1SCMB 1R6PA 1CKKA 4HRHA 3L47A 3BFBA 2OTBA 2WSNA 2F2OA 4KGEA 1JBZA 4MVFA 2L50A 2WCLA 2CTNA 2OTGC 2LCPA 3B88A 1GGZA 4BDUA 3FWCA 3D10A 5HZOA 1SNLA 5LK4A 3I5FC 5DPIA 1YHIA 1XO5A 4C0LA 2PXSA 3GJ1A 3WLDA 1RFJA 4DXNA 4HREE 3D77A 2F3ZA 1A2XA 1XFYO 3NSIA 2HPWA 2DDDA 3SVDA 3JTDB 4JRBA 1SPYA 2WSOA 1DJZA 3BQ3A 2GW4B 3AI5A 1F4QA 3CGAA 1DJWA 1RROA 3K21A 3PSRA 3D74A 1HCJA 4MEWA 1J7OA 2LM5A 4R6BA 2K7DA 2VVIA 2MLFC 3DQ7A 1FPWA 1S5GZ 5D69A 2Z1OA 2EHBA 2JZIA 1IWQA 4EMQA 2Z6XA 1YUTA 2H8QA 2VVJA 1EL4A 2JNXA 3RLZA 2JQ6A 1W7UA 1IKUA 1OZOA 1XSSA 1KFUL 3U0MA 4GUKA 1HUYA 2G9BA 3TZ1A 3NGVA 2DUEA 3FWBA 4ORAB 5F6TA 1JSAA 2HPSA 3ED8A 3IR8A 4MN0A 1TNPA 1SCMC 3DZTA 2L2CA 3BUXB 3KO0A 3D75A 2JC2A 4IK4A 3R1OA 3K1KA 3ZNIA 2KI4C 1IQ3A 4TNCA 3DQEA 3LLEA 5DTYA 3DVJA 3S0GA 3SSYA 1XVJA 1KFXL 3WLCA 4ZF4A 2GTEA 1Q73A 2V4EC 3RM1A 3OHMB 5DQBA 2ZN9A 3EVUA 1JBYA 4JGEA 3DPWA 5BTTB 1K94A 1SY9A 1N2DA 3CZ0A 4OV2A 1TIZA 1FF1A 4P1QA 5HZUA 3BFHA 2OTEA 1SL9A 4PFEA 4NDDA 1M63B 2AWJA 1S26D 2G3OA 1NX2A 1QLKA 4Q7UA 1A03A 2HF5A 4PDZA 5I94A 4Q7TA 4ORCB 2OPOA 1UHKA 1TOPA 3U8AA 3DQ6A 4GF6B 4W7FA 1IQ5A 2BL0C 3FS7A 2KBMA 4H3MA 4YI9A 4L13A 5DKRA 4CIDA 3DQUA 2O5GA 1S5GY 2L2EA 1W7JB 2K7BA 3KCTA 1PK0D 2LLUA 2H5QA 3BFAA 3SVOA 3A4UB 3PIBA 4W6LA 1SL8A 5DRGA 2A4JA 4QJ4B 2M1UA 4KW8A 1OMRA 4ORNA 3D78A 3S0AA 4FTGA 1WRZA 1S6ZA 2KLDA 4XVPA 5ER5A 1F70A 3SSTA 1ZUZA 1L2OB 1TCFA 5AQBB 2JXCA 2BNXA 3DQFA 4P5OE 3DQNA 2B3QA 1G33A 1C3ZA 4PCWA 4OGSA 2G6XA 3EK8A 2WORA 1XA5A 1S1EA 2LVJA 1EMBA 2KYCA 2ZNEA 3O4YA 3EKJA 4FQOA 5DU0A 2FOTA 1B8LA 1DMOA 2H61A 2LC5A 2CNPA 3FE8A 3DPXA 1Z4HA 4PHNA 3EK4A 2ICRA 2L4IA 2H8VA 5DY6A 1P28A 4H47A 1SK6D 2ISDA 1SRAA 1Z1QA 3ST2A 4M2PA 1JFJA 3O4XA 3LF3A 5DQMA 3ZUJA 3ZUFA 3PM2A 5D3OA 4I5KA 2TN4A 1XK4A 2QEBA 1IJ5A 3K1EA 2Y1NA 3SVNA 1ZGPA 4Q7RA 4W6DA 4TZGA 2OJKA 4GNKB 1ORGA 5AFPA 4GGFC 2AH8A 4W69A 3EKHA 4RYSA 1H6RA 1QLSA 3BJHA 1F4OA 1KYSA 4KEXA 1YX8A 4W6KA 1S6IA 1BR1B 4GBAA 2E30A 5HKZA 2AWLA 3CWGA 3DY9A 2LVIA 3VHTA 3DQ1A 1Y1AA 3SJSA 2KI6C 2WCKA 2PMYA 4W6TA 1M45A 3PJIA 1RWYA 5I8NA 3VRRA 1XA9A 4HSZA 1IRJA 1K9KA 1SR6B 1B8RA 4C0KA 1BMOA 2WCEA 1EMLA 1KK8B 1AP4A 1XFVO 4GAOA 2A53B 1YJ2A 3I5HB 1KSOA 4BY4A 2KGRA 2JULA 5CSIA 2MBXA 3EG5B 3TS5B 3B86A 3QMEA 1DF0B 2GX0A 1UHHA 1ZOTB 2FJUB 1PULA 1DTLA 4KF5A 2FJYA 1Q4AA 1YTZC 2P6BB 4B30B 2H5PA 1OOGA 1B9AA 1C4FA 1ZACA 5LTRA 3RWTA 5DTZA 1MHOA 2HFCA 3PJ5A 3D0YB 3IF7A 4ETOA 2WCMA 2DUGA 2KQ6A 1Y0VH 3WNXB 4JKTA 4HVFA 4IK1A 3W1DA 1IH0A 5T3IA 3QRXA 4OY4A 2QLGA 2G2SB 1UURA 4IL1A 3OSRA 3BOWA 5AANA 4DXMA 1DJHA 3VRQA 1B7TZ 4DRWA 2WHSA 3DQ8A 1XFZO 5FI7A 3F45A 5HLVA 1W7IB 1G8IA 5BT0A 2QEHA 1PVAA 2LHLA 3S05A 4PE1A 4WQ3A 1CDLA 4OKHA 2DUHA 5HYDA 3DQCA 4PPLA 2ZO7A 2M0RA 2BE6A 1DEKA 2JNFA 1Z2CB 2LP2A 2NCPA 1OMDA 4U8DA 1SR6C 3UO9A 3ZTFA 3U0NA 1EMFA 2YE0A 2M49B 4W7RA 3SSLA 1Y6WA 2FCEA 2HQZA 1KK8C 2KDHA 2P70A 1G7KA 3SG6A 1OOHA 2LVVA 3SSVA 2NLNA 2BBNA 1BJFA 3U8CA 1OQPA 2JPTA 5JJGA 1UHIA 3SSKA 1KQMC 5EBJA 2FWQA 1DF0A 3IP2A 2F3YA 1PALA 4UPGA 2MJWB 3DXLA 3AKBA 2Y5IA 1GFLA 3P28A 1UWOA 2WCBA 1SSEB 2F33A 1N0YA 3LF4B 1WY9A 2RH7A 3KCSA 2KOTA 2LAPA 3I5IB 3DQJA 4XGYA 2LLTA 4L1IA 5KU1A 3SVSA 4KYNA 1FW4A 3O6BA 3RZSA 2HGDA 3OP0A 3CFHA 3C1VA 4JWQA 3SVUA 3CS1A 2F2PA 3PALA 1KYPA 2JRFA 4W6BA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 5FI6A 3DQ2A 3CFAA 1MUXA 1C7VA 4YGAA 2FZUA 4MZKA 4MZLA 4KW9A 1ZGQA 2G3DB 2COLB 4MZJA 1RECA 1ZMZA 1DJIA 3B6XA 4I5NB 5FVFA 2LE9B 1AJ4A 1YHGA 1CLLA 3H1OA 1SKTA 1YVHA 3CGLA 1DJYA 1RTP1 1UHJA 2PXWA 2EMDA 4Z4KA 1J1DA 1EMMA 5JOLA 2QT2A 2LP3A 3FE9A 2I94A 4W7AA 3LCPC 2POXA 3DVEA 3TUYB 1DQEA 4JPZB 4YI8A 4WQ2A 1KSMA 3TDUA 4W7DA 1NX1A 1CFCA 4DXPA 2ZKMX 5EJUA 3DQ4A 1F8HA 3AKOA 4N1GA 3PFVA 2QLIA 3DD4A 1JBAA 5DTLA 5HZTA 2Z6YA 3R1PA
chains in the Genus database with same CATH topology
2JADA 1AUIB 4HQ8A 3PN7C 2BE4A 1EMEA 2HQ8A 2WC8A 2KSPA 2NCOA 5H89A 3WHTB 1Q80A 2KAVA 3BX9A 4OHSA 5G08A 2NXQA 4H3LA 5AEQA 2PSRA 1J1EA 4GESB 1DGUA 3I5IC 4PE0A 2M8UA 3CZTX 2Y1MA 1S36A 3EVVA 3WHUB 2Q6PA 1QX7A 1JC0A 4JF9A 1EG3A 2BECA 1OXEA 1N65A 2AUCA 2RGIA 2ZRSA 3DVKA 1W7SA 1BT6A 1K93D 1QJTA 4CFRA 2GV5A 4W6FA 3ICBA 2WHUA 2QLEA 1XFUO 3ADFA 1PSRA 5DPJA 1PVBA 4GGNA 3AI4A 4W77A 3RWAA 1XFWO 1JFKA 3JTDC 1B4CA 1EJ3A 3O2PA 4DXQA 4IK3A 3GK4X 2AAOA 2A48A 2G6YA 2H6VA 1B9CA 3DQKA 4OQWA 1WDCB 1ALWA 1QYOA 3VROA 1R2UA 2Y4QA 1MXEA 2SASA 5DKQA 1JC2A 1NX0A 3CLNA 4UTSA 3TUYC 2O24A 4CLNA 2G5ZB 2IE2A 3EK7A 5HKYA 4W74A 2ZMUA 1OXFA 3VHTB 4ZCVA 3CR5X 1TNWA 1LA3A 2HJOA 4NDBA 4DKMA 2A54B 2QLHA 1EMGA 4ORBB 4YBHB 4I2YA 4XJKA 1BF5A 1TN4A 4NWSA 4GOBA 3AKAA 3WCKA 1LXFC 2Q57A 1KFUS 2DD7A 3NXAA 4IZNA 1RK9A 1FBVA 4DUQA 2DDCA 1DGVA 3I5GB 4U2VA 1YZWA 3W1CA 2L0PA 1OOJA 2JT0A 2JXLA 4QJ5B 1K8UA 2YDZA 2MLEC 2BKHB 2H61C 4LJBA 2L98A 2MA2A 1GJYA 1Y1XA 1WLMA 3ZWHA 5KSZA 5FYXA 2AWMA 4KAGA 1KK7Z 1QVIZ 1F0BA 3DQAA 3U0LA 1KFXS 1JF2A 5DRFA 1QATA 4W6RA 1JUOA 1CV7A 3VGOA 1VRKA 3BUOB 1B8CA 2I7AA 1V1GA 3OGOA 4W6SA 3CD1A 2L51A 4R1EA 2VADA 3VICA 2AHAA 4H3NA 4LJCA 3SG4A 2QLGB 2DUFA 4YGCB 3G9AA 1S3PA 1WDCC 3NSOA 1BLQA 1KWOB 1NSHA 3E3RA 2O29A 1SL7A 1QASA 2YFPA 3BOWB 2KFFA 1NYAA 1F09A 4W76A 4N3DA 2ZN8A 5EB6A 2D8NA 1AJ5A 1W7TA 1LA0A 1QXPA 1WRKA 2IOVA 1B47A 4MLWA 1RMMA 1A4PA 2OS8B 2QZ0A 3NEDA 2A52B 4GGFA 3SIBA 1OZSA 2LMVA 1DJGA 4YRUA 4YGBB 3EVRA 4AS8A 2A46A 1L7ZA 2CBLA 2K7CA 2FL1A 1L2OC 3E5VA 1QIWA 2KQYA 2LANA 1CMFA 1QYQA 4Z4MA 4AQIA 3GL4A 3BUMB 5EB7A 1DVIA 1WLZA 1CLMA 3SG5A 5LTQA 2KAYA 4KF5C 1JC1A 4P2YB 3SSHA 3SVEA 1TRFA 1RMPA 5AXIA 1K90D 3DQ3A 1GGWA 4J88A 1KQVA 3JVTB 2VZXA 3M22A 1KK7Y 1QVIY 5KTYA 2L4HA 1Z1PA 2QACA 2HQKA 1NCZA 3P8UA 1QTXA 1UUSA 1BR4B 2H9WA 2VRGA 4USLA 2BTJA 3BUNB 2BCBA 3M0WA 2M7NA 3PATA 1CDMA 4PHJA 2K2AA 2FCDA 4CPVA 3O77A 1EMAA 1UP5A 4PHMA 1BU3A 2M29A 3IQOA 3U8PA 4DXIA 5CPVA 3OSQA 4W6AA 4PHKA 1U5IB 1BODA 3ST0A 1EXRA 1JWDA 3BXCA 1ALVA 4W6NA 4GPLB 3LVDA 1NX3A 3GEXA 3E5TA 1FI5A 2JTTA 1ZFSA 5DTXA 4KA9A 3SRYA 2WHTA 2HGYA 4Q9WA 1PSBA 2OTGB 3DQ9A 1EH2A 3CD9A 5PALA 2QPTA 1OSAA 2Q4UA 1A29A 3SVBA 3I5FB 2OS8C 1K95A 2SCPA 2O2BA 2K8MB 1B1GA 1YX7A 1F54A 5CSNA 3SVCA 4MRXA 3NSLA 2LMTA 2WISA 2LV7A 1QV0A 2KNEA 1YUUA 2A56B 3GB3A 3E5WA 1E8AA 2KHNA 4DXOA 3I5HC 3KPXA 2CT9A 3NT3A 2BCAA 1J7QA 5BPJA 4Q9XA 1LINA 1F55A 5HKWA 2EGDA 1XYDA 3TS5C 4AQJA 3SS0A 2QRFA 4LJDC 4PE4A 5EHUA 3CBEA 5HGEA 2VAEA 4L9MA 4YGEB 4IK5A 1AK8A 3SG3A 1DT7B 3LVAA 2HQWA 4MBEA 3DQ5A 2P4MA 2NZ0A 1QX2A 2DUIA 1YJFA 1F71A 2V53A 3O78A 4A4CA 4OR9B 4XL5A 4P76A 1S6CA 2WIQA 1NWDA 2ZMWA 4CFQA 3VK1A 2KI6D 4B5YA 1K96A 3SG2A 4PPKA 1RM9A 1HQVA 1K9UA 2IB5A 3NSKA 2G16B 4KPIA 1OE9B 2GGMA 3CR2A 1MQ1A 1C07A 1KYRA 1FI6A 4PPJA 2M97A 3H1RA 1D1OA 4ANJA 1CLBA 1U5IA 4ZIOA 4IK8A 4W7EA 2AWKA 2KI4B 3GK1A 3DQOA 3V3DA 4GFTA 4QJ3B 2R2IA 1M39A 2OKWA 4H48A 4JFGA 4W6MA 4W6IA 1H4UA 2DD9A 3NF0A 2V4EB 4C0JA 4EN1A 2HRSA 3BXKA 4W6JA 3LA1A 2KFGA 3OX5A 1H8BA 3UFZA 2LUCA 3KEVA 5HW9A 1XQMA 1YVLA 3CTNA 5TNCA 2KYFA 3OB1B 3ST4A 1J7RA 1OMVA 2Q91A 1Q4CA 3NEZA 3A8SA 2BL0B 5D7FA 3PJ7A 2KAXA 4XJKB 2PASA 1ZUXA 2C9JA 5ER4X 5DKNA 1NP8A 4ZINA 2ZNDA 4M2OA 1CDNA 2JOJA 4HRGA 3MGFA 3SV5A 2LVKA 5B8IB 4PE7A 4EDSA 1NCYA 1MYWA 4I5LB 4W6GA 3MSEB 5J2OA 3OB2B 1QXTA 2K7OA 2GGZA 3LVCA 2E6WA 4W6CA 4W72A 1CNPA 3CFFA 3HCMA 4AR7A 4W6PA 1CFFA 5AERA 3TDIA 3TDZA 5FVGA 2BKIB 2MRDA 1CM4A 2O60A 3DQMA 4JC2A 4N5XA 4OVNF 4WRIA 4F0ZB 1GQMA 2L5XB 3KHEA 5GQQC 2LLSA 2EC6B 3DPZA 2V4EA 1QIVA 4DS7A 4YGDB 1GL4A 4MSPA 1YRUB 1ODBA 3PLFB 4NQGA 4D1EA 1CTRA 4LQUA 2M9GA 4A4BA 4ZB1A 2AMIA 4KW4A 3SVRA 2B3PA 1RRXA 4JQ0D 5IBWA 1EMKA 2JTZA 4ICBA 2MHHA 5EXCI 3H4SE 3SG7A 3LK1A 2KGBC 1TNXA 2G2BA 4R6DA 1JF0A 4Q04A 5EXUA 2Y0GA 5K89A 2JWWA 1XMZA 1K9PA 2KBIA 3PM8A 1SBJA 4KF4A 1X02A 5J3XA 1EMCA 2WOSA 3IQQA 4MRYA 4DKNA 3DQIA 1NIWA 1C7WA 5EXBA 4E68A 2PRUA 1EG4A 1YFPA 1SYMA 2B1UA 1DJXA 1RMOA 2QU1A 4L12A 5FVIA 1V1FA 3A8RA 1TNQA 4XOWA 4OCIA 2ZFDA 1QS7A 2H5RA 1IGVA 4OJ0A 3ST3A 3EVPA 4ZF3A 1IJ6A 2K2FA 4W75A 1OXDA 4I5JA 3BUWB 2EC6C 1XK4C 3VRPA 3CB9A 4W7XA 3DQHA 4ZCUA 3NT9A 2IB6A 2WURA 5BTTA 2OKYA 1UHNA 3SSPA 2ZRTA 5HLOA 1HT9A 2M3WA 2EMOA 2LHIA 4KGFA 2JT3A 1KCYA 5I2LA 2H5OA 2I18A 1NPQA 4ZBLA 1S6JA 3BYAA 2G6EA 3TMTA 4W6OA 3TMRA 5DPGA 2HETA 2F8PA 2KFHA 3DF0B 1H4BA 2WNDA 4W6UA 3AAJA 3HX4A 3WXAA 4BY5A 1MOVA 3LSAA 3UG0A 2DOQA 1XAEA 3BXAA 4DCKA 3SIAA 4IK9A 3VRNA 1Q4EA 4RTCA 4HQCA 1PRWA 3I5GC 5KTGA 5H88A 1QX5B 1CB1A 2K0JA 5HBDA 4W73A 3CR4X 3PJBA 2IS9A 5BQLA 1A75B 1J7PA 4EDOA 2GW3A 3BXBA 1SCVA 1LKJA 3M24A 5H87A 4RYWA 4LW5A 4ZFSA 5F9GA 2CXJA 5I2OA 2GX2A 2A47A 1GGXA 1NCXA 2Z6ZA 1KQMB 2MAZA 2LUXA 2JU0A 1QV1A 1BOCA 1G4YR 2LMUA 1YRTB 1QY3A 1Y1UA 4NDCA 2M1KB 5FHVA 3DQLA 4HQ9A 1KWOC 1BFPA 3LK0A 1M46A 2ZO6A 1XFXO 1YR5A 1AHRA 2CCMA 4ZF5A 3I19A 1MWNA 2A50B 4M2QA 1MXLC 1SW8A 3GK2A 4LQTA 4W7CA 4XYNA 2EMNA 1WRLA 1M31A 2C9IA 3DF0A 5DPHA 2H2KA 4DIRA 5CSFA 4J8AA 4EULA 1K2HA 3LS3A 1MOUA 1CFPA 1AVSA 5I2QA 2PALA 4TZAA 3U0KA 2K61A 1RJVA 2JT8A 1NUBA 1TTXA 4XOVA 3DQDA 1LVCD 3LL8B 3GJ2A 3ZULA 1CFDA 2LNKA 1IG5A 2YE1A 5CSJA 1CDPA 4J89A 1YHHA 1A75A 4N1FA 3GOFA 1CM1A 3JVTC 2ARLA 1YUSA 5LTPA 3KF9A 1MR8A 2BCXA 4JEOA 2WCFA 1J55A 1YURA 3OX6A 1UISA 4LJDA 3DVMA 1ZGOA 2VVHA 3PN7B 1QYFA 1MF8B 4HE4A 4B30A 1CMGA 1KP5A 1Q4DA 2PVBA 2BBMA 1Q4BA 1BG1A 1TCOB 2HCGA 4W6HA 4AOMA 5HZSA 3D0YA 2OGRA 3FIAA 1SCMB 1R6PA 1CKKA 4HRHA 2OTBA 2WSNA 2F2OA 4KGEA 1JBZA 4MVFA 2L50A 2CTNA 2OTGC 2LCPA 1GGZA 4BDUA 3FWCA 3D10A 5HZOA 1SNLA 5LK4A 3I5FC 5DPIA 1YHIA 1XO5A 4C0LA 2PXSA 3GJ1A 3WLDA 1RFJA 4DXNA 4HREE 2F3ZA 1A2XA 1XFYO 3NSIA 2HPWA 2DDDA 3SVDA 3JTDB 4JRBA 1SPYA 2WSOA 1DJZA 3BQ3A 2GW4B 3AI5A 1F4QA 3CGAA 1DJWA 1RROA 3K21A 3PSRA 1HCJA 4MEWA 1J7OA 2LM5A 4R6BA 2K7DA 2VVIA 2MLFC 3DQ7A 1FPWA 1S5GZ 5D69A 2Z1OA 2EHBA 2JZIA 1IWQA 4EMQA 2Z6XA 1YUTA 2H8QA 2VVJA 1EL4A 2JNXA 3RLZA 2JQ6A 1W7UA 1IKUA 1OZOA 1XSSA 1KFUL 3U0MA 4GUKA 1HUYA 2G9BA 3TZ1A 2DUEA 3FWBA 4ORAB 5F6TA 1JSAA 2HPSA 3ED8A 3IR8A 4MN0A 1TNPA 1SCMC 3BUXB 3KO0A 2JC2A 4IK4A 3K1KA 3ZNIA 2KI4C 1IQ3A 4TNCA 3DQEA 3LLEA 5DTYA 3DVJA 3SSYA 1XVJA 1KFXL 3WLCA 4ZF4A 1Q73A 2V4EC 3RM1A 3OHMB 5DQBA 2ZN9A 3EVUA 1JBYA 4JGEA 3DPWA 5BTTB 1K94A 1SY9A 1N2DA 4OV2A 1TIZA 1FF1A 4P1QA 5HZUA 4PFEA 2OTEA 1SL9A 4NDDA 1M63B 2AWJA 1S26D 2G3OA 1NX2A 1QLKA 4Q7UA 1A03A 4Q7TA 2HF5A 4PDZA 4ORCB 2OPOA 1UHKA 1TOPA 3U8AA 3DQ6A 4GF6B 4W7FA 1IQ5A 2BL0C 3FS7A 2KBMA 4H3MA 4YI9A 4L13A 5DKRA 4CIDA 3DQUA 2O5GA 1S5GY 2L2EA 1W7JB 2K7BA 3KCTA 1PK0D 2LLUA 2H5QA 3SVOA 3A4UB 3PIBA 4W6LA 1SL8A 5DRGA 2A4JA 4QJ4B 2M1UA 4KW8A 1OMRA 4ORNA 4FTGA 1WRZA 1S6ZA 4XVPA 5ER5A 1F70A 3SSTA 1ZUZA 1L2OB 1TCFA 5AQBB 2JXCA 3DQFA 4P5OE 3DQNA 2B3QA 1G33A 4PCWA 4OGSA 2G6XA 3EK8A 2WORA 1XA5A 1S1EA 2LVJA 1EMBA 2KYCA 2ZNEA 3O4YA 3EKJA 4FQOA 5DU0A 2FOTA 1B8LA 1DMOA 2H61A 2LC5A 2CNPA 3DPXA 4PHNA 3EK4A 2ICRA 2L4IA 5DY6A 4H47A 1SK6D 2ISDA 1SRAA 1Z1QA 3ST2A 4M2PA 1JFJA 3LF3A 5DQMA 3ZUJA 3ZUFA 4I5KA 2TN4A 1XK4A 1IJ5A 2Y1NA 3SVNA 1ZGPA 4Q7RA 4W6DA 4TZGA 2OJKA 4GNKB 5AFPA 4GGFC 2AH8A 4W69A 3EKHA 4RYSA 1H6RA 1QLSA 1F4OA 1KYSA 4KEXA 1YX8A 4W6KA 1S6IA 1BR1B 4GBAA 2E30A 5HKZA 2AWLA 3CWGA 3VHTA 2LVIA 3DQ1A 1Y1AA 3SJSA 2KI6C 2PMYA 4W6TA 1M45A 1RWYA 5I8NA 3VRRA 1XA9A 4HSZA 1IRJA 1K9KA 1SR6B 1B8RA 4C0KA 1BMOA 2WCEA 1EMLA 1KK8B 1AP4A 1XFVO 4GAOA 2A53B 1YJ2A 3I5HB 1KSOA 4BY4A 2KGRA 2JULA 5CSIA 2MBXA 3TS5B 1DF0B 2GX0A 1UHHA 1ZOTB 2FJUB 1PULA 1DTLA 4KF5A 1Q4AA 1YTZC 2P6BB 4B30B 2H5PA 1B9AA 1C4FA 1ZACA 5LTRA 3RWTA 5DTZA 1MHOA 2HFCA 3PJ5A 3D0YB 3IF7A 4ETOA 2DUGA 2KQ6A 1Y0VH 3WNXB 4HVFA 4IK1A 3W1DA 1IH0A 5T3IA 3QRXA 4OY4A 2QLGA 2G2SB 1UURA 4IL1A 3OSRA 3BOWA 5AANA 4DXMA 1DJHA 3VRQA 1B7TZ 4DRWA 2WHSA 3DQ8A 1XFZO 3F45A 5HLVA 1W7IB 1G8IA 5BT0A 1PVAA 2LHLA 3S05A 4PE1A 4WQ3A 1CDLA 4OKHA 2DUHA 5HYDA 3DQCA 4PPLA 2ZO7A 2M0RA 2BE6A 2JNFA 2LP2A 2NCPA 1OMDA 4U8DA 1SR6C 3ZTFA 3U0NA 1EMFA 2YE0A 2M49B 4W7RA 3SSLA 1Y6WA 2FCEA 2HQZA 1KK8C 2KDHA 1G7KA 3SG6A 2LVVA 3SSVA 2NLNA 2BBNA 1BJFA 3U8CA 1OQPA 2JPTA 5JJGA 1UHIA 3SSKA 1KQMC 5EBJA 2FWQA 1DF0A 3IP2A 2F3YA 1PALA 4UPGA 2MJWB 3AKBA 2Y5IA 1GFLA 3P28A 1UWOA 2WCBA 2F33A 1N0YA 3LF4B 1WY9A 2RH7A 3KCSA 2KOTA 2LAPA 3I5IB 3DQJA 4XGYA 2LLTA 4L1IA 5KU1A 3SVSA 1FW4A 3O6BA 2HGDA 3OP0A 3CFHA 3C1VA 4JWQA 3SVUA 3CS1A 2F2PA 3PALA 1KYPA 2JRFA 4W6BA 2M7LA 3AAKA 4PALA 1SMGA 2I2RE 1B7TY 3DQ2A 3CFAA 1MUXA 1C7VA 4YGAA 2FZUA 4MZKA 4MZLA 4KW9A 1ZGQA 2G3DB 2COLB 4MZJA 1RECA 1ZMZA 1DJIA 4I5NB 5FVFA 2LE9B 1AJ4A 1YHGA 1CLLA 3H1OA 1SKTA 1YVHA 3CGLA 1DJYA 1RTP1 1UHJA 2PXWA 2EMDA 4Z4KA 1J1DA 1EMMA 5JOLA 2QT2A 2LP3A 2I94A 4W7AA 3LCPC 2POXA 3DVEA 3TUYB 4YI8A 4JPZB 4WQ2A 1KSMA 3TDUA 4W7DA 1NX1A 1CFCA 4DXPA 2ZKMX 5EJUA 3DQ4A 1F8HA 3AKOA 4N1GA 3PFVA 2QLIA 3DD4A 1JBAA 5DTLA 5HZTA 2Z6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAD A;  1AUI B;  4HQ8 A;  3PN7 C;  2BE4 A;  1EME A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  5H89 A;  3WHT B;  1Q80 A;  2KAV A;  3BX9 A;  4OHS A;  5G08 A;  2NXQ A;  4H3L A;  5AEQ A;  2PSR A;  1J1E A;  4GES B;  1DGU A;  3I5I C;  4PE0 A;  2M8U A;  3CZT X;  2Y1M A;  1S36 A;  3EVV A;  3WHU B;  2Q6P A;  1QX7 A;  1JC0 A;  4JF9 A;  1EG3 A;  2BEC A;  1OXE A;  1N65 A;  2AUC A;  2RGI A;  2ZRS A;  3DVK A;  1W7S A;  1BT6 A;  1K93 D;  1QJT A;  4CFR A;  2GV5 A;  4W6F A;  3ICB A;  2WHU A;  2QLE A;  1XFU O;  3ADF A;  1PSR A;  5DPJ A;  1PVB A;  4GGN A;  3AI4 A;  4W77 A;  3RWA A;  1XFW O;  1JFK A;  3JTD C;  1B4C A;  1EJ3 A;  3O2P A;  4DXQ A;  4IK3 A;  3GK4 X;  2AAO A;  2A48 A;  2G6Y A;  2H6V A;  1B9C A;  3DQK A;  4OQW A;  1WDC B;  1ALW A;  1QYO A;  3VRO A;  1R2U A;  2Y4Q A;  1MXE A;  2SAS A;  5DKQ A;  1JC2 A;  1NX0 A;  3CLN A;  4UTS A;  3TUY C;  2O24 A;  4CLN A;  2G5Z B;  2IE2 A;  3EK7 A;  5HKY A;  4W74 A;  2ZMU A;  1OXF A;  3VHT B;  4ZCV A;  3CR5 X;  1TNW A;  1LA3 A;  2HJO A;  4NDB A;  4DKM A;  2A54 B;  2QLH A;  1EMG A;  4ORB B;  4YBH B;  4I2Y A;  4XJK A;  1BF5 A;  1TN4 A;  4NWS A;  4GOB A;  3AKA A;  3WCK A;  1LXF C;  2Q57 A;  1KFU S;  2DD7 A;  3NXA A;  4IZN A;  1RK9 A;  1FBV A;  4DUQ A;  2DDC A;  1DGV A;  3I5G B;  4U2V A;  1YZW A;  3W1C A;  2L0P A;  1OOJ A;  2JT0 A;  2JXL A;  4QJ5 B;  1K8U A;  2YDZ A;  2MLE C;  2BKH B;  2H61 C;  4LJB A;  2L98 A;  2MA2 A;  1GJY A;  1Y1X A;  1WLM A;  3ZWH A;  5KSZ A;  5FYX A;  2AWM A;  4KAG A;  1KK7 Z;  1QVI Z;  1F0B A;  3DQA A;  3U0L A;  1KFX S;  1JF2 A;  5DRF A;  1QAT A;  4W6R A;  1JUO A;  1CV7 A;  3VGO A;  1VRK A;  3BUO B;  1B8C A;  2I7A A;  1V1G A;  3OGO A;  4W6S A;  3CD1 A;  2L51 A;  4R1E A;  2VAD A;  3VIC A;  2AHA A;  4H3N A;  4LJC A;  3SG4 A;  2QLG B;  2DUF A;  4YGC B;  3G9A A;  1S3P A;  1WDC C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  3E3R A;  2O29 A;  1SL7 A;  1QAS A;  2YFP A;  3BOW B;  2KFF A;  1NYA A;  1F09 A;  4W76 A;  4N3D A;  2ZN8 A;  5EB6 A;  2D8N A;  1AJ5 A;  1W7T A;  1LA0 A;  1QXP A;  1WRK A;  2IOV A;  1B47 A;  4MLW A;  1RMM A;  1A4P A;  2OS8 B;  2QZ0 A;  3NED A;  2A52 B;  4GGF A;  3SIB A;  1OZS A;  2LMV A;  1DJG A;  4YRU A;  4YGB B;  3EVR A;  4AS8 A;  2A46 A;  1L7Z A;  2CBL A;  2K7C A;  2FL1 A;  1L2O C;  3E5V A;  1QIW A;  2KQY A;  2LAN A;  1CMF A;  1QYQ A;  4Z4M A;  4AQI A;  3GL4 A;  3BUM B;  5EB7 A;  1DVI A;  1WLZ A;  1CLM A;  3SG5 A;  5LTQ A;  2KAY A;  4KF5 C;  1JC1 A;  4P2Y B;  3SSH A;  3SVE A;  1TRF A;  1RMP A;  5AXI A;  1K90 D;  3DQ3 A;  1GGW A;  4J88 A;  1KQV A;  3JVT B;  2VZX A;  3M22 A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  1Z1P A;  2QAC A;  2HQK A;  1NCZ A;  3P8U A;  1QTX A;  1UUS A;  1BR4 B;  2H9W A;  2VRG A;  4USL A;  2BTJ A;  3BUN B;  2BCB A;  3M0W A;  2M7N A;  3PAT A;  1CDM A;  4PHJ A;  2K2A A;  2FCD A;  4CPV A;  3O77 A;  1EMA A;  1UP5 A;  4PHM A;  1BU3 A;  2M29 A;  3IQO A;  3U8P A;  4DXI A;  5CPV A;  3OSQ A;  4W6A A;  4PHK A;  1U5I B;  1BOD A;  3ST0 A;  1EXR A;  1JWD A;  3BXC A;  1ALV A;  4W6N A;  4GPL B;  3LVD A;  1NX3 A;  3GEX A;  3E5T A;  1FI5 A;  2JTT A;  1ZFS A;  5DTX A;  4KA9 A;  3SRY A;  2WHT A;  2HGY A;  4Q9W A;  1PSB A;  2OTG B;  3DQ9 A;  1EH2 A;  3CD9 A;  5PAL A;  2QPT A;  1OSA A;  2Q4U A;  1A29 A;  3SVB A;  3I5F B;  2OS8 C;  1K95 A;  2SCP A;  2O2B A;  2K8M B;  1B1G A;  1YX7 A;  1F54 A;  5CSN A;  3SVC A;  4MRX A;  3NSL A;  2LMT A;  2WIS A;  2LV7 A;  1QV0 A;  2KNE A;  1YUU A;  2A56 B;  3GB3 A;  3E5W A;  1E8A A;  2KHN A;  4DXO A;  3I5H C;  3KPX A;  2CT9 A;  3NT3 A;  2BCA A;  1J7Q A;  5BPJ A;  4Q9X A;  1LIN A;  1F55 A;  5HKW A;  2EGD A;  1XYD A;  3TS5 C;  4AQJ A;  3SS0 A;  2QRF A;  4LJD C;  4PE4 A;  5EHU A;  3CBE A;  5HGE A;  2VAE A;  4L9M A;  4YGE B;  4IK5 A;  1AK8 A;  3SG3 A;  1DT7 B;  3LVA A;  2HQW A;  4MBE A;  3DQ5 A;  2P4M A;  2NZ0 A;  1QX2 A;  2DUI A;  1YJF A;  1F71 A;  2V53 A;  3O78 A;  4A4C A;  4OR9 B;  4XL5 A;  4P76 A;  1S6C A;  2WIQ A;  1NWD A;  2ZMW A;  4CFQ A;  3VK1 A;  2KI6 D;  4B5Y A;  1K96 A;  3SG2 A;  4PPK A;  1RM9 A;  1HQV A;  1K9U A;  2IB5 A;  3NSK A;  2G16 B;  4KPI A;  1OE9 B;  2GGM A;  3CR2 A;  1MQ1 A;  1C07 A;  1KYR A;  1FI6 A;  4PPJ A;  2M97 A;  3H1R A;  1D1O A;  4ANJ A;  1CLB A;  1U5I A;  4ZIO A;  4IK8 A;  4W7E A;  2AWK A;  2KI4 B;  3GK1 A;  3DQO A;  3V3D A;  4GFT A;  4QJ3 B;  2R2I A;  1M39 A;  2OKW A;  4H48 A;  4JFG A;  4W6M A;  4W6I A;  1H4U A;  2DD9 A;  3NF0 A;  2V4E B;  4C0J A;  4EN1 A;  2HRS A;  3BXK A;  4W6J A;  3LA1 A;  2KFG A;  3OX5 A;  1H8B A;  3UFZ A;  2LUC A;  3KEV A;  5HW9 A;  1XQM A;  1YVL A;  3CTN A;  5TNC A;  2KYF A;  3OB1 B;  3ST4 A;  1J7R A;  1OMV A;  2Q91 A;  1Q4C A;  3NEZ A;  3A8S A;  2BL0 B;  5D7F A;  3PJ7 A;  2KAX A;  4XJK B;  2PAS A;  1ZUX A;  2C9J A;  5ER4 X;  5DKN A;  1NP8 A;  4ZIN A;  2ZND A;  4M2O A;  1CDN A;  2JOJ A;  4HRG A;  3MGF A;  3SV5 A;  2LVK A;  5B8I B;  4PE7 A;  4EDS A;  1NCY A;  1MYW A;  4I5L B;  4W6G A;  3MSE B;  5J2O A;  3OB2 B;  1QXT A;  2K7O A;  2GGZ A;  3LVC A;  2E6W A;  4W6C A;  4W72 A;  1CNP A;  3CFF A;  3HCM A;  4AR7 A;  4W6P A;  1CFF A;  5AER A;  3TDI A;  3TDZ A;  5FVG A;  2BKI B;  2MRD A;  1CM4 A;  2O60 A;  3DQM A;  4JC2 A;  4N5X A;  4OVN F;  4WRI A;  4F0Z B;  1GQM A;  2L5X B;  3KHE A;  5GQQ C;  2LLS A;  2EC6 B;  3DPZ A;  2V4E A;  1QIV A;  4DS7 A;  4YGD B;  1GL4 A;  4MSP A;  1YRU B;  1ODB A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  4LQU A;  2M9G A;  4A4B A;  4ZB1 A;  2AMI A;  4KW4 A;  3SVR A;  2B3P A;  1RRX A;  4JQ0 D;  5IBW A;  1EMK A;  2JTZ A;  4ICB A;  2MHH A;  5EXC I;  3H4S E;  3SG7 A;  3LK1 A;  2KGB C;  1TNX A;  2G2B A;  4R6D A;  1JF0 A;  4Q04 A;  5EXU A;  2Y0G A;  5K89 A;  2JWW A;  1XMZ A;  1K9P A;  2KBI A;  3PM8 A;  1SBJ A;  4KF4 A;  1X02 A;  5J3X A;  1EMC A;  2WOS A;  3IQQ A;  4MRY A;  4DKN A;  3DQI A;  1NIW A;  1C7W A;  5EXB A;  4E68 A;  2PRU A;  1EG4 A;  1YFP A;  1SYM A;  2B1U A;  1DJX A;  1RMO A;  2QU1 A;  4L12 A;  5FVI A;  1V1F A;  3A8R A;  1TNQ A;  4XOW A;  4OCI A;  2ZFD A;  1QS7 A;  2H5R A;  1IGV A;  4OJ0 A;  3ST3 A;  3EVP A;  4ZF3 A;  1IJ6 A;  2K2F A;  4W75 A;  1OXD A;  4I5J A;  3BUW B;  2EC6 C;  1XK4 C;  3VRP A;  3CB9 A;  4W7X A;  3DQH A;  4ZCU A;  3NT9 A;  2IB6 A;  2WUR A;  5BTT A;  2OKY A;  1UHN A;  3SSP A;  2ZRT A;  5HLO A;  1HT9 A;  2M3W A;  2EMO A;  2LHI A;  4KGF A;  2JT3 A;  1KCY A;  5I2L A;  2H5O A;  2I18 A;  1NPQ A;  4ZBL A;  1S6J A;  3BYA A;  2G6E A;  3TMT A;  4W6O A;  3TMR A;  5DPG A;  2HET A;  2F8P A;  2KFH A;  3DF0 B;  1H4B A;  2WND A;  4W6U A;  3AAJ A;  3HX4 A;  3WXA A;  4BY5 A;  1MOV A;  3LSA A;  3UG0 A;  2DOQ A;  1XAE A;  3BXA A;  4DCK A;  3SIA A;  4IK9 A;  3VRN A;  1Q4E A;  4RTC A;  4HQC A;  1PRW A;  3I5G C;  5KTG A;  5H88 A;  1QX5 B;  1CB1 A;  2K0J A;  5HBD A;  4W73 A;  3CR4 X;  3PJB A;  2IS9 A;  5BQL A;  1A75 B;  1J7P A;  4EDO A;  2GW3 A;  3BXB A;  1SCV A;  1LKJ A;  3M24 A;  5H87 A;  4RYW A;  4LW5 A;  4ZFS A;  5F9G A;  2CXJ A;  5I2O A;  2GX2 A;  2A47 A;  1GGX A;  1NCX A;  2Z6Z A;  1KQM B;  2MAZ A;  2LUX A;  2JU0 A;  1QV1 A;  1BOC A;  1G4Y R;  2LMU A;  1YRT B;  1QY3 A;  1Y1U A;  4NDC A;  2M1K B;  5FHV A;  3DQL A;  4HQ9 A;  1KWO C;  1BFP A;  3LK0 A;  1M46 A;  2ZO6 A;  1XFX O;  1YR5 A;  1AHR A;  2CCM A;  4ZF5 A;  3I19 A;  1MWN A;  2A50 B;  4M2Q A;  1MXL C;  1SW8 A;  3GK2 A;  4LQT A;  4W7C A;  4XYN A;  2EMN A;  1WRL A;  1M31 A;  2C9I A;  3DF0 A;  5DPH A;  2H2K A;  4DIR A;  5CSF A;  4J8A A;  4EUL A;  1K2H A;  3LS3 A;  1MOU A;  1CFP A;  1AVS A;  5I2Q A;  2PAL A;  4TZA A;  3U0K A;  2K61 A;  1RJV A;  2JT8 A;  1NUB A;  1TTX A;  4XOV A;  3DQD A;  1LVC D;  3LL8 B;  3GJ2 A;  3ZUL A;  1CFD A;  2LNK A;  1IG5 A;  2YE1 A;  5CSJ A;  1CDP A;  4J89 A;  1YHH A;  1A75 A;  4N1F A;  3GOF A;  1CM1 A;  3JVT C;  2ARL A;  1YUS A;  5LTP A;  3KF9 A;  1MR8 A;  2BCX A;  4JEO A;  2WCF A;  1J55 A;  1YUR A;  3OX6 A;  1UIS A;  4LJD A;  3DVM A;  1ZGO A;  2VVH A;  3PN7 B;  1QYF A;  1MF8 B;  4HE4 A;  4B30 A;  1CMG A;  1KP5 A;  1Q4D A;  2PVB A;  2BBM A;  1Q4B A;  1BG1 A;  1TCO B;  2HCG A;  4W6H A;  4AOM A;  5HZS A;  3D0Y A;  2OGR A;  3FIA A;  1SCM B;  1R6P A;  1CKK A;  4HRH A;  2OTB A;  2WSN A;  2F2O A;  4KGE A;  1JBZ A;  4MVF A;  2L50 A;  2CTN A;  2OTG C;  2LCP A;  1GGZ A;  4BDU A;  3FWC A;  3D10 A;  5HZO A;  1SNL A;  5LK4 A;  3I5F C;  5DPI A;  1YHI A;  1XO5 A;  4C0L A;  2PXS A;  3GJ1 A;  3WLD A;  1RFJ A;  4DXN A;  4HRE E;  2F3Z A;  1A2X A;  1XFY O;  3NSI A;  2HPW A;  2DDD A;  3SVD A;  3JTD B;  4JRB A;  1SPY A;  2WSO A;  1DJZ A;  3BQ3 A;  2GW4 B;  3AI5 A;  1F4Q A;  3CGA A;  1DJW A;  1RRO A;  3K21 A;  3PSR A;  1HCJ A;  4MEW A;  1J7O A;  2LM5 A;  4R6B A;  2K7D A;  2VVI A;  2MLF C;  3DQ7 A;  1FPW A;  1S5G Z;  5D69 A;  2Z1O A;  2EHB A;  2JZI A;  1IWQ A;  4EMQ A;  2Z6X A;  1YUT A;  2H8Q A;  2VVJ A;  1EL4 A;  2JNX A;  3RLZ A;  2JQ6 A;  1W7U A;  1IKU A;  1OZO A;  1XSS A;  1KFU L;  3U0M A;  4GUK A;  1HUY A;  2G9B A;  3TZ1 A;  2DUE A;  3FWB A;  4ORA B;  5F6T A;  1JSA A;  2HPS A;  3ED8 A;  3IR8 A;  4MN0 A;  1TNP A;  1SCM C;  3BUX B;  3KO0 A;  2JC2 A;  4IK4 A;  3K1K A;  3ZNI A;  2KI4 C;  1IQ3 A;  4TNC A;  3DQE A;  3LLE A;  5DTY A;  3DVJ A;  3SSY A;  1XVJ A;  1KFX L;  3WLC A;  4ZF4 A;  1Q73 A;  2V4E C;  3RM1 A;  3OHM B;  5DQB A;  2ZN9 A;  3EVU A;  1JBY A;  4JGE A;  3DPW A;  5BTT B;  1K94 A;  1SY9 A;  1N2D A;  4OV2 A;  1TIZ A;  1FF1 A;  4P1Q A;  5HZU A;  4PFE A;  2OTE A;  1SL9 A;  4NDD A;  1M63 B;  2AWJ A;  1S26 D;  2G3O A;  1NX2 A;  1QLK A;  4Q7U A;  1A03 A;  4Q7T A;  2HF5 A;  4PDZ A;  4ORC B;  2OPO A;  1UHK A;  1TOP A;  3U8A A;  3DQ6 A;  4GF6 B;  4W7F A;  1IQ5 A;  2BL0 C;  3FS7 A;  2KBM A;  4H3M A;  4YI9 A;  4L13 A;  5DKR A;  4CID A;  3DQU A;  2O5G A;  1S5G Y;  2L2E A;  1W7J B;  2K7B A;  3KCT A;  1PK0 D;  2LLU A;  2H5Q A;  3SVO A;  3A4U B;  3PIB A;  4W6L A;  1SL8 A;  5DRG A;  2A4J A;  4QJ4 B;  2M1U A;  4KW8 A;  1OMR A;  4ORN A;  4FTG A;  1WRZ A;  1S6Z A;  4XVP A;  5ER5 A;  1F70 A;  3SST A;  1ZUZ A;  1L2O B;  1TCF A;  5AQB B;  2JXC A;  3DQF A;  4P5O E;  3DQN A;  2B3Q A;  1G33 A;  4PCW A;  4OGS A;  2G6X A;  3EK8 A;  2WOR A;  1XA5 A;  1S1E A;  2LVJ A;  1EMB A;  2KYC A;  2ZNE A;  3O4Y A;  3EKJ A;  4FQO A;  5DU0 A;  2FOT A;  1B8L A;  1DMO A;  2H61 A;  2LC5 A;  2CNP A;  3DPX A;  4PHN A;  3EK4 A;  2ICR A;  2L4I A;  5DY6 A;  4H47 A;  1SK6 D;  2ISD A;  1SRA A;  1Z1Q A;  3ST2 A;  4M2P A;  1JFJ A;  3LF3 A;  5DQM A;  3ZUJ A;  3ZUF A;  4I5K A;  2TN4 A;  1XK4 A;  1IJ5 A;  2Y1N A;  3SVN A;  1ZGP A;  4Q7R A;  4W6D A;  4TZG A;  2OJK A;  4GNK B;  5AFP A;  4GGF C;  2AH8 A;  4W69 A;  3EKH A;  4RYS A;  1H6R A;  1QLS A;  1F4O A;  1KYS A;  4KEX A;  1YX8 A;  4W6K A;  1S6I A;  1BR1 B;  4GBA A;  2E30 A;  5HKZ A;  2AWL A;  3CWG A;  3VHT A;  2LVI A;  3DQ1 A;  1Y1A A;  3SJS A;  2KI6 C;  2PMY A;  4W6T A;  1M45 A;  1RWY A;  5I8N A;  3VRR A;  1XA9 A;  4HSZ A;  1IRJ A;  1K9K A;  1SR6 B;  1B8R A;  4C0K A;  1BMO A;  2WCE A;  1EML A;  1KK8 B;  1AP4 A;  1XFV O;  4GAO A;  2A53 B;  1YJ2 A;  3I5H B;  1KSO A;  4BY4 A;  2KGR A;  2JUL A;  5CSI A;  2MBX A;  3TS5 B;  1DF0 B;  2GX0 A;  1UHH A;  1ZOT B;  2FJU B;  1PUL A;  1DTL A;  4KF5 A;  1Q4A A;  1YTZ C;  2P6B B;  4B30 B;  2H5P A;  1B9A A;  1C4F A;  1ZAC A;  5LTR A;  3RWT A;  5DTZ A;  1MHO A;  2HFC A;  3PJ5 A;  3D0Y B;  3IF7 A;  4ETO A;  2DUG A;  2KQ6 A;  1Y0V H;  3WNX B;  4HVF A;  4IK1 A;  3W1D A;  1IH0 A;  5T3I A;  3QRX A;  4OY4 A;  2QLG A;  2G2S B;  1UUR A;  4IL1 A;  3OSR A;  3BOW A;  5AAN A;  4DXM A;  1DJH A;  3VRQ A;  1B7T Z;  4DRW A;  2WHS A;  3DQ8 A;  1XFZ O;  3F45 A;  5HLV A;  1W7I B;  1G8I A;  5BT0 A;  1PVA A;  2LHL A;  3S05 A;  4PE1 A;  4WQ3 A;  1CDL A;  4OKH A;  2DUH A;  5HYD A;  3DQC A;  4PPL A;  2ZO7 A;  2M0R A;  2BE6 A;  2JNF A;  2LP2 A;  2NCP A;  1OMD A;  4U8D A;  1SR6 C;  3ZTF A;  3U0N A;  1EMF A;  2YE0 A;  2M49 B;  4W7R A;  3SSL A;  1Y6W A;  2FCE A;  2HQZ A;  1KK8 C;  2KDH A;  1G7K A;  3SG6 A;  2LVV A;  3SSV A;  2NLN A;  2BBN A;  1BJF A;  3U8C A;  1OQP A;  2JPT A;  5JJG A;  1UHI A;  3SSK A;  1KQM C;  5EBJ A;  2FWQ A;  1DF0 A;  3IP2 A;  2F3Y A;  1PAL A;  4UPG A;  2MJW B;  3AKB A;  2Y5I A;  1GFL A;  3P28 A;  1UWO A;  2WCB A;  2F33 A;  1N0Y A;  3LF4 B;  1WY9 A;  2RH7 A;  3KCS A;  2KOT A;  2LAP A;  3I5I B;  3DQJ A;  4XGY A;  2LLT A;  4L1I A;  5KU1 A;  3SVS A;  1FW4 A;  3O6B A;  2HGD A;  3OP0 A;  3CFH A;  3C1V A;  4JWQ A;  3SVU A;  3CS1 A;  2F2P A;  3PAL A;  1KYP A;  2JRF A;  4W6B A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  3DQ2 A;  3CFA A;  1MUX A;  1C7V A;  4YGA A;  2FZU A;  4MZK A;  4MZL A;  4KW9 A;  1ZGQ A;  2G3D B;  2COL B;  4MZJ A;  1REC A;  1ZMZ A;  1DJI A;  4I5N B;  5FVF A;  2LE9 B;  1AJ4 A;  1YHG A;  1CLL A;  3H1O A;  1SKT A;  1YVH A;  3CGL A;  1DJY A;  1RTP 1;  1UHJ A;  2PXW A;  2EMD A;  4Z4K A;  1J1D A;  1EMM A;  5JOL A;  2QT2 A;  2LP3 A;  2I94 A;  4W7A A;  3LCP C;  2POX A;  3DVE A;  3TUY B;  4YI8 A;  4JPZ B;  4WQ2 A;  1KSM A;  3TDU A;  4W7D A;  1NX1 A;  1CFC A;  4DXP A;  2ZKM X;  5EJU A;  3DQ4 A;  1F8H A;  3AKO A;  4N1G A;  3PFV A;  2QLI A;  3DD4 A;  1JBA A;  5DTL A;  5HZT A;  2Z6Y A; 
#chains in the Genus database with same CATH topology
 2JAD A;  1AUI B;  4HQ8 A;  3PN7 C;  2BE4 A;  1EME A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  5H89 A;  3WHT B;  1Q80 A;  2KAV A;  3BX9 A;  4OHS A;  5G08 A;  1OOI X;  2NXQ A;  4H3L A;  5AEQ A;  2PSR A;  1J1E A;  3SS4 A;  4GES B;  1DGU A;  3I5I C;  4PE0 A;  2M8U A;  3CZT X;  2Y1M A;  1S36 A;  3EVV A;  3WHU B;  2Q6P A;  1QX7 A;  1JC0 A;  4JF9 A;  1EG3 A;  2BEC A;  1OXE A;  1N65 A;  2AUC A;  2RGI A;  2ZRS A;  3DVK A;  1W7S A;  1BT6 A;  1K93 D;  1QJT A;  4CFR A;  2GV5 A;  4W6F A;  3ICB A;  2WHU A;  2QLE A;  1XFU O;  3ADF A;  1PSR A;  5DPJ A;  1PVB A;  3R1V A;  4GGN A;  3AI4 A;  4W77 A;  3RWA A;  1XFW O;  1JFK A;  3JTD C;  1B4C A;  1EJ3 A;  3O2P A;  4DXQ A;  4IK3 A;  3GK4 X;  2AAO A;  2A48 A;  2H6V A;  2G6Y A;  3V2L A;  1B9C A;  3DQK A;  4OQW A;  1WDC B;  1ALW A;  1QYO A;  3VRO A;  1R2U A;  2Y4Q A;  1MXE A;  2SAS A;  2WC6 A;  5DKQ A;  1JC2 A;  1NX0 A;  3CLN A;  4UTS A;  3TUY C;  2O24 A;  4CLN A;  2G5Z B;  2IE2 A;  3EK7 A;  5HKY A;  4W74 A;  2ZMU A;  1OXF A;  3VHT B;  4ZCV A;  3CR5 X;  1TNW A;  1LA3 A;  2HJO A;  4NDB A;  4DKM A;  2A54 B;  2QLH A;  1EMG A;  4ORB B;  4YBH B;  4I2Y A;  4XJK A;  1BF5 A;  1TN4 A;  4NWS A;  4GOB A;  3AKA A;  3WCK A;  1LXF C;  2Q57 A;  1KFU S;  1IIO A;  2DD7 A;  3NXA A;  4IZN A;  1RK9 A;  1FBV A;  4DUQ A;  2DDC A;  1DGV A;  3I5G B;  4U2V A;  1YZW A;  3W1C A;  2L0P A;  1OOJ A;  2JT0 A;  2JXL A;  4QJ5 B;  1K8U A;  2YDZ A;  2MLE C;  2BKH B;  2H61 C;  4LJB A;  1W9Z A;  2L98 A;  2MA2 A;  1GJY A;  1Y1X A;  1WLM A;  3ZWH A;  5KSZ A;  5FYX A;  2AWM A;  4KAG A;  1KK7 Z;  1QVI Z;  1F0B A;  3DQA A;  4OZD A;  3U0L A;  1KFX S;  1JF2 A;  5DRF A;  1QAT A;  4W6R A;  1JUO A;  1CV7 A;  3VGO A;  1VRK A;  3BUO B;  1B8C A;  2I7A A;  1V1G A;  3OGO A;  4W6S A;  3CD1 A;  2L51 A;  4R1E A;  2VAD A;  3VIC A;  2AHA A;  4H3N A;  4LJC A;  3SG4 A;  2KPH A;  2QLG B;  2DUF A;  4YGC B;  3G9A A;  1S3P A;  1WDC C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  3E3R A;  2O29 A;  1SL7 A;  1QAS A;  2YFP A;  3BOW B;  2KFF A;  1NYA A;  1F09 A;  4W76 A;  1OOF A;  4N3D A;  2ZN8 A;  5EB6 A;  2D8N A;  1AJ5 A;  1W7T A;  3B87 A;  1LA0 A;  1QXP A;  1WRK A;  2IOV A;  3S0E A;  1B47 A;  2PQL A;  3NHT A;  4MLW A;  1RMM A;  1A4P A;  1T14 A;  2OS8 B;  2QZ0 A;  3NED A;  2A52 B;  4GGF A;  3SIB A;  1OZS A;  2LMV A;  1DJG A;  4YRU A;  4YGB B;  3EVR A;  4AS8 A;  2A46 A;  1L7Z A;  3DYE A;  2CBL A;  2K7C A;  2FL1 A;  1L2O C;  2ERB A;  3E5V A;  1QIW A;  2PYQ A;  2KQY A;  2LAN A;  1CMF A;  1QYQ A;  4Z4M A;  2QEV A;  4AQI A;  3GL4 A;  3BUM B;  5EB7 A;  1DVI A;  1WLZ A;  1CLM A;  1GM0 A;  3SG5 A;  2BAP A;  5LTQ A;  2KAY A;  4KF5 C;  1JC1 A;  4P2Y B;  3SSH A;  3SVE A;  1TRF A;  1RMP A;  5AXI A;  1K90 D;  3DQ3 A;  1GGW A;  4J88 A;  1KQV A;  3JVT B;  2VZX A;  3M22 A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  1Z1P A;  3L4A A;  2QAC A;  2HQK A;  1NCZ A;  5DIC A;  3P8U A;  1QTX A;  1UUS A;  1BR4 B;  2H9W A;  3CYZ A;  4USL A;  2VRG A;  3NHI A;  2BTJ A;  3BUN B;  2BCB A;  3M0W A;  2M7N A;  3PAT A;  1CDM A;  4PHJ A;  2K2A A;  2FCD A;  4CPV A;  3O77 A;  1EMA A;  1UP5 A;  4PHM A;  3FE6 A;  1BU3 A;  2M29 A;  3IQO A;  3U8P A;  4DXI A;  5CPV A;  3OSQ A;  4W6A A;  4PHK A;  1U5I B;  1BOD A;  3ST0 A;  1EXR A;  1JWD A;  3BXC A;  1ALV A;  4W6N A;  4GPL B;  3R72 A;  3LVD A;  1NX3 A;  3GEX A;  3E5T A;  1FI5 A;  2JTT A;  1ZFS A;  1TUJ A;  5DTX A;  4KA9 A;  3SRY A;  2WHT A;  2HGY A;  4Q9W A;  1PSB A;  2OTG B;  3DQ9 A;  1EH2 A;  3CD9 A;  5PAL A;  2QPT A;  1OSA A;  2Q4U A;  1A29 A;  3SVB A;  3I5F B;  2OS8 C;  1K95 A;  2SCP A;  2O2B A;  2K8M B;  1B1G A;  1YX7 A;  1F54 A;  5CSN A;  3SVC A;  3B7A A;  4MRX A;  3NSL A;  2LMT A;  2WIS A;  2LV7 A;  2QDI A;  1QV0 A;  2KNE A;  1YUU A;  2A56 B;  3GB3 A;  3SS3 A;  3E5W A;  1E8A A;  2KHN A;  4DXO A;  3I5H C;  3KPX A;  2CT9 A;  3NT3 A;  2BCA A;  1J7Q A;  5BPJ A;  4Q9X A;  3CZ1 A;  1LIN A;  1F55 A;  5HKW A;  2EGD A;  1XYD A;  3TS5 C;  4AQJ A;  3SS0 A;  2QRF A;  4LJD C;  4PE4 A;  5EHU A;  3CBE A;  5HGE A;  2VAE A;  4L9M A;  4YGE B;  4IK5 A;  1AK8 A;  3SG3 A;  1DT7 B;  3LVA A;  2HQW A;  4MBE A;  1DC1 A;  3DQ5 A;  2P4M A;  2NZ0 A;  1QX2 A;  2DUI A;  1YJF A;  1F71 A;  2V53 A;  3O78 A;  4A4C A;  4OR9 B;  4XL5 A;  4P76 A;  1S6C A;  2WIQ A;  1NWD A;  2ZMW A;  4CFQ A;  3L4L A;  3VK1 A;  2KI6 D;  4B5Y A;  1K96 A;  3SG2 A;  4PPK A;  1RM9 A;  1HQV A;  1K9U A;  2IB5 A;  3NSK A;  2G16 B;  4KPI A;  1OE9 B;  2GGM A;  3CR2 A;  1MQ1 A;  1C07 A;  1KYR A;  1FI6 A;  4PPJ A;  2M97 A;  3H1R A;  1D1O A;  4ANJ A;  1CLB A;  1U5I A;  4ZIO A;  4IK8 A;  4INW A;  4W7E A;  2AWK A;  2KI4 B;  3GK1 A;  3DQO A;  3V3D A;  1C3Y A;  4GFT A;  4QJ3 B;  2R2I A;  1M39 A;  2OKW A;  4H48 A;  4JFG A;  4W6M A;  4W6I A;  1H4U A;  2DD9 A;  2V4E B;  3NF0 A;  2WCH A;  4C0J A;  4EN1 A;  2HRS A;  3BXK A;  4W6J A;  3S0F A;  2KFG A;  3LA1 A;  3OX5 A;  3UNW A;  1H8B A;  3UFZ A;  2LUC A;  3KEV A;  5FI2 A;  5HW9 A;  1XQM A;  1YVL A;  3CTN A;  5TNC A;  2KYF A;  3OB1 B;  3ST4 A;  1J7R A;  1QWV A;  1OMV A;  2Q91 A;  1Q4C A;  3NEZ A;  3A8S A;  2BL0 B;  5D7F A;  3PJ7 A;  2KAX A;  4XJK B;  2PAS A;  1ZUX A;  2C9J A;  5ER4 X;  4INX A;  5DKN A;  1NP8 A;  4ZIN A;  2ZND A;  4M2O A;  3Q8I A;  1CDN A;  2JOJ A;  4HRG A;  3MGF A;  1TWO A;  3SV5 A;  2LVK A;  5B8I B;  4PE7 A;  4EDS A;  1NCY A;  1MYW A;  4I5L B;  4W6G A;  3MSE B;  5J2O A;  3OB2 B;  1QXT A;  2K7O A;  2GGZ A;  3LVC A;  2E6W A;  4W6C A;  4W72 A;  3IVT A;  1CNP A;  3CFF A;  3HCM A;  4AR7 A;  4W6P A;  1CFF A;  5AER A;  3TDI A;  3TDZ A;  5FVG A;  2BKI B;  2MRD A;  1CM4 A;  2O60 A;  3DQM A;  4JC2 A;  4N5X A;  4OVN F;  4WRI A;  4F0Z B;  1GQM A;  2L5X B;  3KHE A;  5GQQ C;  2LLS A;  2EC6 B;  3DPZ A;  2V4E A;  1QIV A;  4DS7 A;  4YGD B;  1GL4 A;  3N7H A;  4MSP A;  1YRU B;  1ODB A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  3D76 A;  4LQU A;  2M9G A;  4A4B A;  4ZB1 A;  2AMI A;  4KW4 A;  3SVR A;  2B3P A;  1RRX A;  4JQ0 D;  5IBW A;  1EMK A;  2JTZ A;  4ICB A;  2MHH A;  5EXC I;  3H4S E;  3SG7 A;  3LK1 A;  2KGB C;  1TNX A;  2G2B A;  4R6D A;  1JF0 A;  4Q04 A;  5EXU A;  2Y0G A;  3CZ2 A;  5K89 A;  2JWW A;  1XMZ A;  3D73 A;  1K9P A;  2KBI A;  3PM8 A;  1SBJ A;  4KF4 A;  1X02 A;  5J3X A;  1EMC A;  2WOS A;  3IQQ A;  1XFR A;  4MRY A;  4DKN A;  3DQI A;  1NIW A;  1C7W A;  5EXB A;  4E68 A;  2PRU A;  2P71 A;  1EG4 A;  2WC5 A;  1YFP A;  1SYM A;  2B1U A;  1DJX A;  1RMO A;  2QU1 A;  4L12 A;  5FVI A;  1V1F A;  3A8R A;  1TNQ A;  4XOW A;  4OCI A;  2ZFD A;  1QS7 A;  3S0B A;  2H5R A;  1IGV A;  4OJ0 A;  3ST3 A;  3EVP A;  4ZF3 A;  1IJ6 A;  2K2F A;  4W75 A;  1OXD A;  4I5J A;  3BUW B;  2EC6 C;  1XK4 C;  3VRP A;  3CB9 A;  4W7X A;  3DQH A;  4ZCU A;  3NT9 A;  2IB6 A;  2WUR A;  5BTT A;  3S0D A;  2OKY A;  1UHN A;  4FQT A;  3SSP A;  2ZRT A;  5HLO A;  5HL1 A;  1HT9 A;  2M3W A;  2EMO A;  2LHI A;  4KGF A;  2JT3 A;  1KCY A;  5I2L A;  2H5O A;  2I18 A;  1NPQ A;  4ZBL A;  1S6J A;  3BYA A;  2KLE A;  2G6E A;  3TMT A;  4W6O A;  3TMR A;  5DPG A;  2HET A;  2F8P A;  2KFH A;  3SS5 A;  3OGN A;  3DF0 B;  1H4B A;  2WND A;  2WCJ A;  4W6U A;  3AAJ A;  3HX4 A;  3WXA A;  4BY5 A;  1MOV A;  3LSA A;  3UG0 A;  2DOQ A;  1XAE A;  3BXA A;  4DCK A;  3SIA A;  2K60 A;  4IK9 A;  3VRN A;  1Q4E A;  4RTC A;  4HQC A;  1PRW A;  3I5G C;  5KTG A;  5H88 A;  1QX5 B;  1CB1 A;  2K0J A;  5HBD A;  4W73 A;  3CR4 X;  3PJB A;  2IS9 A;  5BQL A;  5EL2 A;  1A75 B;  1J7P A;  4EDO A;  2GW3 A;  3BXB A;  1SCV A;  1LKJ A;  3M24 A;  5H87 A;  4RYW A;  4LW5 A;  4ZFS A;  4PT1 A;  5F9G A;  2CXJ A;  5I2O A;  1LS8 A;  2GX2 A;  2A47 A;  1GGX A;  1NCX A;  2Z6Z A;  1OW4 A;  1KQM B;  2MAZ A;  2LUX A;  2JU0 A;  1QV1 A;  1BOC A;  1G4Y R;  2LMU A;  1YRT B;  1QY3 A;  1Y1U A;  4NDC A;  4F7F A;  2M1K B;  5FHV A;  3DQL A;  4HQ9 A;  1KWO C;  1BFP A;  3LK0 A;  1M46 A;  2ZO6 A;  1XFX O;  1YR5 A;  1AHR A;  2CCM A;  4ZF5 A;  3I19 A;  1MWN A;  2A50 B;  3VB1 A;  4JD9 A;  4M2Q A;  1MXL C;  1SW8 A;  3GK2 A;  4LQT A;  4W7C A;  4XYN A;  2EMN A;  1WRL A;  3OBV A;  3CAB A;  1M31 A;  2C9I A;  3DF0 A;  5DPH A;  2H2K A;  4DIR A;  5CSF A;  4J8A A;  4EUL A;  1K2H A;  3LS3 A;  1MOU A;  1CFP A;  1AVS A;  4IJ7 A;  5I2Q A;  2PAL A;  4TZA A;  3U0K A;  3CDN A;  2K61 A;  1RJV A;  2JT8 A;  1NUB A;  1TTX A;  4XOV A;  3DQD A;  2L5Y A;  1LVC D;  3LL8 B;  1DEL A;  3GJ2 A;  3ZUL A;  1CFD A;  2LNK A;  1IG5 A;  2YE1 A;  5CSJ A;  1CDP A;  4J89 A;  1YHH A;  1A75 A;  4N1F A;  3GOF A;  1CM1 A;  3JVT C;  1TUZ A;  2ARL A;  1YUS A;  5LTP A;  3KF9 A;  1MR8 A;  2BCX A;  4JEO A;  2WCF A;  1J55 A;  1YUR A;  3OX6 A;  1UIS A;  4LJD A;  3DVM A;  1ZGO A;  2VVH A;  3PN7 B;  1QYF A;  1MF8 B;  4HE4 A;  4B30 A;  1CMG A;  1KP5 A;  1Q4D A;  2JPO A;  2YGU A;  2PVB A;  2BBM A;  1Q4B A;  1BG1 A;  1TCO B;  2HCG A;  4W6H A;  4AOM A;  2QEO A;  5HZS A;  3D0Y A;  2OGR A;  3FIA A;  1SCM B;  1R6P A;  1CKK A;  4HRH A;  3L47 A;  3BFB A;  2OTB A;  2WSN A;  2F2O A;  4KGE A;  1JBZ A;  4MVF A;  2L50 A;  2WCL A;  2CTN A;  2OTG C;  2LCP A;  3B88 A;  1GGZ A;  4BDU A;  3FWC A;  3D10 A;  5HZO A;  1SNL A;  5LK4 A;  3I5F C;  5DPI A;  1YHI A;  1XO5 A;  4C0L A;  2PXS A;  3GJ1 A;  3WLD A;  1RFJ A;  4DXN A;  4HRE E;  3D77 A;  2F3Z A;  1A2X A;  1XFY O;  3NSI A;  2HPW A;  2DDD A;  3SVD A;  3JTD B;  4JRB A;  1SPY A;  2WSO A;  1DJZ A;  3BQ3 A;  2GW4 B;  3AI5 A;  1F4Q A;  3CGA A;  1DJW A;  1RRO A;  3K21 A;  3PSR A;  3D74 A;  1HCJ A;  4MEW A;  1J7O A;  2LM5 A;  4R6B A;  2K7D A;  2VVI A;  2MLF C;  3DQ7 A;  1FPW A;  1S5G Z;  5D69 A;  2Z1O A;  2EHB A;  2JZI A;  1IWQ A;  4EMQ A;  2Z6X A;  1YUT A;  2H8Q A;  2VVJ A;  1EL4 A;  2JNX A;  3RLZ A;  2JQ6 A;  1W7U A;  1IKU A;  1OZO A;  1XSS A;  1KFU L;  3U0M A;  4GUK A;  1HUY A;  2G9B A;  3TZ1 A;  3NGV A;  2DUE A;  3FWB A;  4ORA B;  5F6T A;  1JSA A;  2HPS A;  3ED8 A;  3IR8 A;  4MN0 A;  1TNP A;  1SCM C;  3DZT A;  2L2C A;  3BUX B;  3KO0 A;  3D75 A;  2JC2 A;  4IK4 A;  3R1O A;  3K1K A;  3ZNI A;  2KI4 C;  1IQ3 A;  4TNC A;  3DQE A;  3LLE A;  5DTY A;  3DVJ A;  3S0G A;  3SSY A;  1XVJ A;  1KFX L;  3WLC A;  4ZF4 A;  2GTE A;  1Q73 A;  2V4E C;  3RM1 A;  3OHM B;  5DQB A;  2ZN9 A;  3EVU A;  1JBY A;  4JGE A;  3DPW A;  5BTT B;  1K94 A;  1SY9 A;  1N2D A;  3CZ0 A;  4OV2 A;  1TIZ A;  1FF1 A;  4P1Q A;  5HZU A;  3BFH A;  2OTE A;  1SL9 A;  4PFE A;  4NDD A;  1M63 B;  2AWJ A;  1S26 D;  2G3O A;  1NX2 A;  1QLK A;  4Q7U A;  1A03 A;  2HF5 A;  4PDZ A;  5I94 A;  4Q7T A;  4ORC B;  2OPO A;  1UHK A;  1TOP A;  3U8A A;  3DQ6 A;  4GF6 B;  4W7F A;  1IQ5 A;  2BL0 C;  3FS7 A;  2KBM A;  4H3M A;  4YI9 A;  4L13 A;  5DKR A;  4CID A;  3DQU A;  2O5G A;  1S5G Y;  2L2E A;  1W7J B;  2K7B A;  3KCT A;  1PK0 D;  2LLU A;  2H5Q A;  3BFA A;  3SVO A;  3A4U B;  3PIB A;  4W6L A;  1SL8 A;  5DRG A;  2A4J A;  4QJ4 B;  2M1U A;  4KW8 A;  1OMR A;  4ORN A;  3D78 A;  3S0A A;  4FTG A;  1WRZ A;  1S6Z A;  2KLD A;  4XVP A;  5ER5 A;  1F70 A;  3SST A;  1ZUZ A;  1L2O B;  1TCF A;  5AQB B;  2JXC A;  2BNX A;  3DQF A;  4P5O E;  3DQN A;  2B3Q A;  1G33 A;  1C3Z A;  4PCW A;  4OGS A;  2G6X A;  3EK8 A;  2WOR A;  1XA5 A;  1S1E A;  2LVJ A;  1EMB A;  2KYC A;  2ZNE A;  3O4Y A;  3EKJ A;  4FQO A;  5DU0 A;  2FOT A;  1B8L A;  1DMO A;  2H61 A;  2LC5 A;  2CNP A;  3FE8 A;  3DPX A;  1Z4H A;  4PHN A;  3EK4 A;  2ICR A;  2L4I A;  2H8V A;  5DY6 A;  1P28 A;  4H47 A;  1SK6 D;  2ISD A;  1SRA A;  1Z1Q A;  3ST2 A;  4M2P A;  1JFJ A;  3O4X A;  3LF3 A;  5DQM A;  3ZUJ A;  3ZUF A;  3PM2 A;  5D3O A;  4I5K A;  2TN4 A;  1XK4 A;  2QEB A;  1IJ5 A;  3K1E A;  2Y1N A;  3SVN A;  1ZGP A;  4Q7R A;  4W6D A;  4TZG A;  2OJK A;  4GNK B;  1ORG A;  5AFP A;  4GGF C;  2AH8 A;  4W69 A;  3EKH A;  4RYS A;  1H6R A;  1QLS A;  3BJH A;  1F4O A;  1KYS A;  4KEX A;  1YX8 A;  4W6K A;  1S6I A;  1BR1 B;  4GBA A;  2E30 A;  5HKZ A;  2AWL A;  3CWG A;  3DY9 A;  2LVI A;  3VHT A;  3DQ1 A;  1Y1A A;  3SJS A;  2KI6 C;  2WCK A;  2PMY A;  4W6T A;  1M45 A;  3PJI A;  1RWY A;  5I8N A;  3VRR A;  1XA9 A;  4HSZ A;  1IRJ A;  1K9K A;  1SR6 B;  1B8R A;  4C0K A;  1BMO A;  2WCE A;  1EML A;  1KK8 B;  1AP4 A;  1XFV O;  4GAO A;  2A53 B;  1YJ2 A;  3I5H B;  1KSO A;  4BY4 A;  2KGR A;  2JUL A;  5CSI A;  2MBX A;  3EG5 B;  3TS5 B;  3B86 A;  3QME A;  1DF0 B;  2GX0 A;  1UHH A;  1ZOT B;  2FJU B;  1PUL A;  1DTL A;  4KF5 A;  2FJY A;  1Q4A A;  1YTZ C;  2P6B B;  4B30 B;  2H5P A;  1OOG A;  1B9A A;  1C4F A;  1ZAC A;  5LTR A;  3RWT A;  5DTZ A;  1MHO A;  2HFC A;  3PJ5 A;  3D0Y B;  3IF7 A;  4ETO A;  2WCM A;  2DUG A;  2KQ6 A;  1Y0V H;  3WNX B;  4JKT A;  4HVF A;  4IK1 A;  3W1D A;  1IH0 A;  5T3I A;  3QRX A;  4OY4 A;  2QLG A;  2G2S B;  1UUR A;  4IL1 A;  3OSR A;  3BOW A;  5AAN A;  4DXM A;  1DJH A;  3VRQ A;  1B7T Z;  4DRW A;  2WHS A;  3DQ8 A;  1XFZ O;  5FI7 A;  3F45 A;  5HLV A;  1W7I B;  1G8I A;  5BT0 A;  2QEH A;  1PVA A;  2LHL A;  3S05 A;  4PE1 A;  4WQ3 A;  1CDL A;  4OKH A;  2DUH A;  5HYD A;  3DQC A;  4PPL A;  2ZO7 A;  2M0R A;  2BE6 A;  1DEK A;  2JNF A;  1Z2C B;  2LP2 A;  2NCP A;  1OMD A;  4U8D A;  1SR6 C;  3UO9 A;  3ZTF A;  3U0N A;  1EMF A;  2YE0 A;  2M49 B;  4W7R A;  3SSL A;  1Y6W A;  2FCE A;  2HQZ A;  1KK8 C;  2KDH A;  2P70 A;  1G7K A;  3SG6 A;  1OOH A;  2LVV A;  3SSV A;  2NLN A;  2BBN A;  1BJF A;  3U8C A;  1OQP A;  2JPT A;  5JJG A;  1UHI A;  3SSK A;  1KQM C;  5EBJ A;  2FWQ A;  1DF0 A;  3IP2 A;  2F3Y A;  1PAL A;  4UPG A;  2MJW B;  3DXL A;  3AKB A;  2Y5I A;  1GFL A;  3P28 A;  1UWO A;  2WCB A;  1SSE B;  2F33 A;  1N0Y A;  3LF4 B;  1WY9 A;  2RH7 A;  3KCS A;  2KOT A;  2LAP A;  3I5I B;  3DQJ A;  4XGY A;  2LLT A;  4L1I A;  5KU1 A;  3SVS A;  4KYN A;  1FW4 A;  3O6B A;  3RZS A;  2HGD A;  3OP0 A;  3CFH A;  3C1V A;  4JWQ A;  3SVU A;  3CS1 A;  2F2P A;  3PAL A;  1KYP A;  2JRF A;  4W6B A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  5FI6 A;  3DQ2 A;  3CFA A;  1MUX A;  1C7V A;  4YGA A;  2FZU A;  4MZK A;  4MZL A;  4KW9 A;  1ZGQ A;  2G3D B;  2COL B;  4MZJ A;  1REC A;  1ZMZ A;  1DJI A;  3B6X A;  4I5N B;  5FVF A;  2LE9 B;  1AJ4 A;  1YHG A;  1CLL A;  3H1O A;  1SKT A;  1YVH A;  3CGL A;  1DJY A;  1RTP 1;  1UHJ A;  2PXW A;  2EMD A;  4Z4K A;  1J1D A;  1EMM A;  5JOL A;  2QT2 A;  2LP3 A;  3FE9 A;  2I94 A;  4W7A A;  3LCP C;  2POX A;  3DVE A;  3TUY B;  1DQE A;  4JPZ B;  4YI8 A;  4WQ2 A;  1KSM A;  3TDU A;  4W7D A;  1NX1 A;  1CFC A;  4DXP A;  2ZKM X;  5EJU A;  3DQ4 A;  1F8H A;  3AKO A;  4N1G A;  3PFV A;  2QLI A;  3DD4 A;  1JBA A;  5DTL A;  5HZT A;  2Z6Y A;  3R1P A; 
#chains in the Genus database with same CATH homology
 2JAD A;  1AUI B;  4HQ8 A;  3PN7 C;  2BE4 A;  1EME A;  2HQ8 A;  2WC8 A;  2KSP A;  2NCO A;  5H89 A;  3WHT B;  1Q80 A;  2KAV A;  3BX9 A;  4OHS A;  5G08 A;  2NXQ A;  4H3L A;  5AEQ A;  2PSR A;  1J1E A;  4GES B;  1DGU A;  3I5I C;  4PE0 A;  2M8U A;  3CZT X;  2Y1M A;  1S36 A;  3EVV A;  3WHU B;  2Q6P A;  1QX7 A;  1JC0 A;  4JF9 A;  1EG3 A;  2BEC A;  1OXE A;  1N65 A;  2AUC A;  2RGI A;  2ZRS A;  3DVK A;  1W7S A;  1BT6 A;  1K93 D;  1QJT A;  4CFR A;  2GV5 A;  4W6F A;  3ICB A;  2WHU A;  2QLE A;  1XFU O;  3ADF A;  1PSR A;  5DPJ A;  1PVB A;  4GGN A;  3AI4 A;  4W77 A;  3RWA A;  1XFW O;  1JFK A;  3JTD C;  1B4C A;  1EJ3 A;  3O2P A;  4DXQ A;  4IK3 A;  3GK4 X;  2AAO A;  2A48 A;  2G6Y A;  2H6V A;  1B9C A;  3DQK A;  4OQW A;  1WDC B;  1ALW A;  1QYO A;  3VRO A;  1R2U A;  2Y4Q A;  1MXE A;  2SAS A;  5DKQ A;  1JC2 A;  1NX0 A;  3CLN A;  4UTS A;  3TUY C;  2O24 A;  4CLN A;  2G5Z B;  2IE2 A;  3EK7 A;  5HKY A;  4W74 A;  2ZMU A;  1OXF A;  3VHT B;  4ZCV A;  3CR5 X;  1TNW A;  1LA3 A;  2HJO A;  4NDB A;  4DKM A;  2A54 B;  2QLH A;  1EMG A;  4ORB B;  4YBH B;  4I2Y A;  4XJK A;  1BF5 A;  1TN4 A;  4NWS A;  4GOB A;  3AKA A;  3WCK A;  1LXF C;  2Q57 A;  1KFU S;  2DD7 A;  3NXA A;  4IZN A;  1RK9 A;  1FBV A;  4DUQ A;  2DDC A;  1DGV A;  3I5G B;  4U2V A;  1YZW A;  3W1C A;  2L0P A;  1OOJ A;  2JT0 A;  2JXL A;  4QJ5 B;  1K8U A;  2YDZ A;  2MLE C;  2BKH B;  2H61 C;  4LJB A;  2L98 A;  2MA2 A;  1GJY A;  1Y1X A;  1WLM A;  3ZWH A;  5KSZ A;  5FYX A;  2AWM A;  4KAG A;  1KK7 Z;  1QVI Z;  1F0B A;  3DQA A;  3U0L A;  1KFX S;  1JF2 A;  5DRF A;  1QAT A;  4W6R A;  1JUO A;  1CV7 A;  3VGO A;  1VRK A;  3BUO B;  1B8C A;  2I7A A;  1V1G A;  3OGO A;  4W6S A;  3CD1 A;  2L51 A;  4R1E A;  2VAD A;  3VIC A;  2AHA A;  4H3N A;  4LJC A;  3SG4 A;  2QLG B;  2DUF A;  4YGC B;  3G9A A;  1S3P A;  1WDC C;  3NSO A;  1BLQ A;  1KWO B;  1NSH A;  3E3R A;  2O29 A;  1SL7 A;  1QAS A;  2YFP A;  3BOW B;  2KFF A;  1NYA A;  1F09 A;  4W76 A;  4N3D A;  2ZN8 A;  5EB6 A;  2D8N A;  1AJ5 A;  1W7T A;  1LA0 A;  1QXP A;  1WRK A;  2IOV A;  1B47 A;  4MLW A;  1RMM A;  1A4P A;  2OS8 B;  2QZ0 A;  3NED A;  2A52 B;  4GGF A;  3SIB A;  1OZS A;  2LMV A;  1DJG A;  4YRU A;  4YGB B;  3EVR A;  4AS8 A;  2A46 A;  1L7Z A;  2CBL A;  2K7C A;  2FL1 A;  1L2O C;  3E5V A;  1QIW A;  2KQY A;  2LAN A;  1CMF A;  1QYQ A;  4Z4M A;  4AQI A;  3GL4 A;  3BUM B;  5EB7 A;  1DVI A;  1WLZ A;  1CLM A;  3SG5 A;  5LTQ A;  2KAY A;  4KF5 C;  1JC1 A;  4P2Y B;  3SSH A;  3SVE A;  1TRF A;  1RMP A;  5AXI A;  1K90 D;  3DQ3 A;  1GGW A;  4J88 A;  1KQV A;  3JVT B;  2VZX A;  3M22 A;  1KK7 Y;  1QVI Y;  5KTY A;  2L4H A;  1Z1P A;  2QAC A;  2HQK A;  1NCZ A;  3P8U A;  1QTX A;  1UUS A;  1BR4 B;  2H9W A;  2VRG A;  4USL A;  2BTJ A;  3BUN B;  2BCB A;  3M0W A;  2M7N A;  3PAT A;  1CDM A;  4PHJ A;  2K2A A;  2FCD A;  4CPV A;  3O77 A;  1EMA A;  1UP5 A;  4PHM A;  1BU3 A;  2M29 A;  3IQO A;  3U8P A;  4DXI A;  5CPV A;  3OSQ A;  4W6A A;  4PHK A;  1U5I B;  1BOD A;  3ST0 A;  1EXR A;  1JWD A;  3BXC A;  1ALV A;  4W6N A;  4GPL B;  3LVD A;  1NX3 A;  3GEX A;  3E5T A;  1FI5 A;  2JTT A;  1ZFS A;  5DTX A;  4KA9 A;  3SRY A;  2WHT A;  2HGY A;  4Q9W A;  1PSB A;  2OTG B;  3DQ9 A;  1EH2 A;  3CD9 A;  5PAL A;  2QPT A;  1OSA A;  2Q4U A;  1A29 A;  3SVB A;  3I5F B;  2OS8 C;  1K95 A;  2SCP A;  2O2B A;  2K8M B;  1B1G A;  1YX7 A;  1F54 A;  5CSN A;  3SVC A;  4MRX A;  3NSL A;  2LMT A;  2WIS A;  2LV7 A;  1QV0 A;  2KNE A;  1YUU A;  2A56 B;  3GB3 A;  3E5W A;  1E8A A;  2KHN A;  4DXO A;  3I5H C;  3KPX A;  2CT9 A;  3NT3 A;  2BCA A;  1J7Q A;  5BPJ A;  4Q9X A;  1LIN A;  1F55 A;  5HKW A;  2EGD A;  1XYD A;  3TS5 C;  4AQJ A;  3SS0 A;  2QRF A;  4LJD C;  4PE4 A;  5EHU A;  3CBE A;  5HGE A;  2VAE A;  4L9M A;  4YGE B;  4IK5 A;  1AK8 A;  3SG3 A;  1DT7 B;  3LVA A;  2HQW A;  4MBE A;  3DQ5 A;  2P4M A;  2NZ0 A;  1QX2 A;  2DUI A;  1YJF A;  1F71 A;  2V53 A;  3O78 A;  4A4C A;  4OR9 B;  4XL5 A;  4P76 A;  1S6C A;  2WIQ A;  1NWD A;  2ZMW A;  4CFQ A;  3VK1 A;  2KI6 D;  4B5Y A;  1K96 A;  3SG2 A;  4PPK A;  1RM9 A;  1HQV A;  1K9U A;  2IB5 A;  3NSK A;  2G16 B;  4KPI A;  1OE9 B;  2GGM A;  3CR2 A;  1MQ1 A;  1C07 A;  1KYR A;  1FI6 A;  4PPJ A;  2M97 A;  3H1R A;  1D1O A;  4ANJ A;  1CLB A;  1U5I A;  4ZIO A;  4IK8 A;  4W7E A;  2AWK A;  2KI4 B;  3GK1 A;  3DQO A;  3V3D A;  4GFT A;  4QJ3 B;  2R2I A;  1M39 A;  2OKW A;  4H48 A;  4JFG A;  4W6M A;  4W6I A;  1H4U A;  2DD9 A;  3NF0 A;  2V4E B;  4C0J A;  4EN1 A;  2HRS A;  3BXK A;  4W6J A;  3LA1 A;  2KFG A;  3OX5 A;  1H8B A;  3UFZ A;  2LUC A;  3KEV A;  5HW9 A;  1XQM A;  1YVL A;  3CTN A;  5TNC A;  2KYF A;  3OB1 B;  3ST4 A;  1J7R A;  1OMV A;  2Q91 A;  1Q4C A;  3NEZ A;  3A8S A;  2BL0 B;  5D7F A;  3PJ7 A;  2KAX A;  4XJK B;  2PAS A;  1ZUX A;  2C9J A;  5ER4 X;  5DKN A;  1NP8 A;  4ZIN A;  2ZND A;  4M2O A;  1CDN A;  2JOJ A;  4HRG A;  3MGF A;  3SV5 A;  2LVK A;  5B8I B;  4PE7 A;  4EDS A;  1NCY A;  1MYW A;  4I5L B;  4W6G A;  3MSE B;  5J2O A;  3OB2 B;  1QXT A;  2K7O A;  2GGZ A;  3LVC A;  2E6W A;  4W6C A;  4W72 A;  1CNP A;  3CFF A;  3HCM A;  4AR7 A;  4W6P A;  1CFF A;  5AER A;  3TDI A;  3TDZ A;  5FVG A;  2BKI B;  2MRD A;  1CM4 A;  2O60 A;  3DQM A;  4JC2 A;  4N5X A;  4OVN F;  4WRI A;  4F0Z B;  1GQM A;  2L5X B;  3KHE A;  5GQQ C;  2LLS A;  2EC6 B;  3DPZ A;  2V4E A;  1QIV A;  4DS7 A;  4YGD B;  1GL4 A;  4MSP A;  1YRU B;  1ODB A;  3PLF B;  4NQG A;  4D1E A;  1CTR A;  4LQU A;  2M9G A;  4A4B A;  4ZB1 A;  2AMI A;  4KW4 A;  3SVR A;  2B3P A;  1RRX A;  4JQ0 D;  5IBW A;  1EMK A;  2JTZ A;  4ICB A;  2MHH A;  5EXC I;  3H4S E;  3SG7 A;  3LK1 A;  2KGB C;  1TNX A;  2G2B A;  4R6D A;  1JF0 A;  4Q04 A;  5EXU A;  2Y0G A;  5K89 A;  2JWW A;  1XMZ A;  1K9P A;  2KBI A;  3PM8 A;  1SBJ A;  4KF4 A;  1X02 A;  5J3X A;  1EMC A;  2WOS A;  3IQQ A;  4MRY A;  4DKN A;  3DQI A;  1NIW A;  1C7W A;  5EXB A;  4E68 A;  2PRU A;  1EG4 A;  1YFP A;  1SYM A;  2B1U A;  1DJX A;  1RMO A;  2QU1 A;  4L12 A;  5FVI A;  1V1F A;  3A8R A;  1TNQ A;  4XOW A;  4OCI A;  2ZFD A;  1QS7 A;  2H5R A;  1IGV A;  4OJ0 A;  3ST3 A;  3EVP A;  4ZF3 A;  1IJ6 A;  2K2F A;  4W75 A;  1OXD A;  4I5J A;  3BUW B;  2EC6 C;  1XK4 C;  3VRP A;  3CB9 A;  4W7X A;  3DQH A;  4ZCU A;  3NT9 A;  2IB6 A;  2WUR A;  5BTT A;  2OKY A;  1UHN A;  3SSP A;  2ZRT A;  5HLO A;  1HT9 A;  2M3W A;  2EMO A;  2LHI A;  4KGF A;  2JT3 A;  1KCY A;  5I2L A;  2H5O A;  2I18 A;  1NPQ A;  4ZBL A;  1S6J A;  3BYA A;  2G6E A;  3TMT A;  4W6O A;  3TMR A;  5DPG A;  2HET A;  2F8P A;  2KFH A;  3DF0 B;  1H4B A;  2WND A;  4W6U A;  3AAJ A;  3HX4 A;  3WXA A;  4BY5 A;  1MOV A;  3LSA A;  3UG0 A;  2DOQ A;  1XAE A;  3BXA A;  4DCK A;  3SIA A;  4IK9 A;  3VRN A;  1Q4E A;  4RTC A;  4HQC A;  1PRW A;  3I5G C;  5KTG A;  5H88 A;  1QX5 B;  1CB1 A;  2K0J A;  5HBD A;  4W73 A;  3CR4 X;  3PJB A;  2IS9 A;  5BQL A;  1A75 B;  1J7P A;  4EDO A;  2GW3 A;  3BXB A;  1SCV A;  1LKJ A;  3M24 A;  5H87 A;  4RYW A;  4LW5 A;  4ZFS A;  5F9G A;  2CXJ A;  5I2O A;  2GX2 A;  2A47 A;  1GGX A;  1NCX A;  2Z6Z A;  1KQM B;  2MAZ A;  2LUX A;  2JU0 A;  1QV1 A;  1BOC A;  1G4Y R;  2LMU A;  1YRT B;  1QY3 A;  1Y1U A;  4NDC A;  2M1K B;  5FHV A;  3DQL A;  4HQ9 A;  1KWO C;  1BFP A;  3LK0 A;  1M46 A;  2ZO6 A;  1XFX O;  1YR5 A;  1AHR A;  2CCM A;  4ZF5 A;  3I19 A;  1MWN A;  2A50 B;  4M2Q A;  1MXL C;  1SW8 A;  3GK2 A;  4LQT A;  4W7C A;  4XYN A;  2EMN A;  1WRL A;  1M31 A;  2C9I A;  3DF0 A;  5DPH A;  2H2K A;  4DIR A;  5CSF A;  4J8A A;  4EUL A;  1K2H A;  3LS3 A;  1MOU A;  1CFP A;  1AVS A;  5I2Q A;  2PAL A;  4TZA A;  3U0K A;  2K61 A;  1RJV A;  2JT8 A;  1NUB A;  1TTX A;  4XOV A;  3DQD A;  1LVC D;  3LL8 B;  3GJ2 A;  3ZUL A;  1CFD A;  2LNK A;  1IG5 A;  2YE1 A;  5CSJ A;  1CDP A;  4J89 A;  1YHH A;  1A75 A;  4N1F A;  3GOF A;  1CM1 A;  3JVT C;  2ARL A;  1YUS A;  5LTP A;  3KF9 A;  1MR8 A;  2BCX A;  4JEO A;  2WCF A;  1J55 A;  1YUR A;  3OX6 A;  1UIS A;  4LJD A;  3DVM A;  1ZGO A;  2VVH A;  3PN7 B;  1QYF A;  1MF8 B;  4HE4 A;  4B30 A;  1CMG A;  1KP5 A;  1Q4D A;  2PVB A;  2BBM A;  1Q4B A;  1BG1 A;  1TCO B;  2HCG A;  4W6H A;  4AOM A;  5HZS A;  3D0Y A;  2OGR A;  3FIA A;  1SCM B;  1R6P A;  1CKK A;  4HRH A;  2OTB A;  2WSN A;  2F2O A;  4KGE A;  1JBZ A;  4MVF A;  2L50 A;  2CTN A;  2OTG C;  2LCP A;  1GGZ A;  4BDU A;  3FWC A;  3D10 A;  5HZO A;  1SNL A;  5LK4 A;  3I5F C;  5DPI A;  1YHI A;  1XO5 A;  4C0L A;  2PXS A;  3GJ1 A;  3WLD A;  1RFJ A;  4DXN A;  4HRE E;  2F3Z A;  1A2X A;  1XFY O;  3NSI A;  2HPW A;  2DDD A;  3SVD A;  3JTD B;  4JRB A;  1SPY A;  2WSO A;  1DJZ A;  3BQ3 A;  2GW4 B;  3AI5 A;  1F4Q A;  3CGA A;  1DJW A;  1RRO A;  3K21 A;  3PSR A;  1HCJ A;  4MEW A;  1J7O A;  2LM5 A;  4R6B A;  2K7D A;  2VVI A;  2MLF C;  3DQ7 A;  1FPW A;  1S5G Z;  5D69 A;  2Z1O A;  2EHB A;  2JZI A;  1IWQ A;  4EMQ A;  2Z6X A;  1YUT A;  2H8Q A;  2VVJ A;  1EL4 A;  2JNX A;  3RLZ A;  2JQ6 A;  1W7U A;  1IKU A;  1OZO A;  1XSS A;  1KFU L;  3U0M A;  4GUK A;  1HUY A;  2G9B A;  3TZ1 A;  2DUE A;  3FWB A;  4ORA B;  5F6T A;  1JSA A;  2HPS A;  3ED8 A;  3IR8 A;  4MN0 A;  1TNP A;  1SCM C;  3BUX B;  3KO0 A;  2JC2 A;  4IK4 A;  3K1K A;  3ZNI A;  2KI4 C;  1IQ3 A;  4TNC A;  3DQE A;  3LLE A;  5DTY A;  3DVJ A;  3SSY A;  1XVJ A;  1KFX L;  3WLC A;  4ZF4 A;  1Q73 A;  2V4E C;  3RM1 A;  3OHM B;  5DQB A;  2ZN9 A;  3EVU A;  1JBY A;  4JGE A;  3DPW A;  5BTT B;  1K94 A;  1SY9 A;  1N2D A;  4OV2 A;  1TIZ A;  1FF1 A;  4P1Q A;  5HZU A;  4PFE A;  2OTE A;  1SL9 A;  4NDD A;  1M63 B;  2AWJ A;  1S26 D;  2G3O A;  1NX2 A;  1QLK A;  4Q7U A;  1A03 A;  4Q7T A;  2HF5 A;  4PDZ A;  4ORC B;  2OPO A;  1UHK A;  1TOP A;  3U8A A;  3DQ6 A;  4GF6 B;  4W7F A;  1IQ5 A;  2BL0 C;  3FS7 A;  2KBM A;  4H3M A;  4YI9 A;  4L13 A;  5DKR A;  4CID A;  3DQU A;  2O5G A;  1S5G Y;  2L2E A;  1W7J B;  2K7B A;  3KCT A;  1PK0 D;  2LLU A;  2H5Q A;  3SVO A;  3A4U B;  3PIB A;  4W6L A;  1SL8 A;  5DRG A;  2A4J A;  4QJ4 B;  2M1U A;  4KW8 A;  1OMR A;  4ORN A;  4FTG A;  1WRZ A;  1S6Z A;  4XVP A;  5ER5 A;  1F70 A;  3SST A;  1ZUZ A;  1L2O B;  1TCF A;  5AQB B;  2JXC A;  3DQF A;  4P5O E;  3DQN A;  2B3Q A;  1G33 A;  4PCW A;  4OGS A;  2G6X A;  3EK8 A;  2WOR A;  1XA5 A;  1S1E A;  2LVJ A;  1EMB A;  2KYC A;  2ZNE A;  3O4Y A;  3EKJ A;  4FQO A;  5DU0 A;  2FOT A;  1B8L A;  1DMO A;  2H61 A;  2LC5 A;  2CNP A;  3DPX A;  4PHN A;  3EK4 A;  2ICR A;  2L4I A;  5DY6 A;  4H47 A;  1SK6 D;  2ISD A;  1SRA A;  1Z1Q A;  3ST2 A;  4M2P A;  1JFJ A;  3LF3 A;  5DQM A;  3ZUJ A;  3ZUF A;  4I5K A;  2TN4 A;  1XK4 A;  1IJ5 A;  2Y1N A;  3SVN A;  1ZGP A;  4Q7R A;  4W6D A;  4TZG A;  2OJK A;  4GNK B;  5AFP A;  4GGF C;  2AH8 A;  4W69 A;  3EKH A;  4RYS A;  1H6R A;  1QLS A;  1F4O A;  1KYS A;  4KEX A;  1YX8 A;  4W6K A;  1S6I A;  1BR1 B;  4GBA A;  2E30 A;  5HKZ A;  2AWL A;  3CWG A;  3VHT A;  2LVI A;  3DQ1 A;  1Y1A A;  3SJS A;  2KI6 C;  2PMY A;  4W6T A;  1M45 A;  1RWY A;  5I8N A;  3VRR A;  1XA9 A;  4HSZ A;  1IRJ A;  1K9K A;  1SR6 B;  1B8R A;  4C0K A;  1BMO A;  2WCE A;  1EML A;  1KK8 B;  1AP4 A;  1XFV O;  4GAO A;  2A53 B;  1YJ2 A;  3I5H B;  1KSO A;  4BY4 A;  2KGR A;  2JUL A;  5CSI A;  2MBX A;  3TS5 B;  1DF0 B;  2GX0 A;  1UHH A;  1ZOT B;  2FJU B;  1PUL A;  1DTL A;  4KF5 A;  1Q4A A;  1YTZ C;  2P6B B;  4B30 B;  2H5P A;  1B9A A;  1C4F A;  1ZAC A;  5LTR A;  3RWT A;  5DTZ A;  1MHO A;  2HFC A;  3PJ5 A;  3D0Y B;  3IF7 A;  4ETO A;  2DUG A;  2KQ6 A;  1Y0V H;  3WNX B;  4HVF A;  4IK1 A;  3W1D A;  1IH0 A;  5T3I A;  3QRX A;  4OY4 A;  2QLG A;  2G2S B;  1UUR A;  4IL1 A;  3OSR A;  3BOW A;  5AAN A;  4DXM A;  1DJH A;  3VRQ A;  1B7T Z;  4DRW A;  2WHS A;  3DQ8 A;  1XFZ O;  3F45 A;  5HLV A;  1W7I B;  1G8I A;  5BT0 A;  1PVA A;  2LHL A;  3S05 A;  4PE1 A;  4WQ3 A;  1CDL A;  4OKH A;  2DUH A;  5HYD A;  3DQC A;  4PPL A;  2ZO7 A;  2M0R A;  2BE6 A;  2JNF A;  2LP2 A;  2NCP A;  1OMD A;  4U8D A;  1SR6 C;  3ZTF A;  3U0N A;  1EMF A;  2YE0 A;  2M49 B;  4W7R A;  3SSL A;  1Y6W A;  2FCE A;  2HQZ A;  1KK8 C;  2KDH A;  1G7K A;  3SG6 A;  2LVV A;  3SSV A;  2NLN A;  2BBN A;  1BJF A;  3U8C A;  1OQP A;  2JPT A;  5JJG A;  1UHI A;  3SSK A;  1KQM C;  5EBJ A;  2FWQ A;  1DF0 A;  3IP2 A;  2F3Y A;  1PAL A;  4UPG A;  2MJW B;  3AKB A;  2Y5I A;  1GFL A;  3P28 A;  1UWO A;  2WCB A;  2F33 A;  1N0Y A;  3LF4 B;  1WY9 A;  2RH7 A;  3KCS A;  2KOT A;  2LAP A;  3I5I B;  3DQJ A;  4XGY A;  2LLT A;  4L1I A;  5KU1 A;  3SVS A;  1FW4 A;  3O6B A;  2HGD A;  3OP0 A;  3CFH A;  3C1V A;  4JWQ A;  3SVU A;  3CS1 A;  2F2P A;  3PAL A;  1KYP A;  2JRF A;  4W6B A;  2M7L A;  3AAK A;  4PAL A;  1SMG A;  2I2R E;  1B7T Y;  3DQ2 A;  3CFA A;  1MUX A;  1C7V A;  4YGA A;  2FZU A;  4MZK A;  4MZL A;  4KW9 A;  1ZGQ A;  2G3D B;  2COL B;  4MZJ A;  1REC A;  1ZMZ A;  1DJI A;  4I5N B;  5FVF A;  2LE9 B;  1AJ4 A;  1YHG A;  1CLL A;  3H1O A;  1SKT A;  1YVH A;  3CGL A;  1DJY A;  1RTP 1;  1UHJ A;  2PXW A;  2EMD A;  4Z4K A;  1J1D A;  1EMM A;  5JOL A;  2QT2 A;  2LP3 A;  2I94 A;  4W7A A;  3LCP C;  2POX A;  3DVE A;  3TUY B;  4YI8 A;  4JPZ B;  4WQ2 A;  1KSM A;  3TDU A;  4W7D A;  1NX1 A;  1CFC A;  4DXP A;  2ZKM X;  5EJU A;  3DQ4 A;  1F8H A;  3AKO A;  4N1G A;  3PFV A;  2QLI A;  3DD4 A;  1JBA A;  5DTL A;  5HZT A;  2Z6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...