3LVAA

Crystal structure of colorless gfp-like protein from aequorea coerulescens
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
234
Chain Sequence
SKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Structural evidence for a dehydrated intermediate in green fluorescent protein chromophore biosynthesis.
pubmed doi rcsb
source organism Aequorea coerulescens
molecule tags Fluorescent protein
total genus 55
structure length 234
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3lvaA00
3U0MA 3P8UA 1RMOA 2GW4B 2Z6YA 3GJ1A 3DQ8A 2C9JA 1EMBA 2IB6A 5AQBB 4KF4A 3DQFA 4EDOA 2A53B 2V4EC 3DQJA 4HQCA 4ZF4A 4W6FA 3VK1A 4Q9WA 2A54B 3NT3A 3OSRA 2A47A 4W75A 4LJDC 4W7CA 4EULA 4DKMA 5DQBA 5FVGA 5HBDA 3TMRA 3W1CA 3OSQA 4LJBA 1ZGOA 5DPHA 1OXDA 3CBEA 5DTLA 3UG0A 4GF6B 2Z6ZA 3IR8A 4Q7RA 1Q4DA 4XGYA 3I19A 1XA9A 3VICA 3EVUA 4TZAA 4W6JA 2GX2A 2DUGA 2ZMUA 5EBJA 3SSVA 4DXNA 2BTJA 2WSOA 1Q4EA 4ORNA 2HCGA 1JBZA 2V4EA 1W7UA 3DQDA 4H3NA 2RH7A 2WHUA 3IP2A 1QYOA 4KGEA 1YHHA 4W7FA 2G3DB 4W7RA 1RM9A 4W74A 2PXSA 3RWAA 1KYPA 4W6HA 2YDZA 1KYSA 4W6CA 2Q57A 4H3LA 4HQ9A 1Q4CA 1Z1QA 5LTRA 2HGYA 5HW9A 3E5TA 4Q7UA 3GL4A 2ZMWA 3DPWA 4ZF3A 3M22A 3PJBA 2AWJA 4KAGA 5FHVA 5DRFA 5HZOA 2Z6XA 3SSTA 1QYFA 2OTEA 3EK7A 1Q4BA 4JFGA 4IZNA 3SSLA 5H87A 2ICRA 4IK5A 5H89A 4AS8A 1UISA 3LA1A 3U0LA 3SSPA 4XL5A 4AR7A 1QXTA 2IOVA 2B3QA 1OXFA 4RYWA 3TMTA 3SG6A 3AI4A 2Q6PA 2GX0A 3NEDA 3V3DA 2IB5A 3SRYA 4W6UA 3E5VA 4TZGA 3K1KA 4W6KA 4DKNA 2H5RA 4ZB1A 1JC0A 2ZO6A 3KCSA 4HVFA 2OJKA 4LJCA 5F9GA 5BTTB 2P4MA 3ZTFA 4KF5A 4LW5A 4IK8A 4DXMA 2POXA 2DDCA 2HQZA 3BXAA 3DQHA 4NWSA 2G6EA 4B30B 3GJ2A 3SG2A 5EXUA 4Q9XA 4DXPA 2ARLA 4W6PA 1RRXA 4P1QA 3EK8A 4W6LA 3SVBA 1EMGA 3CFHA 4H3MA 4RYSA 5HZUA 1G7KA 4JF9A 2O24A 4ZBLA 3NT9A 3SVCA 3ZUFA 3BX9A 3RWTA 2AWMA 3PJ5A 4H47A 1KP5A 3LF4B 3LSAA 3GEXA 2FL1A 4DXQA 4KEXA 3PJ7A 3DQEA 5FVIA 1YJFA 3CD9A 3BXCA 4W6DA 2JADA 4KW8A 1QY3A 5EXCI 3EVPA 2A56B 5EXBA 2G6YA 2WHTA 1QYQA 3LVCA 3DQUA 2OGRA 3DQKA 2EMOA 4W76A 2DUHA 3DQ1A 1MOUA 4GOBA 4JC2A 4B5YA 2WIQA 4RTCA 2H6VA 5DTZA 3G9AA 4W6IA 3DPZA 4IK3A 5BTTA 2QZ0A 5DTXA 4R6DA 4KW4A 2VVJA 2QLIA 4KA9A 3WLDA 1S6ZA 2YE0A 3SSYA 4B30A 3DQ2A 4UTSA 4W7DA 4W7EA 3DQ3A 2OKWA 5FVFA 1YFPA 3GB3A 2QLEA 5HZTA 2WURA 3CFAA 3EKHA 4J8AA 4KF5C 2DUEA 2WISA 2B3PA 5LTPA 2YE1A 2QLGB 5DTYA 3CFFA 3SSHA 2A52B 5DPGA 3DQ4A 4LQTA 1XQMA 5HZSA 1RMMA 1W7TA 4W6AA 3U0NA 4IK1A 2HRSA 4U2VA 1EMMA 1EMFA 3NF0A 4EMQA 5LTQA 2FWQA 2VAEA 5KTGA 3DQ9A 4OY4A 4W6GA 3U8CA 5EB6A 5BT0A 4N3DA 2AWLA 3PIBA 2AHAA 4OQWA 2QT2A 4Z4MA 3SG3A 1YHGA 3ST4A 1W7SA 3U8PA 4HQ8A 1F0BA 1XMZA 2QRFA 3CD1A 5DU0A 4JRBA 4L1IA 2G3OA 2PXWA 4IK4A 4W6BA 3SVDA 1YJ2A 3AI5A 3DQ7A 3ST3A 3DQ6A 4I2YA 5DRGA 3W1DA 3EK4A 1GFLA 4J88A 4PPLA 2V4EB 3SVRA 3LVAA 1CV7A 3SG5A 5HGEA 3SVEA 2A48A 2VZXA 2O2BA 2DUFA 1ZGPA 2HPWA 1EMAA 4L13A 3SVNA 2H8QA 3E5WA 2Y0GA 3S05A 3DQMA 1H4UA 3CGLA 3ST2A 3EVRA 1HUYA 3MGFA 4W69A 4W6TA 2VVIA 1XAEA 2Z1OA 4ZF5A 2QLGA 3H1OA 3U8AA 3SVOA 3ED8A 4BDUA 4W6MA 5DPJA 2C9IA 2DD7A 5J2OA 1F09A 4R6BA 4PPKA 3EVVA 4J89A 1EMCA 5DQMA 5LK4A 3LVDA 1HCJA 4EDSA 5BQLA 3O78A 3WCKA 4JEOA 3U0KA 3DQCA 2G6XA 3LF3A 2H5QA 2YFPA 3DQNA 3SVUA 2O29A 3DQOA 3A8SA 4DXIA 1MYWA 3VHTB 1B9CA 3DQ5A 4W6NA 2IE2A 1RMPA 2QU1A 3SG7A 4ANJA 3DPXA 3LS3A 5EB7A 5DY6A 3P28A 3DQLA 3NEZA 4GESB 1KYRA 2QLHA 1GGXA 2HQKA 2FZUA 3H1RA 4W73A 3SSKA 1EMKA 1JC1A 2HJOA 3SV5A 4LQUA 4OGSA 4H48A 3AKOA 3EKJA 1MOVA 5DPIA 2EMNA 2H5PA 3UFZA 4EN1A 4LJDA 1ZUXA 4Z4KA 1ZGQA 3DQIA 1YZWA 3SG4A 2VVHA 1JBYA 4JGEA 4PFEA 1YHIA 3CB9A 3WLCA 2HGDA 2VADA 3ZUJA 3O77A 4KPIA 2GW3A 4PPJA 2DD9A 3KCTA 1Z1PA 1EMLA 2G5ZB 4ZIOA 4IK9A 4W6OA 2DDDA 4OJ0A 3ADFA 4ZINA 1BFPA 4Q7TA 3ZULA 5H88A 4OHSA 4XVPA 2G16B 4W72A 1EMEA 4KW9A 1XSSA 2H5OA 3SS0A 2WHSA 5T3IA 1GL4A 1OXEA 4W7AA 4W6RA 4W7XA 2OKYA 2AWKA 4DXOA 4XOVA 3VHTA 4KGFA 1Q73A 2A50B 2HFCA 3M24A 1C4FA 4ZFSA 2OTBA 4L12A 2EMDA 2AH8A 5EJUA 4HE4A 3OGOA 3ST0A 3SVSA 4XOWA 2G2SB 4W6SA 2DUIA 4W77A 3BXBA 3DQAA 1H6RA 1Q4AA 5EHUA 2WSNA 2A46A 2ZO7A 2H9WA 4P76A
chains in the Genus database with same CATH superfamily
3U0MA 3P8UA 1RMOA 2GW4B 2Z6YA 3GJ1A 3DQ8A 2C9JA 1EMBA 2IB6A 5AQBB 4KF4A 3DQFA 4EDOA 2A53B 2V4EC 3DQJA 4HQCA 4ZF4A 4W6FA 3VK1A 4Q9WA 2A54B 3NT3A 3OSRA 2A47A 4W75A 4LJDC 4W7CA 4EULA 4DKMA 5DQBA 5FVGA 5HBDA 3TMRA 3W1CA 3OSQA 4LJBA 1ZGOA 5DPHA 1OXDA 3CBEA 5DTLA 3UG0A 4GF6B 2Z6ZA 3IR8A 4Q7RA 1Q4DA 4XGYA 3I19A 1XA9A 3VICA 3EVUA 4TZAA 4W6JA 2GX2A 2DUGA 2ZMUA 5EBJA 3SSVA 4DXNA 2BTJA 2WSOA 1Q4EA 4ORNA 2HCGA 1JBZA 2V4EA 1W7UA 3DQDA 4H3NA 2RH7A 2WHUA 3IP2A 1QYOA 4KGEA 1YHHA 4W7FA 2G3DB 4W7RA 1RM9A 4W74A 2PXSA 3RWAA 1KYPA 4W6HA 2YDZA 1KYSA 4W6CA 2Q57A 4H3LA 4HQ9A 1Q4CA 1Z1QA 5LTRA 2HGYA 5HW9A 3E5TA 4Q7UA 3GL4A 2ZMWA 3DPWA 4ZF3A 3M22A 3PJBA 2AWJA 4KAGA 5FHVA 5DRFA 5HZOA 2Z6XA 3SSTA 1QYFA 2OTEA 3EK7A 1Q4BA 4JFGA 4IZNA 3SSLA 5H87A 2ICRA 4IK5A 5H89A 4AS8A 1UISA 3LA1A 3U0LA 3SSPA 4XL5A 4AR7A 1QXTA 2IOVA 2B3QA 1OXFA 4RYWA 3TMTA 3SG6A 3AI4A 2Q6PA 2GX0A 3NEDA 3V3DA 2IB5A 3SRYA 4W6UA 3E5VA 4TZGA 3K1KA 4W6KA 4DKNA 2H5RA 4ZB1A 1JC0A 2ZO6A 3KCSA 4HVFA 2OJKA 4LJCA 5F9GA 5BTTB 2P4MA 3ZTFA 4KF5A 4LW5A 4IK8A 4DXMA 2POXA 2DDCA 2HQZA 3BXAA 3DQHA 4NWSA 2G6EA 4B30B 3GJ2A 3SG2A 5EXUA 4Q9XA 4DXPA 2ARLA 4W6PA 1RRXA 4P1QA 3EK8A 4W6LA 3SVBA 1EMGA 3CFHA 4H3MA 4RYSA 5HZUA 1G7KA 4JF9A 2O24A 4ZBLA 3NT9A 3SVCA 3ZUFA 3BX9A 3RWTA 2AWMA 3PJ5A 4H47A 1KP5A 3LF4B 3LSAA 3GEXA 2FL1A 4DXQA 4KEXA 3PJ7A 3DQEA 5FVIA 1YJFA 3CD9A 3BXCA 4W6DA 2JADA 4KW8A 1QY3A 5EXCI 3EVPA 2A56B 5EXBA 2G6YA 2WHTA 1QYQA 3LVCA 3DQUA 2OGRA 3DQKA 2EMOA 4W76A 2DUHA 3DQ1A 1MOUA 4GOBA 4JC2A 4B5YA 2WIQA 4RTCA 2H6VA 5DTZA 3G9AA 4W6IA 3DPZA 4IK3A 5BTTA 2QZ0A 5DTXA 4R6DA 4KW4A 2VVJA 2QLIA 4KA9A 3WLDA 1S6ZA 2YE0A 3SSYA 4B30A 3DQ2A 4UTSA 4W7DA 4W7EA 3DQ3A 2OKWA 5FVFA 1YFPA 3GB3A 2QLEA 5HZTA 2WURA 3CFAA 3EKHA 4J8AA 4KF5C 2DUEA 2WISA 2B3PA 5LTPA 2YE1A 2QLGB 5DTYA 3CFFA 3SSHA 2A52B 5DPGA 3DQ4A 4LQTA 1XQMA 5HZSA 1RMMA 1W7TA 4W6AA 3U0NA 4IK1A 2HRSA 4U2VA 1EMMA 1EMFA 3NF0A 4EMQA 5LTQA 2FWQA 2VAEA 5KTGA 3DQ9A 4OY4A 4W6GA 3U8CA 5EB6A 5BT0A 4N3DA 2AWLA 3PIBA 2AHAA 4OQWA 2QT2A 4Z4MA 3SG3A 1YHGA 3ST4A 1W7SA 3U8PA 4HQ8A 1F0BA 1XMZA 2QRFA 3CD1A 5DU0A 4JRBA 4L1IA 2G3OA 2PXWA 4IK4A 4W6BA 3SVDA 1YJ2A 3AI5A 3DQ7A 3ST3A 3DQ6A 4I2YA 5DRGA 3W1DA 3EK4A 1GFLA 4J88A 4PPLA 2V4EB 3SVRA 3LVAA 1CV7A 3SG5A 5HGEA 3SVEA 2A48A 2VZXA 2O2BA 2DUFA 1ZGPA 2HPWA 1EMAA 4L13A 3SVNA 2H8QA 3E5WA 2Y0GA 3S05A 3DQMA 1H4UA 3CGLA 3ST2A 3EVRA 1HUYA 3MGFA 4W69A 4W6TA 2VVIA 1XAEA 2Z1OA 4ZF5A 2QLGA 3H1OA 3U8AA 3SVOA 3ED8A 4BDUA 4W6MA 5DPJA 2C9IA 2DD7A 5J2OA 1F09A 4R6BA 4PPKA 3EVVA 4J89A 1EMCA 5DQMA 5LK4A 3LVDA 1HCJA 4EDSA 5BQLA 3O78A 3WCKA 4JEOA 3U0KA 3DQCA 2G6XA 3LF3A 2H5QA 2YFPA 3DQNA 3SVUA 2O29A 3DQOA 3A8SA 4DXIA 1MYWA 3VHTB 1B9CA 3DQ5A 4W6NA 2IE2A 1RMPA 2QU1A 3SG7A 4ANJA 3DPXA 3LS3A 5EB7A 5DY6A 3P28A 3DQLA 3NEZA 4GESB 1KYRA 2QLHA 1GGXA 2HQKA 2FZUA 3H1RA 4W73A 3SSKA 1EMKA 1JC1A 2HJOA 3SV5A 4LQUA 4OGSA 4H48A 3AKOA 3EKJA 1MOVA 5DPIA 2EMNA 2H5PA 3UFZA 4EN1A 4LJDA 1ZUXA 4Z4KA 1ZGQA 3DQIA 1YZWA 3SG4A 2VVHA 1JBYA 4JGEA 4PFEA 1YHIA 3CB9A 3WLCA 2HGDA 2VADA 3ZUJA 3O77A 4KPIA 2GW3A 4PPJA 2DD9A 3KCTA 1Z1PA 1EMLA 2G5ZB 4ZIOA 4IK9A 4W6OA 2DDDA 4OJ0A 3ADFA 4ZINA 1BFPA 4Q7TA 3ZULA 5H88A 4OHSA 4XVPA 2G16B 4W72A 1EMEA 4KW9A 1XSSA 2H5OA 3SS0A 2WHSA 5T3IA 1GL4A 1OXEA 4W7AA 4W6RA 4W7XA 2OKYA 2AWKA 4DXOA 4XOVA 3VHTA 4KGFA 1Q73A 2A50B 2HFCA 3M24A 1C4FA 4ZFSA 2OTBA 4L12A 2EMDA 2AH8A 5EJUA 4HE4A 3OGOA 3ST0A 3SVSA 4XOWA 2G2SB 4W6SA 2DUIA 4W77A 3BXBA 3DQAA 1H6RA 1Q4AA 5EHUA 2WSNA 2A46A 2ZO7A 2H9WA 4P76A
chains in the Genus database with same CATH topology
3U0MA 3P8UA 1RMOA 2GW4B 2Z6YA 3GJ1A 3DQ8A 2C9JA 1EMBA 2IB6A 5AQBB 4KF4A 3DQFA 4EDOA 2A53B 2V4EC 3DQJA 4HQCA 4ZF4A 4W6FA 3VK1A 4Q9WA 2A54B 3NT3A 3OSRA 2A47A 4W75A 4LJDC 4W7CA 4EULA 4DKMA 5DQBA 5FVGA 5HBDA 3TMRA 3W1CA 3OSQA 4LJBA 1ZGOA 5DPHA 1OXDA 3CBEA 5DTLA 3UG0A 4GF6B 2Z6ZA 3IR8A 4Q7RA 1Q4DA 4XGYA 3I19A 1XA9A 3VICA 3EVUA 4TZAA 4W6JA 2GX2A 2DUGA 2ZMUA 5EBJA 3SSVA 4DXNA 2BTJA 2WSOA 1Q4EA 4ORNA 2HCGA 1JBZA 2V4EA 1W7UA 3DQDA 4H3NA 2RH7A 2WHUA 3IP2A 1QYOA 4KGEA 1YHHA 4W7FA 2G3DB 4W7RA 1RM9A 4W74A 2PXSA 3RWAA 1KYPA 4W6HA 2YDZA 1KYSA 4W6CA 2Q57A 4H3LA 4HQ9A 1Q4CA 1Z1QA 5LTRA 2HGYA 5HW9A 3E5TA 4Q7UA 3GL4A 2ZMWA 3DPWA 4ZF3A 3M22A 3PJBA 2AWJA 4KAGA 5FHVA 5DRFA 5HZOA 2Z6XA 3SSTA 1QYFA 2OTEA 3EK7A 1Q4BA 4JFGA 4IZNA 3SSLA 5H87A 2ICRA 4IK5A 5H89A 4AS8A 1UISA 3LA1A 3U0LA 3SSPA 4XL5A 4AR7A 1QXTA 2IOVA 2B3QA 1OXFA 4RYWA 3TMTA 3SG6A 3AI4A 2Q6PA 2GX0A 3NEDA 3V3DA 2IB5A 3SRYA 4W6UA 3E5VA 4TZGA 3K1KA 4W6KA 4DKNA 2H5RA 4ZB1A 1JC0A 2ZO6A 3KCSA 4HVFA 2OJKA 4LJCA 5F9GA 5BTTB 2P4MA 3ZTFA 4KF5A 4LW5A 4IK8A 4DXMA 2POXA 2DDCA 2HQZA 3BXAA 3DQHA 4NWSA 2G6EA 4B30B 3GJ2A 3SG2A 5EXUA 4Q9XA 4DXPA 2ARLA 4W6PA 1RRXA 4P1QA 3EK8A 4W6LA 3SVBA 1EMGA 3CFHA 4H3MA 4RYSA 5HZUA 1G7KA 4JF9A 2O24A 4ZBLA 3NT9A 3SVCA 3ZUFA 3BX9A 3RWTA 2AWMA 3PJ5A 4H47A 1KP5A 3LF4B 3LSAA 3GEXA 2FL1A 4DXQA 4KEXA 3PJ7A 3DQEA 5FVIA 1YJFA 3CD9A 3BXCA 4W6DA 2JADA 4KW8A 1QY3A 5EXCI 3EVPA 2A56B 5EXBA 2G6YA 2WHTA 1QYQA 3LVCA 3DQUA 2OGRA 3DQKA 2EMOA 4W76A 2DUHA 3DQ1A 1MOUA 4GOBA 4JC2A 4B5YA 2WIQA 4RTCA 2H6VA 5DTZA 3G9AA 4W6IA 3DPZA 4IK3A 5BTTA 2QZ0A 5DTXA 4R6DA 4KW4A 2VVJA 2QLIA 4KA9A 3WLDA 1S6ZA 2YE0A 3SSYA 4B30A 3DQ2A 4UTSA 4W7DA 4W7EA 3DQ3A 2OKWA 5FVFA 1YFPA 3GB3A 2QLEA 5HZTA 2WURA 3CFAA 3EKHA 4J8AA 4KF5C 2DUEA 2WISA 2B3PA 5LTPA 2YE1A 2QLGB 5DTYA 3CFFA 3SSHA 2A52B 5DPGA 3DQ4A 4LQTA 1XQMA 5HZSA 1RMMA 1W7TA 4W6AA 3U0NA 4IK1A 2HRSA 4U2VA 1EMMA 1EMFA 3NF0A 4EMQA 5LTQA 2FWQA 2VAEA 5KTGA 3DQ9A 4OY4A 4W6GA 3U8CA 5EB6A 5BT0A 4N3DA 2AWLA 3PIBA 2AHAA 4OQWA 2QT2A 4Z4MA 3SG3A 1YHGA 3ST4A 1W7SA 3U8PA 4HQ8A 1F0BA 1XMZA 2QRFA 3CD1A 5DU0A 4JRBA 4L1IA 2G3OA 2PXWA 4IK4A 4W6BA 3SVDA 1YJ2A 3AI5A 3DQ7A 3ST3A 3DQ6A 4I2YA 5DRGA 3W1DA 3EK4A 1GFLA 4J88A 4PPLA 2V4EB 3SVRA 3LVAA 1CV7A 3SG5A 5HGEA 3SVEA 2A48A 2VZXA 2O2BA 2DUFA 1ZGPA 2HPWA 1EMAA 4L13A 3SVNA 2H8QA 3E5WA 2Y0GA 3S05A 3DQMA 1H4UA 3CGLA 3ST2A 3EVRA 1HUYA 3MGFA 4W69A 4W6TA 2VVIA 1XAEA 2Z1OA 4ZF5A 2QLGA 3H1OA 3U8AA 3SVOA 3ED8A 4BDUA 4W6MA 5DPJA 2C9IA 2DD7A 5J2OA 1F09A 4R6BA 4PPKA 3EVVA 4J89A 1EMCA 5DQMA 5LK4A 3LVDA 1HCJA 4EDSA 5BQLA 3O78A 3WCKA 4JEOA 3U0KA 3DQCA 2G6XA 3LF3A 2H5QA 2YFPA 3DQNA 3SVUA 2O29A 3DQOA 3A8SA 4DXIA 1MYWA 3VHTB 1B9CA 3DQ5A 4W6NA 2IE2A 1RMPA 2QU1A 3SG7A 4ANJA 3DPXA 3LS3A 5EB7A 5DY6A 3P28A 3DQLA 3NEZA 4GESB 1KYRA 2QLHA 1GGXA 2HQKA 2FZUA 3H1RA 4W73A 3SSKA 1EMKA 1JC1A 2HJOA 3SV5A 4LQUA 4OGSA 4H48A 3AKOA 3EKJA 1MOVA 5DPIA 2EMNA 2H5PA 3UFZA 4EN1A 4LJDA 1ZUXA 4Z4KA 1ZGQA 3DQIA 1YZWA 3SG4A 2VVHA 1JBYA 4JGEA 4PFEA 1YHIA 3CB9A 3WLCA 2HGDA 2VADA 3ZUJA 3O77A 4KPIA 2GW3A 4PPJA 2DD9A 3KCTA 1Z1PA 1EMLA 2G5ZB 4ZIOA 4IK9A 4W6OA 2DDDA 4OJ0A 3ADFA 4ZINA 1BFPA 4Q7TA 3ZULA 5H88A 4OHSA 4XVPA 2G16B 4W72A 1EMEA 4KW9A 1XSSA 2H5OA 3SS0A 2WHSA 5T3IA 1GL4A 1OXEA 4W7AA 4W6RA 4W7XA 2OKYA 2AWKA 4DXOA 4XOVA 3VHTA 4KGFA 1Q73A 2A50B 2HFCA 3M24A 1C4FA 4ZFSA 2OTBA 4L12A 2EMDA 2AH8A 5EJUA 4HE4A 3OGOA 3ST0A 3SVSA 4XOWA 2G2SB 4W6SA 2DUIA 4W77A 3BXBA 3DQAA 1H6RA 1Q4AA 5EHUA 2WSNA 2A46A 2ZO7A 2H9WA 4P76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U0M A;  3P8U A;  1RMO A;  2GW4 B;  2Z6Y A;  3GJ1 A;  3DQ8 A;  2C9J A;  1EMB A;  2IB6 A;  5AQB B;  4KF4 A;  3DQF A;  4EDO A;  2A53 B;  2V4E C;  3DQJ A;  4HQC A;  4ZF4 A;  4W6F A;  3VK1 A;  4Q9W A;  2A54 B;  3NT3 A;  3OSR A;  2A47 A;  4W75 A;  4LJD C;  4W7C A;  4EUL A;  4DKM A;  5DQB A;  5FVG A;  5HBD A;  3TMR A;  3W1C A;  3OSQ A;  4LJB A;  1ZGO A;  5DPH A;  1OXD A;  3CBE A;  5DTL A;  3UG0 A;  4GF6 B;  2Z6Z A;  3IR8 A;  4Q7R A;  1Q4D A;  4XGY A;  3I19 A;  1XA9 A;  3VIC A;  3EVU A;  4TZA A;  4W6J A;  2GX2 A;  2DUG A;  2ZMU A;  5EBJ A;  3SSV A;  4DXN A;  2BTJ A;  2WSO A;  1Q4E A;  4ORN A;  2HCG A;  1JBZ A;  2V4E A;  1W7U A;  3DQD A;  4H3N A;  2RH7 A;  2WHU A;  3IP2 A;  1QYO A;  4KGE A;  1YHH A;  4W7F A;  2G3D B;  4W7R A;  1RM9 A;  4W74 A;  2PXS A;  3RWA A;  1KYP A;  4W6H A;  2YDZ A;  1KYS A;  4W6C A;  2Q57 A;  4H3L A;  4HQ9 A;  1Q4C A;  1Z1Q A;  5LTR A;  2HGY A;  5HW9 A;  3E5T A;  4Q7U A;  3GL4 A;  2ZMW A;  3DPW A;  4ZF3 A;  3M22 A;  3PJB A;  2AWJ A;  4KAG A;  5FHV A;  5DRF A;  5HZO A;  2Z6X A;  3SST A;  1QYF A;  2OTE A;  3EK7 A;  1Q4B A;  4JFG A;  4IZN A;  3SSL A;  5H87 A;  2ICR A;  4IK5 A;  5H89 A;  4AS8 A;  1UIS A;  3LA1 A;  3U0L A;  3SSP A;  4XL5 A;  4AR7 A;  1QXT A;  2IOV A;  2B3Q A;  1OXF A;  4RYW A;  3TMT A;  3SG6 A;  3AI4 A;  2Q6P A;  2GX0 A;  3NED A;  3V3D A;  2IB5 A;  3SRY A;  4W6U A;  3E5V A;  4TZG A;  3K1K A;  4W6K A;  4DKN A;  2H5R A;  4ZB1 A;  1JC0 A;  2ZO6 A;  3KCS A;  4HVF A;  2OJK A;  4LJC A;  5F9G A;  5BTT B;  2P4M A;  3ZTF A;  4KF5 A;  4LW5 A;  4IK8 A;  4DXM A;  2POX A;  2DDC A;  2HQZ A;  3BXA A;  3DQH A;  4NWS A;  2G6E A;  4B30 B;  3GJ2 A;  3SG2 A;  5EXU A;  4Q9X A;  4DXP A;  2ARL A;  4W6P A;  1RRX A;  4P1Q A;  3EK8 A;  4W6L A;  3SVB A;  1EMG A;  3CFH A;  4H3M A;  4RYS A;  5HZU A;  1G7K A;  4JF9 A;  2O24 A;  4ZBL A;  3NT9 A;  3SVC A;  3ZUF A;  3BX9 A;  3RWT A;  2AWM A;  3PJ5 A;  4H47 A;  1KP5 A;  3LF4 B;  3LSA A;  3GEX A;  2FL1 A;  4DXQ A;  4KEX A;  3PJ7 A;  3DQE A;  5FVI A;  1YJF A;  3CD9 A;  3BXC A;  4W6D A;  2JAD A;  4KW8 A;  1QY3 A;  5EXC I;  3EVP A;  2A56 B;  5EXB A;  2G6Y A;  2WHT A;  1QYQ A;  3LVC A;  3DQU A;  2OGR A;  3DQK A;  2EMO A;  4W76 A;  2DUH A;  3DQ1 A;  1MOU A;  4GOB A;  4JC2 A;  4B5Y A;  2WIQ A;  4RTC A;  2H6V A;  5DTZ A;  3G9A A;  4W6I A;  3DPZ A;  4IK3 A;  5BTT A;  2QZ0 A;  5DTX A;  4R6D A;  4KW4 A;  2VVJ A;  2QLI A;  4KA9 A;  3WLD A;  1S6Z A;  2YE0 A;  3SSY A;  4B30 A;  3DQ2 A;  4UTS A;  4W7D A;  4W7E A;  3DQ3 A;  2OKW A;  5FVF A;  1YFP A;  3GB3 A;  2QLE A;  5HZT A;  2WUR A;  3CFA A;  3EKH A;  4J8A A;  4KF5 C;  2DUE A;  2WIS A;  2B3P A;  5LTP A;  2YE1 A;  2QLG B;  5DTY A;  3CFF A;  3SSH A;  2A52 B;  5DPG A;  3DQ4 A;  4LQT A;  1XQM A;  5HZS A;  1RMM A;  1W7T A;  4W6A A;  3U0N A;  4IK1 A;  2HRS A;  4U2V A;  1EMM A;  1EMF A;  3NF0 A;  4EMQ A;  5LTQ A;  2FWQ A;  2VAE A;  5KTG A;  3DQ9 A;  4OY4 A;  4W6G A;  3U8C A;  5EB6 A;  5BT0 A;  4N3D A;  2AWL A;  3PIB A;  2AHA A;  4OQW A;  2QT2 A;  4Z4M A;  3SG3 A;  1YHG A;  3ST4 A;  1W7S A;  3U8P A;  4HQ8 A;  1F0B A;  1XMZ A;  2QRF A;  3CD1 A;  5DU0 A;  4JRB A;  4L1I A;  2G3O A;  2PXW A;  4IK4 A;  4W6B A;  3SVD A;  1YJ2 A;  3AI5 A;  3DQ7 A;  3ST3 A;  3DQ6 A;  4I2Y A;  5DRG A;  3W1D A;  3EK4 A;  1GFL A;  4J88 A;  4PPL A;  2V4E B;  3SVR A;  3LVA A;  1CV7 A;  3SG5 A;  5HGE A;  3SVE A;  2A48 A;  2VZX A;  2O2B A;  2DUF A;  1ZGP A;  2HPW A;  1EMA A;  4L13 A;  3SVN A;  2H8Q A;  3E5W A;  2Y0G A;  3S05 A;  3DQM A;  1H4U A;  3CGL A;  3ST2 A;  3EVR A;  1HUY A;  3MGF A;  4W69 A;  4W6T A;  2VVI A;  1XAE A;  2Z1O A;  4ZF5 A;  2QLG A;  3H1O A;  3U8A A;  3SVO A;  3ED8 A;  4BDU A;  4W6M A;  5DPJ A;  2C9I A;  2DD7 A;  5J2O A;  1F09 A;  4R6B A;  4PPK A;  3EVV A;  4J89 A;  1EMC A;  5DQM A;  5LK4 A;  3LVD A;  1HCJ A;  4EDS A;  5BQL A;  3O78 A;  3WCK A;  4JEO A;  3U0K A;  3DQC A;  2G6X A;  3LF3 A;  2H5Q A;  2YFP A;  3DQN A;  3SVU A;  2O29 A;  3DQO A;  3A8S A;  4DXI A;  1MYW A;  3VHT B;  1B9C A;  3DQ5 A;  4W6N A;  2IE2 A;  1RMP A;  2QU1 A;  3SG7 A;  4ANJ A;  3DPX A;  3LS3 A;  5EB7 A;  5DY6 A;  3P28 A;  3DQL A;  3NEZ A;  4GES B;  1KYR A;  2QLH A;  1GGX A;  2HQK A;  2FZU A;  3H1R A;  4W73 A;  3SSK A;  1EMK A;  1JC1 A;  2HJO A;  3SV5 A;  4LQU A;  4OGS A;  4H48 A;  3AKO A;  3EKJ A;  1MOV A;  5DPI A;  2EMN A;  2H5P A;  3UFZ A;  4EN1 A;  4LJD A;  1ZUX A;  4Z4K A;  1ZGQ A;  3DQI A;  1YZW A;  3SG4 A;  2VVH A;  1JBY A;  4JGE A;  4PFE A;  1YHI A;  3CB9 A;  3WLC A;  2HGD A;  2VAD A;  3ZUJ A;  3O77 A;  4KPI A;  2GW3 A;  4PPJ A;  2DD9 A;  3KCT A;  1Z1P A;  1EML A;  2G5Z B;  4ZIO A;  4IK9 A;  4W6O A;  2DDD A;  4OJ0 A;  3ADF A;  4ZIN A;  1BFP A;  4Q7T A;  3ZUL A;  5H88 A;  4OHS A;  4XVP A;  2G16 B;  4W72 A;  1EME A;  4KW9 A;  1XSS A;  2H5O A;  3SS0 A;  2WHS A;  5T3I A;  1GL4 A;  1OXE A;  4W7A A;  4W6R A;  4W7X A;  2OKY A;  2AWK A;  4DXO A;  4XOV A;  3VHT A;  4KGF A;  1Q73 A;  2A50 B;  2HFC A;  3M24 A;  1C4F A;  4ZFS A;  2OTB A;  4L12 A;  2EMD A;  2AH8 A;  5EJU A;  4HE4 A;  3OGO A;  3ST0 A;  3SVS A;  4XOW A;  2G2S B;  4W6S A;  2DUI A;  4W77 A;  3BXB A;  3DQA A;  1H6R A;  1Q4A A;  5EHU A;  2WSN A;  2A46 A;  2ZO7 A;  2H9W A;  4P76 A; 
#chains in the Genus database with same CATH topology
 3U0M A;  3P8U A;  1RMO A;  2GW4 B;  2Z6Y A;  3GJ1 A;  3DQ8 A;  2C9J A;  1EMB A;  2IB6 A;  5AQB B;  4KF4 A;  3DQF A;  4EDO A;  2A53 B;  2V4E C;  3DQJ A;  4HQC A;  4ZF4 A;  4W6F A;  3VK1 A;  4Q9W A;  2A54 B;  3NT3 A;  3OSR A;  2A47 A;  4W75 A;  4LJD C;  4W7C A;  4EUL A;  4DKM A;  5DQB A;  5FVG A;  5HBD A;  3TMR A;  3W1C A;  3OSQ A;  4LJB A;  1ZGO A;  5DPH A;  1OXD A;  3CBE A;  5DTL A;  3UG0 A;  4GF6 B;  2Z6Z A;  3IR8 A;  4Q7R A;  1Q4D A;  4XGY A;  3I19 A;  1XA9 A;  3VIC A;  3EVU A;  4TZA A;  4W6J A;  2GX2 A;  2DUG A;  2ZMU A;  5EBJ A;  3SSV A;  4DXN A;  2BTJ A;  2WSO A;  1Q4E A;  4ORN A;  2HCG A;  1JBZ A;  2V4E A;  1W7U A;  3DQD A;  4H3N A;  2RH7 A;  2WHU A;  3IP2 A;  1QYO A;  4KGE A;  1YHH A;  4W7F A;  2G3D B;  4W7R A;  1RM9 A;  4W74 A;  2PXS A;  3RWA A;  1KYP A;  4W6H A;  2YDZ A;  1KYS A;  4W6C A;  2Q57 A;  4H3L A;  4HQ9 A;  1Q4C A;  1Z1Q A;  5LTR A;  2HGY A;  5HW9 A;  3E5T A;  4Q7U A;  3GL4 A;  2ZMW A;  3DPW A;  4ZF3 A;  3M22 A;  3PJB A;  2AWJ A;  4KAG A;  5FHV A;  5DRF A;  5HZO A;  2Z6X A;  3SST A;  1QYF A;  2OTE A;  3EK7 A;  1Q4B A;  4JFG A;  4IZN A;  3SSL A;  5H87 A;  2ICR A;  4IK5 A;  5H89 A;  4AS8 A;  1UIS A;  3LA1 A;  3U0L A;  3SSP A;  4XL5 A;  4AR7 A;  1QXT A;  2IOV A;  2B3Q A;  1OXF A;  4RYW A;  3TMT A;  3SG6 A;  3AI4 A;  2Q6P A;  2GX0 A;  3NED A;  3V3D A;  2IB5 A;  3SRY A;  4W6U A;  3E5V A;  4TZG A;  3K1K A;  4W6K A;  4DKN A;  2H5R A;  4ZB1 A;  1JC0 A;  2ZO6 A;  3KCS A;  4HVF A;  2OJK A;  4LJC A;  5F9G A;  5BTT B;  2P4M A;  3ZTF A;  4KF5 A;  4LW5 A;  4IK8 A;  4DXM A;  2POX A;  2DDC A;  2HQZ A;  3BXA A;  3DQH A;  4NWS A;  2G6E A;  4B30 B;  3GJ2 A;  3SG2 A;  5EXU A;  4Q9X A;  4DXP A;  2ARL A;  4W6P A;  1RRX A;  4P1Q A;  3EK8 A;  4W6L A;  3SVB A;  1EMG A;  3CFH A;  4H3M A;  4RYS A;  5HZU A;  1G7K A;  4JF9 A;  2O24 A;  4ZBL A;  3NT9 A;  3SVC A;  3ZUF A;  3BX9 A;  3RWT A;  2AWM A;  3PJ5 A;  4H47 A;  1KP5 A;  3LF4 B;  3LSA A;  3GEX A;  2FL1 A;  4DXQ A;  4KEX A;  3PJ7 A;  3DQE A;  5FVI A;  1YJF A;  3CD9 A;  3BXC A;  4W6D A;  2JAD A;  4KW8 A;  1QY3 A;  5EXC I;  3EVP A;  2A56 B;  5EXB A;  2G6Y A;  2WHT A;  1QYQ A;  3LVC A;  3DQU A;  2OGR A;  3DQK A;  2EMO A;  4W76 A;  2DUH A;  3DQ1 A;  1MOU A;  4GOB A;  4JC2 A;  4B5Y A;  2WIQ A;  4RTC A;  2H6V A;  5DTZ A;  3G9A A;  4W6I A;  3DPZ A;  4IK3 A;  5BTT A;  2QZ0 A;  5DTX A;  4R6D A;  4KW4 A;  2VVJ A;  2QLI A;  4KA9 A;  3WLD A;  1S6Z A;  2YE0 A;  3SSY A;  4B30 A;  3DQ2 A;  4UTS A;  4W7D A;  4W7E A;  3DQ3 A;  2OKW A;  5FVF A;  1YFP A;  3GB3 A;  2QLE A;  5HZT A;  2WUR A;  3CFA A;  3EKH A;  4J8A A;  4KF5 C;  2DUE A;  2WIS A;  2B3P A;  5LTP A;  2YE1 A;  2QLG B;  5DTY A;  3CFF A;  3SSH A;  2A52 B;  5DPG A;  3DQ4 A;  4LQT A;  1XQM A;  5HZS A;  1RMM A;  1W7T A;  4W6A A;  3U0N A;  4IK1 A;  2HRS A;  4U2V A;  1EMM A;  1EMF A;  3NF0 A;  4EMQ A;  5LTQ A;  2FWQ A;  2VAE A;  5KTG A;  3DQ9 A;  4OY4 A;  4W6G A;  3U8C A;  5EB6 A;  5BT0 A;  4N3D A;  2AWL A;  3PIB A;  2AHA A;  4OQW A;  2QT2 A;  4Z4M A;  3SG3 A;  1YHG A;  3ST4 A;  1W7S A;  3U8P A;  4HQ8 A;  1F0B A;  1XMZ A;  2QRF A;  3CD1 A;  5DU0 A;  4JRB A;  4L1I A;  2G3O A;  2PXW A;  4IK4 A;  4W6B A;  3SVD A;  1YJ2 A;  3AI5 A;  3DQ7 A;  3ST3 A;  3DQ6 A;  4I2Y A;  5DRG A;  3W1D A;  3EK4 A;  1GFL A;  4J88 A;  4PPL A;  2V4E B;  3SVR A;  3LVA A;  1CV7 A;  3SG5 A;  5HGE A;  3SVE A;  2A48 A;  2VZX A;  2O2B A;  2DUF A;  1ZGP A;  2HPW A;  1EMA A;  4L13 A;  3SVN A;  2H8Q A;  3E5W A;  2Y0G A;  3S05 A;  3DQM A;  1H4U A;  3CGL A;  3ST2 A;  3EVR A;  1HUY A;  3MGF A;  4W69 A;  4W6T A;  2VVI A;  1XAE A;  2Z1O A;  4ZF5 A;  2QLG A;  3H1O A;  3U8A A;  3SVO A;  3ED8 A;  4BDU A;  4W6M A;  5DPJ A;  2C9I A;  2DD7 A;  5J2O A;  1F09 A;  4R6B A;  4PPK A;  3EVV A;  4J89 A;  1EMC A;  5DQM A;  5LK4 A;  3LVD A;  1HCJ A;  4EDS A;  5BQL A;  3O78 A;  3WCK A;  4JEO A;  3U0K A;  3DQC A;  2G6X A;  3LF3 A;  2H5Q A;  2YFP A;  3DQN A;  3SVU A;  2O29 A;  3DQO A;  3A8S A;  4DXI A;  1MYW A;  3VHT B;  1B9C A;  3DQ5 A;  4W6N A;  2IE2 A;  1RMP A;  2QU1 A;  3SG7 A;  4ANJ A;  3DPX A;  3LS3 A;  5EB7 A;  5DY6 A;  3P28 A;  3DQL A;  3NEZ A;  4GES B;  1KYR A;  2QLH A;  1GGX A;  2HQK A;  2FZU A;  3H1R A;  4W73 A;  3SSK A;  1EMK A;  1JC1 A;  2HJO A;  3SV5 A;  4LQU A;  4OGS A;  4H48 A;  3AKO A;  3EKJ A;  1MOV A;  5DPI A;  2EMN A;  2H5P A;  3UFZ A;  4EN1 A;  4LJD A;  1ZUX A;  4Z4K A;  1ZGQ A;  3DQI A;  1YZW A;  3SG4 A;  2VVH A;  1JBY A;  4JGE A;  4PFE A;  1YHI A;  3CB9 A;  3WLC A;  2HGD A;  2VAD A;  3ZUJ A;  3O77 A;  4KPI A;  2GW3 A;  4PPJ A;  2DD9 A;  3KCT A;  1Z1P A;  1EML A;  2G5Z B;  4ZIO A;  4IK9 A;  4W6O A;  2DDD A;  4OJ0 A;  3ADF A;  4ZIN A;  1BFP A;  4Q7T A;  3ZUL A;  5H88 A;  4OHS A;  4XVP A;  2G16 B;  4W72 A;  1EME A;  4KW9 A;  1XSS A;  2H5O A;  3SS0 A;  2WHS A;  5T3I A;  1GL4 A;  1OXE A;  4W7A A;  4W6R A;  4W7X A;  2OKY A;  2AWK A;  4DXO A;  4XOV A;  3VHT A;  4KGF A;  1Q73 A;  2A50 B;  2HFC A;  3M24 A;  1C4F A;  4ZFS A;  2OTB A;  4L12 A;  2EMD A;  2AH8 A;  5EJU A;  4HE4 A;  3OGO A;  3ST0 A;  3SVS A;  4XOW A;  2G2S B;  4W6S A;  2DUI A;  4W77 A;  3BXB A;  3DQA A;  1H6R A;  1Q4A A;  5EHU A;  2WSN A;  2A46 A;  2ZO7 A;  2H9W A;  4P76 A; 
#chains in the Genus database with same CATH homology
 3U0M A;  3P8U A;  1RMO A;  2GW4 B;  2Z6Y A;  3GJ1 A;  3DQ8 A;  2C9J A;  1EMB A;  2IB6 A;  5AQB B;  4KF4 A;  3DQF A;  4EDO A;  2A53 B;  2V4E C;  3DQJ A;  4HQC A;  4ZF4 A;  4W6F A;  3VK1 A;  4Q9W A;  2A54 B;  3NT3 A;  3OSR A;  2A47 A;  4W75 A;  4LJD C;  4W7C A;  4EUL A;  4DKM A;  5DQB A;  5FVG A;  5HBD A;  3TMR A;  3W1C A;  3OSQ A;  4LJB A;  1ZGO A;  5DPH A;  1OXD A;  3CBE A;  5DTL A;  3UG0 A;  4GF6 B;  2Z6Z A;  3IR8 A;  4Q7R A;  1Q4D A;  4XGY A;  3I19 A;  1XA9 A;  3VIC A;  3EVU A;  4TZA A;  4W6J A;  2GX2 A;  2DUG A;  2ZMU A;  5EBJ A;  3SSV A;  4DXN A;  2BTJ A;  2WSO A;  1Q4E A;  4ORN A;  2HCG A;  1JBZ A;  2V4E A;  1W7U A;  3DQD A;  4H3N A;  2RH7 A;  2WHU A;  3IP2 A;  1QYO A;  4KGE A;  1YHH A;  4W7F A;  2G3D B;  4W7R A;  1RM9 A;  4W74 A;  2PXS A;  3RWA A;  1KYP A;  4W6H A;  2YDZ A;  1KYS A;  4W6C A;  2Q57 A;  4H3L A;  4HQ9 A;  1Q4C A;  1Z1Q A;  5LTR A;  2HGY A;  5HW9 A;  3E5T A;  4Q7U A;  3GL4 A;  2ZMW A;  3DPW A;  4ZF3 A;  3M22 A;  3PJB A;  2AWJ A;  4KAG A;  5FHV A;  5DRF A;  5HZO A;  2Z6X A;  3SST A;  1QYF A;  2OTE A;  3EK7 A;  1Q4B A;  4JFG A;  4IZN A;  3SSL A;  5H87 A;  2ICR A;  4IK5 A;  5H89 A;  4AS8 A;  1UIS A;  3LA1 A;  3U0L A;  3SSP A;  4XL5 A;  4AR7 A;  1QXT A;  2IOV A;  2B3Q A;  1OXF A;  4RYW A;  3TMT A;  3SG6 A;  3AI4 A;  2Q6P A;  2GX0 A;  3NED A;  3V3D A;  2IB5 A;  3SRY A;  4W6U A;  3E5V A;  4TZG A;  3K1K A;  4W6K A;  4DKN A;  2H5R A;  4ZB1 A;  1JC0 A;  2ZO6 A;  3KCS A;  4HVF A;  2OJK A;  4LJC A;  5F9G A;  5BTT B;  2P4M A;  3ZTF A;  4KF5 A;  4LW5 A;  4IK8 A;  4DXM A;  2POX A;  2DDC A;  2HQZ A;  3BXA A;  3DQH A;  4NWS A;  2G6E A;  4B30 B;  3GJ2 A;  3SG2 A;  5EXU A;  4Q9X A;  4DXP A;  2ARL A;  4W6P A;  1RRX A;  4P1Q A;  3EK8 A;  4W6L A;  3SVB A;  1EMG A;  3CFH A;  4H3M A;  4RYS A;  5HZU A;  1G7K A;  4JF9 A;  2O24 A;  4ZBL A;  3NT9 A;  3SVC A;  3ZUF A;  3BX9 A;  3RWT A;  2AWM A;  3PJ5 A;  4H47 A;  1KP5 A;  3LF4 B;  3LSA A;  3GEX A;  2FL1 A;  4DXQ A;  4KEX A;  3PJ7 A;  3DQE A;  5FVI A;  1YJF A;  3CD9 A;  3BXC A;  4W6D A;  2JAD A;  4KW8 A;  1QY3 A;  5EXC I;  3EVP A;  2A56 B;  5EXB A;  2G6Y A;  2WHT A;  1QYQ A;  3LVC A;  3DQU A;  2OGR A;  3DQK A;  2EMO A;  4W76 A;  2DUH A;  3DQ1 A;  1MOU A;  4GOB A;  4JC2 A;  4B5Y A;  2WIQ A;  4RTC A;  2H6V A;  5DTZ A;  3G9A A;  4W6I A;  3DPZ A;  4IK3 A;  5BTT A;  2QZ0 A;  5DTX A;  4R6D A;  4KW4 A;  2VVJ A;  2QLI A;  4KA9 A;  3WLD A;  1S6Z A;  2YE0 A;  3SSY A;  4B30 A;  3DQ2 A;  4UTS A;  4W7D A;  4W7E A;  3DQ3 A;  2OKW A;  5FVF A;  1YFP A;  3GB3 A;  2QLE A;  5HZT A;  2WUR A;  3CFA A;  3EKH A;  4J8A A;  4KF5 C;  2DUE A;  2WIS A;  2B3P A;  5LTP A;  2YE1 A;  2QLG B;  5DTY A;  3CFF A;  3SSH A;  2A52 B;  5DPG A;  3DQ4 A;  4LQT A;  1XQM A;  5HZS A;  1RMM A;  1W7T A;  4W6A A;  3U0N A;  4IK1 A;  2HRS A;  4U2V A;  1EMM A;  1EMF A;  3NF0 A;  4EMQ A;  5LTQ A;  2FWQ A;  2VAE A;  5KTG A;  3DQ9 A;  4OY4 A;  4W6G A;  3U8C A;  5EB6 A;  5BT0 A;  4N3D A;  2AWL A;  3PIB A;  2AHA A;  4OQW A;  2QT2 A;  4Z4M A;  3SG3 A;  1YHG A;  3ST4 A;  1W7S A;  3U8P A;  4HQ8 A;  1F0B A;  1XMZ A;  2QRF A;  3CD1 A;  5DU0 A;  4JRB A;  4L1I A;  2G3O A;  2PXW A;  4IK4 A;  4W6B A;  3SVD A;  1YJ2 A;  3AI5 A;  3DQ7 A;  3ST3 A;  3DQ6 A;  4I2Y A;  5DRG A;  3W1D A;  3EK4 A;  1GFL A;  4J88 A;  4PPL A;  2V4E B;  3SVR A;  3LVA A;  1CV7 A;  3SG5 A;  5HGE A;  3SVE A;  2A48 A;  2VZX A;  2O2B A;  2DUF A;  1ZGP A;  2HPW A;  1EMA A;  4L13 A;  3SVN A;  2H8Q A;  3E5W A;  2Y0G A;  3S05 A;  3DQM A;  1H4U A;  3CGL A;  3ST2 A;  3EVR A;  1HUY A;  3MGF A;  4W69 A;  4W6T A;  2VVI A;  1XAE A;  2Z1O A;  4ZF5 A;  2QLG A;  3H1O A;  3U8A A;  3SVO A;  3ED8 A;  4BDU A;  4W6M A;  5DPJ A;  2C9I A;  2DD7 A;  5J2O A;  1F09 A;  4R6B A;  4PPK A;  3EVV A;  4J89 A;  1EMC A;  5DQM A;  5LK4 A;  3LVD A;  1HCJ A;  4EDS A;  5BQL A;  3O78 A;  3WCK A;  4JEO A;  3U0K A;  3DQC A;  2G6X A;  3LF3 A;  2H5Q A;  2YFP A;  3DQN A;  3SVU A;  2O29 A;  3DQO A;  3A8S A;  4DXI A;  1MYW A;  3VHT B;  1B9C A;  3DQ5 A;  4W6N A;  2IE2 A;  1RMP A;  2QU1 A;  3SG7 A;  4ANJ A;  3DPX A;  3LS3 A;  5EB7 A;  5DY6 A;  3P28 A;  3DQL A;  3NEZ A;  4GES B;  1KYR A;  2QLH A;  1GGX A;  2HQK A;  2FZU A;  3H1R A;  4W73 A;  3SSK A;  1EMK A;  1JC1 A;  2HJO A;  3SV5 A;  4LQU A;  4OGS A;  4H48 A;  3AKO A;  3EKJ A;  1MOV A;  5DPI A;  2EMN A;  2H5P A;  3UFZ A;  4EN1 A;  4LJD A;  1ZUX A;  4Z4K A;  1ZGQ A;  3DQI A;  1YZW A;  3SG4 A;  2VVH A;  1JBY A;  4JGE A;  4PFE A;  1YHI A;  3CB9 A;  3WLC A;  2HGD A;  2VAD A;  3ZUJ A;  3O77 A;  4KPI A;  2GW3 A;  4PPJ A;  2DD9 A;  3KCT A;  1Z1P A;  1EML A;  2G5Z B;  4ZIO A;  4IK9 A;  4W6O A;  2DDD A;  4OJ0 A;  3ADF A;  4ZIN A;  1BFP A;  4Q7T A;  3ZUL A;  5H88 A;  4OHS A;  4XVP A;  2G16 B;  4W72 A;  1EME A;  4KW9 A;  1XSS A;  2H5O A;  3SS0 A;  2WHS A;  5T3I A;  1GL4 A;  1OXE A;  4W7A A;  4W6R A;  4W7X A;  2OKY A;  2AWK A;  4DXO A;  4XOV A;  3VHT A;  4KGF A;  1Q73 A;  2A50 B;  2HFC A;  3M24 A;  1C4F A;  4ZFS A;  2OTB A;  4L12 A;  2EMD A;  2AH8 A;  5EJU A;  4HE4 A;  3OGO A;  3ST0 A;  3SVS A;  4XOW A;  2G2S B;  4W6S A;  2DUI A;  4W77 A;  3BXB A;  3DQA A;  1H6R A;  1Q4A A;  5EHU A;  2WSN A;  2A46 A;  2ZO7 A;  2H9W A;  4P76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...