3SG6A

Crystal structure of dimeric gcamp2-lia(linker 1)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
409
structure length
383
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLIANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 125
structure length 383
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg6A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg6A01
2LE9B 3A4UB 1QTXA 1B7TZ 1Q4EA 5HLVA 2LVJA 1DJHA 5AERA 3DQ4A 4I2YA 1GQMA 3BXKA 2KBMA 4W6OA 2L5XB 3PLFB 1GL4A 2JXCA 2JWWA 3DQ6A 5HKYA 2P6BB 1NCYA 3SVOA 3KPXA 1QATA 2A4JA 2DD9A 1RFJA 3VRPA 3DVMA 2K8MB 2VVJA 5G08A 5CPVA 3LK1A 4D1EA 1S6JA 1XFUO 3BUMB 3TS5C 1QIWA 4AR7A 3I5FC 4N1FA 2QLIA 3AKBA 3WCKA 4JC2A 1L7ZA 2QLHA 2KFGA 4Q7UA 4M2PA 4L13A 2PASA 4DUQA 4PE7A 3LK0A 5CSJA 1AJ4A 2SCPA 2PALA 2O60A 3VRRA 3CB9A 2IS9A 4CPVA 4Q9WA 4W7CA 1F4OA 2BCBA 4MZKA 5HKWA 4N5XA 1IJ6A 1KCYA 3ST0A 4DXNA 4HQ8A 3DVJA 2DUFA 1XK4C 1Q4BA 2QLEA 4P1QA 4KPIA 2M8UA 4BY4A 4NDBA 1B8CA 2A48A 2JT0A 3ZTFA 4ZFSA 3SIAA 1DF0B 1XFYO 1IGVA 2Y1NA 1NUBA 1UHIA 2A56B 2WCFA 4DXPA 4OY4A 1N2DA 1NX3A 3CFFA 1MXLC 2WC8A 4H48A 3DQLA 1QJTA 4UPGA 2Z1OA 1YUSA 3EK7A 1W7TA 5DTXA 4HQCA 1SR6B 1XFWO 2LP3A 2O29A 4DKNA 2LHIA 2AHAA 5F6TA 1QX5B 3DQMA 1M63B 2F2PA 2MLEC 5JJGA 1QYQA 4PE4A 1B9AA 2CNPA 2K2FA 3NT3A 3DQ1A 4CLNA 4JWQA 1KYRA 5K89A 1JF0A 4U2VA 2KI4B 2DUHA 4W6HA 1OZOA 5EBJA 1A2XA 2FZUA 1GGWA 3DF0A 5PALA 1TIZA 2L51A 1BLQA 1F0BA 2H2KA 2E6WA 2JPTA 4A4BA 1ZACA 4AS8A 1PALA 4JRBA 4W72A 3MGFA 3LSAA 2JT8A 3CS1A 3HCMA 3AI5A 3WHTB 1SL7A 4JEOA 1EG4A 2B1UA 1RTP1 2VVIA 5LTRA 3DVEA 2O5GA 2PXWA 3DQHA 3ICBA 4XOVA 1F4QA 2NCPA 3DQ2A 1DGUA 1CFDA 4EULA 3SSTA 3OP0A 2WISA 1DJWA 4Q7RA 2COLB 1OMVA 1CB1A 1EMCA 2L98A 4XOWA 2V4EB 5CSNA 4JFGA 1OOJA 3NSIA 4OV2A 2O2BA 3K1KA 1WRKA 4J88A 2Y1MA 2MA2A 4YRUA 1AJ5A 2KQ6A 3VICA 3LS3A 2JNFA 3DQEA 3IQOA 3VROA 4GGFA 2OKWA 3SSVA 4AOMA 3PN7B 1N65A 1YUUA 3PJ7A 2GGZA 4XYNA 2LMUA 4W6JA 1SL9A 3BXAA 1OZSA 1J7RA 2KNEA 3IF7A 4CIDA 1F09A 2POXA 1U5IA 3RLZA 2ICRA 2L2EA 4ZF3A 5KTGA 4H3MA 2BKHB 1DT7B 3H1OA 2A54B 1OQPA 2Y4QA 4YGBB 2RH7A 4IK8A 1ZUXA 1KQMB 2GW3A 4P76A 3JVTB 1KSOA 5H89A 2KGBC 1YVLA 3TDIA 1BMOA 1R6PA 2MLFC 1SCMC 3A8RA 5I8NA 1SR6C 1QIVA 2F3ZA 2FJUB 4RTCA 4JQ0D 5DKQA 1Z1PA 2WHUA 3D10A 2M7LA 5BTTA 3DQIA 4XL5A 4W6RA 1IJ5A 4ORBB 2F8PA 1YZWA 3JTDC 3I19A 2C9IA 1TRFA 3SIBA 1QX7A 2F2OA 3RWAA 3E5TA 1CDLA 1XVJA 2WIQA 2K2AA 3RM1A 3SSYA 3SG6A 1S26D 4E68A 1MR8A 2LANA 1JF2A 4GGFC 3D0YA 1EMGA 2WCBA 4ANJA 1QXTA 4H3NA 3KCSA 1K90D 5EXBA 1LA0A 1B47A 4EDOA 1IG5A 3DQUA 3OX6A 1B7TY 2HCGA 2KYFA 2OTBA 3TS5B 4ZIOA 2ZMWA 5LK4A 2M1KB 4H3LA 4ICBA 1SK6D 2FCEA 5DKNA 3NEZA 3VHTA 4HE4A 3PM8A 5EHUA 3NSKA 5H88A 1Z1QA 4NDDA 4DXQA 2PSRA 4P5OE 1OXEA 1ALVA 3LLEA 1YVHA 2H8QA 2FOTA 3O4YA 4QJ5B 2R2IA 1QVIZ 1WDCC 4PPJA 1BJFA 4GNKB 2ARLA 2MRDA 5DPIA 4M2OA 3CGLA 1KQVA 5D69A 5KTYA 1RMMA 2H5QA 2G2BA 4B5YA 4YGCB 5FVIA 5EXCI 1D1OA 4MEWA 1H6RA 3OGOA 1FF1A 2BE6A 1EJ3A 1EMKA 1AUIB 5BQLA 5ER4X 1Q4DA 5FHVA 1QLSA 1S36A 4EN1A 3TMRA 1CDMA 2FCDA 1QV1A 5D7FA 4QJ3B 5HBDA 2LMTA 3HX4A 1QYFA 2HQWA 4KF5A 1Y0VH 3TZ1A 2BBNA 2YE1A 3DQ9A 1TNXA 1KWOC 5HYDA 1GGXA 2CXJA 3WXAA 2L0PA 2EMOA 1TTXA 4B30B 1NYAA 1EG3A 4IL1A 2LUXA 5DY6A 4PFEA 4GESB 1PVAA 1BF5A 4LJCA 3W1CA 1JC1A 3KEVA 2NCOA 4XGYA 1EL4A 1RECA 1F71A 1J1EA 4HVFA 3CGAA 1V1GA 4PHJA 4W7AA 4W73A 1F70A 2JU0A 5DU0A 5CSIA 1ZMZA 5BT0A 2BCXA 1SY9A 1YRUB 4W6IA 3H4SE 4RYSA 4DRWA 1AK8A 2MBXA 2O24A 4HQ9A 4R6BA 4JPZB 1Q73A 2LV7A 1K9UA 4W6CA 4BDUA 1EMFA 3TDZA 3U8PA 2AWJA 3SG5A 4ZF5A 1NIWA 1W7IB 4KGFA 1PULA 1IH0A 3NF0A 2G2SB 2H6VA 1UHHA 1Q4CA 1H4BA 3U0MA 2AMIA 1AP4A 1KFUL 4PDZA 2MHHA 2NZ0A 5F9GA 3CWGA 1TNPA 1LINA 2G6YA 2LVVA 4USLA 4MSPA 2PMYA 5IBWA 3M0WA 1ZGQA 1BFPA 3PJBA 2MAZA 1XO5A 4N1GA 2QLGA 2P4MA 3LVDA 4IK3A 4ORCB 1G33A 2VADA 3GOFA 3ST3A 1H8BA 1HT9A 4MRYA 5LTQA 1UP5A 1XMZA 4XVPA 5I2QA 3P8UA 1E8AA 2IB6A 3FWCA 3SG3A 2QACA 3GK2A 3MSEB 4OCIA 1BR4B 4W7DA 4W6BA 3ZWHA 3VK1A 4TZGA 3DPZA 2JNXA 2BTJA 4MZJA 4W6UA 3E5VA 3QRXA 5DKRA 3DF0B 1K9PA 2M29A 4J89A 4L1IA 4LJDA 1JWDA 1S6CA 3BUNB 4ZBLA 1SCMB 1G7KA 2KGRA 2WORA 2L4IA 5DPGA 3OHMB 5HZOA 2QZ0A 2JULA 5ER5A 3SV5A 3H1RA 2JQ6A 3CR5X 4GF6B 1KFXL 1MXEA 1CLLA 2I2RE 3OB1B 2WNDA 1NP8A 3ST2A 3K21A 3DQ3A 2ZN9A 4W7XA 4OGSA 4PPLA 1RK9A 3DQJA 3JTDB 1C7VA 1WRLA 1SBJA 4IK1A 1KFUS 4KAGA 4PHKA 1QASA 3GJ1A 1X02A 3CZTX 1FBVA 4W75A 4PE0A 1XYDA 2M1UA 1DF0A 1UWOA 1SRAA 3E5WA 1AHRA 2L4HA 1UURA 2AWMA 1QXPA 1G8IA 1S3PA 1MUXA 3CFAA 2OTEA 4Z4MA 1MHOA 1U5IB 2Z6XA 3SVNA 2F33A 1YX7A 2D8NA 4KA9A 2JOJA 1BG1A 1K93D 1H4UA 4ZF4A 4I5KA 4GUKA 3TUYC 1ZOTB 2BKIB 1JC2A 3SVDA 4YBHB 2I7AA 1JFKA 4MZLA 5H87A 1UUSA 1MOUA 1R2UA 2BBMA 1KK7Y 2DOQA 2HFCA 1SMGA 5LTPA 1LKJA 1CLBA 5J3XA 1WDCB 3SG7A 1C4FA 2HGYA 2PRUA 1QV0A 2HETA 4W6AA 5BTTB 1PVBA 3IQQA 3KF9A 4ZB1A 5HZSA 2SASA 4DXOA 2VZXA 3F45A 2VAEA 3VRQA 1UHJA 2Z6YA 1KFXS 4Q9XA 3ZNIA 3GL4A 4C0KA 4W77A 1SPYA 4NDCA 4KEXA 2LC5A 3IP2A 2M9GA 3BQ3A 2JZIA 3WLDA 2M0RA 3DQOA 3GK1A 2KFFA 3D0YB 3LCPC 1NX1A 3SVSA 5DTLA 4JGEA 1KWOB 3FWBA 1M31A 4W76A 1TOPA 2AH8A 3SG2A 4W6LA 3BUWB 2NXQA 1FI6A 2Y5IA 1CFFA 4XJKA 4GFTA 1C07A 1A03A 4MLWA 5DPHA 5FVFA 3BOWA 2K61A 2DUEA 1OMRA 1CMFA 2GW4B 5EXUA 3KO0A 3SG4A 1KSMA 2WCEA 2HPSA 4TZAA 1JFJA 3P28A 4W7EA 2M7NA 3I5HC 2E30A 1KK8C 1RRXA 4N3DA 1K9KA 1NCXA 5DRGA 4I5NB 2HRSA 4AQJA 4IK9A 1CDNA 5J2OA 4PALA 5DQMA 2EGDA 5KSZA 5DPJA 4KGEA 3O78A 3BUXB 2MJWB 2AWLA 1NWDA 1Y1UA 1YJFA 2K0JA 2HQZA 1SNLA 1DJGA 4LQUA 5B8IB 1GJYA 2QU1A 3LVAA 2BL0B 1QYOA 2A47A 2LAPA 1CTRA 4PHNA 2OJKA 1K95A 2KOTA 1OXDA 1CFPA 1OXFA 4DXIA 1MYWA 3NXAA 3SSHA 1B4CA 3TMTA 4LW5A 2H5OA 2DUIA 1JUOA 2WURA 3DD4A 2QPTA 2EC6C 2GX0A 4M2QA 1WLZA 2KFHA 1M39A 1MOVA 4W6GA 3DPWA 1A75A 4LQTA 2F3YA 1PRWA 2DDDA 1NCZA 3WNXB 3DQAA 2Q6PA 2Q91A 2JRFA 2CTNA 4YGAA 4LJBA 4MVFA 3U8CA 1DJYA 1TNQA 2B3QA 2H9WA 1K2HA 2WOSA 1UHNA 2Z6ZA 3WLCA 1C7WA 2KHNA 1B1GA 1IKUA 4ZCUA 3TDUA 4R6DA 4P2YB 2KAXA 4W7RA 3O6BA 4HRHA 1S6IA 5DQBA 1CDPA 2HGDA 3CR2A 1HCJA 1ZGPA 1B9CA 2OS8C 4W6PA 2A50B 2G5ZB 4KW4A 5HGEA 1CM4A 2ZN8A 2OPOA 2LLUA 1S1EA 2EMNA 1EMMA 1QY3A 2HF5A 1CM1A 1PSBA 1YURA 4JF9A 2ZFDA 3S05A 1OMDA 2H61A 2OTGC 3OSQA 3LVCA 1SL8A 4GOBA 1RMOA 3SVCA 5FYXA 1CKKA 4DKMA 3CTNA 1EMEA 4AQIA 2ZMUA 3AAKA 4I5JA 2ZRSA 2JADA 2G9BA 2LLTA 1XK4A 1YR5A 3I5IC 2LMVA 2BECA 2KAYA 1N0YA 1YHHA 1OE9B 1NPQA 3CR4X 1JC0A 3SVUA 2QLGB 2FWQA 3GK4X 4YGDB 3SSPA 2NLNA 3DQ7A 4KF4A 1CFCA 4YI8A 3LL8B 1B8LA 1YX8A 3DQCA 3NSOA 1WLMA 1RJVA 5EJUA 2BL0C 4B30A 1QLKA 2PXSA 3AKAA 2K7CA 2OKYA 4KF5C 2FL1A 1RROA 1W7UA 1SW8A 3FIAA 4PE1A 1J1DA 2ZO7A 2WHSA 2KAVA 4W69A 2VVHA 3BXBA 1CMGA 1KYSA 3TUYB 5HKZA 2KYCA 2GV5A 1YUTA 1EH2A 4GAOA 4TNCA 5HW9A 2HJOA 1GFLA 4W6SA 2H61C 1LVCD 1DTLA 2HQ8A 2QT2A 2B3PA 2DUGA 2OGRA 1L2OC 4OR9B 3SRYA 4NQGA 1ZUZA 4RYWA 4NWSA 4PCWA 4ZCVA 4HRGA 1V1FA 2JXLA 4F0ZB 1RMPA 1YFPA 3M24A 1UHKA 3DQNA 1A29A 3RWTA 3SSLA 4I5LB 2AUCA 3DQFA 2AAOA 5FVGA 5AFPA 4GPLB 1PSRA 1LXFC 2JTZA 4PHMA 5EB6A 4FTGA 1FPWA 1S5GZ 4DS7A 3OX5A 2CCMA 4Q04A 2HQKA 3CD1A 1ODBA 4J8AA 3GB3A 2G3DB 3LF3A 3NT9A 1DJZA 3BUOB 3EK4A 1Y1AA 4WRIA 1CNPA 3IR8A 3I5GC 4ZINA 4ETOA 1DJIA 4YI9A 3NSLA 2EMDA 3EVVA 2IB5A 4KW9A 3EKHA 4YGEB 2KBIA 3M22A 3CFHA 4OVNF 1Q4AA 1J7QA 1W7JB 4EDSA 4FQOA 1XFVO 4OQWA 2KQYA 3PSRA 1BR1B 5DTYA 5CSFA 1BT6A 4IK4A 2I94A 3PFVA 3VGOA 5BPJA 3AI4A 2WHTA 3EVUA 2I18A 3KHEA 2JTTA 3I5HB 2GX2A 4DIRA 5AEQA 1HUYA 2JC2A 4QJ4B 1KK8B 1DGVA 3PATA 5TNCA 3CD9A 3UFZA 4MRXA 1DJXA 2RGIA 1B8RA 1TNWA 2QRFA 1XSSA 1YTZC 4DCKA 3CLNA 4L12A 3CBEA 3SVRA 1BU3A 1DMOA 1XAEA 3OB2B 1EMLA 3BX9A 4KW8A 4LJDC 2KSPA 5EB7A 2WSOA 4W6FA 1ALWA 1AVSA 2CT9A 3OSRA 2G6XA 4MN0A 3FS7A 1MQ1A 2KI6C 2BE4A 1CLMA 4W6KA 2CBLA 4GGNA 4EMQA 1JBAA 3ZULA 3U8AA 3A8SA 3GJ2A 3EVPA 1NX2A 3DVKA 4W6DA 3WHUB 2EC6B 4XJKB 5HZUA 5GQQC 3BOWB 2Y0GA 3C1VA 4IK5A 3KCTA 2ISDA 5DTZA 3SS0A 1J7PA 1TN4A 4W7FA 2G16B 3ZUFA 2WSNA 4GBAA 3EVRA 1OSAA 4W6TA 2ZNEA 1F54A 2V53A 3LA1A 1QVIY 2LVIA 2EHBA 3DQ5A 1BODA 5HZTA 3BYAA 1NX0A 3V3DA 1XFXO 2A52B 3U0LA 4BY5A 2G3OA 2L50A 2YE0A 2KDHA 4HSZA 2ZKMX 3GEXA 2LLSA 4WQ2A 3DPXA 2DD7A 1M46A 3U0NA 1UISA 2OS8B 2V4EA 1IRJA 1XFZO 4W6NA 1DVIA 1NSHA 1M45A 4CFRA 2H5RA 1W7SA 3UG0A 3AKOA 1IWQA 1YJ2A 1IQ3A 3O2PA 2OTGB 5AANA 2LNKA 3VHTB 2IE2A 4MBEA 4OJ0A 4W6MA 4Q7TA 1FI5A 1VRKA 1YHGA 2IOVA 2TN4A 2KI4C 4C0JA 3I5IB 5AQBB 4H47A 3EK8A 2HPWA 3SVBA 4U8DA 1WY9A 1RM9A 3PIBA 3ST4A 1K8UA 1KYPA 1BOCA 1JBYA 4W74A 3EKJA 4A4CA 1ZFSA 1J7OA 1ZGOA 2M49B 1XA9A 4ORAB 2H5PA 1A75B 1G4YR 1TCFA 1QS7A 5DRFA 4WQ3A 2Q57A 1SYMA 2LVKA 3PALA 1TCOB 4R1EA 1IQ5A 1KK7Z 2LP2A 2PVBA 2AWKA 2M97A 2M3WA 1JBZA 1QX2A 3I5FB 1EMBA 1GGZA 3SVEA 4Z4KA 1F8HA 1K96A 2V4EC 3ADFA 2DDCA 1RWYA 2K7BA 3DQKA 1YHIA 3W1DA 4OKHA 3LF4B 2G6EA 1CV7A 2A53B 3DQ8A 3O77A 4CFQA 1PK0D 5T3IA 2YDZA 5KU1A 1HQVA 3DQDA 3ED8A 2A46A 1K94A 2ZRTA 3G9AA 3PN7C 3VRNA 2K7DA 4HREE 2YFPA 1EMAA 2BCAA 1YRTB 3E3RA 2Q4UA 1L2OB 2ZO6A 3NEDA 4DXMA 1S6ZA 1EXRA 2LHLA 3SJSA 5I2OA 4OHSA 2JT3A 5I2LA 1Q80A 1A4PA 2K7OA 1WRZA 1KQMC 1Y6WA 3JVTC 3BXCA 3U0KA 2VRGA 2LCPA 1KP5A 3SSKA 3AAJA 3I5GB 4L9MA 2ZNDA 1JSAA 2KI6D 1F55A 3PJ5A 5HLOA 5JOLA 2C9JA 4PPKA 4ORNA 1XQMA 1XA5A 4IZNA 3ZUJA 1MF8B 1FW4A 2LM5A 1SKTA 4UTSA 1MWNA 1S5GY 1J55A 1Y1XA 1LA3A 5AXIA 1SCVA 2LUCA 4C0LA 2GGMA
chains in the Genus database with same CATH superfamily
2LE9B 3A4UB 1QTXA 1B7TZ 2H8VA 1Q4EA 5HLVA 2LVJA 1DJHA 5AERA 3DZTA 3DQ4A 4I2YA 4KYNA 1GQMA 3BXKA 2KBMA 4W6OA 2L5XB 3PLFB 1GL4A 2JXCA 2JWWA 3DQ6A 5HKYA 2L5YA 1NCYA 2P6BB 3L4LA 2L2CA 3SVOA 3KPXA 3CZ2A 1QATA 2A4JA 2DD9A 1RFJA 3VRPA 3DVMA 2K8MB 2VVJA 5G08A 3SS4A 5CPVA 3LK1A 4D1EA 1S6JA 1XFUO 3BUMB 3TS5C 1QIWA 4AR7A 3I5FC 4N1FA 2WCKA 2QLIA 3AKBA 3WCKA 4JC2A 1L7ZA 2QLHA 2KFGA 4Q7UA 4M2PA 4L13A 2PASA 4DUQA 4PE7A 3LK0A 5CSJA 1AJ4A 2ERBA 5FI6A 2SCPA 2PALA 2O60A 3VRRA 3CB9A 2IS9A 4CPVA 4Q9WA 4W7CA 1F4OA 2BCBA 4MZKA 5HKWA 4N5XA 1IJ6A 1KCYA 3ST0A 4DXNA 4HQ8A 3DVJA 3DXLA 2DUFA 1XK4C 1Q4BA 2QLEA 4P1QA 1QWVA 4KPIA 2M8UA 4BY4A 4NDBA 1B8CA 2A48A 2JT0A 3ZTFA 4ZFSA 3SIAA 1DF0B 1XFYO 1IGVA 2Y1NA 1NUBA 1UHIA 2A56B 2WCFA 4DXPA 4OY4A 1N2DA 1NX3A 3CFFA 1MXLC 2WC8A 4H48A 3DQLA 1QJTA 4UPGA 2Z1OA 1YUSA 3EK7A 1W7TA 5DTXA 4HQCA 2FJYA 1SR6B 1XFWO 2LP3A 2O29A 4DKNA 2LHIA 2AHAA 5F6TA 1QX5B 3DQMA 1M63B 2F2PA 2MLEC 3OBVA 5JJGA 1QYQA 4PE4A 1B9AA 2CNPA 1OW4A 3OGNA 2K2FA 3NT3A 3DQ1A 4CLNA 4JWQA 1KYRA 5K89A 1JF0A 4U2VA 2KI4B 2DUHA 4W6HA 1OZOA 5EBJA 1A2XA 2FZUA 1GGWA 3DF0A 5PALA 1TIZA 2L51A 1BLQA 1F0BA 2H2KA 2E6WA 3NGVA 2JPTA 4A4BA 1TUZA 1ZACA 4AS8A 1PALA 4JRBA 4W72A 3MGFA 3LSAA 2JT8A 3CS1A 3HCMA 3AI5A 3WHTB 1SL7A 4JEOA 1EG4A 2B1UA 1RTP1 2VVIA 5LTRA 3DVEA 2O5GA 2PXWA 3DQHA 3ICBA 4XOVA 1F4QA 2NCPA 3DQ2A 1DGUA 1CFDA 4EULA 3SSTA 4JKTA 3OP0A 2WISA 1DJWA 4Q7RA 2COLB 1OMVA 1CB1A 2YGUA 1EMCA 2L98A 3D75A 4XOWA 2V4EB 5CSNA 4JFGA 1OOJA 3NSIA 4OV2A 2O2BA 3K1KA 1WRKA 4J88A 2Y1MA 2MA2A 4YRUA 2WCHA 1AJ5A 2KQ6A 3VICA 3LS3A 2JNFA 3DQEA 3CZ0A 3IQOA 3VROA 4GGFA 2OKWA 3SSVA 4AOMA 3PN7B 1N65A 1YUUA 3PJ7A 2GGZA 4XYNA 2LMUA 4W6JA 1SL9A 3S0AA 3BXAA 1OZSA 1J7RA 2KNEA 3IF7A 4CIDA 1F09A 2POXA 1U5IA 3RLZA 2ICRA 2L2EA 4ZF3A 5KTGA 4H3MA 2BKHB 1DT7B 3H1OA 2A54B 1OQPA 2Y4QA 4YGBB 2RH7A 4IK8A 1ZUXA 1KQMB 2GW3A 4P76A 3JVTB 1KSOA 5H89A 2KGBC 1YVLA 3TDIA 1BMOA 1R6PA 2MLFC 1SCMC 3A8RA 5I8NA 1C3YA 1SR6C 1QIVA 2QEBA 2F3ZA 2FJUB 4RTCA 4JQ0D 5DKQA 1Z1PA 2WHUA 3D10A 2M7LA 5BTTA 3R1PA 3DQIA 4XL5A 4W6RA 1IJ5A 4ORBB 2F8PA 1YZWA 3JTDC 3I19A 2C9IA 1TRFA 3SIBA 1QX7A 2F2OA 3RWAA 3E5TA 1CDLA 1XVJA 3S0FA 2WIQA 2K2AA 3RM1A 3SSYA 3SG6A 2GTEA 1S26D 4E68A 1MR8A 2LANA 1JF2A 3D77A 4GGFC 3D0YA 1EMGA 2WCBA 4ANJA 2WCLA 1QXTA 4H3NA 3KCSA 1K90D 5EXBA 1LA0A 3VB1A 1B47A 4EDOA 1IG5A 3DQUA 3OX6A 1B7TY 2BAPA 2HCGA 2KYFA 2OTBA 3TS5B 4ZIOA 2ZMWA 5LK4A 2M1KB 4H3LA 4ICBA 1SK6D 2QEOA 2FCEA 5DKNA 3NEZA 3VHTA 4HE4A 3PM8A 5EHUA 3NSKA 5H88A 1Z1QA 4NDDA 4DXQA 2PSRA 4P5OE 1OXEA 3UNWA 1ALVA 3LLEA 1YVHA 2H8QA 2FOTA 3O4YA 4QJ5B 2R2IA 1QVIZ 1WDCC 4PPJA 1BJFA 4GNKB 2ARLA 2MRDA 5DPIA 4M2OA 3CGLA 1KQVA 5D69A 5KTYA 1RMMA 2H5QA 2G2BA 4B5YA 4YGCB 5FVIA 3NHTA 5EXCI 1D1OA 4MEWA 1H6RA 1LS8A 3OGOA 1FF1A 1P28A 2BE6A 1EJ3A 1EMKA 1AUIB 5EL2A 3D76A 5BQLA 5ER4X 1Q4DA 3R72A 5FHVA 1QLSA 1S36A 4EN1A 3TMRA 1CDMA 2FCDA 1QV1A 5D7FA 4QJ3B 5HBDA 2LMTA 3HX4A 1QYFA 2HQWA 4KF5A 1Y0VH 3TZ1A 2BBNA 2YE1A 3DQ9A 1TNXA 1KWOC 5HYDA 1GGXA 2CXJA 3WXAA 2L0PA 2EMOA 1TTXA 4B30B 1NYAA 1EG3A 1DC1A 4IL1A 2LUXA 5DY6A 4PFEA 4GESB 1PVAA 1BF5A 2KLDA 4LJCA 3W1CA 1JC1A 3KEVA 2NCOA 4XGYA 1EL4A 1RECA 1F71A 1J1EA 4HVFA 3CGAA 1V1GA 4PHJA 4W7AA 4W73A 1F70A 1DELA 2JU0A 1SSEB 3D74A 3N7HA 1DEKA 5DU0A 5CSIA 1ZMZA 5BT0A 2BCXA 1SY9A 3BFAA 1YRUB 4W6IA 3H4SE 4RYSA 4DRWA 1AK8A 5DICA 2MBXA 2O24A 3R1VA 4HQ9A 4R6BA 4JPZB 2K60A 1Q73A 2LV7A 1K9UA 4W6CA 4BDUA 1EMFA 3TDZA 4PT1A 3U8PA 2AWJA 3SG5A 4ZF5A 1NIWA 1W7IB 4KGFA 1PULA 1IH0A 3NF0A 2G2SB 2H6VA 1UHHA 1Q4CA 1H4BA 3U0MA 2AMIA 1AP4A 1KFUL 4PDZA 2MHHA 2NZ0A 5F9GA 3CWGA 1TNPA 1LINA 2G6YA 2LVVA 4USLA 4MSPA 2PMYA 5IBWA 3M0WA 1ZGQA 1BFPA 3PJBA 2MAZA 3BJHA 1XO5A 1DQEA 4N1GA 3D78A 2QLGA 2P4MA 3LVDA 1W9ZA 4IK3A 4ORCB 1G33A 2VADA 3GOFA 3ST3A 1H8BA 1HT9A 4MRYA 5LTQA 1UP5A 1XMZA 4XVPA 5I2QA 3P8UA 1E8AA 2IB6A 3FWCA 3SG3A 2QACA 3GK2A 3MSEB 4OCIA 1BR4B 4W7DA 4W6BA 3ZWHA 3VK1A 4TZGA 3DPZA 2JNXA 5FI7A 2BTJA 4MZJA 4W6UA 3E5VA 3QRXA 5DKRA 3DF0B 1K9PA 2M29A 4J89A 4L1IA 4LJDA 1JWDA 1S6CA 3BUNB 4ZBLA 1SCMB 1G7KA 2KGRA 2WORA 2L4IA 5DPGA 3OHMB 5HZOA 2QZ0A 2JULA 5ER5A 3SV5A 3H1RA 2JQ6A 3CR5X 4GF6B 1KFXL 1MXEA 1CLLA 2I2RE 3OB1B 2WNDA 1NP8A 3ST2A 3K21A 3DQ3A 3BFBA 2ZN9A 4W7XA 4OGSA 4PPLA 1RK9A 3DQJA 3JTDB 1C7VA 1WRLA 1SBJA 4IK1A 1KFUS 4KAGA 4PHKA 1QASA 3GJ1A 1X02A 3CZTX 1FBVA 4W75A 4PE0A 1XYDA 2M1UA 1DF0A 1UWOA 3V2LA 1SRAA 3E5WA 1AHRA 2L4HA 3B87A 1UURA 2AWMA 1QXPA 2QEHA 1G8IA 1S3PA 1MUXA 3CFAA 2OTEA 4Z4MA 1MHOA 1U5IB 2Z6XA 3SVNA 2F33A 1YX7A 2D8NA 4KA9A 5HL1A 2JOJA 1BG1A 1K93D 1H4UA 4ZF4A 4I5KA 4GUKA 3TUYC 1ZOTB 2BKIB 1JC2A 3SVDA 4YBHB 2I7AA 3IVTA 1JFKA 4MZLA 5H87A 1UUSA 1MOUA 1R2UA 2BBMA 1KK7Y 2DOQA 2HFCA 1SMGA 3CZ1A 5LTPA 1LKJA 1CLBA 5J3XA 1WDCB 3SG7A 1C4FA 2HGYA 2PRUA 1QV0A 2HETA 4W6AA 3B7AA 3RZSA 1OOHA 5BTTB 1PVBA 3IQQA 3KF9A 4ZB1A 5HZSA 2SASA 4DXOA 2VZXA 3F45A 5D3OA 2VAEA 3VRQA 2PYQA 1UHJA 2Z6YA 1KFXS 4Q9XA 3ZNIA 3GL4A 4C0KA 4W77A 2QDIA 4OZDA 3CDNA 2WCJA 1SPYA 4NDCA 4KEXA 2LC5A 3IP2A 2M9GA 3BQ3A 2JZIA 3WLDA 3UO9A 2M0RA 3DQOA 3GK1A 2KFFA 3D0YB 3LCPC 1NX1A 3SVSA 5DTLA 4JGEA 1KWOB 3FWBA 1M31A 4W76A 1TOPA 2AH8A 4JD9A 3SG2A 4W6LA 3BUWB 2NXQA 1FI6A 2BNXA 2Y5IA 1CFFA 4XJKA 4GFTA 1C07A 1A03A 4MLWA 5DPHA 5FVFA 3BOWA 2K61A 2DUEA 1OMRA 1CMFA 2GW4B 5EXUA 3KO0A 3SG4A 1KSMA 2WC5A 2WCEA 2HPSA 4TZAA 1JFJA 3P28A 4W7EA 2M7NA 3I5HC 2E30A 1KK8C 1RRXA 4N3DA 1K9KA 1NCXA 5DRGA 2QEVA 4I5NB 4F7FA 2HRSA 4AQJA 3S0GA 4IK9A 1CDNA 5J2OA 4PALA 5DQMA 2EGDA 5KSZA 5DPJA 4KGEA 3O78A 3BUXB 3R1OA 2MJWB 2AWLA 1NWDA 1Y1UA 1YJFA 2K0JA 2HQZA 1XFRA 1SNLA 1DJGA 4LQUA 5B8IB 1GJYA 2QU1A 3LVAA 2BL0B 1QYOA 2A47A 2LAPA 1CTRA 4PHNA 2OJKA 1K95A 2KOTA 1OXDA 3B86A 1CFPA 1OXFA 4DXIA 1MYWA 3NXAA 3SSHA 1B4CA 3TMTA 4LW5A 2H5OA 3CABA 3K1EA 2DUIA 1JUOA 2WURA 1GM0A 3DD4A 2QPTA 2EC6C 2GX0A 4M2QA 1WLZA 2KFHA 1M39A 1MOVA 4W6GA 3DPWA 1A75A 4LQTA 4FQTA 2F3YA 1PRWA 2DDDA 1NCZA 3WNXB 3DQAA 2Q6PA 2Q91A 2JRFA 2CTNA 4YGAA 4LJBA 4MVFA 3U8CA 1DJYA 1TNQA 2B3QA 2H9WA 1K2HA 2WOSA 1UHNA 2Z6ZA 3WLCA 1C7WA 2KHNA 1B1GA 1IKUA 4ZCUA 3TDUA 4R6DA 4P2YB 2KAXA 3FE6A 4W7RA 3O6BA 4HRHA 1S6IA 5DQBA 1CDPA 2HGDA 3CR2A 1HCJA 1ZGPA 3S0BA 1B9CA 2OS8C 4W6PA 2A50B 2G5ZB 4KW4A 5HGEA 1CM4A 2ZN8A 2OPOA 2LLUA 1S1EA 2EMNA 1EMMA 1QY3A 2HF5A 1CM1A 1PSBA 1YURA 4JF9A 2ZFDA 3S05A 1OMDA 2H61A 2OTGC 3OSQA 3LVCA 1SL8A 4GOBA 1RMOA 3SVCA 5FYXA 1CKKA 4DKMA 3CTNA 1EMEA 4AQIA 2ZMUA 3AAKA 4I5JA 2ZRSA 2JADA 2G9BA 2LLTA 1XK4A 1YR5A 3I5IC 1C3ZA 2LMVA 2BECA 2KAYA 1N0YA 1YHHA 1OE9B 1NPQA 3CR4X 1JC0A 3SVUA 2QLGB 3O4XA 2FWQA 3GK4X 4YGDB 3SSPA 2NLNA 3DQ7A 4KF4A 1CFCA 4YI8A 3LL8B 1B8LA 1YX8A 3DQCA 3NSOA 1WLMA 1RJVA 5EJUA 2BL0C 4B30A 1QLKA 4IJ7A 2PXSA 3AKAA 2K7CA 2OKYA 4KF5C 2FL1A 1RROA 1W7UA 1SW8A 3FIAA 4PE1A 1J1DA 2ZO7A 2WHSA 2KAVA 4W69A 2VVHA 3BXBA 1CMGA 1KYSA 3TUYB 5HKZA 2KYCA 2GV5A 1YUTA 1EH2A 4GAOA 4TNCA 5HW9A 2HJOA 2JPOA 1GFLA 4W6SA 2H61C 1LVCD 1DTLA 2HQ8A 2QT2A 2B3PA 3BFHA 2DUGA 2OGRA 3FE8A 1L2OC 4OR9B 3SRYA 4NQGA 1ZUZA 4RYWA 1T14A 4NWSA 4PCWA 4ZCVA 4HRGA 1V1FA 2JXLA 4F0ZB 1RMPA 1YFPA 3M24A 1UHKA 3DQNA 1A29A 3RWTA 3SSLA 4I5LB 2AUCA 3DQFA 2AAOA 5FVGA 5AFPA 4GPLB 1PSRA 1LXFC 5FI2A 1TUJA 2JTZA 4PHMA 5EB6A 4FTGA 1FPWA 1S5GZ 4DS7A 3OX5A 2CCMA 4Q04A 2HQKA 3CD1A 1ODBA 4J8AA 3GB3A 2G3DB 3LF3A 3NT9A 1DJZA 3BUOB 3EK4A 1Y1AA 4WRIA 1CNPA 3IR8A 3I5GC 4ZINA 4ETOA 1DJIA 4YI9A 3NSLA 2EMDA 3EVVA 2IB5A 4KW9A 3EKHA 4YGEB 2KBIA 3L47A 3M22A 3CFHA 4OVNF 1Q4AA 1J7QA 1W7JB 3L4AA 4EDSA 4FQOA 1XFVO 4OQWA 2KQYA 3PSRA 1BR1B 5DTYA 5CSFA 1BT6A 4IK4A 2I94A 3PFVA 3VGOA 5BPJA 3AI4A 2WHTA 3EVUA 2I18A 3KHEA 2JTTA 3I5HB 2GX2A 4DIRA 5AEQA 1HUYA 2JC2A 4QJ4B 1KK8B 1DGVA 3PATA 5TNCA 3CD9A 3UFZA 4MRXA 3B6XA 1DJXA 2RGIA 3FE9A 1B8RA 1TNWA 2QRFA 1XSSA 1YTZC 3S0DA 4DCKA 3CLNA 3PM2A 4L12A 1OOGA 3CBEA 3SVRA 1BU3A 1DMOA 1XAEA 3OB2B 1EMLA 3BX9A 4KW8A 4LJDC 2KSPA 1Z4HA 5EB7A 2WSOA 4W6FA 1ALWA 1AVSA 2CT9A 3OSRA 2G6XA 4MN0A 3FS7A 1MQ1A 2KI6C 2BE4A 1CLMA 4W6KA 2CBLA 4GGNA 4EMQA 1JBAA 3ZULA 3U8AA 1Z2CB 3A8SA 3GJ2A 3EVPA 1NX2A 3DVKA 4W6DA 3WHUB 2EC6B 4XJKB 5HZUA 5GQQC 3BOWB 2Y0GA 3C1VA 4IK5A 3KCTA 2ISDA 5DTZA 3SS0A 1J7PA 1TN4A 4W7FA 2G16B 3ZUFA 2WSNA 4GBAA 3EVRA 1OSAA 4W6TA 2ZNEA 1F54A 2V53A 1QVIY 3LA1A 2LVIA 2EHBA 3DQ5A 1BODA 5HZTA 3BYAA 1NX0A 3V3DA 1XFXO 2A52B 3U0LA 4BY5A 2G3OA 3DY9A 2L50A 2YE0A 2KDHA 4HSZA 2ZKMX 3GEXA 2LLSA 3Q8IA 4WQ2A 3DPXA 2DD7A 1M46A 3U0NA 1UISA 2OS8B 2V4EA 1IRJA 1XFZO 3B88A 4W6NA 1DVIA 1NSHA 1M45A 4CFRA 2H5RA 1W7SA 3UG0A 3AKOA 1IWQA 4INWA 1YJ2A 1IQ3A 3O2PA 2OTGB 5AANA 2LNKA 3VHTB 2IE2A 4MBEA 4OJ0A 4W6MA 4Q7TA 1ORGA 1FI5A 4INXA 1VRKA 1YHGA 2IOVA 2TN4A 2KI4C 4C0JA 3I5IB 5AQBB 4H47A 3EK8A 2HPWA 3SVBA 4U8DA 1WY9A 1RM9A 3PIBA 3ST4A 1K8UA 2P71A 1KYPA 1BOCA 1JBYA 4W74A 3EKJA 4A4CA 1ZFSA 1J7OA 3QMEA 1ZGOA 3PJIA 2M49B 2WCMA 1XA9A 4ORAB 2H5PA 3SS3A 2PQLA 1A75B 2WC6A 1G4YR 1TCFA 1QS7A 5DRFA 4WQ3A 2Q57A 1SYMA 2LVKA 3PALA 1TCOB 4R1EA 1IQ5A 1KK7Z 2LP2A 2PVBA 2AWKA 2M97A 2M3WA 1JBZA 1QX2A 3I5FB 1OOFA 1EMBA 1GGZA 3SVEA 4Z4KA 1F8HA 1K96A 2V4EC 3ADFA 2DDCA 1RWYA 2K7BA 2P70A 3DQKA 1YHIA 3W1DA 4OKHA 3LF4B 1IIOA 2G6EA 1CV7A 2A53B 3DQ8A 3O77A 4CFQA 1PK0D 3D73A 5T3IA 3EG5B 2YDZA 5KU1A 1HQVA 3DQDA 3ED8A 2A46A 1OOIX 1K94A 2ZRTA 3G9AA 3PN7C 3VRNA 2K7DA 4HREE 2YFPA 1EMAA 2BCAA 1YRTB 3E3RA 2Q4UA 5I94A 1L2OB 2ZO6A 3NEDA 3CYZA 2KPHA 4DXMA 1S6ZA 1EXRA 2LHLA 3SJSA 5I2OA 4OHSA 2JT3A 5I2LA 1Q80A 1TWOA 1A4PA 2K7OA 1WRZA 1KQMC 1Y6WA 3JVTC 3BXCA 3U0KA 3NHIA 2VRGA 2LCPA 1KP5A 3SSKA 3AAJA 3I5GB 4L9MA 2ZNDA 1JSAA 2KI6D 1F55A 3PJ5A 5HLOA 2KLEA 5JOLA 2C9JA 4PPKA 4ORNA 1XQMA 1XA5A 4IZNA 3ZUJA 1MF8B 1FW4A 2LM5A 1SKTA 4UTSA 1MWNA 1S5GY 1J55A 1Y1XA 1LA3A 5AXIA 3SS5A 1SCVA 2LUCA 3S0EA 3DYEA 4C0LA 2GGMA
chains in the Genus database with same CATH topology
2LE9B 3A4UB 1QTXA 1B7TZ 1Q4EA 5HLVA 2LVJA 1DJHA 5AERA 3DQ4A 4I2YA 1GQMA 3BXKA 2KBMA 4W6OA 2L5XB 3PLFB 1GL4A 2JXCA 2JWWA 3DQ6A 5HKYA 2P6BB 1NCYA 3SVOA 3KPXA 1QATA 2A4JA 2DD9A 1RFJA 3VRPA 3DVMA 2K8MB 2VVJA 5G08A 5CPVA 3LK1A 4D1EA 1S6JA 1XFUO 3BUMB 3TS5C 1QIWA 4AR7A 3I5FC 4N1FA 2QLIA 3AKBA 3WCKA 4JC2A 1L7ZA 2QLHA 2KFGA 4Q7UA 4M2PA 4L13A 2PASA 4DUQA 4PE7A 3LK0A 5CSJA 1AJ4A 2SCPA 2PALA 2O60A 3VRRA 3CB9A 2IS9A 4CPVA 4Q9WA 4W7CA 1F4OA 2BCBA 4MZKA 5HKWA 4N5XA 1IJ6A 1KCYA 3ST0A 4DXNA 4HQ8A 3DVJA 2DUFA 1XK4C 1Q4BA 2QLEA 4P1QA 4KPIA 2M8UA 4BY4A 4NDBA 1B8CA 2A48A 2JT0A 3ZTFA 4ZFSA 3SIAA 1DF0B 1XFYO 1IGVA 2Y1NA 1NUBA 1UHIA 2A56B 2WCFA 4DXPA 4OY4A 1N2DA 1NX3A 3CFFA 1MXLC 2WC8A 4H48A 3DQLA 1QJTA 4UPGA 2Z1OA 1YUSA 3EK7A 1W7TA 5DTXA 4HQCA 1SR6B 1XFWO 2LP3A 2O29A 4DKNA 2LHIA 2AHAA 5F6TA 1QX5B 3DQMA 1M63B 2F2PA 2MLEC 5JJGA 1QYQA 4PE4A 1B9AA 2CNPA 2K2FA 3NT3A 3DQ1A 4CLNA 4JWQA 1KYRA 5K89A 1JF0A 4U2VA 2KI4B 2DUHA 4W6HA 1OZOA 5EBJA 1A2XA 2FZUA 1GGWA 3DF0A 5PALA 1TIZA 2L51A 1BLQA 1F0BA 2H2KA 2E6WA 2JPTA 4A4BA 1ZACA 4AS8A 1PALA 4JRBA 4W72A 3MGFA 3LSAA 2JT8A 3CS1A 3HCMA 3AI5A 3WHTB 1SL7A 4JEOA 1EG4A 2B1UA 1RTP1 2VVIA 5LTRA 3DVEA 2O5GA 2PXWA 3DQHA 3ICBA 4XOVA 1F4QA 2NCPA 3DQ2A 1DGUA 1CFDA 4EULA 3SSTA 3OP0A 2WISA 1DJWA 4Q7RA 2COLB 1OMVA 1CB1A 1EMCA 2L98A 4XOWA 2V4EB 5CSNA 4JFGA 1OOJA 3NSIA 4OV2A 2O2BA 3K1KA 1WRKA 4J88A 2Y1MA 2MA2A 4YRUA 1AJ5A 2KQ6A 3VICA 3LS3A 2JNFA 3DQEA 3IQOA 3VROA 4GGFA 2OKWA 3SSVA 4AOMA 3PN7B 1N65A 1YUUA 3PJ7A 2GGZA 4XYNA 2LMUA 4W6JA 1SL9A 3BXAA 1OZSA 1J7RA 2KNEA 3IF7A 4CIDA 1F09A 2POXA 1U5IA 3RLZA 2ICRA 2L2EA 4ZF3A 5KTGA 4H3MA 2BKHB 1DT7B 3H1OA 2A54B 1OQPA 2Y4QA 4YGBB 2RH7A 4IK8A 1ZUXA 1KQMB 2GW3A 4P76A 3JVTB 1KSOA 5H89A 2KGBC 1YVLA 3TDIA 1BMOA 1R6PA 2MLFC 1SCMC 3A8RA 5I8NA 1SR6C 1QIVA 2F3ZA 2FJUB 4RTCA 4JQ0D 5DKQA 1Z1PA 2WHUA 3D10A 2M7LA 5BTTA 3DQIA 4XL5A 4W6RA 1IJ5A 4ORBB 2F8PA 1YZWA 3JTDC 3I19A 2C9IA 1TRFA 3SIBA 1QX7A 2F2OA 3RWAA 3E5TA 1CDLA 1XVJA 2WIQA 2K2AA 3RM1A 3SSYA 3SG6A 1S26D 4E68A 1MR8A 2LANA 1JF2A 4GGFC 3D0YA 1EMGA 2WCBA 4ANJA 1QXTA 4H3NA 3KCSA 1K90D 5EXBA 1LA0A 1B47A 4EDOA 1IG5A 3DQUA 3OX6A 1B7TY 2HCGA 2KYFA 2OTBA 3TS5B 4ZIOA 2ZMWA 5LK4A 2M1KB 4H3LA 4ICBA 1SK6D 2FCEA 5DKNA 3NEZA 3VHTA 4HE4A 3PM8A 5EHUA 3NSKA 5H88A 1Z1QA 4NDDA 4DXQA 2PSRA 4P5OE 1OXEA 1ALVA 3LLEA 1YVHA 2H8QA 2FOTA 3O4YA 4QJ5B 2R2IA 1QVIZ 1WDCC 4PPJA 1BJFA 4GNKB 2ARLA 2MRDA 5DPIA 4M2OA 3CGLA 1KQVA 5D69A 5KTYA 1RMMA 2H5QA 2G2BA 4B5YA 4YGCB 5FVIA 5EXCI 1D1OA 4MEWA 1H6RA 3OGOA 1FF1A 2BE6A 1EJ3A 1EMKA 1AUIB 5BQLA 5ER4X 1Q4DA 5FHVA 1QLSA 1S36A 4EN1A 3TMRA 1CDMA 2FCDA 1QV1A 5D7FA 4QJ3B 5HBDA 2LMTA 3HX4A 1QYFA 2HQWA 4KF5A 1Y0VH 3TZ1A 2BBNA 2YE1A 3DQ9A 1TNXA 1KWOC 5HYDA 1GGXA 2CXJA 3WXAA 2L0PA 2EMOA 1TTXA 4B30B 1NYAA 1EG3A 4IL1A 2LUXA 5DY6A 4PFEA 4GESB 1PVAA 1BF5A 4LJCA 3W1CA 1JC1A 3KEVA 2NCOA 4XGYA 1EL4A 1RECA 1F71A 1J1EA 4HVFA 3CGAA 1V1GA 4PHJA 4W7AA 4W73A 1F70A 2JU0A 5DU0A 5CSIA 1ZMZA 5BT0A 2BCXA 1SY9A 1YRUB 4W6IA 3H4SE 4RYSA 4DRWA 1AK8A 2MBXA 2O24A 4HQ9A 4R6BA 4JPZB 1Q73A 2LV7A 1K9UA 4W6CA 4BDUA 1EMFA 3TDZA 3U8PA 2AWJA 3SG5A 4ZF5A 1NIWA 1W7IB 4KGFA 1PULA 1IH0A 3NF0A 2G2SB 2H6VA 1UHHA 1Q4CA 1H4BA 3U0MA 2AMIA 1AP4A 1KFUL 4PDZA 2MHHA 2NZ0A 5F9GA 3CWGA 1TNPA 1LINA 2G6YA 2LVVA 4USLA 4MSPA 2PMYA 5IBWA 3M0WA 1ZGQA 1BFPA 3PJBA 2MAZA 1XO5A 4N1GA 2QLGA 2P4MA 3LVDA 4IK3A 4ORCB 1G33A 2VADA 3GOFA 3ST3A 1H8BA 1HT9A 4MRYA 5LTQA 1UP5A 1XMZA 4XVPA 5I2QA 3P8UA 1E8AA 2IB6A 3FWCA 3SG3A 2QACA 3GK2A 3MSEB 4OCIA 1BR4B 4W7DA 4W6BA 3ZWHA 3VK1A 4TZGA 3DPZA 2JNXA 2BTJA 4MZJA 4W6UA 3E5VA 3QRXA 5DKRA 3DF0B 1K9PA 2M29A 4J89A 4L1IA 4LJDA 1JWDA 1S6CA 3BUNB 4ZBLA 1SCMB 1G7KA 2KGRA 2WORA 2L4IA 5DPGA 3OHMB 5HZOA 2QZ0A 2JULA 5ER5A 3SV5A 3H1RA 2JQ6A 3CR5X 4GF6B 1KFXL 1MXEA 1CLLA 2I2RE 3OB1B 2WNDA 1NP8A 3ST2A 3K21A 3DQ3A 2ZN9A 4W7XA 4OGSA 4PPLA 1RK9A 3DQJA 3JTDB 1C7VA 1WRLA 1SBJA 4IK1A 1KFUS 4KAGA 4PHKA 1QASA 3GJ1A 1X02A 3CZTX 1FBVA 4W75A 4PE0A 1XYDA 2M1UA 1DF0A 1UWOA 1SRAA 3E5WA 1AHRA 2L4HA 1UURA 2AWMA 1QXPA 1G8IA 1S3PA 1MUXA 3CFAA 2OTEA 4Z4MA 1MHOA 1U5IB 2Z6XA 3SVNA 2F33A 1YX7A 2D8NA 4KA9A 2JOJA 1BG1A 1K93D 1H4UA 4ZF4A 4I5KA 4GUKA 3TUYC 1ZOTB 2BKIB 1JC2A 3SVDA 4YBHB 2I7AA 1JFKA 4MZLA 5H87A 1UUSA 1MOUA 1R2UA 2BBMA 1KK7Y 2DOQA 2HFCA 1SMGA 5LTPA 1LKJA 1CLBA 5J3XA 1WDCB 3SG7A 1C4FA 2HGYA 2PRUA 1QV0A 2HETA 4W6AA 5BTTB 1PVBA 3IQQA 3KF9A 4ZB1A 5HZSA 2SASA 4DXOA 2VZXA 3F45A 2VAEA 3VRQA 1UHJA 2Z6YA 1KFXS 4Q9XA 3ZNIA 3GL4A 4C0KA 4W77A 1SPYA 4NDCA 4KEXA 2LC5A 3IP2A 2M9GA 3BQ3A 2JZIA 3WLDA 2M0RA 3DQOA 3GK1A 2KFFA 3D0YB 3LCPC 1NX1A 3SVSA 5DTLA 4JGEA 1KWOB 3FWBA 1M31A 4W76A 1TOPA 2AH8A 3SG2A 4W6LA 3BUWB 2NXQA 1FI6A 2Y5IA 1CFFA 4XJKA 4GFTA 1C07A 1A03A 4MLWA 5DPHA 5FVFA 3BOWA 2K61A 2DUEA 1OMRA 1CMFA 2GW4B 5EXUA 3KO0A 3SG4A 1KSMA 2WCEA 2HPSA 4TZAA 1JFJA 3P28A 4W7EA 2M7NA 3I5HC 2E30A 1KK8C 1RRXA 4N3DA 1K9KA 1NCXA 5DRGA 4I5NB 2HRSA 4AQJA 4IK9A 1CDNA 5J2OA 4PALA 5DQMA 2EGDA 5KSZA 5DPJA 4KGEA 3O78A 3BUXB 2MJWB 2AWLA 1NWDA 1Y1UA 1YJFA 2K0JA 2HQZA 1SNLA 1DJGA 4LQUA 5B8IB 1GJYA 2QU1A 3LVAA 2BL0B 1QYOA 2A47A 2LAPA 1CTRA 4PHNA 2OJKA 1K95A 2KOTA 1OXDA 1CFPA 1OXFA 4DXIA 1MYWA 3NXAA 3SSHA 1B4CA 3TMTA 4LW5A 2H5OA 2DUIA 1JUOA 2WURA 3DD4A 2QPTA 2EC6C 2GX0A 4M2QA 1WLZA 2KFHA 1M39A 1MOVA 4W6GA 3DPWA 1A75A 4LQTA 2F3YA 1PRWA 2DDDA 1NCZA 3WNXB 3DQAA 2Q6PA 2Q91A 2JRFA 2CTNA 4YGAA 4LJBA 4MVFA 3U8CA 1DJYA 1TNQA 2B3QA 2H9WA 1K2HA 2WOSA 1UHNA 2Z6ZA 3WLCA 1C7WA 2KHNA 1B1GA 1IKUA 4ZCUA 3TDUA 4R6DA 4P2YB 2KAXA 4W7RA 3O6BA 4HRHA 1S6IA 5DQBA 1CDPA 2HGDA 3CR2A 1HCJA 1ZGPA 1B9CA 2OS8C 4W6PA 2A50B 2G5ZB 4KW4A 5HGEA 1CM4A 2ZN8A 2OPOA 2LLUA 1S1EA 2EMNA 1EMMA 1QY3A 2HF5A 1CM1A 1PSBA 1YURA 4JF9A 2ZFDA 3S05A 1OMDA 2H61A 2OTGC 3OSQA 3LVCA 1SL8A 4GOBA 1RMOA 3SVCA 5FYXA 1CKKA 4DKMA 3CTNA 1EMEA 4AQIA 2ZMUA 3AAKA 4I5JA 2ZRSA 2JADA 2G9BA 2LLTA 1XK4A 1YR5A 3I5IC 2LMVA 2BECA 2KAYA 1N0YA 1YHHA 1OE9B 1NPQA 3CR4X 1JC0A 3SVUA 2QLGB 2FWQA 3GK4X 4YGDB 3SSPA 2NLNA 3DQ7A 4KF4A 1CFCA 4YI8A 3LL8B 1B8LA 1YX8A 3DQCA 3NSOA 1WLMA 1RJVA 5EJUA 2BL0C 4B30A 1QLKA 2PXSA 3AKAA 2K7CA 2OKYA 4KF5C 2FL1A 1RROA 1W7UA 1SW8A 3FIAA 4PE1A 1J1DA 2ZO7A 2WHSA 2KAVA 4W69A 2VVHA 3BXBA 1CMGA 1KYSA 3TUYB 5HKZA 2KYCA 2GV5A 1YUTA 1EH2A 4GAOA 4TNCA 5HW9A 2HJOA 1GFLA 4W6SA 2H61C 1LVCD 1DTLA 2HQ8A 2QT2A 2B3PA 2DUGA 2OGRA 1L2OC 4OR9B 3SRYA 4NQGA 1ZUZA 4RYWA 4NWSA 4PCWA 4ZCVA 4HRGA 1V1FA 2JXLA 4F0ZB 1RMPA 1YFPA 3M24A 1UHKA 3DQNA 1A29A 3RWTA 3SSLA 4I5LB 2AUCA 3DQFA 2AAOA 5FVGA 5AFPA 4GPLB 1PSRA 1LXFC 2JTZA 4PHMA 5EB6A 4FTGA 1FPWA 1S5GZ 4DS7A 3OX5A 2CCMA 4Q04A 2HQKA 3CD1A 1ODBA 4J8AA 3GB3A 2G3DB 3LF3A 3NT9A 1DJZA 3BUOB 3EK4A 1Y1AA 4WRIA 1CNPA 3IR8A 3I5GC 4ZINA 4ETOA 1DJIA 4YI9A 3NSLA 2EMDA 3EVVA 2IB5A 4KW9A 3EKHA 4YGEB 2KBIA 3M22A 3CFHA 4OVNF 1Q4AA 1J7QA 1W7JB 4EDSA 4FQOA 1XFVO 4OQWA 2KQYA 3PSRA 1BR1B 5DTYA 5CSFA 1BT6A 4IK4A 2I94A 3PFVA 3VGOA 5BPJA 3AI4A 2WHTA 3EVUA 2I18A 3KHEA 2JTTA 3I5HB 2GX2A 4DIRA 5AEQA 1HUYA 2JC2A 4QJ4B 1KK8B 1DGVA 3PATA 5TNCA 3CD9A 3UFZA 4MRXA 1DJXA 2RGIA 1B8RA 1TNWA 2QRFA 1XSSA 1YTZC 4DCKA 3CLNA 4L12A 3CBEA 3SVRA 1BU3A 1DMOA 1XAEA 3OB2B 1EMLA 3BX9A 4KW8A 4LJDC 2KSPA 5EB7A 2WSOA 4W6FA 1ALWA 1AVSA 2CT9A 3OSRA 2G6XA 4MN0A 3FS7A 1MQ1A 2KI6C 2BE4A 1CLMA 4W6KA 2CBLA 4GGNA 4EMQA 1JBAA 3ZULA 3U8AA 3A8SA 3GJ2A 3EVPA 1NX2A 3DVKA 4W6DA 3WHUB 2EC6B 4XJKB 5HZUA 5GQQC 3BOWB 2Y0GA 3C1VA 4IK5A 3KCTA 2ISDA 5DTZA 3SS0A 1J7PA 1TN4A 4W7FA 2G16B 3ZUFA 2WSNA 4GBAA 3EVRA 1OSAA 4W6TA 2ZNEA 1F54A 2V53A 3LA1A 1QVIY 2LVIA 2EHBA 3DQ5A 1BODA 5HZTA 3BYAA 1NX0A 3V3DA 1XFXO 2A52B 3U0LA 4BY5A 2G3OA 2L50A 2YE0A 2KDHA 4HSZA 2ZKMX 3GEXA 2LLSA 4WQ2A 3DPXA 2DD7A 1M46A 3U0NA 1UISA 2OS8B 2V4EA 1IRJA 1XFZO 4W6NA 1DVIA 1NSHA 1M45A 4CFRA 2H5RA 1W7SA 3UG0A 3AKOA 1IWQA 1YJ2A 1IQ3A 3O2PA 2OTGB 5AANA 2LNKA 3VHTB 2IE2A 4MBEA 4OJ0A 4W6MA 4Q7TA 1FI5A 1VRKA 1YHGA 2IOVA 2TN4A 2KI4C 4C0JA 3I5IB 5AQBB 4H47A 3EK8A 2HPWA 3SVBA 4U8DA 1WY9A 1RM9A 3PIBA 3ST4A 1K8UA 1KYPA 1BOCA 1JBYA 4W74A 3EKJA 4A4CA 1ZFSA 1J7OA 1ZGOA 2M49B 1XA9A 4ORAB 2H5PA 1A75B 1G4YR 1TCFA 1QS7A 5DRFA 4WQ3A 2Q57A 1SYMA 2LVKA 3PALA 1TCOB 4R1EA 1IQ5A 1KK7Z 2LP2A 2PVBA 2AWKA 2M97A 2M3WA 1JBZA 1QX2A 3I5FB 1EMBA 1GGZA 3SVEA 4Z4KA 1F8HA 1K96A 2V4EC 3ADFA 2DDCA 1RWYA 2K7BA 3DQKA 1YHIA 3W1DA 4OKHA 3LF4B 2G6EA 1CV7A 2A53B 3DQ8A 3O77A 4CFQA 1PK0D 5T3IA 2YDZA 5KU1A 1HQVA 3DQDA 3ED8A 2A46A 1K94A 2ZRTA 3G9AA 3PN7C 3VRNA 2K7DA 4HREE 2YFPA 1EMAA 2BCAA 1YRTB 3E3RA 2Q4UA 1L2OB 2ZO6A 3NEDA 4DXMA 1S6ZA 1EXRA 2LHLA 3SJSA 5I2OA 4OHSA 2JT3A 5I2LA 1Q80A 1A4PA 2K7OA 1WRZA 1KQMC 1Y6WA 3JVTC 3BXCA 3U0KA 2VRGA 2LCPA 1KP5A 3SSKA 3AAJA 3I5GB 4L9MA 2ZNDA 1JSAA 2KI6D 1F55A 3PJ5A 5HLOA 5JOLA 2C9JA 4PPKA 4ORNA 1XQMA 1XA5A 4IZNA 3ZUJA 1MF8B 1FW4A 2LM5A 1SKTA 4UTSA 1MWNA 1S5GY 1J55A 1Y1XA 1LA3A 5AXIA 1SCVA 2LUCA 4C0LA 2GGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LE9 B;  3A4U B;  1QTX A;  1B7T Z;  1Q4E A;  5HLV A;  2LVJ A;  1DJH A;  5AER A;  3DQ4 A;  4I2Y A;  1GQM A;  3BXK A;  2KBM A;  4W6O A;  2L5X B;  3PLF B;  1GL4 A;  2JXC A;  2JWW A;  3DQ6 A;  5HKY A;  2P6B B;  1NCY A;  3SVO A;  3KPX A;  1QAT A;  2A4J A;  2DD9 A;  1RFJ A;  3VRP A;  3DVM A;  2K8M B;  2VVJ A;  5G08 A;  5CPV A;  3LK1 A;  4D1E A;  1S6J A;  1XFU O;  3BUM B;  3TS5 C;  1QIW A;  4AR7 A;  3I5F C;  4N1F A;  2QLI A;  3AKB A;  3WCK A;  4JC2 A;  1L7Z A;  2QLH A;  2KFG A;  4Q7U A;  4M2P A;  4L13 A;  2PAS A;  4DUQ A;  4PE7 A;  3LK0 A;  5CSJ A;  1AJ4 A;  2SCP A;  2PAL A;  2O60 A;  3VRR A;  3CB9 A;  2IS9 A;  4CPV A;  4Q9W A;  4W7C A;  1F4O A;  2BCB A;  4MZK A;  5HKW A;  4N5X A;  1IJ6 A;  1KCY A;  3ST0 A;  4DXN A;  4HQ8 A;  3DVJ A;  2DUF A;  1XK4 C;  1Q4B A;  2QLE A;  4P1Q A;  4KPI A;  2M8U A;  4BY4 A;  4NDB A;  1B8C A;  2A48 A;  2JT0 A;  3ZTF A;  4ZFS A;  3SIA A;  1DF0 B;  1XFY O;  1IGV A;  2Y1N A;  1NUB A;  1UHI A;  2A56 B;  2WCF A;  4DXP A;  4OY4 A;  1N2D A;  1NX3 A;  3CFF A;  1MXL C;  2WC8 A;  4H48 A;  3DQL A;  1QJT A;  4UPG A;  2Z1O A;  1YUS A;  3EK7 A;  1W7T A;  5DTX A;  4HQC A;  1SR6 B;  1XFW O;  2LP3 A;  2O29 A;  4DKN A;  2LHI A;  2AHA A;  5F6T A;  1QX5 B;  3DQM A;  1M63 B;  2F2P A;  2MLE C;  5JJG A;  1QYQ A;  4PE4 A;  1B9A A;  2CNP A;  2K2F A;  3NT3 A;  3DQ1 A;  4CLN A;  4JWQ A;  1KYR A;  5K89 A;  1JF0 A;  4U2V A;  2KI4 B;  2DUH A;  4W6H A;  1OZO A;  5EBJ A;  1A2X A;  2FZU A;  1GGW A;  3DF0 A;  5PAL A;  1TIZ A;  2L51 A;  1BLQ A;  1F0B A;  2H2K A;  2E6W A;  2JPT A;  4A4B A;  1ZAC A;  4AS8 A;  1PAL A;  4JRB A;  4W72 A;  3MGF A;  3LSA A;  2JT8 A;  3CS1 A;  3HCM A;  3AI5 A;  3WHT B;  1SL7 A;  4JEO A;  1EG4 A;  2B1U A;  1RTP 1;  2VVI A;  5LTR A;  3DVE A;  2O5G A;  2PXW A;  3DQH A;  3ICB A;  4XOV A;  1F4Q A;  2NCP A;  3DQ2 A;  1DGU A;  1CFD A;  4EUL A;  3SST A;  3OP0 A;  2WIS A;  1DJW A;  4Q7R A;  2COL B;  1OMV A;  1CB1 A;  1EMC A;  2L98 A;  4XOW A;  2V4E B;  5CSN A;  4JFG A;  1OOJ A;  3NSI A;  4OV2 A;  2O2B A;  3K1K A;  1WRK A;  4J88 A;  2Y1M A;  2MA2 A;  4YRU A;  1AJ5 A;  2KQ6 A;  3VIC A;  3LS3 A;  2JNF A;  3DQE A;  3IQO A;  3VRO A;  4GGF A;  2OKW A;  3SSV A;  4AOM A;  3PN7 B;  1N65 A;  1YUU A;  3PJ7 A;  2GGZ A;  4XYN A;  2LMU A;  4W6J A;  1SL9 A;  3BXA A;  1OZS A;  1J7R A;  2KNE A;  3IF7 A;  4CID A;  1F09 A;  2POX A;  1U5I A;  3RLZ A;  2ICR A;  2L2E A;  4ZF3 A;  5KTG A;  4H3M A;  2BKH B;  1DT7 B;  3H1O A;  2A54 B;  1OQP A;  2Y4Q A;  4YGB B;  2RH7 A;  4IK8 A;  1ZUX A;  1KQM B;  2GW3 A;  4P76 A;  3JVT B;  1KSO A;  5H89 A;  2KGB C;  1YVL A;  3TDI A;  1BMO A;  1R6P A;  2MLF C;  1SCM C;  3A8R A;  5I8N A;  1SR6 C;  1QIV A;  2F3Z A;  2FJU B;  4RTC A;  4JQ0 D;  5DKQ A;  1Z1P A;  2WHU A;  3D10 A;  2M7L A;  5BTT A;  3DQI A;  4XL5 A;  4W6R A;  1IJ5 A;  4ORB B;  2F8P A;  1YZW A;  3JTD C;  3I19 A;  2C9I A;  1TRF A;  3SIB A;  1QX7 A;  2F2O A;  3RWA A;  3E5T A;  1CDL A;  1XVJ A;  2WIQ A;  2K2A A;  3RM1 A;  3SSY A;  3SG6 A;  1S26 D;  4E68 A;  1MR8 A;  2LAN A;  1JF2 A;  4GGF C;  3D0Y A;  1EMG A;  2WCB A;  4ANJ A;  1QXT A;  4H3N A;  3KCS A;  1K90 D;  5EXB A;  1LA0 A;  1B47 A;  4EDO A;  1IG5 A;  3DQU A;  3OX6 A;  1B7T Y;  2HCG A;  2KYF A;  2OTB A;  3TS5 B;  4ZIO A;  2ZMW A;  5LK4 A;  2M1K B;  4H3L A;  4ICB A;  1SK6 D;  2FCE A;  5DKN A;  3NEZ A;  3VHT A;  4HE4 A;  3PM8 A;  5EHU A;  3NSK A;  5H88 A;  1Z1Q A;  4NDD A;  4DXQ A;  2PSR A;  4P5O E;  1OXE A;  1ALV A;  3LLE A;  1YVH A;  2H8Q A;  2FOT A;  3O4Y A;  4QJ5 B;  2R2I A;  1QVI Z;  1WDC C;  4PPJ A;  1BJF A;  4GNK B;  2ARL A;  2MRD A;  5DPI A;  4M2O A;  3CGL A;  1KQV A;  5D69 A;  5KTY A;  1RMM A;  2H5Q A;  2G2B A;  4B5Y A;  4YGC B;  5FVI A;  5EXC I;  1D1O A;  4MEW A;  1H6R A;  3OGO A;  1FF1 A;  2BE6 A;  1EJ3 A;  1EMK A;  1AUI B;  5BQL A;  5ER4 X;  1Q4D A;  5FHV A;  1QLS A;  1S36 A;  4EN1 A;  3TMR A;  1CDM A;  2FCD A;  1QV1 A;  5D7F A;  4QJ3 B;  5HBD A;  2LMT A;  3HX4 A;  1QYF A;  2HQW A;  4KF5 A;  1Y0V H;  3TZ1 A;  2BBN A;  2YE1 A;  3DQ9 A;  1TNX A;  1KWO C;  5HYD A;  1GGX A;  2CXJ A;  3WXA A;  2L0P A;  2EMO A;  1TTX A;  4B30 B;  1NYA A;  1EG3 A;  4IL1 A;  2LUX A;  5DY6 A;  4PFE A;  4GES B;  1PVA A;  1BF5 A;  4LJC A;  3W1C A;  1JC1 A;  3KEV A;  2NCO A;  4XGY A;  1EL4 A;  1REC A;  1F71 A;  1J1E A;  4HVF A;  3CGA A;  1V1G A;  4PHJ A;  4W7A A;  4W73 A;  1F70 A;  2JU0 A;  5DU0 A;  5CSI A;  1ZMZ A;  5BT0 A;  2BCX A;  1SY9 A;  1YRU B;  4W6I A;  3H4S E;  4RYS A;  4DRW A;  1AK8 A;  2MBX A;  2O24 A;  4HQ9 A;  4R6B A;  4JPZ B;  1Q73 A;  2LV7 A;  1K9U A;  4W6C A;  4BDU A;  1EMF A;  3TDZ A;  3U8P A;  2AWJ A;  3SG5 A;  4ZF5 A;  1NIW A;  1W7I B;  4KGF A;  1PUL A;  1IH0 A;  3NF0 A;  2G2S B;  2H6V A;  1UHH A;  1Q4C A;  1H4B A;  3U0M A;  2AMI A;  1AP4 A;  1KFU L;  4PDZ A;  2MHH A;  2NZ0 A;  5F9G A;  3CWG A;  1TNP A;  1LIN A;  2G6Y A;  2LVV A;  4USL A;  4MSP A;  2PMY A;  5IBW A;  3M0W A;  1ZGQ A;  1BFP A;  3PJB A;  2MAZ A;  1XO5 A;  4N1G A;  2QLG A;  2P4M A;  3LVD A;  4IK3 A;  4ORC B;  1G33 A;  2VAD A;  3GOF A;  3ST3 A;  1H8B A;  1HT9 A;  4MRY A;  5LTQ A;  1UP5 A;  1XMZ A;  4XVP A;  5I2Q A;  3P8U A;  1E8A A;  2IB6 A;  3FWC A;  3SG3 A;  2QAC A;  3GK2 A;  3MSE B;  4OCI A;  1BR4 B;  4W7D A;  4W6B A;  3ZWH A;  3VK1 A;  4TZG A;  3DPZ A;  2JNX A;  2BTJ A;  4MZJ A;  4W6U A;  3E5V A;  3QRX A;  5DKR A;  3DF0 B;  1K9P A;  2M29 A;  4J89 A;  4L1I A;  4LJD A;  1JWD A;  1S6C A;  3BUN B;  4ZBL A;  1SCM B;  1G7K A;  2KGR A;  2WOR A;  2L4I A;  5DPG A;  3OHM B;  5HZO A;  2QZ0 A;  2JUL A;  5ER5 A;  3SV5 A;  3H1R A;  2JQ6 A;  3CR5 X;  4GF6 B;  1KFX L;  1MXE A;  1CLL A;  2I2R E;  3OB1 B;  2WND A;  1NP8 A;  3ST2 A;  3K21 A;  3DQ3 A;  2ZN9 A;  4W7X A;  4OGS A;  4PPL A;  1RK9 A;  3DQJ A;  3JTD B;  1C7V A;  1WRL A;  1SBJ A;  4IK1 A;  1KFU S;  4KAG A;  4PHK A;  1QAS A;  3GJ1 A;  1X02 A;  3CZT X;  1FBV A;  4W75 A;  4PE0 A;  1XYD A;  2M1U A;  1DF0 A;  1UWO A;  1SRA A;  3E5W A;  1AHR A;  2L4H A;  1UUR A;  2AWM A;  1QXP A;  1G8I A;  1S3P A;  1MUX A;  3CFA A;  2OTE A;  4Z4M A;  1MHO A;  1U5I B;  2Z6X A;  3SVN A;  2F33 A;  1YX7 A;  2D8N A;  4KA9 A;  2JOJ A;  1BG1 A;  1K93 D;  1H4U A;  4ZF4 A;  4I5K A;  4GUK A;  3TUY C;  1ZOT B;  2BKI B;  1JC2 A;  3SVD A;  4YBH B;  2I7A A;  1JFK A;  4MZL A;  5H87 A;  1UUS A;  1MOU A;  1R2U A;  2BBM A;  1KK7 Y;  2DOQ A;  2HFC A;  1SMG A;  5LTP A;  1LKJ A;  1CLB A;  5J3X A;  1WDC B;  3SG7 A;  1C4F A;  2HGY A;  2PRU A;  1QV0 A;  2HET A;  4W6A A;  5BTT B;  1PVB A;  3IQQ A;  3KF9 A;  4ZB1 A;  5HZS A;  2SAS A;  4DXO A;  2VZX A;  3F45 A;  2VAE A;  3VRQ A;  1UHJ A;  2Z6Y A;  1KFX S;  4Q9X A;  3ZNI A;  3GL4 A;  4C0K A;  4W77 A;  1SPY A;  4NDC A;  4KEX A;  2LC5 A;  3IP2 A;  2M9G A;  3BQ3 A;  2JZI A;  3WLD A;  2M0R A;  3DQO A;  3GK1 A;  2KFF A;  3D0Y B;  3LCP C;  1NX1 A;  3SVS A;  5DTL A;  4JGE A;  1KWO B;  3FWB A;  1M31 A;  4W76 A;  1TOP A;  2AH8 A;  3SG2 A;  4W6L A;  3BUW B;  2NXQ A;  1FI6 A;  2Y5I A;  1CFF A;  4XJK A;  4GFT A;  1C07 A;  1A03 A;  4MLW A;  5DPH A;  5FVF A;  3BOW A;  2K61 A;  2DUE A;  1OMR A;  1CMF A;  2GW4 B;  5EXU A;  3KO0 A;  3SG4 A;  1KSM A;  2WCE A;  2HPS A;  4TZA A;  1JFJ A;  3P28 A;  4W7E A;  2M7N A;  3I5H C;  2E30 A;  1KK8 C;  1RRX A;  4N3D A;  1K9K A;  1NCX A;  5DRG A;  4I5N B;  2HRS A;  4AQJ A;  4IK9 A;  1CDN A;  5J2O A;  4PAL A;  5DQM A;  2EGD A;  5KSZ A;  5DPJ A;  4KGE A;  3O78 A;  3BUX B;  2MJW B;  2AWL A;  1NWD A;  1Y1U A;  1YJF A;  2K0J A;  2HQZ A;  1SNL A;  1DJG A;  4LQU A;  5B8I B;  1GJY A;  2QU1 A;  3LVA A;  2BL0 B;  1QYO A;  2A47 A;  2LAP A;  1CTR A;  4PHN A;  2OJK A;  1K95 A;  2KOT A;  1OXD A;  1CFP A;  1OXF A;  4DXI A;  1MYW A;  3NXA A;  3SSH A;  1B4C A;  3TMT A;  4LW5 A;  2H5O A;  2DUI A;  1JUO A;  2WUR A;  3DD4 A;  2QPT A;  2EC6 C;  2GX0 A;  4M2Q A;  1WLZ A;  2KFH A;  1M39 A;  1MOV A;  4W6G A;  3DPW A;  1A75 A;  4LQT A;  2F3Y A;  1PRW A;  2DDD A;  1NCZ A;  3WNX B;  3DQA A;  2Q6P A;  2Q91 A;  2JRF A;  2CTN A;  4YGA A;  4LJB A;  4MVF A;  3U8C A;  1DJY A;  1TNQ A;  2B3Q A;  2H9W A;  1K2H A;  2WOS A;  1UHN A;  2Z6Z A;  3WLC A;  1C7W A;  2KHN A;  1B1G A;  1IKU A;  4ZCU A;  3TDU A;  4R6D A;  4P2Y B;  2KAX A;  4W7R A;  3O6B A;  4HRH A;  1S6I A;  5DQB A;  1CDP A;  2HGD A;  3CR2 A;  1HCJ A;  1ZGP A;  1B9C A;  2OS8 C;  4W6P A;  2A50 B;  2G5Z B;  4KW4 A;  5HGE A;  1CM4 A;  2ZN8 A;  2OPO A;  2LLU A;  1S1E A;  2EMN A;  1EMM A;  1QY3 A;  2HF5 A;  1CM1 A;  1PSB A;  1YUR A;  4JF9 A;  2ZFD A;  3S05 A;  1OMD A;  2H61 A;  2OTG C;  3OSQ A;  3LVC A;  1SL8 A;  4GOB A;  1RMO A;  3SVC A;  5FYX A;  1CKK A;  4DKM A;  3CTN A;  1EME A;  4AQI A;  2ZMU A;  3AAK A;  4I5J A;  2ZRS A;  2JAD A;  2G9B A;  2LLT A;  1XK4 A;  1YR5 A;  3I5I C;  2LMV A;  2BEC A;  2KAY A;  1N0Y A;  1YHH A;  1OE9 B;  1NPQ A;  3CR4 X;  1JC0 A;  3SVU A;  2QLG B;  2FWQ A;  3GK4 X;  4YGD B;  3SSP A;  2NLN A;  3DQ7 A;  4KF4 A;  1CFC A;  4YI8 A;  3LL8 B;  1B8L A;  1YX8 A;  3DQC A;  3NSO A;  1WLM A;  1RJV A;  5EJU A;  2BL0 C;  4B30 A;  1QLK A;  2PXS A;  3AKA A;  2K7C A;  2OKY A;  4KF5 C;  2FL1 A;  1RRO A;  1W7U A;  1SW8 A;  3FIA A;  4PE1 A;  1J1D A;  2ZO7 A;  2WHS A;  2KAV A;  4W69 A;  2VVH A;  3BXB A;  1CMG A;  1KYS A;  3TUY B;  5HKZ A;  2KYC A;  2GV5 A;  1YUT A;  1EH2 A;  4GAO A;  4TNC A;  5HW9 A;  2HJO A;  1GFL A;  4W6S A;  2H61 C;  1LVC D;  1DTL A;  2HQ8 A;  2QT2 A;  2B3P A;  2DUG A;  2OGR A;  1L2O C;  4OR9 B;  3SRY A;  4NQG A;  1ZUZ A;  4RYW A;  4NWS A;  4PCW A;  4ZCV A;  4HRG A;  1V1F A;  2JXL A;  4F0Z B;  1RMP A;  1YFP A;  3M24 A;  1UHK A;  3DQN A;  1A29 A;  3RWT A;  3SSL A;  4I5L B;  2AUC A;  3DQF A;  2AAO A;  5FVG A;  5AFP A;  4GPL B;  1PSR A;  1LXF C;  2JTZ A;  4PHM A;  5EB6 A;  4FTG A;  1FPW A;  1S5G Z;  4DS7 A;  3OX5 A;  2CCM A;  4Q04 A;  2HQK A;  3CD1 A;  1ODB A;  4J8A A;  3GB3 A;  2G3D B;  3LF3 A;  3NT9 A;  1DJZ A;  3BUO B;  3EK4 A;  1Y1A A;  4WRI A;  1CNP A;  3IR8 A;  3I5G C;  4ZIN A;  4ETO A;  1DJI A;  4YI9 A;  3NSL A;  2EMD A;  3EVV A;  2IB5 A;  4KW9 A;  3EKH A;  4YGE B;  2KBI A;  3M22 A;  3CFH A;  4OVN F;  1Q4A A;  1J7Q A;  1W7J B;  4EDS A;  4FQO A;  1XFV O;  4OQW A;  2KQY A;  3PSR A;  1BR1 B;  5DTY A;  5CSF A;  1BT6 A;  4IK4 A;  2I94 A;  3PFV A;  3VGO A;  5BPJ A;  3AI4 A;  2WHT A;  3EVU A;  2I18 A;  3KHE A;  2JTT A;  3I5H B;  2GX2 A;  4DIR A;  5AEQ A;  1HUY A;  2JC2 A;  4QJ4 B;  1KK8 B;  1DGV A;  3PAT A;  5TNC A;  3CD9 A;  3UFZ A;  4MRX A;  1DJX A;  2RGI A;  1B8R A;  1TNW A;  2QRF A;  1XSS A;  1YTZ C;  4DCK A;  3CLN A;  4L12 A;  3CBE A;  3SVR A;  1BU3 A;  1DMO A;  1XAE A;  3OB2 B;  1EML A;  3BX9 A;  4KW8 A;  4LJD C;  2KSP A;  5EB7 A;  2WSO A;  4W6F A;  1ALW A;  1AVS A;  2CT9 A;  3OSR A;  2G6X A;  4MN0 A;  3FS7 A;  1MQ1 A;  2KI6 C;  2BE4 A;  1CLM A;  4W6K A;  2CBL A;  4GGN A;  4EMQ A;  1JBA A;  3ZUL A;  3U8A A;  3A8S A;  3GJ2 A;  3EVP A;  1NX2 A;  3DVK A;  4W6D A;  3WHU B;  2EC6 B;  4XJK B;  5HZU A;  5GQQ C;  3BOW B;  2Y0G A;  3C1V A;  4IK5 A;  3KCT A;  2ISD A;  5DTZ A;  3SS0 A;  1J7P A;  1TN4 A;  4W7F A;  2G16 B;  3ZUF A;  2WSN A;  4GBA A;  3EVR A;  1OSA A;  4W6T A;  2ZNE A;  1F54 A;  2V53 A;  3LA1 A;  1QVI Y;  2LVI A;  2EHB A;  3DQ5 A;  1BOD A;  5HZT A;  3BYA A;  1NX0 A;  3V3D A;  1XFX O;  2A52 B;  3U0L A;  4BY5 A;  2G3O A;  2L50 A;  2YE0 A;  2KDH A;  4HSZ A;  2ZKM X;  3GEX A;  2LLS A;  4WQ2 A;  3DPX A;  2DD7 A;  1M46 A;  3U0N A;  1UIS A;  2OS8 B;  2V4E A;  1IRJ A;  1XFZ O;  4W6N A;  1DVI A;  1NSH A;  1M45 A;  4CFR A;  2H5R A;  1W7S A;  3UG0 A;  3AKO A;  1IWQ A;  1YJ2 A;  1IQ3 A;  3O2P A;  2OTG B;  5AAN A;  2LNK A;  3VHT B;  2IE2 A;  4MBE A;  4OJ0 A;  4W6M A;  4Q7T A;  1FI5 A;  1VRK A;  1YHG A;  2IOV A;  2TN4 A;  2KI4 C;  4C0J A;  3I5I B;  5AQB B;  4H47 A;  3EK8 A;  2HPW A;  3SVB A;  4U8D A;  1WY9 A;  1RM9 A;  3PIB A;  3ST4 A;  1K8U A;  1KYP A;  1BOC A;  1JBY A;  4W74 A;  3EKJ A;  4A4C A;  1ZFS A;  1J7O A;  1ZGO A;  2M49 B;  1XA9 A;  4ORA B;  2H5P A;  1A75 B;  1G4Y R;  1TCF A;  1QS7 A;  5DRF A;  4WQ3 A;  2Q57 A;  1SYM A;  2LVK A;  3PAL A;  1TCO B;  4R1E A;  1IQ5 A;  1KK7 Z;  2LP2 A;  2PVB A;  2AWK A;  2M97 A;  2M3W A;  1JBZ A;  1QX2 A;  3I5F B;  1EMB A;  1GGZ A;  3SVE A;  4Z4K A;  1F8H A;  1K96 A;  2V4E C;  3ADF A;  2DDC A;  1RWY A;  2K7B A;  3DQK A;  1YHI A;  3W1D A;  4OKH A;  3LF4 B;  2G6E A;  1CV7 A;  2A53 B;  3DQ8 A;  3O77 A;  4CFQ A;  1PK0 D;  5T3I A;  2YDZ A;  5KU1 A;  1HQV A;  3DQD A;  3ED8 A;  2A46 A;  1K94 A;  2ZRT A;  3G9A A;  3PN7 C;  3VRN A;  2K7D A;  4HRE E;  2YFP A;  1EMA A;  2BCA A;  1YRT B;  3E3R A;  2Q4U A;  1L2O B;  2ZO6 A;  3NED A;  4DXM A;  1S6Z A;  1EXR A;  2LHL A;  3SJS A;  5I2O A;  4OHS A;  2JT3 A;  5I2L A;  1Q80 A;  1A4P A;  2K7O A;  1WRZ A;  1KQM C;  1Y6W A;  3JVT C;  3BXC A;  3U0K A;  2VRG A;  2LCP A;  1KP5 A;  3SSK A;  3AAJ A;  3I5G B;  4L9M A;  2ZND A;  1JSA A;  2KI6 D;  1F55 A;  3PJ5 A;  5HLO A;  5JOL A;  2C9J A;  4PPK A;  4ORN A;  1XQM A;  1XA5 A;  4IZN A;  3ZUJ A;  1MF8 B;  1FW4 A;  2LM5 A;  1SKT A;  4UTS A;  1MWN A;  1S5G Y;  1J55 A;  1Y1X A;  1LA3 A;  5AXI A;  1SCV A;  2LUC A;  4C0L A;  2GGM A; 
#chains in the Genus database with same CATH topology
 2LE9 B;  3A4U B;  1QTX A;  1B7T Z;  2H8V A;  1Q4E A;  5HLV A;  2LVJ A;  1DJH A;  5AER A;  3DZT A;  3DQ4 A;  4I2Y A;  4KYN A;  1GQM A;  3BXK A;  2KBM A;  4W6O A;  2L5X B;  3PLF B;  1GL4 A;  2JXC A;  2JWW A;  3DQ6 A;  5HKY A;  2L5Y A;  1NCY A;  2P6B B;  3L4L A;  2L2C A;  3SVO A;  3KPX A;  3CZ2 A;  1QAT A;  2A4J A;  2DD9 A;  1RFJ A;  3VRP A;  3DVM A;  2K8M B;  2VVJ A;  5G08 A;  3SS4 A;  5CPV A;  3LK1 A;  4D1E A;  1S6J A;  1XFU O;  3BUM B;  3TS5 C;  1QIW A;  4AR7 A;  3I5F C;  4N1F A;  2WCK A;  2QLI A;  3AKB A;  3WCK A;  4JC2 A;  1L7Z A;  2QLH A;  2KFG A;  4Q7U A;  4M2P A;  4L13 A;  2PAS A;  4DUQ A;  4PE7 A;  3LK0 A;  5CSJ A;  1AJ4 A;  2ERB A;  5FI6 A;  2SCP A;  2PAL A;  2O60 A;  3VRR A;  3CB9 A;  2IS9 A;  4CPV A;  4Q9W A;  4W7C A;  1F4O A;  2BCB A;  4MZK A;  5HKW A;  4N5X A;  1IJ6 A;  1KCY A;  3ST0 A;  4DXN A;  4HQ8 A;  3DVJ A;  3DXL A;  2DUF A;  1XK4 C;  1Q4B A;  2QLE A;  4P1Q A;  1QWV A;  4KPI A;  2M8U A;  4BY4 A;  4NDB A;  1B8C A;  2A48 A;  2JT0 A;  3ZTF A;  4ZFS A;  3SIA A;  1DF0 B;  1XFY O;  1IGV A;  2Y1N A;  1NUB A;  1UHI A;  2A56 B;  2WCF A;  4DXP A;  4OY4 A;  1N2D A;  1NX3 A;  3CFF A;  1MXL C;  2WC8 A;  4H48 A;  3DQL A;  1QJT A;  4UPG A;  2Z1O A;  1YUS A;  3EK7 A;  1W7T A;  5DTX A;  4HQC A;  2FJY A;  1SR6 B;  1XFW O;  2LP3 A;  2O29 A;  4DKN A;  2LHI A;  2AHA A;  5F6T A;  1QX5 B;  3DQM A;  1M63 B;  2F2P A;  2MLE C;  3OBV A;  5JJG A;  1QYQ A;  4PE4 A;  1B9A A;  2CNP A;  1OW4 A;  3OGN A;  2K2F A;  3NT3 A;  3DQ1 A;  4CLN A;  4JWQ A;  1KYR A;  5K89 A;  1JF0 A;  4U2V A;  2KI4 B;  2DUH A;  4W6H A;  1OZO A;  5EBJ A;  1A2X A;  2FZU A;  1GGW A;  3DF0 A;  5PAL A;  1TIZ A;  2L51 A;  1BLQ A;  1F0B A;  2H2K A;  2E6W A;  3NGV A;  2JPT A;  4A4B A;  1TUZ A;  1ZAC A;  4AS8 A;  1PAL A;  4JRB A;  4W72 A;  3MGF A;  3LSA A;  2JT8 A;  3CS1 A;  3HCM A;  3AI5 A;  3WHT B;  1SL7 A;  4JEO A;  1EG4 A;  2B1U A;  1RTP 1;  2VVI A;  5LTR A;  3DVE A;  2O5G A;  2PXW A;  3DQH A;  3ICB A;  4XOV A;  1F4Q A;  2NCP A;  3DQ2 A;  1DGU A;  1CFD A;  4EUL A;  3SST A;  4JKT A;  3OP0 A;  2WIS A;  1DJW A;  4Q7R A;  2COL B;  1OMV A;  1CB1 A;  2YGU A;  1EMC A;  2L98 A;  3D75 A;  4XOW A;  2V4E B;  5CSN A;  4JFG A;  1OOJ A;  3NSI A;  4OV2 A;  2O2B A;  3K1K A;  1WRK A;  4J88 A;  2Y1M A;  2MA2 A;  4YRU A;  2WCH A;  1AJ5 A;  2KQ6 A;  3VIC A;  3LS3 A;  2JNF A;  3DQE A;  3CZ0 A;  3IQO A;  3VRO A;  4GGF A;  2OKW A;  3SSV A;  4AOM A;  3PN7 B;  1N65 A;  1YUU A;  3PJ7 A;  2GGZ A;  4XYN A;  2LMU A;  4W6J A;  1SL9 A;  3S0A A;  3BXA A;  1OZS A;  1J7R A;  2KNE A;  3IF7 A;  4CID A;  1F09 A;  2POX A;  1U5I A;  3RLZ A;  2ICR A;  2L2E A;  4ZF3 A;  5KTG A;  4H3M A;  2BKH B;  1DT7 B;  3H1O A;  2A54 B;  1OQP A;  2Y4Q A;  4YGB B;  2RH7 A;  4IK8 A;  1ZUX A;  1KQM B;  2GW3 A;  4P76 A;  3JVT B;  1KSO A;  5H89 A;  2KGB C;  1YVL A;  3TDI A;  1BMO A;  1R6P A;  2MLF C;  1SCM C;  3A8R A;  5I8N A;  1C3Y A;  1SR6 C;  1QIV A;  2QEB A;  2F3Z A;  2FJU B;  4RTC A;  4JQ0 D;  5DKQ A;  1Z1P A;  2WHU A;  3D10 A;  2M7L A;  5BTT A;  3R1P A;  3DQI A;  4XL5 A;  4W6R A;  1IJ5 A;  4ORB B;  2F8P A;  1YZW A;  3JTD C;  3I19 A;  2C9I A;  1TRF A;  3SIB A;  1QX7 A;  2F2O A;  3RWA A;  3E5T A;  1CDL A;  1XVJ A;  3S0F A;  2WIQ A;  2K2A A;  3RM1 A;  3SSY A;  3SG6 A;  2GTE A;  1S26 D;  4E68 A;  1MR8 A;  2LAN A;  1JF2 A;  3D77 A;  4GGF C;  3D0Y A;  1EMG A;  2WCB A;  4ANJ A;  2WCL A;  1QXT A;  4H3N A;  3KCS A;  1K90 D;  5EXB A;  1LA0 A;  3VB1 A;  1B47 A;  4EDO A;  1IG5 A;  3DQU A;  3OX6 A;  1B7T Y;  2BAP A;  2HCG A;  2KYF A;  2OTB A;  3TS5 B;  4ZIO A;  2ZMW A;  5LK4 A;  2M1K B;  4H3L A;  4ICB A;  1SK6 D;  2QEO A;  2FCE A;  5DKN A;  3NEZ A;  3VHT A;  4HE4 A;  3PM8 A;  5EHU A;  3NSK A;  5H88 A;  1Z1Q A;  4NDD A;  4DXQ A;  2PSR A;  4P5O E;  1OXE A;  3UNW A;  1ALV A;  3LLE A;  1YVH A;  2H8Q A;  2FOT A;  3O4Y A;  4QJ5 B;  2R2I A;  1QVI Z;  1WDC C;  4PPJ A;  1BJF A;  4GNK B;  2ARL A;  2MRD A;  5DPI A;  4M2O A;  3CGL A;  1KQV A;  5D69 A;  5KTY A;  1RMM A;  2H5Q A;  2G2B A;  4B5Y A;  4YGC B;  5FVI A;  3NHT A;  5EXC I;  1D1O A;  4MEW A;  1H6R A;  1LS8 A;  3OGO A;  1FF1 A;  1P28 A;  2BE6 A;  1EJ3 A;  1EMK A;  1AUI B;  5EL2 A;  3D76 A;  5BQL A;  5ER4 X;  1Q4D A;  3R72 A;  5FHV A;  1QLS A;  1S36 A;  4EN1 A;  3TMR A;  1CDM A;  2FCD A;  1QV1 A;  5D7F A;  4QJ3 B;  5HBD A;  2LMT A;  3HX4 A;  1QYF A;  2HQW A;  4KF5 A;  1Y0V H;  3TZ1 A;  2BBN A;  2YE1 A;  3DQ9 A;  1TNX A;  1KWO C;  5HYD A;  1GGX A;  2CXJ A;  3WXA A;  2L0P A;  2EMO A;  1TTX A;  4B30 B;  1NYA A;  1EG3 A;  1DC1 A;  4IL1 A;  2LUX A;  5DY6 A;  4PFE A;  4GES B;  1PVA A;  1BF5 A;  2KLD A;  4LJC A;  3W1C A;  1JC1 A;  3KEV A;  2NCO A;  4XGY A;  1EL4 A;  1REC A;  1F71 A;  1J1E A;  4HVF A;  3CGA A;  1V1G A;  4PHJ A;  4W7A A;  4W73 A;  1F70 A;  1DEL A;  2JU0 A;  1SSE B;  3D74 A;  3N7H A;  1DEK A;  5DU0 A;  5CSI A;  1ZMZ A;  5BT0 A;  2BCX A;  1SY9 A;  3BFA A;  1YRU B;  4W6I A;  3H4S E;  4RYS A;  4DRW A;  1AK8 A;  5DIC A;  2MBX A;  2O24 A;  3R1V A;  4HQ9 A;  4R6B A;  4JPZ B;  2K60 A;  1Q73 A;  2LV7 A;  1K9U A;  4W6C A;  4BDU A;  1EMF A;  3TDZ A;  4PT1 A;  3U8P A;  2AWJ A;  3SG5 A;  4ZF5 A;  1NIW A;  1W7I B;  4KGF A;  1PUL A;  1IH0 A;  3NF0 A;  2G2S B;  2H6V A;  1UHH A;  1Q4C A;  1H4B A;  3U0M A;  2AMI A;  1AP4 A;  1KFU L;  4PDZ A;  2MHH A;  2NZ0 A;  5F9G A;  3CWG A;  1TNP A;  1LIN A;  2G6Y A;  2LVV A;  4USL A;  4MSP A;  2PMY A;  5IBW A;  3M0W A;  1ZGQ A;  1BFP A;  3PJB A;  2MAZ A;  3BJH A;  1XO5 A;  1DQE A;  4N1G A;  3D78 A;  2QLG A;  2P4M A;  3LVD A;  1W9Z A;  4IK3 A;  4ORC B;  1G33 A;  2VAD A;  3GOF A;  3ST3 A;  1H8B A;  1HT9 A;  4MRY A;  5LTQ A;  1UP5 A;  1XMZ A;  4XVP A;  5I2Q A;  3P8U A;  1E8A A;  2IB6 A;  3FWC A;  3SG3 A;  2QAC A;  3GK2 A;  3MSE B;  4OCI A;  1BR4 B;  4W7D A;  4W6B A;  3ZWH A;  3VK1 A;  4TZG A;  3DPZ A;  2JNX A;  5FI7 A;  2BTJ A;  4MZJ A;  4W6U A;  3E5V A;  3QRX A;  5DKR A;  3DF0 B;  1K9P A;  2M29 A;  4J89 A;  4L1I A;  4LJD A;  1JWD A;  1S6C A;  3BUN B;  4ZBL A;  1SCM B;  1G7K A;  2KGR A;  2WOR A;  2L4I A;  5DPG A;  3OHM B;  5HZO A;  2QZ0 A;  2JUL A;  5ER5 A;  3SV5 A;  3H1R A;  2JQ6 A;  3CR5 X;  4GF6 B;  1KFX L;  1MXE A;  1CLL A;  2I2R E;  3OB1 B;  2WND A;  1NP8 A;  3ST2 A;  3K21 A;  3DQ3 A;  3BFB A;  2ZN9 A;  4W7X A;  4OGS A;  4PPL A;  1RK9 A;  3DQJ A;  3JTD B;  1C7V A;  1WRL A;  1SBJ A;  4IK1 A;  1KFU S;  4KAG A;  4PHK A;  1QAS A;  3GJ1 A;  1X02 A;  3CZT X;  1FBV A;  4W75 A;  4PE0 A;  1XYD A;  2M1U A;  1DF0 A;  1UWO A;  3V2L A;  1SRA A;  3E5W A;  1AHR A;  2L4H A;  3B87 A;  1UUR A;  2AWM A;  1QXP A;  2QEH A;  1G8I A;  1S3P A;  1MUX A;  3CFA A;  2OTE A;  4Z4M A;  1MHO A;  1U5I B;  2Z6X A;  3SVN A;  2F33 A;  1YX7 A;  2D8N A;  4KA9 A;  5HL1 A;  2JOJ A;  1BG1 A;  1K93 D;  1H4U A;  4ZF4 A;  4I5K A;  4GUK A;  3TUY C;  1ZOT B;  2BKI B;  1JC2 A;  3SVD A;  4YBH B;  2I7A A;  3IVT A;  1JFK A;  4MZL A;  5H87 A;  1UUS A;  1MOU A;  1R2U A;  2BBM A;  1KK7 Y;  2DOQ A;  2HFC A;  1SMG A;  3CZ1 A;  5LTP A;  1LKJ A;  1CLB A;  5J3X A;  1WDC B;  3SG7 A;  1C4F A;  2HGY A;  2PRU A;  1QV0 A;  2HET A;  4W6A A;  3B7A A;  3RZS A;  1OOH A;  5BTT B;  1PVB A;  3IQQ A;  3KF9 A;  4ZB1 A;  5HZS A;  2SAS A;  4DXO A;  2VZX A;  3F45 A;  5D3O A;  2VAE A;  3VRQ A;  2PYQ A;  1UHJ A;  2Z6Y A;  1KFX S;  4Q9X A;  3ZNI A;  3GL4 A;  4C0K A;  4W77 A;  2QDI A;  4OZD A;  3CDN A;  2WCJ A;  1SPY A;  4NDC A;  4KEX A;  2LC5 A;  3IP2 A;  2M9G A;  3BQ3 A;  2JZI A;  3WLD A;  3UO9 A;  2M0R A;  3DQO A;  3GK1 A;  2KFF A;  3D0Y B;  3LCP C;  1NX1 A;  3SVS A;  5DTL A;  4JGE A;  1KWO B;  3FWB A;  1M31 A;  4W76 A;  1TOP A;  2AH8 A;  4JD9 A;  3SG2 A;  4W6L A;  3BUW B;  2NXQ A;  1FI6 A;  2BNX A;  2Y5I A;  1CFF A;  4XJK A;  4GFT A;  1C07 A;  1A03 A;  4MLW A;  5DPH A;  5FVF A;  3BOW A;  2K61 A;  2DUE A;  1OMR A;  1CMF A;  2GW4 B;  5EXU A;  3KO0 A;  3SG4 A;  1KSM A;  2WC5 A;  2WCE A;  2HPS A;  4TZA A;  1JFJ A;  3P28 A;  4W7E A;  2M7N A;  3I5H C;  2E30 A;  1KK8 C;  1RRX A;  4N3D A;  1K9K A;  1NCX A;  5DRG A;  2QEV A;  4I5N B;  4F7F A;  2HRS A;  4AQJ A;  3S0G A;  4IK9 A;  1CDN A;  5J2O A;  4PAL A;  5DQM A;  2EGD A;  5KSZ A;  5DPJ A;  4KGE A;  3O78 A;  3BUX B;  3R1O A;  2MJW B;  2AWL A;  1NWD A;  1Y1U A;  1YJF A;  2K0J A;  2HQZ A;  1XFR A;  1SNL A;  1DJG A;  4LQU A;  5B8I B;  1GJY A;  2QU1 A;  3LVA A;  2BL0 B;  1QYO A;  2A47 A;  2LAP A;  1CTR A;  4PHN A;  2OJK A;  1K95 A;  2KOT A;  1OXD A;  3B86 A;  1CFP A;  1OXF A;  4DXI A;  1MYW A;  3NXA A;  3SSH A;  1B4C A;  3TMT A;  4LW5 A;  2H5O A;  3CAB A;  3K1E A;  2DUI A;  1JUO A;  2WUR A;  1GM0 A;  3DD4 A;  2QPT A;  2EC6 C;  2GX0 A;  4M2Q A;  1WLZ A;  2KFH A;  1M39 A;  1MOV A;  4W6G A;  3DPW A;  1A75 A;  4LQT A;  4FQT A;  2F3Y A;  1PRW A;  2DDD A;  1NCZ A;  3WNX B;  3DQA A;  2Q6P A;  2Q91 A;  2JRF A;  2CTN A;  4YGA A;  4LJB A;  4MVF A;  3U8C A;  1DJY A;  1TNQ A;  2B3Q A;  2H9W A;  1K2H A;  2WOS A;  1UHN A;  2Z6Z A;  3WLC A;  1C7W A;  2KHN A;  1B1G A;  1IKU A;  4ZCU A;  3TDU A;  4R6D A;  4P2Y B;  2KAX A;  3FE6 A;  4W7R A;  3O6B A;  4HRH A;  1S6I A;  5DQB A;  1CDP A;  2HGD A;  3CR2 A;  1HCJ A;  1ZGP A;  3S0B A;  1B9C A;  2OS8 C;  4W6P A;  2A50 B;  2G5Z B;  4KW4 A;  5HGE A;  1CM4 A;  2ZN8 A;  2OPO A;  2LLU A;  1S1E A;  2EMN A;  1EMM A;  1QY3 A;  2HF5 A;  1CM1 A;  1PSB A;  1YUR A;  4JF9 A;  2ZFD A;  3S05 A;  1OMD A;  2H61 A;  2OTG C;  3OSQ A;  3LVC A;  1SL8 A;  4GOB A;  1RMO A;  3SVC A;  5FYX A;  1CKK A;  4DKM A;  3CTN A;  1EME A;  4AQI A;  2ZMU A;  3AAK A;  4I5J A;  2ZRS A;  2JAD A;  2G9B A;  2LLT A;  1XK4 A;  1YR5 A;  3I5I C;  1C3Z A;  2LMV A;  2BEC A;  2KAY A;  1N0Y A;  1YHH A;  1OE9 B;  1NPQ A;  3CR4 X;  1JC0 A;  3SVU A;  2QLG B;  3O4X A;  2FWQ A;  3GK4 X;  4YGD B;  3SSP A;  2NLN A;  3DQ7 A;  4KF4 A;  1CFC A;  4YI8 A;  3LL8 B;  1B8L A;  1YX8 A;  3DQC A;  3NSO A;  1WLM A;  1RJV A;  5EJU A;  2BL0 C;  4B30 A;  1QLK A;  4IJ7 A;  2PXS A;  3AKA A;  2K7C A;  2OKY A;  4KF5 C;  2FL1 A;  1RRO A;  1W7U A;  1SW8 A;  3FIA A;  4PE1 A;  1J1D A;  2ZO7 A;  2WHS A;  2KAV A;  4W69 A;  2VVH A;  3BXB A;  1CMG A;  1KYS A;  3TUY B;  5HKZ A;  2KYC A;  2GV5 A;  1YUT A;  1EH2 A;  4GAO A;  4TNC A;  5HW9 A;  2HJO A;  2JPO A;  1GFL A;  4W6S A;  2H61 C;  1LVC D;  1DTL A;  2HQ8 A;  2QT2 A;  2B3P A;  3BFH A;  2DUG A;  2OGR A;  3FE8 A;  1L2O C;  4OR9 B;  3SRY A;  4NQG A;  1ZUZ A;  4RYW A;  1T14 A;  4NWS A;  4PCW A;  4ZCV A;  4HRG A;  1V1F A;  2JXL A;  4F0Z B;  1RMP A;  1YFP A;  3M24 A;  1UHK A;  3DQN A;  1A29 A;  3RWT A;  3SSL A;  4I5L B;  2AUC A;  3DQF A;  2AAO A;  5FVG A;  5AFP A;  4GPL B;  1PSR A;  1LXF C;  5FI2 A;  1TUJ A;  2JTZ A;  4PHM A;  5EB6 A;  4FTG A;  1FPW A;  1S5G Z;  4DS7 A;  3OX5 A;  2CCM A;  4Q04 A;  2HQK A;  3CD1 A;  1ODB A;  4J8A A;  3GB3 A;  2G3D B;  3LF3 A;  3NT9 A;  1DJZ A;  3BUO B;  3EK4 A;  1Y1A A;  4WRI A;  1CNP A;  3IR8 A;  3I5G C;  4ZIN A;  4ETO A;  1DJI A;  4YI9 A;  3NSL A;  2EMD A;  3EVV A;  2IB5 A;  4KW9 A;  3EKH A;  4YGE B;  2KBI A;  3L47 A;  3M22 A;  3CFH A;  4OVN F;  1Q4A A;  1J7Q A;  1W7J B;  3L4A A;  4EDS A;  4FQO A;  1XFV O;  4OQW A;  2KQY A;  3PSR A;  1BR1 B;  5DTY A;  5CSF A;  1BT6 A;  4IK4 A;  2I94 A;  3PFV A;  3VGO A;  5BPJ A;  3AI4 A;  2WHT A;  3EVU A;  2I18 A;  3KHE A;  2JTT A;  3I5H B;  2GX2 A;  4DIR A;  5AEQ A;  1HUY A;  2JC2 A;  4QJ4 B;  1KK8 B;  1DGV A;  3PAT A;  5TNC A;  3CD9 A;  3UFZ A;  4MRX A;  3B6X A;  1DJX A;  2RGI A;  3FE9 A;  1B8R A;  1TNW A;  2QRF A;  1XSS A;  1YTZ C;  3S0D A;  4DCK A;  3CLN A;  3PM2 A;  4L12 A;  1OOG A;  3CBE A;  3SVR A;  1BU3 A;  1DMO A;  1XAE A;  3OB2 B;  1EML A;  3BX9 A;  4KW8 A;  4LJD C;  2KSP A;  1Z4H A;  5EB7 A;  2WSO A;  4W6F A;  1ALW A;  1AVS A;  2CT9 A;  3OSR A;  2G6X A;  4MN0 A;  3FS7 A;  1MQ1 A;  2KI6 C;  2BE4 A;  1CLM A;  4W6K A;  2CBL A;  4GGN A;  4EMQ A;  1JBA A;  3ZUL A;  3U8A A;  1Z2C B;  3A8S A;  3GJ2 A;  3EVP A;  1NX2 A;  3DVK A;  4W6D A;  3WHU B;  2EC6 B;  4XJK B;  5HZU A;  5GQQ C;  3BOW B;  2Y0G A;  3C1V A;  4IK5 A;  3KCT A;  2ISD A;  5DTZ A;  3SS0 A;  1J7P A;  1TN4 A;  4W7F A;  2G16 B;  3ZUF A;  2WSN A;  4GBA A;  3EVR A;  1OSA A;  4W6T A;  2ZNE A;  1F54 A;  2V53 A;  1QVI Y;  3LA1 A;  2LVI A;  2EHB A;  3DQ5 A;  1BOD A;  5HZT A;  3BYA A;  1NX0 A;  3V3D A;  1XFX O;  2A52 B;  3U0L A;  4BY5 A;  2G3O A;  3DY9 A;  2L50 A;  2YE0 A;  2KDH A;  4HSZ A;  2ZKM X;  3GEX A;  2LLS A;  3Q8I A;  4WQ2 A;  3DPX A;  2DD7 A;  1M46 A;  3U0N A;  1UIS A;  2OS8 B;  2V4E A;  1IRJ A;  1XFZ O;  3B88 A;  4W6N A;  1DVI A;  1NSH A;  1M45 A;  4CFR A;  2H5R A;  1W7S A;  3UG0 A;  3AKO A;  1IWQ A;  4INW A;  1YJ2 A;  1IQ3 A;  3O2P A;  2OTG B;  5AAN A;  2LNK A;  3VHT B;  2IE2 A;  4MBE A;  4OJ0 A;  4W6M A;  4Q7T A;  1ORG A;  1FI5 A;  4INX A;  1VRK A;  1YHG A;  2IOV A;  2TN4 A;  2KI4 C;  4C0J A;  3I5I B;  5AQB B;  4H47 A;  3EK8 A;  2HPW A;  3SVB A;  4U8D A;  1WY9 A;  1RM9 A;  3PIB A;  3ST4 A;  1K8U A;  2P71 A;  1KYP A;  1BOC A;  1JBY A;  4W74 A;  3EKJ A;  4A4C A;  1ZFS A;  1J7O A;  3QME A;  1ZGO A;  3PJI A;  2M49 B;  2WCM A;  1XA9 A;  4ORA B;  2H5P A;  3SS3 A;  2PQL A;  1A75 B;  2WC6 A;  1G4Y R;  1TCF A;  1QS7 A;  5DRF A;  4WQ3 A;  2Q57 A;  1SYM A;  2LVK A;  3PAL A;  1TCO B;  4R1E A;  1IQ5 A;  1KK7 Z;  2LP2 A;  2PVB A;  2AWK A;  2M97 A;  2M3W A;  1JBZ A;  1QX2 A;  3I5F B;  1OOF A;  1EMB A;  1GGZ A;  3SVE A;  4Z4K A;  1F8H A;  1K96 A;  2V4E C;  3ADF A;  2DDC A;  1RWY A;  2K7B A;  2P70 A;  3DQK A;  1YHI A;  3W1D A;  4OKH A;  3LF4 B;  1IIO A;  2G6E A;  1CV7 A;  2A53 B;  3DQ8 A;  3O77 A;  4CFQ A;  1PK0 D;  3D73 A;  5T3I A;  3EG5 B;  2YDZ A;  5KU1 A;  1HQV A;  3DQD A;  3ED8 A;  2A46 A;  1OOI X;  1K94 A;  2ZRT A;  3G9A A;  3PN7 C;  3VRN A;  2K7D A;  4HRE E;  2YFP A;  1EMA A;  2BCA A;  1YRT B;  3E3R A;  2Q4U A;  5I94 A;  1L2O B;  2ZO6 A;  3NED A;  3CYZ A;  2KPH A;  4DXM A;  1S6Z A;  1EXR A;  2LHL A;  3SJS A;  5I2O A;  4OHS A;  2JT3 A;  5I2L A;  1Q80 A;  1TWO A;  1A4P A;  2K7O A;  1WRZ A;  1KQM C;  1Y6W A;  3JVT C;  3BXC A;  3U0K A;  3NHI A;  2VRG A;  2LCP A;  1KP5 A;  3SSK A;  3AAJ A;  3I5G B;  4L9M A;  2ZND A;  1JSA A;  2KI6 D;  1F55 A;  3PJ5 A;  5HLO A;  2KLE A;  5JOL A;  2C9J A;  4PPK A;  4ORN A;  1XQM A;  1XA5 A;  4IZN A;  3ZUJ A;  1MF8 B;  1FW4 A;  2LM5 A;  1SKT A;  4UTS A;  1MWN A;  1S5G Y;  1J55 A;  1Y1X A;  1LA3 A;  5AXI A;  3SS5 A;  1SCV A;  2LUC A;  3S0E A;  3DYE A;  4C0L A;  2GGM A; 
#chains in the Genus database with same CATH homology
 2LE9 B;  3A4U B;  1QTX A;  1B7T Z;  1Q4E A;  5HLV A;  2LVJ A;  1DJH A;  5AER A;  3DQ4 A;  4I2Y A;  1GQM A;  3BXK A;  2KBM A;  4W6O A;  2L5X B;  3PLF B;  1GL4 A;  2JXC A;  2JWW A;  3DQ6 A;  5HKY A;  2P6B B;  1NCY A;  3SVO A;  3KPX A;  1QAT A;  2A4J A;  2DD9 A;  1RFJ A;  3VRP A;  3DVM A;  2K8M B;  2VVJ A;  5G08 A;  5CPV A;  3LK1 A;  4D1E A;  1S6J A;  1XFU O;  3BUM B;  3TS5 C;  1QIW A;  4AR7 A;  3I5F C;  4N1F A;  2QLI A;  3AKB A;  3WCK A;  4JC2 A;  1L7Z A;  2QLH A;  2KFG A;  4Q7U A;  4M2P A;  4L13 A;  2PAS A;  4DUQ A;  4PE7 A;  3LK0 A;  5CSJ A;  1AJ4 A;  2SCP A;  2PAL A;  2O60 A;  3VRR A;  3CB9 A;  2IS9 A;  4CPV A;  4Q9W A;  4W7C A;  1F4O A;  2BCB A;  4MZK A;  5HKW A;  4N5X A;  1IJ6 A;  1KCY A;  3ST0 A;  4DXN A;  4HQ8 A;  3DVJ A;  2DUF A;  1XK4 C;  1Q4B A;  2QLE A;  4P1Q A;  4KPI A;  2M8U A;  4BY4 A;  4NDB A;  1B8C A;  2A48 A;  2JT0 A;  3ZTF A;  4ZFS A;  3SIA A;  1DF0 B;  1XFY O;  1IGV A;  2Y1N A;  1NUB A;  1UHI A;  2A56 B;  2WCF A;  4DXP A;  4OY4 A;  1N2D A;  1NX3 A;  3CFF A;  1MXL C;  2WC8 A;  4H48 A;  3DQL A;  1QJT A;  4UPG A;  2Z1O A;  1YUS A;  3EK7 A;  1W7T A;  5DTX A;  4HQC A;  1SR6 B;  1XFW O;  2LP3 A;  2O29 A;  4DKN A;  2LHI A;  2AHA A;  5F6T A;  1QX5 B;  3DQM A;  1M63 B;  2F2P A;  2MLE C;  5JJG A;  1QYQ A;  4PE4 A;  1B9A A;  2CNP A;  2K2F A;  3NT3 A;  3DQ1 A;  4CLN A;  4JWQ A;  1KYR A;  5K89 A;  1JF0 A;  4U2V A;  2KI4 B;  2DUH A;  4W6H A;  1OZO A;  5EBJ A;  1A2X A;  2FZU A;  1GGW A;  3DF0 A;  5PAL A;  1TIZ A;  2L51 A;  1BLQ A;  1F0B A;  2H2K A;  2E6W A;  2JPT A;  4A4B A;  1ZAC A;  4AS8 A;  1PAL A;  4JRB A;  4W72 A;  3MGF A;  3LSA A;  2JT8 A;  3CS1 A;  3HCM A;  3AI5 A;  3WHT B;  1SL7 A;  4JEO A;  1EG4 A;  2B1U A;  1RTP 1;  2VVI A;  5LTR A;  3DVE A;  2O5G A;  2PXW A;  3DQH A;  3ICB A;  4XOV A;  1F4Q A;  2NCP A;  3DQ2 A;  1DGU A;  1CFD A;  4EUL A;  3SST A;  3OP0 A;  2WIS A;  1DJW A;  4Q7R A;  2COL B;  1OMV A;  1CB1 A;  1EMC A;  2L98 A;  4XOW A;  2V4E B;  5CSN A;  4JFG A;  1OOJ A;  3NSI A;  4OV2 A;  2O2B A;  3K1K A;  1WRK A;  4J88 A;  2Y1M A;  2MA2 A;  4YRU A;  1AJ5 A;  2KQ6 A;  3VIC A;  3LS3 A;  2JNF A;  3DQE A;  3IQO A;  3VRO A;  4GGF A;  2OKW A;  3SSV A;  4AOM A;  3PN7 B;  1N65 A;  1YUU A;  3PJ7 A;  2GGZ A;  4XYN A;  2LMU A;  4W6J A;  1SL9 A;  3BXA A;  1OZS A;  1J7R A;  2KNE A;  3IF7 A;  4CID A;  1F09 A;  2POX A;  1U5I A;  3RLZ A;  2ICR A;  2L2E A;  4ZF3 A;  5KTG A;  4H3M A;  2BKH B;  1DT7 B;  3H1O A;  2A54 B;  1OQP A;  2Y4Q A;  4YGB B;  2RH7 A;  4IK8 A;  1ZUX A;  1KQM B;  2GW3 A;  4P76 A;  3JVT B;  1KSO A;  5H89 A;  2KGB C;  1YVL A;  3TDI A;  1BMO A;  1R6P A;  2MLF C;  1SCM C;  3A8R A;  5I8N A;  1SR6 C;  1QIV A;  2F3Z A;  2FJU B;  4RTC A;  4JQ0 D;  5DKQ A;  1Z1P A;  2WHU A;  3D10 A;  2M7L A;  5BTT A;  3DQI A;  4XL5 A;  4W6R A;  1IJ5 A;  4ORB B;  2F8P A;  1YZW A;  3JTD C;  3I19 A;  2C9I A;  1TRF A;  3SIB A;  1QX7 A;  2F2O A;  3RWA A;  3E5T A;  1CDL A;  1XVJ A;  2WIQ A;  2K2A A;  3RM1 A;  3SSY A;  3SG6 A;  1S26 D;  4E68 A;  1MR8 A;  2LAN A;  1JF2 A;  4GGF C;  3D0Y A;  1EMG A;  2WCB A;  4ANJ A;  1QXT A;  4H3N A;  3KCS A;  1K90 D;  5EXB A;  1LA0 A;  1B47 A;  4EDO A;  1IG5 A;  3DQU A;  3OX6 A;  1B7T Y;  2HCG A;  2KYF A;  2OTB A;  3TS5 B;  4ZIO A;  2ZMW A;  5LK4 A;  2M1K B;  4H3L A;  4ICB A;  1SK6 D;  2FCE A;  5DKN A;  3NEZ A;  3VHT A;  4HE4 A;  3PM8 A;  5EHU A;  3NSK A;  5H88 A;  1Z1Q A;  4NDD A;  4DXQ A;  2PSR A;  4P5O E;  1OXE A;  1ALV A;  3LLE A;  1YVH A;  2H8Q A;  2FOT A;  3O4Y A;  4QJ5 B;  2R2I A;  1QVI Z;  1WDC C;  4PPJ A;  1BJF A;  4GNK B;  2ARL A;  2MRD A;  5DPI A;  4M2O A;  3CGL A;  1KQV A;  5D69 A;  5KTY A;  1RMM A;  2H5Q A;  2G2B A;  4B5Y A;  4YGC B;  5FVI A;  5EXC I;  1D1O A;  4MEW A;  1H6R A;  3OGO A;  1FF1 A;  2BE6 A;  1EJ3 A;  1EMK A;  1AUI B;  5BQL A;  5ER4 X;  1Q4D A;  5FHV A;  1QLS A;  1S36 A;  4EN1 A;  3TMR A;  1CDM A;  2FCD A;  1QV1 A;  5D7F A;  4QJ3 B;  5HBD A;  2LMT A;  3HX4 A;  1QYF A;  2HQW A;  4KF5 A;  1Y0V H;  3TZ1 A;  2BBN A;  2YE1 A;  3DQ9 A;  1TNX A;  1KWO C;  5HYD A;  1GGX A;  2CXJ A;  3WXA A;  2L0P A;  2EMO A;  1TTX A;  4B30 B;  1NYA A;  1EG3 A;  4IL1 A;  2LUX A;  5DY6 A;  4PFE A;  4GES B;  1PVA A;  1BF5 A;  4LJC A;  3W1C A;  1JC1 A;  3KEV A;  2NCO A;  4XGY A;  1EL4 A;  1REC A;  1F71 A;  1J1E A;  4HVF A;  3CGA A;  1V1G A;  4PHJ A;  4W7A A;  4W73 A;  1F70 A;  2JU0 A;  5DU0 A;  5CSI A;  1ZMZ A;  5BT0 A;  2BCX A;  1SY9 A;  1YRU B;  4W6I A;  3H4S E;  4RYS A;  4DRW A;  1AK8 A;  2MBX A;  2O24 A;  4HQ9 A;  4R6B A;  4JPZ B;  1Q73 A;  2LV7 A;  1K9U A;  4W6C A;  4BDU A;  1EMF A;  3TDZ A;  3U8P A;  2AWJ A;  3SG5 A;  4ZF5 A;  1NIW A;  1W7I B;  4KGF A;  1PUL A;  1IH0 A;  3NF0 A;  2G2S B;  2H6V A;  1UHH A;  1Q4C A;  1H4B A;  3U0M A;  2AMI A;  1AP4 A;  1KFU L;  4PDZ A;  2MHH A;  2NZ0 A;  5F9G A;  3CWG A;  1TNP A;  1LIN A;  2G6Y A;  2LVV A;  4USL A;  4MSP A;  2PMY A;  5IBW A;  3M0W A;  1ZGQ A;  1BFP A;  3PJB A;  2MAZ A;  1XO5 A;  4N1G A;  2QLG A;  2P4M A;  3LVD A;  4IK3 A;  4ORC B;  1G33 A;  2VAD A;  3GOF A;  3ST3 A;  1H8B A;  1HT9 A;  4MRY A;  5LTQ A;  1UP5 A;  1XMZ A;  4XVP A;  5I2Q A;  3P8U A;  1E8A A;  2IB6 A;  3FWC A;  3SG3 A;  2QAC A;  3GK2 A;  3MSE B;  4OCI A;  1BR4 B;  4W7D A;  4W6B A;  3ZWH A;  3VK1 A;  4TZG A;  3DPZ A;  2JNX A;  2BTJ A;  4MZJ A;  4W6U A;  3E5V A;  3QRX A;  5DKR A;  3DF0 B;  1K9P A;  2M29 A;  4J89 A;  4L1I A;  4LJD A;  1JWD A;  1S6C A;  3BUN B;  4ZBL A;  1SCM B;  1G7K A;  2KGR A;  2WOR A;  2L4I A;  5DPG A;  3OHM B;  5HZO A;  2QZ0 A;  2JUL A;  5ER5 A;  3SV5 A;  3H1R A;  2JQ6 A;  3CR5 X;  4GF6 B;  1KFX L;  1MXE A;  1CLL A;  2I2R E;  3OB1 B;  2WND A;  1NP8 A;  3ST2 A;  3K21 A;  3DQ3 A;  2ZN9 A;  4W7X A;  4OGS A;  4PPL A;  1RK9 A;  3DQJ A;  3JTD B;  1C7V A;  1WRL A;  1SBJ A;  4IK1 A;  1KFU S;  4KAG A;  4PHK A;  1QAS A;  3GJ1 A;  1X02 A;  3CZT X;  1FBV A;  4W75 A;  4PE0 A;  1XYD A;  2M1U A;  1DF0 A;  1UWO A;  1SRA A;  3E5W A;  1AHR A;  2L4H A;  1UUR A;  2AWM A;  1QXP A;  1G8I A;  1S3P A;  1MUX A;  3CFA A;  2OTE A;  4Z4M A;  1MHO A;  1U5I B;  2Z6X A;  3SVN A;  2F33 A;  1YX7 A;  2D8N A;  4KA9 A;  2JOJ A;  1BG1 A;  1K93 D;  1H4U A;  4ZF4 A;  4I5K A;  4GUK A;  3TUY C;  1ZOT B;  2BKI B;  1JC2 A;  3SVD A;  4YBH B;  2I7A A;  1JFK A;  4MZL A;  5H87 A;  1UUS A;  1MOU A;  1R2U A;  2BBM A;  1KK7 Y;  2DOQ A;  2HFC A;  1SMG A;  5LTP A;  1LKJ A;  1CLB A;  5J3X A;  1WDC B;  3SG7 A;  1C4F A;  2HGY A;  2PRU A;  1QV0 A;  2HET A;  4W6A A;  5BTT B;  1PVB A;  3IQQ A;  3KF9 A;  4ZB1 A;  5HZS A;  2SAS A;  4DXO A;  2VZX A;  3F45 A;  2VAE A;  3VRQ A;  1UHJ A;  2Z6Y A;  1KFX S;  4Q9X A;  3ZNI A;  3GL4 A;  4C0K A;  4W77 A;  1SPY A;  4NDC A;  4KEX A;  2LC5 A;  3IP2 A;  2M9G A;  3BQ3 A;  2JZI A;  3WLD A;  2M0R A;  3DQO A;  3GK1 A;  2KFF A;  3D0Y B;  3LCP C;  1NX1 A;  3SVS A;  5DTL A;  4JGE A;  1KWO B;  3FWB A;  1M31 A;  4W76 A;  1TOP A;  2AH8 A;  3SG2 A;  4W6L A;  3BUW B;  2NXQ A;  1FI6 A;  2Y5I A;  1CFF A;  4XJK A;  4GFT A;  1C07 A;  1A03 A;  4MLW A;  5DPH A;  5FVF A;  3BOW A;  2K61 A;  2DUE A;  1OMR A;  1CMF A;  2GW4 B;  5EXU A;  3KO0 A;  3SG4 A;  1KSM A;  2WCE A;  2HPS A;  4TZA A;  1JFJ A;  3P28 A;  4W7E A;  2M7N A;  3I5H C;  2E30 A;  1KK8 C;  1RRX A;  4N3D A;  1K9K A;  1NCX A;  5DRG A;  4I5N B;  2HRS A;  4AQJ A;  4IK9 A;  1CDN A;  5J2O A;  4PAL A;  5DQM A;  2EGD A;  5KSZ A;  5DPJ A;  4KGE A;  3O78 A;  3BUX B;  2MJW B;  2AWL A;  1NWD A;  1Y1U A;  1YJF A;  2K0J A;  2HQZ A;  1SNL A;  1DJG A;  4LQU A;  5B8I B;  1GJY A;  2QU1 A;  3LVA A;  2BL0 B;  1QYO A;  2A47 A;  2LAP A;  1CTR A;  4PHN A;  2OJK A;  1K95 A;  2KOT A;  1OXD A;  1CFP A;  1OXF A;  4DXI A;  1MYW A;  3NXA A;  3SSH A;  1B4C A;  3TMT A;  4LW5 A;  2H5O A;  2DUI A;  1JUO A;  2WUR A;  3DD4 A;  2QPT A;  2EC6 C;  2GX0 A;  4M2Q A;  1WLZ A;  2KFH A;  1M39 A;  1MOV A;  4W6G A;  3DPW A;  1A75 A;  4LQT A;  2F3Y A;  1PRW A;  2DDD A;  1NCZ A;  3WNX B;  3DQA A;  2Q6P A;  2Q91 A;  2JRF A;  2CTN A;  4YGA A;  4LJB A;  4MVF A;  3U8C A;  1DJY A;  1TNQ A;  2B3Q A;  2H9W A;  1K2H A;  2WOS A;  1UHN A;  2Z6Z A;  3WLC A;  1C7W A;  2KHN A;  1B1G A;  1IKU A;  4ZCU A;  3TDU A;  4R6D A;  4P2Y B;  2KAX A;  4W7R A;  3O6B A;  4HRH A;  1S6I A;  5DQB A;  1CDP A;  2HGD A;  3CR2 A;  1HCJ A;  1ZGP A;  1B9C A;  2OS8 C;  4W6P A;  2A50 B;  2G5Z B;  4KW4 A;  5HGE A;  1CM4 A;  2ZN8 A;  2OPO A;  2LLU A;  1S1E A;  2EMN A;  1EMM A;  1QY3 A;  2HF5 A;  1CM1 A;  1PSB A;  1YUR A;  4JF9 A;  2ZFD A;  3S05 A;  1OMD A;  2H61 A;  2OTG C;  3OSQ A;  3LVC A;  1SL8 A;  4GOB A;  1RMO A;  3SVC A;  5FYX A;  1CKK A;  4DKM A;  3CTN A;  1EME A;  4AQI A;  2ZMU A;  3AAK A;  4I5J A;  2ZRS A;  2JAD A;  2G9B A;  2LLT A;  1XK4 A;  1YR5 A;  3I5I C;  2LMV A;  2BEC A;  2KAY A;  1N0Y A;  1YHH A;  1OE9 B;  1NPQ A;  3CR4 X;  1JC0 A;  3SVU A;  2QLG B;  2FWQ A;  3GK4 X;  4YGD B;  3SSP A;  2NLN A;  3DQ7 A;  4KF4 A;  1CFC A;  4YI8 A;  3LL8 B;  1B8L A;  1YX8 A;  3DQC A;  3NSO A;  1WLM A;  1RJV A;  5EJU A;  2BL0 C;  4B30 A;  1QLK A;  2PXS A;  3AKA A;  2K7C A;  2OKY A;  4KF5 C;  2FL1 A;  1RRO A;  1W7U A;  1SW8 A;  3FIA A;  4PE1 A;  1J1D A;  2ZO7 A;  2WHS A;  2KAV A;  4W69 A;  2VVH A;  3BXB A;  1CMG A;  1KYS A;  3TUY B;  5HKZ A;  2KYC A;  2GV5 A;  1YUT A;  1EH2 A;  4GAO A;  4TNC A;  5HW9 A;  2HJO A;  1GFL A;  4W6S A;  2H61 C;  1LVC D;  1DTL A;  2HQ8 A;  2QT2 A;  2B3P A;  2DUG A;  2OGR A;  1L2O C;  4OR9 B;  3SRY A;  4NQG A;  1ZUZ A;  4RYW A;  4NWS A;  4PCW A;  4ZCV A;  4HRG A;  1V1F A;  2JXL A;  4F0Z B;  1RMP A;  1YFP A;  3M24 A;  1UHK A;  3DQN A;  1A29 A;  3RWT A;  3SSL A;  4I5L B;  2AUC A;  3DQF A;  2AAO A;  5FVG A;  5AFP A;  4GPL B;  1PSR A;  1LXF C;  2JTZ A;  4PHM A;  5EB6 A;  4FTG A;  1FPW A;  1S5G Z;  4DS7 A;  3OX5 A;  2CCM A;  4Q04 A;  2HQK A;  3CD1 A;  1ODB A;  4J8A A;  3GB3 A;  2G3D B;  3LF3 A;  3NT9 A;  1DJZ A;  3BUO B;  3EK4 A;  1Y1A A;  4WRI A;  1CNP A;  3IR8 A;  3I5G C;  4ZIN A;  4ETO A;  1DJI A;  4YI9 A;  3NSL A;  2EMD A;  3EVV A;  2IB5 A;  4KW9 A;  3EKH A;  4YGE B;  2KBI A;  3M22 A;  3CFH A;  4OVN F;  1Q4A A;  1J7Q A;  1W7J B;  4EDS A;  4FQO A;  1XFV O;  4OQW A;  2KQY A;  3PSR A;  1BR1 B;  5DTY A;  5CSF A;  1BT6 A;  4IK4 A;  2I94 A;  3PFV A;  3VGO A;  5BPJ A;  3AI4 A;  2WHT A;  3EVU A;  2I18 A;  3KHE A;  2JTT A;  3I5H B;  2GX2 A;  4DIR A;  5AEQ A;  1HUY A;  2JC2 A;  4QJ4 B;  1KK8 B;  1DGV A;  3PAT A;  5TNC A;  3CD9 A;  3UFZ A;  4MRX A;  1DJX A;  2RGI A;  1B8R A;  1TNW A;  2QRF A;  1XSS A;  1YTZ C;  4DCK A;  3CLN A;  4L12 A;  3CBE A;  3SVR A;  1BU3 A;  1DMO A;  1XAE A;  3OB2 B;  1EML A;  3BX9 A;  4KW8 A;  4LJD C;  2KSP A;  5EB7 A;  2WSO A;  4W6F A;  1ALW A;  1AVS A;  2CT9 A;  3OSR A;  2G6X A;  4MN0 A;  3FS7 A;  1MQ1 A;  2KI6 C;  2BE4 A;  1CLM A;  4W6K A;  2CBL A;  4GGN A;  4EMQ A;  1JBA A;  3ZUL A;  3U8A A;  3A8S A;  3GJ2 A;  3EVP A;  1NX2 A;  3DVK A;  4W6D A;  3WHU B;  2EC6 B;  4XJK B;  5HZU A;  5GQQ C;  3BOW B;  2Y0G A;  3C1V A;  4IK5 A;  3KCT A;  2ISD A;  5DTZ A;  3SS0 A;  1J7P A;  1TN4 A;  4W7F A;  2G16 B;  3ZUF A;  2WSN A;  4GBA A;  3EVR A;  1OSA A;  4W6T A;  2ZNE A;  1F54 A;  2V53 A;  3LA1 A;  1QVI Y;  2LVI A;  2EHB A;  3DQ5 A;  1BOD A;  5HZT A;  3BYA A;  1NX0 A;  3V3D A;  1XFX O;  2A52 B;  3U0L A;  4BY5 A;  2G3O A;  2L50 A;  2YE0 A;  2KDH A;  4HSZ A;  2ZKM X;  3GEX A;  2LLS A;  4WQ2 A;  3DPX A;  2DD7 A;  1M46 A;  3U0N A;  1UIS A;  2OS8 B;  2V4E A;  1IRJ A;  1XFZ O;  4W6N A;  1DVI A;  1NSH A;  1M45 A;  4CFR A;  2H5R A;  1W7S A;  3UG0 A;  3AKO A;  1IWQ A;  1YJ2 A;  1IQ3 A;  3O2P A;  2OTG B;  5AAN A;  2LNK A;  3VHT B;  2IE2 A;  4MBE A;  4OJ0 A;  4W6M A;  4Q7T A;  1FI5 A;  1VRK A;  1YHG A;  2IOV A;  2TN4 A;  2KI4 C;  4C0J A;  3I5I B;  5AQB B;  4H47 A;  3EK8 A;  2HPW A;  3SVB A;  4U8D A;  1WY9 A;  1RM9 A;  3PIB A;  3ST4 A;  1K8U A;  1KYP A;  1BOC A;  1JBY A;  4W74 A;  3EKJ A;  4A4C A;  1ZFS A;  1J7O A;  1ZGO A;  2M49 B;  1XA9 A;  4ORA B;  2H5P A;  1A75 B;  1G4Y R;  1TCF A;  1QS7 A;  5DRF A;  4WQ3 A;  2Q57 A;  1SYM A;  2LVK A;  3PAL A;  1TCO B;  4R1E A;  1IQ5 A;  1KK7 Z;  2LP2 A;  2PVB A;  2AWK A;  2M97 A;  2M3W A;  1JBZ A;  1QX2 A;  3I5F B;  1EMB A;  1GGZ A;  3SVE A;  4Z4K A;  1F8H A;  1K96 A;  2V4E C;  3ADF A;  2DDC A;  1RWY A;  2K7B A;  3DQK A;  1YHI A;  3W1D A;  4OKH A;  3LF4 B;  2G6E A;  1CV7 A;  2A53 B;  3DQ8 A;  3O77 A;  4CFQ A;  1PK0 D;  5T3I A;  2YDZ A;  5KU1 A;  1HQV A;  3DQD A;  3ED8 A;  2A46 A;  1K94 A;  2ZRT A;  3G9A A;  3PN7 C;  3VRN A;  2K7D A;  4HRE E;  2YFP A;  1EMA A;  2BCA A;  1YRT B;  3E3R A;  2Q4U A;  1L2O B;  2ZO6 A;  3NED A;  4DXM A;  1S6Z A;  1EXR A;  2LHL A;  3SJS A;  5I2O A;  4OHS A;  2JT3 A;  5I2L A;  1Q80 A;  1A4P A;  2K7O A;  1WRZ A;  1KQM C;  1Y6W A;  3JVT C;  3BXC A;  3U0K A;  2VRG A;  2LCP A;  1KP5 A;  3SSK A;  3AAJ A;  3I5G B;  4L9M A;  2ZND A;  1JSA A;  2KI6 D;  1F55 A;  3PJ5 A;  5HLO A;  5JOL A;  2C9J A;  4PPK A;  4ORN A;  1XQM A;  1XA5 A;  4IZN A;  3ZUJ A;  1MF8 B;  1FW4 A;  2LM5 A;  1SKT A;  4UTS A;  1MWN A;  1S5G Y;  1J55 A;  1Y1X A;  1LA3 A;  5AXI A;  1SCV A;  2LUC A;  4C0L A;  2GGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...