3SG6A

Crystal structure of dimeric gcamp2-lia(linker 1)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
409
structure length
383
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLIANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
total genus 125
structure length 383
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg6A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg6A01
3PN7C 3DQ4A 2O60A 2GW3A 4W6HA 1OMDA 2D8NA 1DTLA 3BXAA 4AR7A 1XSSA 1LXFC 3CR4X 1EH2A 5AEQA 3VRQA 4W6TA 1CDNA 2BL0C 4FTGA 1JBZA 1RMPA 1LVCD 5BTTA 2Y4QA 1Y1UA 1KK8B 2VADA 1SYMA 1QASA 3VRPA 1SL9A 2JRFA 1IRJA 4NDBA 3I5IB 4JWQA 1J1EA 2Y1NA 5EXCI 4Z4MA 1BF5A 2G2BA 3DQ8A 3CR5X 1IH0A 4GBAA 1Z1PA 3SVNA 1RMOA 2AHAA 1YHIA 1SBJA 4W77A 4HVFA 1KSOA 3LVCA 5G08A 2DUGA 4JGEA 3DVJA 4KA9A 3ZULA 1PK0D 1FW4A 3DQLA 2LE9B 1SCMB 1YRUB 1UHKA 4W7AA 2V4EC 3WNXB 4H3MA 4W75A 1JSAA 1QYFA 1IJ5A 4ORCB 4L12A 4YGBB 4W6OA 1W7UA 2O5GA 3DVKA 2LUXA 2AWMA 4Z4KA 1DJZA 3EVRA 1ODBA 2QPTA 1C7WA 5EXBA 1KFUS 1A75B 1XMZA 1NYAA 4DS7A 1UHJA 3PM8A 4ZF5A 2G6EA 3NSOA 1XFWO 4W6DA 2WNDA 3TS5B 3CD9A 4M2PA 2G2SB 3NT9A 1CV7A 4L13A 4IK8A 2LMTA 4NWSA 4PDZA 1RM9A 1M63B 3CS1A 2OTGB 3CD1A 2CNPA 1K9UA 5JOLA 1XYDA 1A4PA 3PATA 1MWNA 2K61A 3DPZA 1YVHA 2HPSA 3K1KA 1C4FA 1B9CA 1Q4CA 3DQFA 3D0YB 2DUFA 4PE4A 1NP8A 1YRTB 3AKAA 4MN0A 2ZMWA 3U0NA 4DIRA 2K7BA 3AAKA 4U2VA 3ST0A 5DPJA 4W6JA 4WRIA 3DQ5A 3E5VA 1E8AA 4J88A 2CXJA 1K95A 2BKIB 3WHTB 2QLIA 1PULA 1TTXA 4XJKB 3DQ3A 1YJ2A 4GOBA 3BOWA 3DQIA 1FPWA 1JBYA 2L0PA 4JEOA 1NX1A 2FCEA 3DQ6A 2PMYA 2DD9A 2BKHB 5HKWA 4PPKA 1CM4A 3CB9A 5ER4X 2M1KB 4MBEA 4OY4A 3A8RA 2DDCA 4CFRA 2HJOA 3DQUA 1EJ3A 2YE0A 1WRZA 4ETOA 5BTTB 4H47A 2F3YA 1RTP1 2L50A 3GB3A 5DQBA 3TZ1A 1B4CA 3BQ3A 1MXLC 4IK9A 1NCXA 2Y1MA 4L9MA 4P2YB 2FOTA 2BCAA 4IK3A 4YGCB 5DPGA 2HQ8A 4N1FA 3LCPC 1YFPA 3E5WA 5HW9A 3SVRA 5DRFA 4W6FA 5FYXA 1DF0A 2TN4A 1IG5A 1QATA 3O4YA 2VVIA 4XOWA 3FWCA 1HT9A 5DRGA 2A4JA 2L4HA 5D7FA 4MSPA 1JC1A 5DY6A 1S6ZA 1A2XA 1RJVA 1BJFA 2KBIA 3SVUA 3PIBA 2LLUA 2JADA 1YURA 4P5OE 4R1EA 2H61C 1QLSA 2LVKA 5D69A 2M9GA 3SS0A 2G3OA 1KQVA 4DKNA 3SG4A 4GF6B 2COLB 4AS8A 2MLEC 2HRSA 4W6MA 2VVHA 3RLZA 2Y5IA 2DUIA 2ISDA 1FI6A 1WRKA 1K96A 1SR6C 3TMTA 3VROA 1C07A 2Z6ZA 4LJBA 1BMOA 3BUNB 1WLMA 4P76A 4UTSA 1F4OA 2FJUB 1N0YA 1SNLA 5CSNA 1XA9A 1TCOB 1A03A 1YVLA 3DD4A 4WQ2A 3ZUFA 1S6IA 5KTYA 4W6PA 1V1FA 1YZWA 3OB1B 3SG5A 3G9AA 4MZJA 4U8DA 3PN7B 4R6DA 4NQGA 2KAYA 3OGOA 1QX5B 2Q6PA 2KAXA 4PHJA 4DCKA 2BL0B 4C0KA 4W6NA 4C0LA 1KFUL 2HCGA 1QYQA 1CDLA 4PCWA 1S1EA 1XK4C 4YI8A 1TNQA 2K2AA 2A54B 4ORNA 1BODA 4JRBA 3U0KA 2SASA 4PHNA 3A8SA 3BOWB 2LAPA 3ZNIA 2WHTA 3DF0B 5EXUA 1F71A 2MHHA 3KF9A 1AUIB 2KQYA 1Y1AA 2H5PA 1W7IB 5PALA 2E6WA 2WORA 1S3PA 2QT2A 3TDUA 3CR2A 4Q7RA 4KF4A 3DVEA 2H5OA 1QVIY 4KGFA 3WLCA 4J89A 2WC8A 1MXEA 3V3DA 3LF4B 2ZMUA 3W1CA 4W7FA 1RK9A 3CLNA 3OB2B 5DKNA 5T3IA 4MLWA 1Q4BA 4OR9B 3IQOA 2V4EB 4CPVA 4ZBLA 4PPLA 3NT3A 3SSLA 4RYWA 2JU0A 3EK7A 2H61A 1W7SA 2A47A 4W73A 4EULA 2KI6D 2B3PA 2YE1A 1XFVO 3GK4X 5FVFA 2DDDA 2YDZA 3DQKA 5J2OA 2KBMA 1TN4A 4ZCVA 3VHTB 1M45A 1F0BA 4LJCA 4MRYA 1Q4DA 2JTZA 2WHSA 3CBEA 1LINA 5J3XA 1XFYO 4ZB1A 2EMOA 4TNCA 5F9GA 2KAVA 2PSRA 5BQLA 2Y0GA 3JTDC 1CMGA 1SRAA 2HPWA 2KGRA 1ZOTB 4W69A 3DQ2A 3VICA 1NCZA 1WDCC 5DU0A 4PALA 4KAGA 1G33A 4Q7TA 5IBWA 1AVSA 3BUMB 3CTNA 3SSHA 3WXAA 5KSZA 1G7KA 3D0YA 2LMVA 1IQ3A 1S5GZ 3O77A 3KHEA 2WCEA 1MOVA 2JNXA 2EGDA 1PSRA 2PXSA 3U0MA 2QRFA 3LA1A 1MYWA 2M3WA 5CPVA 1CFPA 1GGWA 2AWKA 3I5HC 1XQMA 1GGZA 2M29A 3RWAA 1YX8A 1BOCA 2A48A 4BY4A 1J7OA 2O2BA 1UWOA 2KFHA 2K8MB 4W6CA 1XK4A 3MSEB 1V1GA 1CLLA 3NEDA 5KTGA 3ICBA 2JQ6A 3BYAA 5HBDA 5CSJA 2ICRA 4DXPA 3DQNA 2AWJA 1KWOC 1KP5A 3BUXB 2JTTA 2MLFC 1FF1A 2OKWA 5EJUA 4MVFA 2JT8A 1H4BA 2IOVA 1ZUXA 5DTLA 1BT6A 1WLZA 1B7TZ 3M22A 3ST4A 2M8UA 3OSQA 3WLDA 1CDPA 1AK8A 2LVJA 1W7JB 1ZACA 1QIVA 2F33A 4W6SA 4BDUA 3E5TA 1MOUA 2POXA 5LTRA 2H5RA 4PE7A 1OMVA 2KHNA 1NX3A 3SSYA 3LSAA 5I2LA 3CFHA 2ZNDA 2B3QA 2JXLA 1DMOA 4IK5A 1XAEA 5H88A 2Q91A 3NSLA 3SVBA 1PVBA 2K0JA 1F54A 2ZN9A 5FVGA 2LVVA 5F6TA 4LQUA 2L51A 5I8NA 1UHHA 2CTNA 1M31A 4A4CA 4CFQA 3SSVA 2H8QA 1K90D 2JNFA 2LVIA 1EMLA 3BX9A 3ZTFA 2GW4B 4W76A 1ZGQA 1HUYA 2FWQA 1SR6B 3PJ7A 3NEZA 4KEXA 4W6BA 1AP4A 3OX6A 1EG3A 3QRXA 4NDDA 2QZ0A 1CFDA 5TNCA 1SKTA 4ZINA 1K93D 1KK7Y 3GJ1A 5DTXA 5FVIA 1YUSA 1YTZC 1Z1QA 3DQOA 3E3RA 4JQ0D 5FHVA 2JT0A 3M0WA 1QVIZ 5LTQA 1SK6D 3AKOA 4DRWA 2RH7A 4GGNA 1B8RA 3O6BA 3DF0A 1QX7A 4PE0A 1ZUZA 3NSIA 2MJWB 4Q04A 1QJTA 2IS9A 2ARLA 1QY3A 2EMNA 3JVTC 1HQVA 1YHGA 4W7DA 3W1DA 1LKJA 1RROA 1UISA 2AH8A 1KYSA 2C9IA 4OKHA 1JC0A 1ALWA 1CM1A 4DXMA 5HZOA 1QS7A 3GL4A 4GESB 1CMFA 2C9JA 2V4EA 4OCIA 2Z6YA 1OOJA 4W6GA 3SIAA 2I18A 3CGLA 1SMGA 1JF2A 2KGBC 2L2EA 3LLEA 4GUKA 1QX2A 1YJFA 2VRGA 3SVCA 4ZF3A 3VHTA 1S6JA 2ZRTA 2OGRA 3IP2A 3VK1A 4IL1A 5B8IB 1XFXO 5HYDA 4H3NA 1SPYA 3GK1A 2NCPA 4PFEA 4N5XA 2BBMA 1DGUA 4OGSA 4IK1A 2HGDA 2F2PA 1ZGOA 2R2IA 1DVIA 1TIZA 1J7RA 2K7OA 1QV1A 2HQWA 2MAZA 2OTEA 5EBJA 1YUUA 5BT0A 1GL4A 1R2UA 3WCKA 1BR1B 1Y1XA 3JTDB 2L5XB 4ANJA 4CIDA 1F55A 3LF3A 1JFKA 3ST2A 1WDCB 2OS8C 1H8BA 3GJ2A 3CWGA 1KCYA 3DQMA 5LK4A 2K7DA 5DKQA 3SJSA 3CGAA 4I5KA 4XGYA 1JWDA 1G4YR 3EKHA 4MZLA 2KOTA 4W7EA 5AQBB 3PLFB 2JPTA 2E30A 2LHIA 3I5HB 1F8HA 1EMFA 5DKRA 2MBXA 4TZAA 4QJ4B 1B9AA 1L2OB 2BE4A 4YGAA 1XA5A 1CB1A 5DTZA 1IWQA 4OQWA 4EDSA 2G9BA 3VGOA 1CNPA 4I5NB 4YI9A 5GQQC 2WURA 1KWOB 3AI4A 1NSHA 2ZRSA 2LNKA 1QLKA 3IF7A 5HLVA 1R6PA 4YGDB 4DXQA 2FL1A 3BUWB 1S36A 3SSKA 2SCPA 3RM1A 4IK4A 1PALA 3RWTA 1CKKA 4F0ZB 2KI4C 2L4IA 2ZFDA 1MHOA 1QXPA 4HQ8A 2A56B 2KFGA 2JWWA 3NSKA 1RMMA 1Q80A 4A4BA 2A50B 2QU1A 3O2PA 3GK2A 4Q9WA 1F4QA 2BECA 4MRXA 2O29A 2OPOA 1K2HA 3H1OA 2WCFA 2FCDA 5H89A 1OE9B 2LP2A 2ZN8A 3SG6A 2KNEA 3DQAA 2ZO6A 3PALA 1QYOA 4GNKB 2BE6A 3BXKA 3U8CA 4QJ5B 3P28A 3IR8A 1JC2A 5ER5A 3IQQA 4ZCUA 2F8PA 2QLEA 1EG4A 2LCPA 4W6RA 3OX5A 1J1DA 1J7QA 4W6LA 1BR4B 1ZGPA 5HKYA 1CFFA 1NIWA 2L98A 4RTCA 1EMBA 1UUSA 5I2QA 1GJYA 5JJGA 2KQ6A 1UHNA 3ADFA 1XFUO 4YBHB 3DVMA 4WQ3A 4HQ9A 3H4SE 4KW8A 1JUOA 1N2DA 1NPQA 1NWDA 3DQDA 4HRHA 1QV0A 1SL8A 3CZTX 4TZGA 2MA2A 1DJWA 3HCMA 1TRFA 1L2OC 3U0LA 1Q4EA 1CTRA 3VRNA 1IQ5A 2KYCA 4GFTA 5HZTA 2PXWA 2AUCA 4W72A 3KEVA 2M7NA 1U5IA 4AQIA 1DGVA 1OZSA 1F09A 1F70A 1TCFA 4HREE 4W74A 3I5GC 1ZMZA 4BY5A 4I5LB 3LK1A 1RECA 3JVTB 4OVNF 3EK4A 1EMKA 4XOVA 3SSPA 2ZKMX 1IKUA 4B30A 1OSAA 3AAJA 4ICBA 2WHUA 3DQEA 1KFXS 2BBNA 2K7CA 3EKJA 5HLOA 1BFPA 2LUCA 2P6BB 2LMUA 2ZNEA 2JC2A 2LP3A 1X02A 2ZO7A 1JFJA 1GQMA 5DPIA 2PVBA 4OV2A 2WOSA 4C0JA 1PRWA 3TMRA 2LLSA 2A46A 3OHMB 1CLMA 1Q4AA 1EMCA 2G6XA 1M46A 4Q9XA 4N1GA 2K2FA 4NDCA 2QLHA 1NUBA 2JZIA 1ALVA 3PSRA 2H9WA 2A52B 4PHMA 1K9KA 3U8AA 1B1GA 2WISA 2PASA 1NCYA 2KYFA 1MQ1A 2LM5A 1KYRA 2H5QA 1QIWA 3DQ1A 1Y0VH 3DQCA 4USLA 1TOPA 2OS8B 4YGEB 2GGMA 1KQMC 4EN1A 2YFPA 4AQJA 4HQCA 1K9PA 2OJKA 4DXOA 3DQ7A 1S26D 1XFZO 2HETA 2EC6C 2VZXA 1YHHA 3HX4A 2G16B 3UFZA 4KW4A 3OSRA 2Z1OA 4JFGA 2JXCA 3LK0A 2LANA 2IB6A 2OKYA 4ZFSA 5HZSA 1D1OA 3FIAA 3VRRA 1W7TA 3SVSA 4DKMA 3TDZA 4GGFC 4HRGA 2DUEA 1DJGA 1Y6WA 1DJYA 4I5JA 1B47A 2BCBA 2GV5A 4N3DA 3LL8B 3SVDA 3LVAA 4FQOA 4JF9A 3I5FC 3SG7A 2M0RA 3DPXA 3KO0A 1UURA 2F2OA 5BPJA 2G6YA 2M49B 3ED8A 4UPGA 2OTBA 3SVOA 5LTPA 1K94A 3KPXA 1SCVA 5I2OA 1J55A 1M39A 3FS7A 5EB6A 1U5IB 1PVAA 4RYSA 5EHUA 1DJXA 2VAEA 2KI4B 3K21A 3ST3A 1WY9A 1A29A 3DQ9A 1NX0A 4QJ3B 2QLGA 2WSOA 2KSPA 2MRDA 2I2RE 1AJ5A 1EL4A 2AWLA 3ZWHA 4J8AA 1S5GY 1RFJA 4P1QA 1YR5A 4B30B 3DPWA 4Q7UA 3AI5A 4W6AA 2DUHA 4M2OA 2IE2A 3A4UB 2CCMA 4XL5A 1KK8C 3GOFA 4HSZA 3NXAA 4JPZB 4LW5A 5HZUA 1XO5A 3GEXA 2RGIA 3SSTA 3I5IC 1OZOA 1JBAA 2P4MA 3TUYB 4E68A 4ZIOA 1LA3A 3BUOB 3C1VA 1Q73A 1YX7A 1DJHA 1TNWA 3UG0A 2KI6C 3LVDA 4H48A 2CT9A 1SW8A 5CSFA 4HE4A 1EXRA 1N65A 4ORBB 3SG2A 2G5ZB 4DUQA 3ZUJA 1K8UA 3I19A 1B7TY 3TDIA 4R6BA 1IGVA 2EHBA 1TNXA 2M97A 2NZ0A 1MF8B 1SCMC 1CDMA 4PPJA 4H3LA 1KFXL 1ZFSA 3EK8A 4CLNA 4GGFA 4KPIA 1DJIA 1WRLA 1XVJA 1EMEA 5HKZA 2WCBA 4LQTA 4W7CA 1CFCA 2NXQA 4W7XA 2KFFA 1EMMA 1KSMA 3S05A 1MUXA 1H6RA 5KU1A 1GGXA 1OQPA 1B8LA 3MGFA 4W6IA 2M7LA 1JF0A 3TS5C 3CFFA 2LHLA 5AFPA 5AANA 2OTGC 1L7ZA 4GPLB 3FWBA 1IJ6A 1J7PA 1OMRA 3I5GB 1NX2A 4EMQA 2LLTA 2HFCA 2LC5A 2DD7A 2VVJA 2Z6XA 3DQJA 2KDHA 4L1IA 3LS3A 1BU3A 2DOQA 4LJDC 1GFLA 4KF5C 3BXCA 2F3ZA 2LV7A 2NLNA 4OJ0A 3SG3A 2HQZA 3PJBA 4OHSA 4DXNA 5HGEA 1YUTA 3EVVA 4KW9A 1HCJA 2JT3A 2I7AA 3SV5A 2QLGB 2Q4UA 3F45A 2WSNA 1S6CA 3OP0A 3WHUB 4MZKA 1BLQA 2A53B 2I94A 2M1UA 1EMGA 1RRXA 3O78A 3D10A 4W7RA 3KCTA 2HQKA 1OXEA 1UHIA 2GX2A 1QTXA 4M2QA 1QXTA 4IZNA 2O24A 1PSBA 2CBLA 3SRYA 2G3DB 2FZUA 1FI5A 4DXIA 3TUYC 5DTYA 3DQHA 2H2KA 2BCXA 5CSIA 1TNPA 1G8IA 1KK7Z 3KCSA 1EMAA 3EVPA 1CLBA 1KQMB 4PE1A 1B8CA 1FBVA 2V53A 2B1UA 4ORAB 1A75A 4I2YA 5H87A 1H4UA 1RWYA 1UP5A 2EC6B 2PRUA 4ZF4A 1MR8A 2IB5A 2EMDA 4XYNA 3EVUA 3P8UA 1DF0B 2AAOA 3NF0A 1KYPA 1LA0A 2BTJA 2AMIA 3H1RA 3SIBA 1SL7A 4MEWA 4EDOA 3CFAA 5DQMA 4PHKA 1AHRA 1AJ4A 2HGYA 5DPHA 2QACA 5EB7A 1DT7B 2JOJA 2JULA 3U8PA 3I5FB 2GX0A 2NCOA 5K89A 1VRKA 2HF5A 3AKBA 3M24A 4KGEA 1BG1A 2WIQA 2PALA 2GGZA 1C7VA 4B5YA 4D1EA 3PJ5A 4LJDA 5AXIA 4KF5A 4YRUA 1OXFA 3SVEA 2Q57A 1SY9A 4XJKA 4W6UA 4JC2A 3PFVA 3BXBA 4GAOA 1OXDA 5AERA 2H6VA 4W6KA 4XVPA 4AOMA
chains in the Genus database with same CATH superfamily
3PN7C 3DQ4A 2O60A 2GW3A 4W6HA 1OMDA 2D8NA 1DTLA 3BXAA 4AR7A 1XSSA 1LXFC 3CR4X 1EH2A 5AEQA 3VRQA 4W6TA 1CDNA 2BL0C 4FTGA 1SSEB 1JBZA 1RMPA 1LVCD 5BTTA 2Y4QA 1Y1UA 1KK8B 2VADA 1SYMA 1QASA 2L2CA 3VRPA 1SL9A 2JRFA 1IRJA 4NDBA 3I5IB 3S0GA 4JWQA 1J1EA 2Y1NA 5EXCI 4Z4MA 1BF5A 2G2BA 3DQ8A 3CR5X 1IH0A 4GBAA 1Z1PA 1LS8A 3SVNA 1RMOA 2AHAA 1YHIA 1SBJA 4W77A 4HVFA 1KSOA 3LVCA 4PT1A 5G08A 2DUGA 4JGEA 3DVJA 4KA9A 3ZULA 1PK0D 1FW4A 3DQLA 1C3ZA 2LE9B 1SCMB 1YRUB 1UHKA 4W7AA 2V4EC 3WNXB 4H3MA 4W75A 1JSAA 1QYFA 1IJ5A 4ORCB 4L12A 4YGBB 4W6OA 1W7UA 2O5GA 3DVKA 2LUXA 2AWMA 4Z4KA 1W9ZA 1DJZA 3EVRA 1ODBA 2QPTA 1C7WA 5EXBA 1KFUS 2P71A 2YGUA 1A75B 1XMZA 1NYAA 4DS7A 1UHJA 3PM8A 4ZF5A 2G6EA 3NSOA 3B7AA 1XFWO 4W6DA 2WNDA 3TS5B 3CD9A 4M2PA 2G2SB 3NT9A 1CV7A 4L13A 4IK8A 2LMTA 4NWSA 4PDZA 1RM9A 1M63B 3CS1A 2OTGB 3CD1A 2CNPA 1K9UA 5JOLA 1XYDA 1A4PA 3PATA 1MWNA 4INXA 2K61A 3CABA 3S0EA 3DPZA 3R1VA 1YVHA 2HPSA 3K1KA 1C4FA 1B9CA 1Q4CA 3DQFA 3D0YB 2DUFA 4PE4A 1NP8A 1YRTB 3AKAA 4MN0A 2ZMWA 3U0NA 4DIRA 2K7BA 3AAKA 4U2VA 3ST0A 5DPJA 4W6JA 4WRIA 3DQ5A 3E5VA 1E8AA 4J88A 2CXJA 1K95A 2BKIB 3WHTB 4JKTA 1PULA 2QLIA 1TTXA 4XJKB 3DQ3A 1YJ2A 1OOGA 4GOBA 3BOWA 3DQIA 1FPWA 1JBYA 2L0PA 4JEOA 1NX1A 1TUZA 2FCEA 3DQ6A 2PMYA 2DD9A 2BKHB 5HKWA 4PPKA 1CM4A 3CB9A 5ER4X 2M1KB 4MBEA 4OY4A 3DY9A 3L4LA 3A8RA 2DDCA 4CFRA 2HJOA 3DQUA 1EJ3A 2YE0A 1WRZA 4ETOA 5BTTB 4H47A 2F3YA 1RTP1 2L50A 3GB3A 5DQBA 3TZ1A 1B4CA 3BQ3A 1MXLC 4IK9A 1NCXA 2Y1MA 4L9MA 4P2YB 2FOTA 2BCAA 1OOHA 4IK3A 4YGCB 5DPGA 2HQ8A 4N1FA 3LCPC 1YFPA 3E5WA 5HW9A 3SVRA 5DRFA 1P28A 4W6FA 5FYXA 1DF0A 2TN4A 1IG5A 1QATA 3EG5B 3O4YA 2VVIA 4XOWA 3FWCA 1HT9A 5DRGA 2A4JA 2L4HA 5D7FA 4MSPA 1JC1A 5DY6A 1S6ZA 1A2XA 1RJVA 1BJFA 2KBIA 3SVUA 3PIBA 2LLUA 2JADA 1YURA 4P5OE 4R1EA 2H61C 1QLSA 2LVKA 3R1OA 5D69A 2M9GA 3SS0A 2G3OA 1KQVA 4DKNA 3SG4A 4GF6B 2COLB 4AS8A 2MLEC 2HRSA 4W6MA 2VVHA 3RLZA 2Y5IA 2DUIA 3SS5A 2ISDA 1FI6A 1WRKA 1K96A 3K1EA 1SR6C 3TMTA 3VROA 1C07A 2Z6ZA 4LJBA 1BMOA 3BUNB 2FJYA 1WLMA 4P76A 4UTSA 1F4OA 2FJUB 1N0YA 3V2LA 1SNLA 5CSNA 1XA9A 1TCOB 2KLEA 1A03A 1YVLA 3DD4A 4WQ2A 3ZUFA 1S6IA 5KTYA 4W6PA 1V1FA 1YZWA 3OB1B 3SG5A 2L5YA 3G9AA 4MZJA 4U8DA 3PN7B 4R6DA 4NQGA 2KAYA 3OGOA 1Z2CB 1QX5B 2Q6PA 2KAXA 4PHJA 4DCKA 2BL0B 4C0KA 4W6NA 4C0LA 1KFUL 2HCGA 1QYQA 1CDLA 4PCWA 1S1EA 1XK4C 4YI8A 1TNQA 2K2AA 2A54B 4ORNA 1BODA 4JRBA 3U0KA 2SASA 4PHNA 3A8SA 3BOWB 2LAPA 3ZNIA 2WHTA 3DF0B 5EXUA 1F71A 2MHHA 1OW4A 3KF9A 3B86A 1AUIB 2KQYA 1Y1AA 2H5PA 1W7IB 5PALA 2E6WA 2WORA 3CDNA 1S3PA 2QT2A 3TDUA 3CR2A 4Q7RA 4KF4A 3DVEA 2H5OA 1QVIY 4KGFA 3WLCA 4J89A 2WC8A 1MXEA 3V3DA 3LF4B 2ZMUA 3W1CA 4W7FA 1RK9A 3CLNA 3OB2B 5DKNA 5T3IA 4MLWA 1Q4BA 4OR9B 1C3YA 3IQOA 2V4EB 4CPVA 4ZBLA 4PPLA 3NT3A 3SSLA 1OOIX 4RYWA 2JU0A 3EK7A 2H61A 1W7SA 2A47A 4W73A 4EULA 2KI6D 2B3PA 2YE1A 1XFVO 3GK4X 5FVFA 2DDDA 2YDZA 3DQKA 5J2OA 2KBMA 1TN4A 4ZCVA 3VHTB 1M45A 1F0BA 4LJCA 4MRYA 1Q4DA 2JTZA 2WHSA 3CBEA 1LINA 5J3XA 1XFYO 4ZB1A 2EMOA 4TNCA 5F9GA 2KAVA 2PSRA 5BQLA 2Y0GA 3JTDC 1CMGA 1SRAA 2HPWA 2KGRA 1ZOTB 4W69A 3DQ2A 3VICA 1NCZA 1WDCC 5DU0A 4PALA 4KAGA 1G33A 4Q7TA 5IBWA 1AVSA 3BUMB 3CTNA 3SSHA 3WXAA 5KSZA 1G7KA 3D0YA 2LMVA 1IQ3A 1S5GZ 3O77A 3KHEA 2WCEA 1MOVA 2JNXA 2EGDA 1PSRA 2PXSA 3U0MA 2QRFA 4KYNA 3LA1A 1MYWA 2M3WA 5CPVA 1CFPA 1GGWA 2AWKA 3I5HC 1XQMA 1GGZA 2M29A 3RWAA 1YX8A 1BOCA 2A48A 4BY4A 1J7OA 2O2BA 1UWOA 2KFHA 2K8MB 4W6CA 1XK4A 3MSEB 1V1GA 1CLLA 2PYQA 3NEDA 5KTGA 3ICBA 2JQ6A 3BYAA 5HBDA 5CSJA 2ICRA 4DXPA 3DQNA 2AWJA 1KWOC 1KP5A 3BUXB 2JTTA 3D77A 2MLFC 1FF1A 2OKWA 5EJUA 3PJIA 4MVFA 2JT8A 1H4BA 2IOVA 3UO9A 1ZUXA 5DTLA 1BT6A 1WLZA 1B7TZ 3M22A 3ST4A 2M8UA 3OSQA 3WLDA 1CDPA 1AK8A 2LVJA 1W7JB 1ZACA 1QIVA 2F33A 4W6SA 4BDUA 3E5TA 1MOUA 2POXA 5LTRA 1TWOA 3CZ2A 2H5RA 4PE7A 1OMVA 2KHNA 1NX3A 3SSYA 3LSAA 5I2LA 3CFHA 2ZNDA 2B3QA 2JXLA 1DMOA 4IK5A 1XAEA 5H88A 2BAPA 2QEBA 2Q91A 3S0DA 3NSLA 3SVBA 1Z4HA 1PVBA 2K0JA 1F54A 2ZN9A 1GM0A 3VB1A 5FVGA 2LVVA 5F6TA 4LQUA 2L51A 5I8NA 1UHHA 2CTNA 1M31A 4A4CA 4CFQA 3SSVA 2H8QA 1K90D 2JNFA 2LVIA 2KLDA 1EMLA 3BX9A 3ZTFA 2GW4B 4W76A 1ZGQA 1HUYA 2FWQA 1SR6B 3PJ7A 3NEZA 4KEXA 4W6BA 1AP4A 3OX6A 1EG3A 3QRXA 4NDDA 2QZ0A 1CFDA 5TNCA 1SKTA 4ZINA 1K93D 1KK7Y 3GJ1A 5DTXA 5FVIA 1YUSA 1YTZC 3DQOA 1Z1QA 3E3RA 4JQ0D 5FHVA 2JT0A 2H8VA 3M0WA 3D74A 1QVIZ 5LTQA 1SK6D 1DELA 3AKOA 4DRWA 2RH7A 4GGNA 1B8RA 3O6BA 3DF0A 1QX7A 4PE0A 1ZUZA 3NSIA 2MJWB 4Q04A 1QJTA 2IS9A 2ARLA 1QY3A 2EMNA 3JVTC 1HQVA 1YHGA 4W7DA 3W1DA 1LKJA 1RROA 1UISA 2AH8A 1KYSA 2C9IA 4OKHA 1JC0A 1ALWA 1CM1A 4DXMA 5HZOA 1QS7A 3GL4A 4GESB 1CMFA 2C9JA 5EL2A 2V4EA 4OCIA 2Z6YA 1OOJA 4W6GA 2WCLA 3SIAA 2I18A 3CGLA 1SMGA 1JF2A 2KGBC 2L2EA 3LLEA 4GUKA 1QX2A 1YJFA 2VRGA 3SVCA 4ZF3A 3VHTA 1S6JA 2ZRTA 2OGRA 3IP2A 3VK1A 4IL1A 5B8IB 1XFXO 5HYDA 4H3NA 1SPYA 3GK1A 2NCPA 4PFEA 4N5XA 3FE9A 2BBMA 1DGUA 4OGSA 4IK1A 2HGDA 2F2PA 1ZGOA 2R2IA 3PM2A 1DVIA 1TIZA 1J7RA 2K7OA 1QV1A 2HQWA 2MAZA 2OTEA 5EBJA 1YUUA 5BT0A 1GL4A 1R2UA 3WCKA 1BR1B 1Y1XA 3JTDB 2L5XB 4ANJA 4CIDA 1F55A 3LF3A 1JFKA 3ST2A 1WDCB 2OS8C 1H8BA 3GJ2A 3CWGA 3SS3A 1KCYA 3DQMA 5LK4A 2K7DA 5DKQA 3SJSA 1OOFA 3CGAA 4I5KA 4XGYA 1JWDA 1G4YR 3EKHA 3S0FA 4MZLA 2KOTA 4W7EA 5AQBB 3PLFB 2JPTA 2WC6A 2E30A 2LHIA 3DXLA 3I5HB 1F8HA 1EMFA 3R1PA 5DKRA 2MBXA 4TZAA 4QJ4B 1B9AA 1L2OB 2BE4A 4YGAA 1XA5A 1CB1A 5DTZA 1IWQA 4OQWA 4EDSA 3FE6A 2G9BA 3NHIA 3VGOA 2QEVA 1CNPA 4I5NB 4YI9A 5GQQC 2WURA 1KWOB 3AI4A 1NSHA 3SS4A 2ZRSA 2LNKA 1QLKA 3B6XA 3IF7A 5HLVA 1R6PA 4YGDB 4DXQA 2FL1A 3BUWB 1S36A 5FI7A 3SSKA 2SCPA 3RM1A 4IK4A 1PALA 3RWTA 1CKKA 4F0ZB 2P70A 2KI4C 2L4IA 2ZFDA 3L47A 4OZDA 1MHOA 1QXPA 3QMEA 4HQ8A 2A56B 2KFGA 2JWWA 3NSKA 1RMMA 1Q80A 4A4BA 2A50B 2QU1A 3O2PA 2BNXA 3GK2A 4Q9WA 1F4QA 2BECA 4MRXA 2O29A 2OPOA 1K2HA 3H1OA 2WCFA 3D78A 2FCDA 5H89A 1OE9B 2LP2A 2ZN8A 3SG6A 2KNEA 3DQAA 2ZO6A 3PALA 1QYOA 4GNKB 2BE6A 3BXKA 3U8CA 4QJ5B 3P28A 1DC1A 1IIOA 3IR8A 1JC2A 5ER5A 3IQQA 4ZCUA 2F8PA 2QLEA 1EG4A 2LCPA 4W6RA 3OX5A 1J1DA 5FI2A 1J7QA 4W6LA 1ORGA 2QEOA 1BR4B 1DEKA 1ZGPA 5HKYA 1TUJA 1CFFA 1NIWA 2L98A 4RTCA 1EMBA 1UUSA 5I2QA 1GJYA 5JJGA 2KQ6A 1UHNA 3ADFA 1XFUO 4YBHB 3Q8IA 3DVMA 4WQ3A 4HQ9A 3H4SE 4KW8A 1JUOA 1N2DA 1NPQA 1NWDA 3DQDA 4HRHA 1QV0A 3S0BA 2WCKA 1SL8A 3S0AA 3CZTX 4TZGA 2MA2A 1DJWA 3HCMA 2WCJA 1TRFA 1L2OC 3U0LA 1Q4EA 1CTRA 3VRNA 1IQ5A 2KYCA 4GFTA 5HZTA 2PXWA 2AUCA 4W72A 3KEVA 2M7NA 1U5IA 4AQIA 1DGVA 1OZSA 1F09A 1F70A 1TCFA 4HREE 4W74A 3I5GC 1ZMZA 4BY5A 4I5LB 3LK1A 1RECA 3JVTB 4OVNF 3EK4A 1EMKA 4XOVA 3SSPA 2ZKMX 1IKUA 4B30A 1OSAA 3AAJA 4ICBA 2WHUA 3DQEA 1KFXS 2BBNA 3R72A 2K7CA 3BJHA 3EKJA 5HLOA 3D76A 1BFPA 2LUCA 2P6BB 2LMUA 3FE8A 2ZNEA 2PQLA 2JC2A 2LP3A 1X02A 2ZO7A 1JFJA 1GQMA 3B87A 5DPIA 2PVBA 4OV2A 2WOSA 4C0JA 1PRWA 3TMRA 2LLSA 2A46A 3OHMB 1CLMA 1Q4AA 1EMCA 2G6XA 1M46A 4Q9XA 4N1GA 2K2FA 4NDCA 2ERBA 2QLHA 3RZSA 1NUBA 2JZIA 1ALVA 3PSRA 2H9WA 2A52B 4PHMA 1K9KA 3U8AA 1B1GA 2WISA 2PASA 1NCYA 3O4XA 2KYFA 1MQ1A 2LM5A 1KYRA 2H5QA 3OGNA 1QIWA 3BFAA 3DQ1A 1Y0VH 3DQCA 4USLA 1TOPA 2OS8B 4YGEB 3NHTA 2GGMA 1KQMC 4EN1A 2YFPA 4AQJA 4HQCA 1K9PA 2OJKA 4DXOA 3DQ7A 1S26D 1XFZO 2HETA 2EC6C 2VZXA 1YHHA 3HX4A 1XFRA 2G16B 3UFZA 3D75A 5D3OA 4KW4A 3OSRA 2Z1OA 4JFGA 2JXCA 3LK0A 2QEHA 2LANA 2IB6A 2OKYA 4ZFSA 5HZSA 1D1OA 3FIAA 3VRRA 1W7TA 3SVSA 4DKMA 3TDZA 4GGFC 4HRGA 4JD9A 2DUEA 1DJGA 1Y6WA 1DJYA 4I5JA 1B47A 2BCBA 2GV5A 2JPOA 3LL8B 4N3DA 3SVDA 3LVAA 4FQOA 4JF9A 3I5FC 3SG7A 3L4AA 2M0RA 3DPXA 3KO0A 1UURA 2F2OA 5BPJA 2G6YA 2M49B 3ED8A 4UPGA 2OTBA 3SVOA 5FI6A 5LTPA 1K94A 3KPXA 1SCVA 5I2OA 4FQTA 2K60A 4INWA 1J55A 1M39A 3FS7A 4F7FA 5EB6A 1U5IB 1PVAA 4RYSA 5EHUA 1DJXA 2VAEA 2KI4B 3B88A 3K21A 3ST3A 1WY9A 1A29A 3DQ9A 1NX0A 4QJ3B 2QLGA 2WSOA 2KSPA 2MRDA 2I2RE 1AJ5A 1EL4A 2AWLA 3ZWHA 4J8AA 1S5GY 1RFJA 4P1QA 1YR5A 4B30B 3DPWA 4Q7UA 5DICA 3AI5A 4W6AA 2DUHA 4M2OA 2IE2A 3A4UB 2CCMA 4XL5A 1KK8C 3GOFA 5HL1A 4HSZA 3NXAA 4JPZB 4LW5A 5HZUA 1XO5A 3GEXA 2RGIA 3IVTA 3SSTA 3I5IC 1OZOA 1JBAA 3CYZA 2P4MA 3TUYB 4E68A 4ZIOA 1LA3A 3BUOB 3C1VA 1Q73A 1YX7A 1DJHA 1TNWA 3UG0A 2KI6C 3LVDA 4H48A 2CT9A 1SW8A 5CSFA 4HE4A 1EXRA 1N65A 4ORBB 3SG2A 2G5ZB 4DUQA 3ZUJA 1K8UA 3I19A 1B7TY 3TDIA 4R6BA 1IGVA 2EHBA 1TNXA 2M97A 2NZ0A 1MF8B 1SCMC 1CDMA 4PPJA 2KPHA 3UNWA 4H3LA 1KFXL 1ZFSA 3EK8A 4CLNA 4GGFA 4KPIA 1DJIA 1WRLA 1XVJA 1EMEA 5HKZA 2WCBA 4LQTA 4W7CA 1CFCA 2NXQA 4W7XA 1T14A 2KFFA 1EMMA 1KSMA 3S05A 1MUXA 1H6RA 5KU1A 1GGXA 1OQPA 1B8LA 3MGFA 4W6IA 2M7LA 1JF0A 3TS5C 2GTEA 3CFFA 2LHLA 5AFPA 5AANA 2OTGC 1L7ZA 4GPLB 3FWBA 1IJ6A 1J7PA 1OMRA 3I5GB 1NX2A 3BFHA 4EMQA 2LLTA 2HFCA 2LC5A 2DD7A 2VVJA 2Z6XA 3DQJA 2KDHA 4L1IA 3LS3A 1BU3A 2DOQA 4LJDC 2WCHA 1GFLA 4KF5C 3BXCA 2F3ZA 3D73A 2LV7A 2NLNA 4OJ0A 3SG3A 2HQZA 3PJBA 4OHSA 4DXNA 1DQEA 5HGEA 1YUTA 3EVVA 4KW9A 1HCJA 2JT3A 2I7AA 3SV5A 2WCMA 2QLGB 2Q4UA 3F45A 2WSNA 1S6CA 3OP0A 3WHUB 4MZKA 1BLQA 2A53B 2I94A 2M1UA 1EMGA 1RRXA 3O78A 3D10A 4W7RA 3KCTA 2HQKA 1OXEA 1UHIA 2GX2A 2QDIA 1QTXA 4M2QA 1QXTA 4IZNA 2O24A 1PSBA 2CBLA 3SRYA 2G3DB 2FZUA 1FI5A 4DXIA 3N7HA 3TUYC 5DTYA 3DQHA 2H2KA 2BCXA 5CSIA 1TNPA 1G8IA 1KK7Z 3KCSA 1EMAA 3EVPA 1CLBA 1KQMB 4PE1A 1B8CA 2WC5A 1FBVA 2V53A 2B1UA 3DYEA 4ORAB 1A75A 4I2YA 5H87A 1H4UA 1RWYA 1UP5A 2EC6B 2PRUA 4ZF4A 1MR8A 2IB5A 2EMDA 4XYNA 3EVUA 3P8UA 1DF0B 2AAOA 3NF0A 1KYPA 1LA0A 2BTJA 2AMIA 3H1RA 1QWVA 3SIBA 1SL7A 4MEWA 4EDOA 3CFAA 5DQMA 4PHKA 1AHRA 1AJ4A 2HGYA 5DPHA 2QACA 5EB7A 1DT7B 3CZ0A 2JOJA 2JULA 3DZTA 3U8PA 3I5FB 2GX0A 2NCOA 5K89A 1VRKA 2HF5A 3AKBA 3M24A 4KGEA 1BG1A 2WIQA 2PALA 2GGZA 1C7VA 4B5YA 4D1EA 3PJ5A 4LJDA 5AXIA 3NGVA 4KF5A 3CZ1A 4YRUA 1OXFA 3SVEA 4IJ7A 2Q57A 1SY9A 3BFBA 3OBVA 4XJKA 4W6UA 4JC2A 3PFVA 3BXBA 5I94A 4GAOA 1OXDA 5AERA 2H6VA 4W6KA 4XVPA 4AOMA
chains in the Genus database with same CATH topology
3PN7C 3DQ4A 2O60A 2GW3A 4W6HA 1OMDA 2D8NA 1DTLA 3BXAA 4AR7A 1XSSA 1LXFC 3CR4X 1EH2A 5AEQA 3VRQA 4W6TA 1CDNA 2BL0C 4FTGA 1JBZA 1RMPA 1LVCD 5BTTA 2Y4QA 1Y1UA 1KK8B 2VADA 1SYMA 1QASA 3VRPA 1SL9A 2JRFA 1IRJA 4NDBA 3I5IB 4JWQA 1J1EA 2Y1NA 5EXCI 4Z4MA 1BF5A 2G2BA 3DQ8A 3CR5X 1IH0A 4GBAA 1Z1PA 3SVNA 1RMOA 2AHAA 1YHIA 1SBJA 4W77A 4HVFA 1KSOA 3LVCA 5G08A 2DUGA 4JGEA 3DVJA 4KA9A 3ZULA 1PK0D 1FW4A 3DQLA 2LE9B 1SCMB 1YRUB 1UHKA 4W7AA 2V4EC 3WNXB 4H3MA 4W75A 1JSAA 1QYFA 1IJ5A 4ORCB 4L12A 4YGBB 4W6OA 1W7UA 2O5GA 3DVKA 2LUXA 2AWMA 4Z4KA 1DJZA 3EVRA 1ODBA 2QPTA 1C7WA 5EXBA 1KFUS 1A75B 1XMZA 1NYAA 4DS7A 1UHJA 3PM8A 4ZF5A 2G6EA 3NSOA 1XFWO 4W6DA 2WNDA 3TS5B 3CD9A 4M2PA 2G2SB 3NT9A 1CV7A 4L13A 4IK8A 2LMTA 4NWSA 4PDZA 1RM9A 1M63B 3CS1A 2OTGB 3CD1A 2CNPA 1K9UA 5JOLA 1XYDA 1A4PA 3PATA 1MWNA 2K61A 3DPZA 1YVHA 2HPSA 3K1KA 1C4FA 1B9CA 1Q4CA 3DQFA 3D0YB 2DUFA 4PE4A 1NP8A 1YRTB 3AKAA 4MN0A 2ZMWA 3U0NA 4DIRA 2K7BA 3AAKA 4U2VA 3ST0A 5DPJA 4W6JA 4WRIA 3DQ5A 3E5VA 1E8AA 4J88A 2CXJA 1K95A 2BKIB 3WHTB 2QLIA 1PULA 1TTXA 4XJKB 3DQ3A 1YJ2A 4GOBA 3BOWA 3DQIA 1FPWA 1JBYA 2L0PA 4JEOA 1NX1A 2FCEA 3DQ6A 2PMYA 2DD9A 2BKHB 5HKWA 4PPKA 1CM4A 3CB9A 5ER4X 2M1KB 4MBEA 4OY4A 3A8RA 2DDCA 4CFRA 2HJOA 3DQUA 1EJ3A 2YE0A 1WRZA 4ETOA 5BTTB 4H47A 2F3YA 1RTP1 2L50A 3GB3A 5DQBA 3TZ1A 1B4CA 3BQ3A 1MXLC 4IK9A 1NCXA 2Y1MA 4L9MA 4P2YB 2FOTA 2BCAA 4IK3A 4YGCB 5DPGA 2HQ8A 4N1FA 3LCPC 1YFPA 3E5WA 5HW9A 3SVRA 5DRFA 4W6FA 5FYXA 1DF0A 2TN4A 1IG5A 1QATA 3O4YA 2VVIA 4XOWA 3FWCA 1HT9A 5DRGA 2A4JA 2L4HA 5D7FA 4MSPA 1JC1A 5DY6A 1S6ZA 1A2XA 1RJVA 1BJFA 2KBIA 3SVUA 3PIBA 2LLUA 2JADA 1YURA 4P5OE 4R1EA 2H61C 1QLSA 2LVKA 5D69A 2M9GA 3SS0A 2G3OA 1KQVA 4DKNA 3SG4A 4GF6B 2COLB 4AS8A 2MLEC 2HRSA 4W6MA 2VVHA 3RLZA 2Y5IA 2DUIA 2ISDA 1FI6A 1WRKA 1K96A 1SR6C 3TMTA 3VROA 1C07A 2Z6ZA 4LJBA 1BMOA 3BUNB 1WLMA 4P76A 4UTSA 1F4OA 2FJUB 1N0YA 1SNLA 5CSNA 1XA9A 1TCOB 1A03A 1YVLA 3DD4A 4WQ2A 3ZUFA 1S6IA 5KTYA 4W6PA 1V1FA 1YZWA 3OB1B 3SG5A 3G9AA 4MZJA 4U8DA 3PN7B 4R6DA 4NQGA 2KAYA 3OGOA 1QX5B 2Q6PA 2KAXA 4PHJA 4DCKA 2BL0B 4C0KA 4W6NA 4C0LA 1KFUL 2HCGA 1QYQA 1CDLA 4PCWA 1S1EA 1XK4C 4YI8A 1TNQA 2K2AA 2A54B 4ORNA 1BODA 4JRBA 3U0KA 2SASA 4PHNA 3A8SA 3BOWB 2LAPA 3ZNIA 2WHTA 3DF0B 5EXUA 1F71A 2MHHA 3KF9A 1AUIB 2KQYA 1Y1AA 2H5PA 1W7IB 5PALA 2E6WA 2WORA 1S3PA 2QT2A 3TDUA 3CR2A 4Q7RA 4KF4A 3DVEA 2H5OA 1QVIY 4KGFA 3WLCA 4J89A 2WC8A 1MXEA 3V3DA 3LF4B 2ZMUA 3W1CA 4W7FA 1RK9A 3CLNA 3OB2B 5DKNA 5T3IA 4MLWA 1Q4BA 4OR9B 3IQOA 2V4EB 4CPVA 4ZBLA 4PPLA 3NT3A 3SSLA 4RYWA 2JU0A 3EK7A 2H61A 1W7SA 2A47A 4W73A 4EULA 2KI6D 2B3PA 2YE1A 1XFVO 3GK4X 5FVFA 2DDDA 2YDZA 3DQKA 5J2OA 2KBMA 1TN4A 4ZCVA 3VHTB 1M45A 1F0BA 4LJCA 4MRYA 1Q4DA 2JTZA 2WHSA 3CBEA 1LINA 5J3XA 1XFYO 4ZB1A 2EMOA 4TNCA 5F9GA 2KAVA 2PSRA 5BQLA 2Y0GA 3JTDC 1CMGA 1SRAA 2HPWA 2KGRA 1ZOTB 4W69A 3DQ2A 3VICA 1NCZA 1WDCC 5DU0A 4PALA 4KAGA 1G33A 4Q7TA 5IBWA 1AVSA 3BUMB 3CTNA 3SSHA 3WXAA 5KSZA 1G7KA 3D0YA 2LMVA 1IQ3A 1S5GZ 3O77A 3KHEA 2WCEA 1MOVA 2JNXA 2EGDA 1PSRA 2PXSA 3U0MA 2QRFA 3LA1A 1MYWA 2M3WA 5CPVA 1CFPA 1GGWA 2AWKA 3I5HC 1XQMA 1GGZA 2M29A 3RWAA 1YX8A 1BOCA 2A48A 4BY4A 1J7OA 2O2BA 1UWOA 2KFHA 2K8MB 4W6CA 1XK4A 3MSEB 1V1GA 1CLLA 3NEDA 5KTGA 3ICBA 2JQ6A 3BYAA 5HBDA 5CSJA 2ICRA 4DXPA 3DQNA 2AWJA 1KWOC 1KP5A 3BUXB 2JTTA 2MLFC 1FF1A 2OKWA 5EJUA 4MVFA 2JT8A 1H4BA 2IOVA 1ZUXA 5DTLA 1BT6A 1WLZA 1B7TZ 3M22A 3ST4A 2M8UA 3OSQA 3WLDA 1CDPA 1AK8A 2LVJA 1W7JB 1ZACA 1QIVA 2F33A 4W6SA 4BDUA 3E5TA 1MOUA 2POXA 5LTRA 2H5RA 4PE7A 1OMVA 2KHNA 1NX3A 3SSYA 3LSAA 5I2LA 3CFHA 2ZNDA 2B3QA 2JXLA 1DMOA 4IK5A 1XAEA 5H88A 2Q91A 3NSLA 3SVBA 1PVBA 2K0JA 1F54A 2ZN9A 5FVGA 2LVVA 5F6TA 4LQUA 2L51A 5I8NA 1UHHA 2CTNA 1M31A 4A4CA 4CFQA 3SSVA 2H8QA 1K90D 2JNFA 2LVIA 1EMLA 3BX9A 3ZTFA 2GW4B 4W76A 1ZGQA 1HUYA 2FWQA 1SR6B 3PJ7A 3NEZA 4KEXA 4W6BA 1AP4A 3OX6A 1EG3A 3QRXA 4NDDA 2QZ0A 1CFDA 5TNCA 1SKTA 4ZINA 1K93D 1KK7Y 3GJ1A 5DTXA 5FVIA 1YUSA 1YTZC 1Z1QA 3DQOA 3E3RA 4JQ0D 5FHVA 2JT0A 3M0WA 1QVIZ 5LTQA 1SK6D 3AKOA 4DRWA 2RH7A 4GGNA 1B8RA 3O6BA 3DF0A 1QX7A 4PE0A 1ZUZA 3NSIA 2MJWB 4Q04A 1QJTA 2IS9A 2ARLA 1QY3A 2EMNA 3JVTC 1HQVA 1YHGA 4W7DA 3W1DA 1LKJA 1RROA 1UISA 2AH8A 1KYSA 2C9IA 4OKHA 1JC0A 1ALWA 1CM1A 4DXMA 5HZOA 1QS7A 3GL4A 4GESB 1CMFA 2C9JA 2V4EA 4OCIA 2Z6YA 1OOJA 4W6GA 3SIAA 2I18A 3CGLA 1SMGA 1JF2A 2KGBC 2L2EA 3LLEA 4GUKA 1QX2A 1YJFA 2VRGA 3SVCA 4ZF3A 3VHTA 1S6JA 2ZRTA 2OGRA 3IP2A 3VK1A 4IL1A 5B8IB 1XFXO 5HYDA 4H3NA 1SPYA 3GK1A 2NCPA 4PFEA 4N5XA 2BBMA 1DGUA 4OGSA 4IK1A 2HGDA 2F2PA 1ZGOA 2R2IA 1DVIA 1TIZA 1J7RA 2K7OA 1QV1A 2HQWA 2MAZA 2OTEA 5EBJA 1YUUA 5BT0A 1GL4A 1R2UA 3WCKA 1BR1B 1Y1XA 3JTDB 2L5XB 4ANJA 4CIDA 1F55A 3LF3A 1JFKA 3ST2A 1WDCB 2OS8C 1H8BA 3GJ2A 3CWGA 1KCYA 3DQMA 5LK4A 2K7DA 5DKQA 3SJSA 3CGAA 4I5KA 4XGYA 1JWDA 1G4YR 3EKHA 4MZLA 2KOTA 4W7EA 5AQBB 3PLFB 2JPTA 2E30A 2LHIA 3I5HB 1F8HA 1EMFA 5DKRA 2MBXA 4TZAA 4QJ4B 1B9AA 1L2OB 2BE4A 4YGAA 1XA5A 1CB1A 5DTZA 1IWQA 4OQWA 4EDSA 2G9BA 3VGOA 1CNPA 4I5NB 4YI9A 5GQQC 2WURA 1KWOB 3AI4A 1NSHA 2ZRSA 2LNKA 1QLKA 3IF7A 5HLVA 1R6PA 4YGDB 4DXQA 2FL1A 3BUWB 1S36A 3SSKA 2SCPA 3RM1A 4IK4A 1PALA 3RWTA 1CKKA 4F0ZB 2KI4C 2L4IA 2ZFDA 1MHOA 1QXPA 4HQ8A 2A56B 2KFGA 2JWWA 3NSKA 1RMMA 1Q80A 4A4BA 2A50B 2QU1A 3O2PA 3GK2A 4Q9WA 1F4QA 2BECA 4MRXA 2O29A 2OPOA 1K2HA 3H1OA 2WCFA 2FCDA 5H89A 1OE9B 2LP2A 2ZN8A 3SG6A 2KNEA 3DQAA 2ZO6A 3PALA 1QYOA 4GNKB 2BE6A 3BXKA 3U8CA 4QJ5B 3P28A 3IR8A 1JC2A 5ER5A 3IQQA 4ZCUA 2F8PA 2QLEA 1EG4A 2LCPA 4W6RA 3OX5A 1J1DA 1J7QA 4W6LA 1BR4B 1ZGPA 5HKYA 1CFFA 1NIWA 2L98A 4RTCA 1EMBA 1UUSA 5I2QA 1GJYA 5JJGA 2KQ6A 1UHNA 3ADFA 1XFUO 4YBHB 3DVMA 4WQ3A 4HQ9A 3H4SE 4KW8A 1JUOA 1N2DA 1NPQA 1NWDA 3DQDA 4HRHA 1QV0A 1SL8A 3CZTX 4TZGA 2MA2A 1DJWA 3HCMA 1TRFA 1L2OC 3U0LA 1Q4EA 1CTRA 3VRNA 1IQ5A 2KYCA 4GFTA 5HZTA 2PXWA 2AUCA 4W72A 3KEVA 2M7NA 1U5IA 4AQIA 1DGVA 1OZSA 1F09A 1F70A 1TCFA 4HREE 4W74A 3I5GC 1ZMZA 4BY5A 4I5LB 3LK1A 1RECA 3JVTB 4OVNF 3EK4A 1EMKA 4XOVA 3SSPA 2ZKMX 1IKUA 4B30A 1OSAA 3AAJA 4ICBA 2WHUA 3DQEA 1KFXS 2BBNA 2K7CA 3EKJA 5HLOA 1BFPA 2LUCA 2P6BB 2LMUA 2ZNEA 2JC2A 2LP3A 1X02A 2ZO7A 1JFJA 1GQMA 5DPIA 2PVBA 4OV2A 2WOSA 4C0JA 1PRWA 3TMRA 2LLSA 2A46A 3OHMB 1CLMA 1Q4AA 1EMCA 2G6XA 1M46A 4Q9XA 4N1GA 2K2FA 4NDCA 2QLHA 1NUBA 2JZIA 1ALVA 3PSRA 2H9WA 2A52B 4PHMA 1K9KA 3U8AA 1B1GA 2WISA 2PASA 1NCYA 2KYFA 1MQ1A 2LM5A 1KYRA 2H5QA 1QIWA 3DQ1A 1Y0VH 3DQCA 4USLA 1TOPA 2OS8B 4YGEB 2GGMA 1KQMC 4EN1A 2YFPA 4AQJA 4HQCA 1K9PA 2OJKA 4DXOA 3DQ7A 1S26D 1XFZO 2HETA 2EC6C 2VZXA 1YHHA 3HX4A 2G16B 3UFZA 4KW4A 3OSRA 2Z1OA 4JFGA 2JXCA 3LK0A 2LANA 2IB6A 2OKYA 4ZFSA 5HZSA 1D1OA 3FIAA 3VRRA 1W7TA 3SVSA 4DKMA 3TDZA 4GGFC 4HRGA 2DUEA 1DJGA 1Y6WA 1DJYA 4I5JA 1B47A 2BCBA 2GV5A 4N3DA 3LL8B 3SVDA 3LVAA 4FQOA 4JF9A 3I5FC 3SG7A 2M0RA 3DPXA 3KO0A 1UURA 2F2OA 5BPJA 2G6YA 2M49B 3ED8A 4UPGA 2OTBA 3SVOA 5LTPA 1K94A 3KPXA 1SCVA 5I2OA 1J55A 1M39A 3FS7A 5EB6A 1U5IB 1PVAA 4RYSA 5EHUA 1DJXA 2VAEA 2KI4B 3K21A 3ST3A 1WY9A 1A29A 3DQ9A 1NX0A 4QJ3B 2QLGA 2WSOA 2KSPA 2MRDA 2I2RE 1AJ5A 1EL4A 2AWLA 3ZWHA 4J8AA 1S5GY 1RFJA 4P1QA 1YR5A 4B30B 3DPWA 4Q7UA 3AI5A 4W6AA 2DUHA 4M2OA 2IE2A 3A4UB 2CCMA 4XL5A 1KK8C 3GOFA 4HSZA 3NXAA 4JPZB 4LW5A 5HZUA 1XO5A 3GEXA 2RGIA 3SSTA 3I5IC 1OZOA 1JBAA 2P4MA 3TUYB 4E68A 4ZIOA 1LA3A 3BUOB 3C1VA 1Q73A 1YX7A 1DJHA 1TNWA 3UG0A 2KI6C 3LVDA 4H48A 2CT9A 1SW8A 5CSFA 4HE4A 1EXRA 1N65A 4ORBB 3SG2A 2G5ZB 4DUQA 3ZUJA 1K8UA 3I19A 1B7TY 3TDIA 4R6BA 1IGVA 2EHBA 1TNXA 2M97A 2NZ0A 1MF8B 1SCMC 1CDMA 4PPJA 4H3LA 1KFXL 1ZFSA 3EK8A 4CLNA 4GGFA 4KPIA 1DJIA 1WRLA 1XVJA 1EMEA 5HKZA 2WCBA 4LQTA 4W7CA 1CFCA 2NXQA 4W7XA 2KFFA 1EMMA 1KSMA 3S05A 1MUXA 1H6RA 5KU1A 1GGXA 1OQPA 1B8LA 3MGFA 4W6IA 2M7LA 1JF0A 3TS5C 3CFFA 2LHLA 5AFPA 5AANA 2OTGC 1L7ZA 4GPLB 3FWBA 1IJ6A 1J7PA 1OMRA 3I5GB 1NX2A 4EMQA 2LLTA 2HFCA 2LC5A 2DD7A 2VVJA 2Z6XA 3DQJA 2KDHA 4L1IA 3LS3A 1BU3A 2DOQA 4LJDC 1GFLA 4KF5C 3BXCA 2F3ZA 2LV7A 2NLNA 4OJ0A 3SG3A 2HQZA 3PJBA 4OHSA 4DXNA 5HGEA 1YUTA 3EVVA 4KW9A 1HCJA 2JT3A 2I7AA 3SV5A 2QLGB 2Q4UA 3F45A 2WSNA 1S6CA 3OP0A 3WHUB 4MZKA 1BLQA 2A53B 2I94A 2M1UA 1EMGA 1RRXA 3O78A 3D10A 4W7RA 3KCTA 2HQKA 1OXEA 1UHIA 2GX2A 1QTXA 4M2QA 1QXTA 4IZNA 2O24A 1PSBA 2CBLA 3SRYA 2G3DB 2FZUA 1FI5A 4DXIA 3TUYC 5DTYA 3DQHA 2H2KA 2BCXA 5CSIA 1TNPA 1G8IA 1KK7Z 3KCSA 1EMAA 3EVPA 1CLBA 1KQMB 4PE1A 1B8CA 1FBVA 2V53A 2B1UA 4ORAB 1A75A 4I2YA 5H87A 1H4UA 1RWYA 1UP5A 2EC6B 2PRUA 4ZF4A 1MR8A 2IB5A 2EMDA 4XYNA 3EVUA 3P8UA 1DF0B 2AAOA 3NF0A 1KYPA 1LA0A 2BTJA 2AMIA 3H1RA 3SIBA 1SL7A 4MEWA 4EDOA 3CFAA 5DQMA 4PHKA 1AHRA 1AJ4A 2HGYA 5DPHA 2QACA 5EB7A 1DT7B 2JOJA 2JULA 3U8PA 3I5FB 2GX0A 2NCOA 5K89A 1VRKA 2HF5A 3AKBA 3M24A 4KGEA 1BG1A 2WIQA 2PALA 2GGZA 1C7VA 4B5YA 4D1EA 3PJ5A 4LJDA 5AXIA 4KF5A 4YRUA 1OXFA 3SVEA 2Q57A 1SY9A 4XJKA 4W6UA 4JC2A 3PFVA 3BXBA 4GAOA 1OXDA 5AERA 2H6VA 4W6KA 4XVPA 4AOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN7 C;  3DQ4 A;  2O60 A;  2GW3 A;  4W6H A;  1OMD A;  2D8N A;  1DTL A;  3BXA A;  4AR7 A;  1XSS A;  1LXF C;  3CR4 X;  1EH2 A;  5AEQ A;  3VRQ A;  4W6T A;  1CDN A;  2BL0 C;  4FTG A;  1JBZ A;  1RMP A;  1LVC D;  5BTT A;  2Y4Q A;  1Y1U A;  1KK8 B;  2VAD A;  1SYM A;  1QAS A;  3VRP A;  1SL9 A;  2JRF A;  1IRJ A;  4NDB A;  3I5I B;  4JWQ A;  1J1E A;  2Y1N A;  5EXC I;  4Z4M A;  1BF5 A;  2G2B A;  3DQ8 A;  3CR5 X;  1IH0 A;  4GBA A;  1Z1P A;  3SVN A;  1RMO A;  2AHA A;  1YHI A;  1SBJ A;  4W77 A;  4HVF A;  1KSO A;  3LVC A;  5G08 A;  2DUG A;  4JGE A;  3DVJ A;  4KA9 A;  3ZUL A;  1PK0 D;  1FW4 A;  3DQL A;  2LE9 B;  1SCM B;  1YRU B;  1UHK A;  4W7A A;  2V4E C;  3WNX B;  4H3M A;  4W75 A;  1JSA A;  1QYF A;  1IJ5 A;  4ORC B;  4L12 A;  4YGB B;  4W6O A;  1W7U A;  2O5G A;  3DVK A;  2LUX A;  2AWM A;  4Z4K A;  1DJZ A;  3EVR A;  1ODB A;  2QPT A;  1C7W A;  5EXB A;  1KFU S;  1A75 B;  1XMZ A;  1NYA A;  4DS7 A;  1UHJ A;  3PM8 A;  4ZF5 A;  2G6E A;  3NSO A;  1XFW O;  4W6D A;  2WND A;  3TS5 B;  3CD9 A;  4M2P A;  2G2S B;  3NT9 A;  1CV7 A;  4L13 A;  4IK8 A;  2LMT A;  4NWS A;  4PDZ A;  1RM9 A;  1M63 B;  3CS1 A;  2OTG B;  3CD1 A;  2CNP A;  1K9U A;  5JOL A;  1XYD A;  1A4P A;  3PAT A;  1MWN A;  2K61 A;  3DPZ A;  1YVH A;  2HPS A;  3K1K A;  1C4F A;  1B9C A;  1Q4C A;  3DQF A;  3D0Y B;  2DUF A;  4PE4 A;  1NP8 A;  1YRT B;  3AKA A;  4MN0 A;  2ZMW A;  3U0N A;  4DIR A;  2K7B A;  3AAK A;  4U2V A;  3ST0 A;  5DPJ A;  4W6J A;  4WRI A;  3DQ5 A;  3E5V A;  1E8A A;  4J88 A;  2CXJ A;  1K95 A;  2BKI B;  3WHT B;  2QLI A;  1PUL A;  1TTX A;  4XJK B;  3DQ3 A;  1YJ2 A;  4GOB A;  3BOW A;  3DQI A;  1FPW A;  1JBY A;  2L0P A;  4JEO A;  1NX1 A;  2FCE A;  3DQ6 A;  2PMY A;  2DD9 A;  2BKH B;  5HKW A;  4PPK A;  1CM4 A;  3CB9 A;  5ER4 X;  2M1K B;  4MBE A;  4OY4 A;  3A8R A;  2DDC A;  4CFR A;  2HJO A;  3DQU A;  1EJ3 A;  2YE0 A;  1WRZ A;  4ETO A;  5BTT B;  4H47 A;  2F3Y A;  1RTP 1;  2L50 A;  3GB3 A;  5DQB A;  3TZ1 A;  1B4C A;  3BQ3 A;  1MXL C;  4IK9 A;  1NCX A;  2Y1M A;  4L9M A;  4P2Y B;  2FOT A;  2BCA A;  4IK3 A;  4YGC B;  5DPG A;  2HQ8 A;  4N1F A;  3LCP C;  1YFP A;  3E5W A;  5HW9 A;  3SVR A;  5DRF A;  4W6F A;  5FYX A;  1DF0 A;  2TN4 A;  1IG5 A;  1QAT A;  3O4Y A;  2VVI A;  4XOW A;  3FWC A;  1HT9 A;  5DRG A;  2A4J A;  2L4H A;  5D7F A;  4MSP A;  1JC1 A;  5DY6 A;  1S6Z A;  1A2X A;  1RJV A;  1BJF A;  2KBI A;  3SVU A;  3PIB A;  2LLU A;  2JAD A;  1YUR A;  4P5O E;  4R1E A;  2H61 C;  1QLS A;  2LVK A;  5D69 A;  2M9G A;  3SS0 A;  2G3O A;  1KQV A;  4DKN A;  3SG4 A;  4GF6 B;  2COL B;  4AS8 A;  2MLE C;  2HRS A;  4W6M A;  2VVH A;  3RLZ A;  2Y5I A;  2DUI A;  2ISD A;  1FI6 A;  1WRK A;  1K96 A;  1SR6 C;  3TMT A;  3VRO A;  1C07 A;  2Z6Z A;  4LJB A;  1BMO A;  3BUN B;  1WLM A;  4P76 A;  4UTS A;  1F4O A;  2FJU B;  1N0Y A;  1SNL A;  5CSN A;  1XA9 A;  1TCO B;  1A03 A;  1YVL A;  3DD4 A;  4WQ2 A;  3ZUF A;  1S6I A;  5KTY A;  4W6P A;  1V1F A;  1YZW A;  3OB1 B;  3SG5 A;  3G9A A;  4MZJ A;  4U8D A;  3PN7 B;  4R6D A;  4NQG A;  2KAY A;  3OGO A;  1QX5 B;  2Q6P A;  2KAX A;  4PHJ A;  4DCK A;  2BL0 B;  4C0K A;  4W6N A;  4C0L A;  1KFU L;  2HCG A;  1QYQ A;  1CDL A;  4PCW A;  1S1E A;  1XK4 C;  4YI8 A;  1TNQ A;  2K2A A;  2A54 B;  4ORN A;  1BOD A;  4JRB A;  3U0K A;  2SAS A;  4PHN A;  3A8S A;  3BOW B;  2LAP A;  3ZNI A;  2WHT A;  3DF0 B;  5EXU A;  1F71 A;  2MHH A;  3KF9 A;  1AUI B;  2KQY A;  1Y1A A;  2H5P A;  1W7I B;  5PAL A;  2E6W A;  2WOR A;  1S3P A;  2QT2 A;  3TDU A;  3CR2 A;  4Q7R A;  4KF4 A;  3DVE A;  2H5O A;  1QVI Y;  4KGF A;  3WLC A;  4J89 A;  2WC8 A;  1MXE A;  3V3D A;  3LF4 B;  2ZMU A;  3W1C A;  4W7F A;  1RK9 A;  3CLN A;  3OB2 B;  5DKN A;  5T3I A;  4MLW A;  1Q4B A;  4OR9 B;  3IQO A;  2V4E B;  4CPV A;  4ZBL A;  4PPL A;  3NT3 A;  3SSL A;  4RYW A;  2JU0 A;  3EK7 A;  2H61 A;  1W7S A;  2A47 A;  4W73 A;  4EUL A;  2KI6 D;  2B3P A;  2YE1 A;  1XFV O;  3GK4 X;  5FVF A;  2DDD A;  2YDZ A;  3DQK A;  5J2O A;  2KBM A;  1TN4 A;  4ZCV A;  3VHT B;  1M45 A;  1F0B A;  4LJC A;  4MRY A;  1Q4D A;  2JTZ A;  2WHS A;  3CBE A;  1LIN A;  5J3X A;  1XFY O;  4ZB1 A;  2EMO A;  4TNC A;  5F9G A;  2KAV A;  2PSR A;  5BQL A;  2Y0G A;  3JTD C;  1CMG A;  1SRA A;  2HPW A;  2KGR A;  1ZOT B;  4W69 A;  3DQ2 A;  3VIC A;  1NCZ A;  1WDC C;  5DU0 A;  4PAL A;  4KAG A;  1G33 A;  4Q7T A;  5IBW A;  1AVS A;  3BUM B;  3CTN A;  3SSH A;  3WXA A;  5KSZ A;  1G7K A;  3D0Y A;  2LMV A;  1IQ3 A;  1S5G Z;  3O77 A;  3KHE A;  2WCE A;  1MOV A;  2JNX A;  2EGD A;  1PSR A;  2PXS A;  3U0M A;  2QRF A;  3LA1 A;  1MYW A;  2M3W A;  5CPV A;  1CFP A;  1GGW A;  2AWK A;  3I5H C;  1XQM A;  1GGZ A;  2M29 A;  3RWA A;  1YX8 A;  1BOC A;  2A48 A;  4BY4 A;  1J7O A;  2O2B A;  1UWO A;  2KFH A;  2K8M B;  4W6C A;  1XK4 A;  3MSE B;  1V1G A;  1CLL A;  3NED A;  5KTG A;  3ICB A;  2JQ6 A;  3BYA A;  5HBD A;  5CSJ A;  2ICR A;  4DXP A;  3DQN A;  2AWJ A;  1KWO C;  1KP5 A;  3BUX B;  2JTT A;  2MLF C;  1FF1 A;  2OKW A;  5EJU A;  4MVF A;  2JT8 A;  1H4B A;  2IOV A;  1ZUX A;  5DTL A;  1BT6 A;  1WLZ A;  1B7T Z;  3M22 A;  3ST4 A;  2M8U A;  3OSQ A;  3WLD A;  1CDP A;  1AK8 A;  2LVJ A;  1W7J B;  1ZAC A;  1QIV A;  2F33 A;  4W6S A;  4BDU A;  3E5T A;  1MOU A;  2POX A;  5LTR A;  2H5R A;  4PE7 A;  1OMV A;  2KHN A;  1NX3 A;  3SSY A;  3LSA A;  5I2L A;  3CFH A;  2ZND A;  2B3Q A;  2JXL A;  1DMO A;  4IK5 A;  1XAE A;  5H88 A;  2Q91 A;  3NSL A;  3SVB A;  1PVB A;  2K0J A;  1F54 A;  2ZN9 A;  5FVG A;  2LVV A;  5F6T A;  4LQU A;  2L51 A;  5I8N A;  1UHH A;  2CTN A;  1M31 A;  4A4C A;  4CFQ A;  3SSV A;  2H8Q A;  1K90 D;  2JNF A;  2LVI A;  1EML A;  3BX9 A;  3ZTF A;  2GW4 B;  4W76 A;  1ZGQ A;  1HUY A;  2FWQ A;  1SR6 B;  3PJ7 A;  3NEZ A;  4KEX A;  4W6B A;  1AP4 A;  3OX6 A;  1EG3 A;  3QRX A;  4NDD A;  2QZ0 A;  1CFD A;  5TNC A;  1SKT A;  4ZIN A;  1K93 D;  1KK7 Y;  3GJ1 A;  5DTX A;  5FVI A;  1YUS A;  1YTZ C;  1Z1Q A;  3DQO A;  3E3R A;  4JQ0 D;  5FHV A;  2JT0 A;  3M0W A;  1QVI Z;  5LTQ A;  1SK6 D;  3AKO A;  4DRW A;  2RH7 A;  4GGN A;  1B8R A;  3O6B A;  3DF0 A;  1QX7 A;  4PE0 A;  1ZUZ A;  3NSI A;  2MJW B;  4Q04 A;  1QJT A;  2IS9 A;  2ARL A;  1QY3 A;  2EMN A;  3JVT C;  1HQV A;  1YHG A;  4W7D A;  3W1D A;  1LKJ A;  1RRO A;  1UIS A;  2AH8 A;  1KYS A;  2C9I A;  4OKH A;  1JC0 A;  1ALW A;  1CM1 A;  4DXM A;  5HZO A;  1QS7 A;  3GL4 A;  4GES B;  1CMF A;  2C9J A;  2V4E A;  4OCI A;  2Z6Y A;  1OOJ A;  4W6G A;  3SIA A;  2I18 A;  3CGL A;  1SMG A;  1JF2 A;  2KGB C;  2L2E A;  3LLE A;  4GUK A;  1QX2 A;  1YJF A;  2VRG A;  3SVC A;  4ZF3 A;  3VHT A;  1S6J A;  2ZRT A;  2OGR A;  3IP2 A;  3VK1 A;  4IL1 A;  5B8I B;  1XFX O;  5HYD A;  4H3N A;  1SPY A;  3GK1 A;  2NCP A;  4PFE A;  4N5X A;  2BBM A;  1DGU A;  4OGS A;  4IK1 A;  2HGD A;  2F2P A;  1ZGO A;  2R2I A;  1DVI A;  1TIZ A;  1J7R A;  2K7O A;  1QV1 A;  2HQW A;  2MAZ A;  2OTE A;  5EBJ A;  1YUU A;  5BT0 A;  1GL4 A;  1R2U A;  3WCK A;  1BR1 B;  1Y1X A;  3JTD B;  2L5X B;  4ANJ A;  4CID A;  1F55 A;  3LF3 A;  1JFK A;  3ST2 A;  1WDC B;  2OS8 C;  1H8B A;  3GJ2 A;  3CWG A;  1KCY A;  3DQM A;  5LK4 A;  2K7D A;  5DKQ A;  3SJS A;  3CGA A;  4I5K A;  4XGY A;  1JWD A;  1G4Y R;  3EKH A;  4MZL A;  2KOT A;  4W7E A;  5AQB B;  3PLF B;  2JPT A;  2E30 A;  2LHI A;  3I5H B;  1F8H A;  1EMF A;  5DKR A;  2MBX A;  4TZA A;  4QJ4 B;  1B9A A;  1L2O B;  2BE4 A;  4YGA A;  1XA5 A;  1CB1 A;  5DTZ A;  1IWQ A;  4OQW A;  4EDS A;  2G9B A;  3VGO A;  1CNP A;  4I5N B;  4YI9 A;  5GQQ C;  2WUR A;  1KWO B;  3AI4 A;  1NSH A;  2ZRS A;  2LNK A;  1QLK A;  3IF7 A;  5HLV A;  1R6P A;  4YGD B;  4DXQ A;  2FL1 A;  3BUW B;  1S36 A;  3SSK A;  2SCP A;  3RM1 A;  4IK4 A;  1PAL A;  3RWT A;  1CKK A;  4F0Z B;  2KI4 C;  2L4I A;  2ZFD A;  1MHO A;  1QXP A;  4HQ8 A;  2A56 B;  2KFG A;  2JWW A;  3NSK A;  1RMM A;  1Q80 A;  4A4B A;  2A50 B;  2QU1 A;  3O2P A;  3GK2 A;  4Q9W A;  1F4Q A;  2BEC A;  4MRX A;  2O29 A;  2OPO A;  1K2H A;  3H1O A;  2WCF A;  2FCD A;  5H89 A;  1OE9 B;  2LP2 A;  2ZN8 A;  3SG6 A;  2KNE A;  3DQA A;  2ZO6 A;  3PAL A;  1QYO A;  4GNK B;  2BE6 A;  3BXK A;  3U8C A;  4QJ5 B;  3P28 A;  3IR8 A;  1JC2 A;  5ER5 A;  3IQQ A;  4ZCU A;  2F8P A;  2QLE A;  1EG4 A;  2LCP A;  4W6R A;  3OX5 A;  1J1D A;  1J7Q A;  4W6L A;  1BR4 B;  1ZGP A;  5HKY A;  1CFF A;  1NIW A;  2L98 A;  4RTC A;  1EMB A;  1UUS A;  5I2Q A;  1GJY A;  5JJG A;  2KQ6 A;  1UHN A;  3ADF A;  1XFU O;  4YBH B;  3DVM A;  4WQ3 A;  4HQ9 A;  3H4S E;  4KW8 A;  1JUO A;  1N2D A;  1NPQ A;  1NWD A;  3DQD A;  4HRH A;  1QV0 A;  1SL8 A;  3CZT X;  4TZG A;  2MA2 A;  1DJW A;  3HCM A;  1TRF A;  1L2O C;  3U0L A;  1Q4E A;  1CTR A;  3VRN A;  1IQ5 A;  2KYC A;  4GFT A;  5HZT A;  2PXW A;  2AUC A;  4W72 A;  3KEV A;  2M7N A;  1U5I A;  4AQI A;  1DGV A;  1OZS A;  1F09 A;  1F70 A;  1TCF A;  4HRE E;  4W74 A;  3I5G C;  1ZMZ A;  4BY5 A;  4I5L B;  3LK1 A;  1REC A;  3JVT B;  4OVN F;  3EK4 A;  1EMK A;  4XOV A;  3SSP A;  2ZKM X;  1IKU A;  4B30 A;  1OSA A;  3AAJ A;  4ICB A;  2WHU A;  3DQE A;  1KFX S;  2BBN A;  2K7C A;  3EKJ A;  5HLO A;  1BFP A;  2LUC A;  2P6B B;  2LMU A;  2ZNE A;  2JC2 A;  2LP3 A;  1X02 A;  2ZO7 A;  1JFJ A;  1GQM A;  5DPI A;  2PVB A;  4OV2 A;  2WOS A;  4C0J A;  1PRW A;  3TMR A;  2LLS A;  2A46 A;  3OHM B;  1CLM A;  1Q4A A;  1EMC A;  2G6X A;  1M46 A;  4Q9X A;  4N1G A;  2K2F A;  4NDC A;  2QLH A;  1NUB A;  2JZI A;  1ALV A;  3PSR A;  2H9W A;  2A52 B;  4PHM A;  1K9K A;  3U8A A;  1B1G A;  2WIS A;  2PAS A;  1NCY A;  2KYF A;  1MQ1 A;  2LM5 A;  1KYR A;  2H5Q A;  1QIW A;  3DQ1 A;  1Y0V H;  3DQC A;  4USL A;  1TOP A;  2OS8 B;  4YGE B;  2GGM A;  1KQM C;  4EN1 A;  2YFP A;  4AQJ A;  4HQC A;  1K9P A;  2OJK A;  4DXO A;  3DQ7 A;  1S26 D;  1XFZ O;  2HET A;  2EC6 C;  2VZX A;  1YHH A;  3HX4 A;  2G16 B;  3UFZ A;  4KW4 A;  3OSR A;  2Z1O A;  4JFG A;  2JXC A;  3LK0 A;  2LAN A;  2IB6 A;  2OKY A;  4ZFS A;  5HZS A;  1D1O A;  3FIA A;  3VRR A;  1W7T A;  3SVS A;  4DKM A;  3TDZ A;  4GGF C;  4HRG A;  2DUE A;  1DJG A;  1Y6W A;  1DJY A;  4I5J A;  1B47 A;  2BCB A;  2GV5 A;  4N3D A;  3LL8 B;  3SVD A;  3LVA A;  4FQO A;  4JF9 A;  3I5F C;  3SG7 A;  2M0R A;  3DPX A;  3KO0 A;  1UUR A;  2F2O A;  5BPJ A;  2G6Y A;  2M49 B;  3ED8 A;  4UPG A;  2OTB A;  3SVO A;  5LTP A;  1K94 A;  3KPX A;  1SCV A;  5I2O A;  1J55 A;  1M39 A;  3FS7 A;  5EB6 A;  1U5I B;  1PVA A;  4RYS A;  5EHU A;  1DJX A;  2VAE A;  2KI4 B;  3K21 A;  3ST3 A;  1WY9 A;  1A29 A;  3DQ9 A;  1NX0 A;  4QJ3 B;  2QLG A;  2WSO A;  2KSP A;  2MRD A;  2I2R E;  1AJ5 A;  1EL4 A;  2AWL A;  3ZWH A;  4J8A A;  1S5G Y;  1RFJ A;  4P1Q A;  1YR5 A;  4B30 B;  3DPW A;  4Q7U A;  3AI5 A;  4W6A A;  2DUH A;  4M2O A;  2IE2 A;  3A4U B;  2CCM A;  4XL5 A;  1KK8 C;  3GOF A;  4HSZ A;  3NXA A;  4JPZ B;  4LW5 A;  5HZU A;  1XO5 A;  3GEX A;  2RGI A;  3SST A;  3I5I C;  1OZO A;  1JBA A;  2P4M A;  3TUY B;  4E68 A;  4ZIO A;  1LA3 A;  3BUO B;  3C1V A;  1Q73 A;  1YX7 A;  1DJH A;  1TNW A;  3UG0 A;  2KI6 C;  3LVD A;  4H48 A;  2CT9 A;  1SW8 A;  5CSF A;  4HE4 A;  1EXR A;  1N65 A;  4ORB B;  3SG2 A;  2G5Z B;  4DUQ A;  3ZUJ A;  1K8U A;  3I19 A;  1B7T Y;  3TDI A;  4R6B A;  1IGV A;  2EHB A;  1TNX A;  2M97 A;  2NZ0 A;  1MF8 B;  1SCM C;  1CDM A;  4PPJ A;  4H3L A;  1KFX L;  1ZFS A;  3EK8 A;  4CLN A;  4GGF A;  4KPI A;  1DJI A;  1WRL A;  1XVJ A;  1EME A;  5HKZ A;  2WCB A;  4LQT A;  4W7C A;  1CFC A;  2NXQ A;  4W7X A;  2KFF A;  1EMM A;  1KSM A;  3S05 A;  1MUX A;  1H6R A;  5KU1 A;  1GGX A;  1OQP A;  1B8L A;  3MGF A;  4W6I A;  2M7L A;  1JF0 A;  3TS5 C;  3CFF A;  2LHL A;  5AFP A;  5AAN A;  2OTG C;  1L7Z A;  4GPL B;  3FWB A;  1IJ6 A;  1J7P A;  1OMR A;  3I5G B;  1NX2 A;  4EMQ A;  2LLT A;  2HFC A;  2LC5 A;  2DD7 A;  2VVJ A;  2Z6X A;  3DQJ A;  2KDH A;  4L1I A;  3LS3 A;  1BU3 A;  2DOQ A;  4LJD C;  1GFL A;  4KF5 C;  3BXC A;  2F3Z A;  2LV7 A;  2NLN A;  4OJ0 A;  3SG3 A;  2HQZ A;  3PJB A;  4OHS A;  4DXN A;  5HGE A;  1YUT A;  3EVV A;  4KW9 A;  1HCJ A;  2JT3 A;  2I7A A;  3SV5 A;  2QLG B;  2Q4U A;  3F45 A;  2WSN A;  1S6C A;  3OP0 A;  3WHU B;  4MZK A;  1BLQ A;  2A53 B;  2I94 A;  2M1U A;  1EMG A;  1RRX A;  3O78 A;  3D10 A;  4W7R A;  3KCT A;  2HQK A;  1OXE A;  1UHI A;  2GX2 A;  1QTX A;  4M2Q A;  1QXT A;  4IZN A;  2O24 A;  1PSB A;  2CBL A;  3SRY A;  2G3D B;  2FZU A;  1FI5 A;  4DXI A;  3TUY C;  5DTY A;  3DQH A;  2H2K A;  2BCX A;  5CSI A;  1TNP A;  1G8I A;  1KK7 Z;  3KCS A;  1EMA A;  3EVP A;  1CLB A;  1KQM B;  4PE1 A;  1B8C A;  1FBV A;  2V53 A;  2B1U A;  4ORA B;  1A75 A;  4I2Y A;  5H87 A;  1H4U A;  1RWY A;  1UP5 A;  2EC6 B;  2PRU A;  4ZF4 A;  1MR8 A;  2IB5 A;  2EMD A;  4XYN A;  3EVU A;  3P8U A;  1DF0 B;  2AAO A;  3NF0 A;  1KYP A;  1LA0 A;  2BTJ A;  2AMI A;  3H1R A;  3SIB A;  1SL7 A;  4MEW A;  4EDO A;  3CFA A;  5DQM A;  4PHK A;  1AHR A;  1AJ4 A;  2HGY A;  5DPH A;  2QAC A;  5EB7 A;  1DT7 B;  2JOJ A;  2JUL A;  3U8P A;  3I5F B;  2GX0 A;  2NCO A;  5K89 A;  1VRK A;  2HF5 A;  3AKB A;  3M24 A;  4KGE A;  1BG1 A;  2WIQ A;  2PAL A;  2GGZ A;  1C7V A;  4B5Y A;  4D1E A;  3PJ5 A;  4LJD A;  5AXI A;  4KF5 A;  4YRU A;  1OXF A;  3SVE A;  2Q57 A;  1SY9 A;  4XJK A;  4W6U A;  4JC2 A;  3PFV A;  3BXB A;  4GAO A;  1OXD A;  5AER A;  2H6V A;  4W6K A;  4XVP A;  4AOM A; 
#chains in the Genus database with same CATH topology
 3PN7 C;  3DQ4 A;  2O60 A;  2GW3 A;  4W6H A;  1OMD A;  2D8N A;  1DTL A;  3BXA A;  4AR7 A;  1XSS A;  1LXF C;  3CR4 X;  1EH2 A;  5AEQ A;  3VRQ A;  4W6T A;  1CDN A;  2BL0 C;  4FTG A;  1SSE B;  1JBZ A;  1RMP A;  1LVC D;  5BTT A;  2Y4Q A;  1Y1U A;  1KK8 B;  2VAD A;  1SYM A;  1QAS A;  2L2C A;  3VRP A;  1SL9 A;  2JRF A;  1IRJ A;  4NDB A;  3I5I B;  3S0G A;  4JWQ A;  1J1E A;  2Y1N A;  5EXC I;  4Z4M A;  1BF5 A;  2G2B A;  3DQ8 A;  3CR5 X;  1IH0 A;  4GBA A;  1Z1P A;  1LS8 A;  3SVN A;  1RMO A;  2AHA A;  1YHI A;  1SBJ A;  4W77 A;  4HVF A;  1KSO A;  3LVC A;  4PT1 A;  5G08 A;  2DUG A;  4JGE A;  3DVJ A;  4KA9 A;  3ZUL A;  1PK0 D;  1FW4 A;  3DQL A;  1C3Z A;  2LE9 B;  1SCM B;  1YRU B;  1UHK A;  4W7A A;  2V4E C;  3WNX B;  4H3M A;  4W75 A;  1JSA A;  1QYF A;  1IJ5 A;  4ORC B;  4L12 A;  4YGB B;  4W6O A;  1W7U A;  2O5G A;  3DVK A;  2LUX A;  2AWM A;  4Z4K A;  1W9Z A;  1DJZ A;  3EVR A;  1ODB A;  2QPT A;  1C7W A;  5EXB A;  1KFU S;  2P71 A;  2YGU A;  1A75 B;  1XMZ A;  1NYA A;  4DS7 A;  1UHJ A;  3PM8 A;  4ZF5 A;  2G6E A;  3NSO A;  3B7A A;  1XFW O;  4W6D A;  2WND A;  3TS5 B;  3CD9 A;  4M2P A;  2G2S B;  3NT9 A;  1CV7 A;  4L13 A;  4IK8 A;  2LMT A;  4NWS A;  4PDZ A;  1RM9 A;  1M63 B;  3CS1 A;  2OTG B;  3CD1 A;  2CNP A;  1K9U A;  5JOL A;  1XYD A;  1A4P A;  3PAT A;  1MWN A;  4INX A;  2K61 A;  3CAB A;  3S0E A;  3DPZ A;  3R1V A;  1YVH A;  2HPS A;  3K1K A;  1C4F A;  1B9C A;  1Q4C A;  3DQF A;  3D0Y B;  2DUF A;  4PE4 A;  1NP8 A;  1YRT B;  3AKA A;  4MN0 A;  2ZMW A;  3U0N A;  4DIR A;  2K7B A;  3AAK A;  4U2V A;  3ST0 A;  5DPJ A;  4W6J A;  4WRI A;  3DQ5 A;  3E5V A;  1E8A A;  4J88 A;  2CXJ A;  1K95 A;  2BKI B;  3WHT B;  4JKT A;  1PUL A;  2QLI A;  1TTX A;  4XJK B;  3DQ3 A;  1YJ2 A;  1OOG A;  4GOB A;  3BOW A;  3DQI A;  1FPW A;  1JBY A;  2L0P A;  4JEO A;  1NX1 A;  1TUZ A;  2FCE A;  3DQ6 A;  2PMY A;  2DD9 A;  2BKH B;  5HKW A;  4PPK A;  1CM4 A;  3CB9 A;  5ER4 X;  2M1K B;  4MBE A;  4OY4 A;  3DY9 A;  3L4L A;  3A8R A;  2DDC A;  4CFR A;  2HJO A;  3DQU A;  1EJ3 A;  2YE0 A;  1WRZ A;  4ETO A;  5BTT B;  4H47 A;  2F3Y A;  1RTP 1;  2L50 A;  3GB3 A;  5DQB A;  3TZ1 A;  1B4C A;  3BQ3 A;  1MXL C;  4IK9 A;  1NCX A;  2Y1M A;  4L9M A;  4P2Y B;  2FOT A;  2BCA A;  1OOH A;  4IK3 A;  4YGC B;  5DPG A;  2HQ8 A;  4N1F A;  3LCP C;  1YFP A;  3E5W A;  5HW9 A;  3SVR A;  5DRF A;  1P28 A;  4W6F A;  5FYX A;  1DF0 A;  2TN4 A;  1IG5 A;  1QAT A;  3EG5 B;  3O4Y A;  2VVI A;  4XOW A;  3FWC A;  1HT9 A;  5DRG A;  2A4J A;  2L4H A;  5D7F A;  4MSP A;  1JC1 A;  5DY6 A;  1S6Z A;  1A2X A;  1RJV A;  1BJF A;  2KBI A;  3SVU A;  3PIB A;  2LLU A;  2JAD A;  1YUR A;  4P5O E;  4R1E A;  2H61 C;  1QLS A;  2LVK A;  3R1O A;  5D69 A;  2M9G A;  3SS0 A;  2G3O A;  1KQV A;  4DKN A;  3SG4 A;  4GF6 B;  2COL B;  4AS8 A;  2MLE C;  2HRS A;  4W6M A;  2VVH A;  3RLZ A;  2Y5I A;  2DUI A;  3SS5 A;  2ISD A;  1FI6 A;  1WRK A;  1K96 A;  3K1E A;  1SR6 C;  3TMT A;  3VRO A;  1C07 A;  2Z6Z A;  4LJB A;  1BMO A;  3BUN B;  2FJY A;  1WLM A;  4P76 A;  4UTS A;  1F4O A;  2FJU B;  1N0Y A;  3V2L A;  1SNL A;  5CSN A;  1XA9 A;  1TCO B;  2KLE A;  1A03 A;  1YVL A;  3DD4 A;  4WQ2 A;  3ZUF A;  1S6I A;  5KTY A;  4W6P A;  1V1F A;  1YZW A;  3OB1 B;  3SG5 A;  2L5Y A;  3G9A A;  4MZJ A;  4U8D A;  3PN7 B;  4R6D A;  4NQG A;  2KAY A;  3OGO A;  1Z2C B;  1QX5 B;  2Q6P A;  2KAX A;  4PHJ A;  4DCK A;  2BL0 B;  4C0K A;  4W6N A;  4C0L A;  1KFU L;  2HCG A;  1QYQ A;  1CDL A;  4PCW A;  1S1E A;  1XK4 C;  4YI8 A;  1TNQ A;  2K2A A;  2A54 B;  4ORN A;  1BOD A;  4JRB A;  3U0K A;  2SAS A;  4PHN A;  3A8S A;  3BOW B;  2LAP A;  3ZNI A;  2WHT A;  3DF0 B;  5EXU A;  1F71 A;  2MHH A;  1OW4 A;  3KF9 A;  3B86 A;  1AUI B;  2KQY A;  1Y1A A;  2H5P A;  1W7I B;  5PAL A;  2E6W A;  2WOR A;  3CDN A;  1S3P A;  2QT2 A;  3TDU A;  3CR2 A;  4Q7R A;  4KF4 A;  3DVE A;  2H5O A;  1QVI Y;  4KGF A;  3WLC A;  4J89 A;  2WC8 A;  1MXE A;  3V3D A;  3LF4 B;  2ZMU A;  3W1C A;  4W7F A;  1RK9 A;  3CLN A;  3OB2 B;  5DKN A;  5T3I A;  4MLW A;  1Q4B A;  4OR9 B;  1C3Y A;  3IQO A;  2V4E B;  4CPV A;  4ZBL A;  4PPL A;  3NT3 A;  3SSL A;  1OOI X;  4RYW A;  2JU0 A;  3EK7 A;  2H61 A;  1W7S A;  2A47 A;  4W73 A;  4EUL A;  2KI6 D;  2B3P A;  2YE1 A;  1XFV O;  3GK4 X;  5FVF A;  2DDD A;  2YDZ A;  3DQK A;  5J2O A;  2KBM A;  1TN4 A;  4ZCV A;  3VHT B;  1M45 A;  1F0B A;  4LJC A;  4MRY A;  1Q4D A;  2JTZ A;  2WHS A;  3CBE A;  1LIN A;  5J3X A;  1XFY O;  4ZB1 A;  2EMO A;  4TNC A;  5F9G A;  2KAV A;  2PSR A;  5BQL A;  2Y0G A;  3JTD C;  1CMG A;  1SRA A;  2HPW A;  2KGR A;  1ZOT B;  4W69 A;  3DQ2 A;  3VIC A;  1NCZ A;  1WDC C;  5DU0 A;  4PAL A;  4KAG A;  1G33 A;  4Q7T A;  5IBW A;  1AVS A;  3BUM B;  3CTN A;  3SSH A;  3WXA A;  5KSZ A;  1G7K A;  3D0Y A;  2LMV A;  1IQ3 A;  1S5G Z;  3O77 A;  3KHE A;  2WCE A;  1MOV A;  2JNX A;  2EGD A;  1PSR A;  2PXS A;  3U0M A;  2QRF A;  4KYN A;  3LA1 A;  1MYW A;  2M3W A;  5CPV A;  1CFP A;  1GGW A;  2AWK A;  3I5H C;  1XQM A;  1GGZ A;  2M29 A;  3RWA A;  1YX8 A;  1BOC A;  2A48 A;  4BY4 A;  1J7O A;  2O2B A;  1UWO A;  2KFH A;  2K8M B;  4W6C A;  1XK4 A;  3MSE B;  1V1G A;  1CLL A;  2PYQ A;  3NED A;  5KTG A;  3ICB A;  2JQ6 A;  3BYA A;  5HBD A;  5CSJ A;  2ICR A;  4DXP A;  3DQN A;  2AWJ A;  1KWO C;  1KP5 A;  3BUX B;  2JTT A;  3D77 A;  2MLF C;  1FF1 A;  2OKW A;  5EJU A;  3PJI A;  4MVF A;  2JT8 A;  1H4B A;  2IOV A;  3UO9 A;  1ZUX A;  5DTL A;  1BT6 A;  1WLZ A;  1B7T Z;  3M22 A;  3ST4 A;  2M8U A;  3OSQ A;  3WLD A;  1CDP A;  1AK8 A;  2LVJ A;  1W7J B;  1ZAC A;  1QIV A;  2F33 A;  4W6S A;  4BDU A;  3E5T A;  1MOU A;  2POX A;  5LTR A;  1TWO A;  3CZ2 A;  2H5R A;  4PE7 A;  1OMV A;  2KHN A;  1NX3 A;  3SSY A;  3LSA A;  5I2L A;  3CFH A;  2ZND A;  2B3Q A;  2JXL A;  1DMO A;  4IK5 A;  1XAE A;  5H88 A;  2BAP A;  2QEB A;  2Q91 A;  3S0D A;  3NSL A;  3SVB A;  1Z4H A;  1PVB A;  2K0J A;  1F54 A;  2ZN9 A;  1GM0 A;  3VB1 A;  5FVG A;  2LVV A;  5F6T A;  4LQU A;  2L51 A;  5I8N A;  1UHH A;  2CTN A;  1M31 A;  4A4C A;  4CFQ A;  3SSV A;  2H8Q A;  1K90 D;  2JNF A;  2LVI A;  2KLD A;  1EML A;  3BX9 A;  3ZTF A;  2GW4 B;  4W76 A;  1ZGQ A;  1HUY A;  2FWQ A;  1SR6 B;  3PJ7 A;  3NEZ A;  4KEX A;  4W6B A;  1AP4 A;  3OX6 A;  1EG3 A;  3QRX A;  4NDD A;  2QZ0 A;  1CFD A;  5TNC A;  1SKT A;  4ZIN A;  1K93 D;  1KK7 Y;  3GJ1 A;  5DTX A;  5FVI A;  1YUS A;  1YTZ C;  3DQO A;  1Z1Q A;  3E3R A;  4JQ0 D;  5FHV A;  2JT0 A;  2H8V A;  3M0W A;  3D74 A;  1QVI Z;  5LTQ A;  1SK6 D;  1DEL A;  3AKO A;  4DRW A;  2RH7 A;  4GGN A;  1B8R A;  3O6B A;  3DF0 A;  1QX7 A;  4PE0 A;  1ZUZ A;  3NSI A;  2MJW B;  4Q04 A;  1QJT A;  2IS9 A;  2ARL A;  1QY3 A;  2EMN A;  3JVT C;  1HQV A;  1YHG A;  4W7D A;  3W1D A;  1LKJ A;  1RRO A;  1UIS A;  2AH8 A;  1KYS A;  2C9I A;  4OKH A;  1JC0 A;  1ALW A;  1CM1 A;  4DXM A;  5HZO A;  1QS7 A;  3GL4 A;  4GES B;  1CMF A;  2C9J A;  5EL2 A;  2V4E A;  4OCI A;  2Z6Y A;  1OOJ A;  4W6G A;  2WCL A;  3SIA A;  2I18 A;  3CGL A;  1SMG A;  1JF2 A;  2KGB C;  2L2E A;  3LLE A;  4GUK A;  1QX2 A;  1YJF A;  2VRG A;  3SVC A;  4ZF3 A;  3VHT A;  1S6J A;  2ZRT A;  2OGR A;  3IP2 A;  3VK1 A;  4IL1 A;  5B8I B;  1XFX O;  5HYD A;  4H3N A;  1SPY A;  3GK1 A;  2NCP A;  4PFE A;  4N5X A;  3FE9 A;  2BBM A;  1DGU A;  4OGS A;  4IK1 A;  2HGD A;  2F2P A;  1ZGO A;  2R2I A;  3PM2 A;  1DVI A;  1TIZ A;  1J7R A;  2K7O A;  1QV1 A;  2HQW A;  2MAZ A;  2OTE A;  5EBJ A;  1YUU A;  5BT0 A;  1GL4 A;  1R2U A;  3WCK A;  1BR1 B;  1Y1X A;  3JTD B;  2L5X B;  4ANJ A;  4CID A;  1F55 A;  3LF3 A;  1JFK A;  3ST2 A;  1WDC B;  2OS8 C;  1H8B A;  3GJ2 A;  3CWG A;  3SS3 A;  1KCY A;  3DQM A;  5LK4 A;  2K7D A;  5DKQ A;  3SJS A;  1OOF A;  3CGA A;  4I5K A;  4XGY A;  1JWD A;  1G4Y R;  3EKH A;  3S0F A;  4MZL A;  2KOT A;  4W7E A;  5AQB B;  3PLF B;  2JPT A;  2WC6 A;  2E30 A;  2LHI A;  3DXL A;  3I5H B;  1F8H A;  1EMF A;  3R1P A;  5DKR A;  2MBX A;  4TZA A;  4QJ4 B;  1B9A A;  1L2O B;  2BE4 A;  4YGA A;  1XA5 A;  1CB1 A;  5DTZ A;  1IWQ A;  4OQW A;  4EDS A;  3FE6 A;  2G9B A;  3NHI A;  3VGO A;  2QEV A;  1CNP A;  4I5N B;  4YI9 A;  5GQQ C;  2WUR A;  1KWO B;  3AI4 A;  1NSH A;  3SS4 A;  2ZRS A;  2LNK A;  1QLK A;  3B6X A;  3IF7 A;  5HLV A;  1R6P A;  4YGD B;  4DXQ A;  2FL1 A;  3BUW B;  1S36 A;  5FI7 A;  3SSK A;  2SCP A;  3RM1 A;  4IK4 A;  1PAL A;  3RWT A;  1CKK A;  4F0Z B;  2P70 A;  2KI4 C;  2L4I A;  2ZFD A;  3L47 A;  4OZD A;  1MHO A;  1QXP A;  3QME A;  4HQ8 A;  2A56 B;  2KFG A;  2JWW A;  3NSK A;  1RMM A;  1Q80 A;  4A4B A;  2A50 B;  2QU1 A;  3O2P A;  2BNX A;  3GK2 A;  4Q9W A;  1F4Q A;  2BEC A;  4MRX A;  2O29 A;  2OPO A;  1K2H A;  3H1O A;  2WCF A;  3D78 A;  2FCD A;  5H89 A;  1OE9 B;  2LP2 A;  2ZN8 A;  3SG6 A;  2KNE A;  3DQA A;  2ZO6 A;  3PAL A;  1QYO A;  4GNK B;  2BE6 A;  3BXK A;  3U8C A;  4QJ5 B;  3P28 A;  1DC1 A;  1IIO A;  3IR8 A;  1JC2 A;  5ER5 A;  3IQQ A;  4ZCU A;  2F8P A;  2QLE A;  1EG4 A;  2LCP A;  4W6R A;  3OX5 A;  1J1D A;  5FI2 A;  1J7Q A;  4W6L A;  1ORG A;  2QEO A;  1BR4 B;  1DEK A;  1ZGP A;  5HKY A;  1TUJ A;  1CFF A;  1NIW A;  2L98 A;  4RTC A;  1EMB A;  1UUS A;  5I2Q A;  1GJY A;  5JJG A;  2KQ6 A;  1UHN A;  3ADF A;  1XFU O;  4YBH B;  3Q8I A;  3DVM A;  4WQ3 A;  4HQ9 A;  3H4S E;  4KW8 A;  1JUO A;  1N2D A;  1NPQ A;  1NWD A;  3DQD A;  4HRH A;  1QV0 A;  3S0B A;  2WCK A;  1SL8 A;  3S0A A;  3CZT X;  4TZG A;  2MA2 A;  1DJW A;  3HCM A;  2WCJ A;  1TRF A;  1L2O C;  3U0L A;  1Q4E A;  1CTR A;  3VRN A;  1IQ5 A;  2KYC A;  4GFT A;  5HZT A;  2PXW A;  2AUC A;  4W72 A;  3KEV A;  2M7N A;  1U5I A;  4AQI A;  1DGV A;  1OZS A;  1F09 A;  1F70 A;  1TCF A;  4HRE E;  4W74 A;  3I5G C;  1ZMZ A;  4BY5 A;  4I5L B;  3LK1 A;  1REC A;  3JVT B;  4OVN F;  3EK4 A;  1EMK A;  4XOV A;  3SSP A;  2ZKM X;  1IKU A;  4B30 A;  1OSA A;  3AAJ A;  4ICB A;  2WHU A;  3DQE A;  1KFX S;  2BBN A;  3R72 A;  2K7C A;  3BJH A;  3EKJ A;  5HLO A;  3D76 A;  1BFP A;  2LUC A;  2P6B B;  2LMU A;  3FE8 A;  2ZNE A;  2PQL A;  2JC2 A;  2LP3 A;  1X02 A;  2ZO7 A;  1JFJ A;  1GQM A;  3B87 A;  5DPI A;  2PVB A;  4OV2 A;  2WOS A;  4C0J A;  1PRW A;  3TMR A;  2LLS A;  2A46 A;  3OHM B;  1CLM A;  1Q4A A;  1EMC A;  2G6X A;  1M46 A;  4Q9X A;  4N1G A;  2K2F A;  4NDC A;  2ERB A;  2QLH A;  3RZS A;  1NUB A;  2JZI A;  1ALV A;  3PSR A;  2H9W A;  2A52 B;  4PHM A;  1K9K A;  3U8A A;  1B1G A;  2WIS A;  2PAS A;  1NCY A;  3O4X A;  2KYF A;  1MQ1 A;  2LM5 A;  1KYR A;  2H5Q A;  3OGN A;  1QIW A;  3BFA A;  3DQ1 A;  1Y0V H;  3DQC A;  4USL A;  1TOP A;  2OS8 B;  4YGE B;  3NHT A;  2GGM A;  1KQM C;  4EN1 A;  2YFP A;  4AQJ A;  4HQC A;  1K9P A;  2OJK A;  4DXO A;  3DQ7 A;  1S26 D;  1XFZ O;  2HET A;  2EC6 C;  2VZX A;  1YHH A;  3HX4 A;  1XFR A;  2G16 B;  3UFZ A;  3D75 A;  5D3O A;  4KW4 A;  3OSR A;  2Z1O A;  4JFG A;  2JXC A;  3LK0 A;  2QEH A;  2LAN A;  2IB6 A;  2OKY A;  4ZFS A;  5HZS A;  1D1O A;  3FIA A;  3VRR A;  1W7T A;  3SVS A;  4DKM A;  3TDZ A;  4GGF C;  4HRG A;  4JD9 A;  2DUE A;  1DJG A;  1Y6W A;  1DJY A;  4I5J A;  1B47 A;  2BCB A;  2GV5 A;  2JPO A;  3LL8 B;  4N3D A;  3SVD A;  3LVA A;  4FQO A;  4JF9 A;  3I5F C;  3SG7 A;  3L4A A;  2M0R A;  3DPX A;  3KO0 A;  1UUR A;  2F2O A;  5BPJ A;  2G6Y A;  2M49 B;  3ED8 A;  4UPG A;  2OTB A;  3SVO A;  5FI6 A;  5LTP A;  1K94 A;  3KPX A;  1SCV A;  5I2O A;  4FQT A;  2K60 A;  4INW A;  1J55 A;  1M39 A;  3FS7 A;  4F7F A;  5EB6 A;  1U5I B;  1PVA A;  4RYS A;  5EHU A;  1DJX A;  2VAE A;  2KI4 B;  3B88 A;  3K21 A;  3ST3 A;  1WY9 A;  1A29 A;  3DQ9 A;  1NX0 A;  4QJ3 B;  2QLG A;  2WSO A;  2KSP A;  2MRD A;  2I2R E;  1AJ5 A;  1EL4 A;  2AWL A;  3ZWH A;  4J8A A;  1S5G Y;  1RFJ A;  4P1Q A;  1YR5 A;  4B30 B;  3DPW A;  4Q7U A;  5DIC A;  3AI5 A;  4W6A A;  2DUH A;  4M2O A;  2IE2 A;  3A4U B;  2CCM A;  4XL5 A;  1KK8 C;  3GOF A;  5HL1 A;  4HSZ A;  3NXA A;  4JPZ B;  4LW5 A;  5HZU A;  1XO5 A;  3GEX A;  2RGI A;  3IVT A;  3SST A;  3I5I C;  1OZO A;  1JBA A;  3CYZ A;  2P4M A;  3TUY B;  4E68 A;  4ZIO A;  1LA3 A;  3BUO B;  3C1V A;  1Q73 A;  1YX7 A;  1DJH A;  1TNW A;  3UG0 A;  2KI6 C;  3LVD A;  4H48 A;  2CT9 A;  1SW8 A;  5CSF A;  4HE4 A;  1EXR A;  1N65 A;  4ORB B;  3SG2 A;  2G5Z B;  4DUQ A;  3ZUJ A;  1K8U A;  3I19 A;  1B7T Y;  3TDI A;  4R6B A;  1IGV A;  2EHB A;  1TNX A;  2M97 A;  2NZ0 A;  1MF8 B;  1SCM C;  1CDM A;  4PPJ A;  2KPH A;  3UNW A;  4H3L A;  1KFX L;  1ZFS A;  3EK8 A;  4CLN A;  4GGF A;  4KPI A;  1DJI A;  1WRL A;  1XVJ A;  1EME A;  5HKZ A;  2WCB A;  4LQT A;  4W7C A;  1CFC A;  2NXQ A;  4W7X A;  1T14 A;  2KFF A;  1EMM A;  1KSM A;  3S05 A;  1MUX A;  1H6R A;  5KU1 A;  1GGX A;  1OQP A;  1B8L A;  3MGF A;  4W6I A;  2M7L A;  1JF0 A;  3TS5 C;  2GTE A;  3CFF A;  2LHL A;  5AFP A;  5AAN A;  2OTG C;  1L7Z A;  4GPL B;  3FWB A;  1IJ6 A;  1J7P A;  1OMR A;  3I5G B;  1NX2 A;  3BFH A;  4EMQ A;  2LLT A;  2HFC A;  2LC5 A;  2DD7 A;  2VVJ A;  2Z6X A;  3DQJ A;  2KDH A;  4L1I A;  3LS3 A;  1BU3 A;  2DOQ A;  4LJD C;  2WCH A;  1GFL A;  4KF5 C;  3BXC A;  2F3Z A;  3D73 A;  2LV7 A;  2NLN A;  4OJ0 A;  3SG3 A;  2HQZ A;  3PJB A;  4OHS A;  4DXN A;  1DQE A;  5HGE A;  1YUT A;  3EVV A;  4KW9 A;  1HCJ A;  2JT3 A;  2I7A A;  3SV5 A;  2WCM A;  2QLG B;  2Q4U A;  3F45 A;  2WSN A;  1S6C A;  3OP0 A;  3WHU B;  4MZK A;  1BLQ A;  2A53 B;  2I94 A;  2M1U A;  1EMG A;  1RRX A;  3O78 A;  3D10 A;  4W7R A;  3KCT A;  2HQK A;  1OXE A;  1UHI A;  2GX2 A;  2QDI A;  1QTX A;  4M2Q A;  1QXT A;  4IZN A;  2O24 A;  1PSB A;  2CBL A;  3SRY A;  2G3D B;  2FZU A;  1FI5 A;  4DXI A;  3N7H A;  3TUY C;  5DTY A;  3DQH A;  2H2K A;  2BCX A;  5CSI A;  1TNP A;  1G8I A;  1KK7 Z;  3KCS A;  1EMA A;  3EVP A;  1CLB A;  1KQM B;  4PE1 A;  1B8C A;  2WC5 A;  1FBV A;  2V53 A;  2B1U A;  3DYE A;  4ORA B;  1A75 A;  4I2Y A;  5H87 A;  1H4U A;  1RWY A;  1UP5 A;  2EC6 B;  2PRU A;  4ZF4 A;  1MR8 A;  2IB5 A;  2EMD A;  4XYN A;  3EVU A;  3P8U A;  1DF0 B;  2AAO A;  3NF0 A;  1KYP A;  1LA0 A;  2BTJ A;  2AMI A;  3H1R A;  1QWV A;  3SIB A;  1SL7 A;  4MEW A;  4EDO A;  3CFA A;  5DQM A;  4PHK A;  1AHR A;  1AJ4 A;  2HGY A;  5DPH A;  2QAC A;  5EB7 A;  1DT7 B;  3CZ0 A;  2JOJ A;  2JUL A;  3DZT A;  3U8P A;  3I5F B;  2GX0 A;  2NCO A;  5K89 A;  1VRK A;  2HF5 A;  3AKB A;  3M24 A;  4KGE A;  1BG1 A;  2WIQ A;  2PAL A;  2GGZ A;  1C7V A;  4B5Y A;  4D1E A;  3PJ5 A;  4LJD A;  5AXI A;  3NGV A;  4KF5 A;  3CZ1 A;  4YRU A;  1OXF A;  3SVE A;  4IJ7 A;  2Q57 A;  1SY9 A;  3BFB A;  3OBV A;  4XJK A;  4W6U A;  4JC2 A;  3PFV A;  3BXB A;  5I94 A;  4GAO A;  1OXD A;  5AER A;  2H6V A;  4W6K A;  4XVP A;  4AOM A; 
#chains in the Genus database with same CATH homology
 3PN7 C;  3DQ4 A;  2O60 A;  2GW3 A;  4W6H A;  1OMD A;  2D8N A;  1DTL A;  3BXA A;  4AR7 A;  1XSS A;  1LXF C;  3CR4 X;  1EH2 A;  5AEQ A;  3VRQ A;  4W6T A;  1CDN A;  2BL0 C;  4FTG A;  1JBZ A;  1RMP A;  1LVC D;  5BTT A;  2Y4Q A;  1Y1U A;  1KK8 B;  2VAD A;  1SYM A;  1QAS A;  3VRP A;  1SL9 A;  2JRF A;  1IRJ A;  4NDB A;  3I5I B;  4JWQ A;  1J1E A;  2Y1N A;  5EXC I;  4Z4M A;  1BF5 A;  2G2B A;  3DQ8 A;  3CR5 X;  1IH0 A;  4GBA A;  1Z1P A;  3SVN A;  1RMO A;  2AHA A;  1YHI A;  1SBJ A;  4W77 A;  4HVF A;  1KSO A;  3LVC A;  5G08 A;  2DUG A;  4JGE A;  3DVJ A;  4KA9 A;  3ZUL A;  1PK0 D;  1FW4 A;  3DQL A;  2LE9 B;  1SCM B;  1YRU B;  1UHK A;  4W7A A;  2V4E C;  3WNX B;  4H3M A;  4W75 A;  1JSA A;  1QYF A;  1IJ5 A;  4ORC B;  4L12 A;  4YGB B;  4W6O A;  1W7U A;  2O5G A;  3DVK A;  2LUX A;  2AWM A;  4Z4K A;  1DJZ A;  3EVR A;  1ODB A;  2QPT A;  1C7W A;  5EXB A;  1KFU S;  1A75 B;  1XMZ A;  1NYA A;  4DS7 A;  1UHJ A;  3PM8 A;  4ZF5 A;  2G6E A;  3NSO A;  1XFW O;  4W6D A;  2WND A;  3TS5 B;  3CD9 A;  4M2P A;  2G2S B;  3NT9 A;  1CV7 A;  4L13 A;  4IK8 A;  2LMT A;  4NWS A;  4PDZ A;  1RM9 A;  1M63 B;  3CS1 A;  2OTG B;  3CD1 A;  2CNP A;  1K9U A;  5JOL A;  1XYD A;  1A4P A;  3PAT A;  1MWN A;  2K61 A;  3DPZ A;  1YVH A;  2HPS A;  3K1K A;  1C4F A;  1B9C A;  1Q4C A;  3DQF A;  3D0Y B;  2DUF A;  4PE4 A;  1NP8 A;  1YRT B;  3AKA A;  4MN0 A;  2ZMW A;  3U0N A;  4DIR A;  2K7B A;  3AAK A;  4U2V A;  3ST0 A;  5DPJ A;  4W6J A;  4WRI A;  3DQ5 A;  3E5V A;  1E8A A;  4J88 A;  2CXJ A;  1K95 A;  2BKI B;  3WHT B;  2QLI A;  1PUL A;  1TTX A;  4XJK B;  3DQ3 A;  1YJ2 A;  4GOB A;  3BOW A;  3DQI A;  1FPW A;  1JBY A;  2L0P A;  4JEO A;  1NX1 A;  2FCE A;  3DQ6 A;  2PMY A;  2DD9 A;  2BKH B;  5HKW A;  4PPK A;  1CM4 A;  3CB9 A;  5ER4 X;  2M1K B;  4MBE A;  4OY4 A;  3A8R A;  2DDC A;  4CFR A;  2HJO A;  3DQU A;  1EJ3 A;  2YE0 A;  1WRZ A;  4ETO A;  5BTT B;  4H47 A;  2F3Y A;  1RTP 1;  2L50 A;  3GB3 A;  5DQB A;  3TZ1 A;  1B4C A;  3BQ3 A;  1MXL C;  4IK9 A;  1NCX A;  2Y1M A;  4L9M A;  4P2Y B;  2FOT A;  2BCA A;  4IK3 A;  4YGC B;  5DPG A;  2HQ8 A;  4N1F A;  3LCP C;  1YFP A;  3E5W A;  5HW9 A;  3SVR A;  5DRF A;  4W6F A;  5FYX A;  1DF0 A;  2TN4 A;  1IG5 A;  1QAT A;  3O4Y A;  2VVI A;  4XOW A;  3FWC A;  1HT9 A;  5DRG A;  2A4J A;  2L4H A;  5D7F A;  4MSP A;  1JC1 A;  5DY6 A;  1S6Z A;  1A2X A;  1RJV A;  1BJF A;  2KBI A;  3SVU A;  3PIB A;  2LLU A;  2JAD A;  1YUR A;  4P5O E;  4R1E A;  2H61 C;  1QLS A;  2LVK A;  5D69 A;  2M9G A;  3SS0 A;  2G3O A;  1KQV A;  4DKN A;  3SG4 A;  4GF6 B;  2COL B;  4AS8 A;  2MLE C;  2HRS A;  4W6M A;  2VVH A;  3RLZ A;  2Y5I A;  2DUI A;  2ISD A;  1FI6 A;  1WRK A;  1K96 A;  1SR6 C;  3TMT A;  3VRO A;  1C07 A;  2Z6Z A;  4LJB A;  1BMO A;  3BUN B;  1WLM A;  4P76 A;  4UTS A;  1F4O A;  2FJU B;  1N0Y A;  1SNL A;  5CSN A;  1XA9 A;  1TCO B;  1A03 A;  1YVL A;  3DD4 A;  4WQ2 A;  3ZUF A;  1S6I A;  5KTY A;  4W6P A;  1V1F A;  1YZW A;  3OB1 B;  3SG5 A;  3G9A A;  4MZJ A;  4U8D A;  3PN7 B;  4R6D A;  4NQG A;  2KAY A;  3OGO A;  1QX5 B;  2Q6P A;  2KAX A;  4PHJ A;  4DCK A;  2BL0 B;  4C0K A;  4W6N A;  4C0L A;  1KFU L;  2HCG A;  1QYQ A;  1CDL A;  4PCW A;  1S1E A;  1XK4 C;  4YI8 A;  1TNQ A;  2K2A A;  2A54 B;  4ORN A;  1BOD A;  4JRB A;  3U0K A;  2SAS A;  4PHN A;  3A8S A;  3BOW B;  2LAP A;  3ZNI A;  2WHT A;  3DF0 B;  5EXU A;  1F71 A;  2MHH A;  3KF9 A;  1AUI B;  2KQY A;  1Y1A A;  2H5P A;  1W7I B;  5PAL A;  2E6W A;  2WOR A;  1S3P A;  2QT2 A;  3TDU A;  3CR2 A;  4Q7R A;  4KF4 A;  3DVE A;  2H5O A;  1QVI Y;  4KGF A;  3WLC A;  4J89 A;  2WC8 A;  1MXE A;  3V3D A;  3LF4 B;  2ZMU A;  3W1C A;  4W7F A;  1RK9 A;  3CLN A;  3OB2 B;  5DKN A;  5T3I A;  4MLW A;  1Q4B A;  4OR9 B;  3IQO A;  2V4E B;  4CPV A;  4ZBL A;  4PPL A;  3NT3 A;  3SSL A;  4RYW A;  2JU0 A;  3EK7 A;  2H61 A;  1W7S A;  2A47 A;  4W73 A;  4EUL A;  2KI6 D;  2B3P A;  2YE1 A;  1XFV O;  3GK4 X;  5FVF A;  2DDD A;  2YDZ A;  3DQK A;  5J2O A;  2KBM A;  1TN4 A;  4ZCV A;  3VHT B;  1M45 A;  1F0B A;  4LJC A;  4MRY A;  1Q4D A;  2JTZ A;  2WHS A;  3CBE A;  1LIN A;  5J3X A;  1XFY O;  4ZB1 A;  2EMO A;  4TNC A;  5F9G A;  2KAV A;  2PSR A;  5BQL A;  2Y0G A;  3JTD C;  1CMG A;  1SRA A;  2HPW A;  2KGR A;  1ZOT B;  4W69 A;  3DQ2 A;  3VIC A;  1NCZ A;  1WDC C;  5DU0 A;  4PAL A;  4KAG A;  1G33 A;  4Q7T A;  5IBW A;  1AVS A;  3BUM B;  3CTN A;  3SSH A;  3WXA A;  5KSZ A;  1G7K A;  3D0Y A;  2LMV A;  1IQ3 A;  1S5G Z;  3O77 A;  3KHE A;  2WCE A;  1MOV A;  2JNX A;  2EGD A;  1PSR A;  2PXS A;  3U0M A;  2QRF A;  3LA1 A;  1MYW A;  2M3W A;  5CPV A;  1CFP A;  1GGW A;  2AWK A;  3I5H C;  1XQM A;  1GGZ A;  2M29 A;  3RWA A;  1YX8 A;  1BOC A;  2A48 A;  4BY4 A;  1J7O A;  2O2B A;  1UWO A;  2KFH A;  2K8M B;  4W6C A;  1XK4 A;  3MSE B;  1V1G A;  1CLL A;  3NED A;  5KTG A;  3ICB A;  2JQ6 A;  3BYA A;  5HBD A;  5CSJ A;  2ICR A;  4DXP A;  3DQN A;  2AWJ A;  1KWO C;  1KP5 A;  3BUX B;  2JTT A;  2MLF C;  1FF1 A;  2OKW A;  5EJU A;  4MVF A;  2JT8 A;  1H4B A;  2IOV A;  1ZUX A;  5DTL A;  1BT6 A;  1WLZ A;  1B7T Z;  3M22 A;  3ST4 A;  2M8U A;  3OSQ A;  3WLD A;  1CDP A;  1AK8 A;  2LVJ A;  1W7J B;  1ZAC A;  1QIV A;  2F33 A;  4W6S A;  4BDU A;  3E5T A;  1MOU A;  2POX A;  5LTR A;  2H5R A;  4PE7 A;  1OMV A;  2KHN A;  1NX3 A;  3SSY A;  3LSA A;  5I2L A;  3CFH A;  2ZND A;  2B3Q A;  2JXL A;  1DMO A;  4IK5 A;  1XAE A;  5H88 A;  2Q91 A;  3NSL A;  3SVB A;  1PVB A;  2K0J A;  1F54 A;  2ZN9 A;  5FVG A;  2LVV A;  5F6T A;  4LQU A;  2L51 A;  5I8N A;  1UHH A;  2CTN A;  1M31 A;  4A4C A;  4CFQ A;  3SSV A;  2H8Q A;  1K90 D;  2JNF A;  2LVI A;  1EML A;  3BX9 A;  3ZTF A;  2GW4 B;  4W76 A;  1ZGQ A;  1HUY A;  2FWQ A;  1SR6 B;  3PJ7 A;  3NEZ A;  4KEX A;  4W6B A;  1AP4 A;  3OX6 A;  1EG3 A;  3QRX A;  4NDD A;  2QZ0 A;  1CFD A;  5TNC A;  1SKT A;  4ZIN A;  1K93 D;  1KK7 Y;  3GJ1 A;  5DTX A;  5FVI A;  1YUS A;  1YTZ C;  1Z1Q A;  3DQO A;  3E3R A;  4JQ0 D;  5FHV A;  2JT0 A;  3M0W A;  1QVI Z;  5LTQ A;  1SK6 D;  3AKO A;  4DRW A;  2RH7 A;  4GGN A;  1B8R A;  3O6B A;  3DF0 A;  1QX7 A;  4PE0 A;  1ZUZ A;  3NSI A;  2MJW B;  4Q04 A;  1QJT A;  2IS9 A;  2ARL A;  1QY3 A;  2EMN A;  3JVT C;  1HQV A;  1YHG A;  4W7D A;  3W1D A;  1LKJ A;  1RRO A;  1UIS A;  2AH8 A;  1KYS A;  2C9I A;  4OKH A;  1JC0 A;  1ALW A;  1CM1 A;  4DXM A;  5HZO A;  1QS7 A;  3GL4 A;  4GES B;  1CMF A;  2C9J A;  2V4E A;  4OCI A;  2Z6Y A;  1OOJ A;  4W6G A;  3SIA A;  2I18 A;  3CGL A;  1SMG A;  1JF2 A;  2KGB C;  2L2E A;  3LLE A;  4GUK A;  1QX2 A;  1YJF A;  2VRG A;  3SVC A;  4ZF3 A;  3VHT A;  1S6J A;  2ZRT A;  2OGR A;  3IP2 A;  3VK1 A;  4IL1 A;  5B8I B;  1XFX O;  5HYD A;  4H3N A;  1SPY A;  3GK1 A;  2NCP A;  4PFE A;  4N5X A;  2BBM A;  1DGU A;  4OGS A;  4IK1 A;  2HGD A;  2F2P A;  1ZGO A;  2R2I A;  1DVI A;  1TIZ A;  1J7R A;  2K7O A;  1QV1 A;  2HQW A;  2MAZ A;  2OTE A;  5EBJ A;  1YUU A;  5BT0 A;  1GL4 A;  1R2U A;  3WCK A;  1BR1 B;  1Y1X A;  3JTD B;  2L5X B;  4ANJ A;  4CID A;  1F55 A;  3LF3 A;  1JFK A;  3ST2 A;  1WDC B;  2OS8 C;  1H8B A;  3GJ2 A;  3CWG A;  1KCY A;  3DQM A;  5LK4 A;  2K7D A;  5DKQ A;  3SJS A;  3CGA A;  4I5K A;  4XGY A;  1JWD A;  1G4Y R;  3EKH A;  4MZL A;  2KOT A;  4W7E A;  5AQB B;  3PLF B;  2JPT A;  2E30 A;  2LHI A;  3I5H B;  1F8H A;  1EMF A;  5DKR A;  2MBX A;  4TZA A;  4QJ4 B;  1B9A A;  1L2O B;  2BE4 A;  4YGA A;  1XA5 A;  1CB1 A;  5DTZ A;  1IWQ A;  4OQW A;  4EDS A;  2G9B A;  3VGO A;  1CNP A;  4I5N B;  4YI9 A;  5GQQ C;  2WUR A;  1KWO B;  3AI4 A;  1NSH A;  2ZRS A;  2LNK A;  1QLK A;  3IF7 A;  5HLV A;  1R6P A;  4YGD B;  4DXQ A;  2FL1 A;  3BUW B;  1S36 A;  3SSK A;  2SCP A;  3RM1 A;  4IK4 A;  1PAL A;  3RWT A;  1CKK A;  4F0Z B;  2KI4 C;  2L4I A;  2ZFD A;  1MHO A;  1QXP A;  4HQ8 A;  2A56 B;  2KFG A;  2JWW A;  3NSK A;  1RMM A;  1Q80 A;  4A4B A;  2A50 B;  2QU1 A;  3O2P A;  3GK2 A;  4Q9W A;  1F4Q A;  2BEC A;  4MRX A;  2O29 A;  2OPO A;  1K2H A;  3H1O A;  2WCF A;  2FCD A;  5H89 A;  1OE9 B;  2LP2 A;  2ZN8 A;  3SG6 A;  2KNE A;  3DQA A;  2ZO6 A;  3PAL A;  1QYO A;  4GNK B;  2BE6 A;  3BXK A;  3U8C A;  4QJ5 B;  3P28 A;  3IR8 A;  1JC2 A;  5ER5 A;  3IQQ A;  4ZCU A;  2F8P A;  2QLE A;  1EG4 A;  2LCP A;  4W6R A;  3OX5 A;  1J1D A;  1J7Q A;  4W6L A;  1BR4 B;  1ZGP A;  5HKY A;  1CFF A;  1NIW A;  2L98 A;  4RTC A;  1EMB A;  1UUS A;  5I2Q A;  1GJY A;  5JJG A;  2KQ6 A;  1UHN A;  3ADF A;  1XFU O;  4YBH B;  3DVM A;  4WQ3 A;  4HQ9 A;  3H4S E;  4KW8 A;  1JUO A;  1N2D A;  1NPQ A;  1NWD A;  3DQD A;  4HRH A;  1QV0 A;  1SL8 A;  3CZT X;  4TZG A;  2MA2 A;  1DJW A;  3HCM A;  1TRF A;  1L2O C;  3U0L A;  1Q4E A;  1CTR A;  3VRN A;  1IQ5 A;  2KYC A;  4GFT A;  5HZT A;  2PXW A;  2AUC A;  4W72 A;  3KEV A;  2M7N A;  1U5I A;  4AQI A;  1DGV A;  1OZS A;  1F09 A;  1F70 A;  1TCF A;  4HRE E;  4W74 A;  3I5G C;  1ZMZ A;  4BY5 A;  4I5L B;  3LK1 A;  1REC A;  3JVT B;  4OVN F;  3EK4 A;  1EMK A;  4XOV A;  3SSP A;  2ZKM X;  1IKU A;  4B30 A;  1OSA A;  3AAJ A;  4ICB A;  2WHU A;  3DQE A;  1KFX S;  2BBN A;  2K7C A;  3EKJ A;  5HLO A;  1BFP A;  2LUC A;  2P6B B;  2LMU A;  2ZNE A;  2JC2 A;  2LP3 A;  1X02 A;  2ZO7 A;  1JFJ A;  1GQM A;  5DPI A;  2PVB A;  4OV2 A;  2WOS A;  4C0J A;  1PRW A;  3TMR A;  2LLS A;  2A46 A;  3OHM B;  1CLM A;  1Q4A A;  1EMC A;  2G6X A;  1M46 A;  4Q9X A;  4N1G A;  2K2F A;  4NDC A;  2QLH A;  1NUB A;  2JZI A;  1ALV A;  3PSR A;  2H9W A;  2A52 B;  4PHM A;  1K9K A;  3U8A A;  1B1G A;  2WIS A;  2PAS A;  1NCY A;  2KYF A;  1MQ1 A;  2LM5 A;  1KYR A;  2H5Q A;  1QIW A;  3DQ1 A;  1Y0V H;  3DQC A;  4USL A;  1TOP A;  2OS8 B;  4YGE B;  2GGM A;  1KQM C;  4EN1 A;  2YFP A;  4AQJ A;  4HQC A;  1K9P A;  2OJK A;  4DXO A;  3DQ7 A;  1S26 D;  1XFZ O;  2HET A;  2EC6 C;  2VZX A;  1YHH A;  3HX4 A;  2G16 B;  3UFZ A;  4KW4 A;  3OSR A;  2Z1O A;  4JFG A;  2JXC A;  3LK0 A;  2LAN A;  2IB6 A;  2OKY A;  4ZFS A;  5HZS A;  1D1O A;  3FIA A;  3VRR A;  1W7T A;  3SVS A;  4DKM A;  3TDZ A;  4GGF C;  4HRG A;  2DUE A;  1DJG A;  1Y6W A;  1DJY A;  4I5J A;  1B47 A;  2BCB A;  2GV5 A;  4N3D A;  3LL8 B;  3SVD A;  3LVA A;  4FQO A;  4JF9 A;  3I5F C;  3SG7 A;  2M0R A;  3DPX A;  3KO0 A;  1UUR A;  2F2O A;  5BPJ A;  2G6Y A;  2M49 B;  3ED8 A;  4UPG A;  2OTB A;  3SVO A;  5LTP A;  1K94 A;  3KPX A;  1SCV A;  5I2O A;  1J55 A;  1M39 A;  3FS7 A;  5EB6 A;  1U5I B;  1PVA A;  4RYS A;  5EHU A;  1DJX A;  2VAE A;  2KI4 B;  3K21 A;  3ST3 A;  1WY9 A;  1A29 A;  3DQ9 A;  1NX0 A;  4QJ3 B;  2QLG A;  2WSO A;  2KSP A;  2MRD A;  2I2R E;  1AJ5 A;  1EL4 A;  2AWL A;  3ZWH A;  4J8A A;  1S5G Y;  1RFJ A;  4P1Q A;  1YR5 A;  4B30 B;  3DPW A;  4Q7U A;  3AI5 A;  4W6A A;  2DUH A;  4M2O A;  2IE2 A;  3A4U B;  2CCM A;  4XL5 A;  1KK8 C;  3GOF A;  4HSZ A;  3NXA A;  4JPZ B;  4LW5 A;  5HZU A;  1XO5 A;  3GEX A;  2RGI A;  3SST A;  3I5I C;  1OZO A;  1JBA A;  2P4M A;  3TUY B;  4E68 A;  4ZIO A;  1LA3 A;  3BUO B;  3C1V A;  1Q73 A;  1YX7 A;  1DJH A;  1TNW A;  3UG0 A;  2KI6 C;  3LVD A;  4H48 A;  2CT9 A;  1SW8 A;  5CSF A;  4HE4 A;  1EXR A;  1N65 A;  4ORB B;  3SG2 A;  2G5Z B;  4DUQ A;  3ZUJ A;  1K8U A;  3I19 A;  1B7T Y;  3TDI A;  4R6B A;  1IGV A;  2EHB A;  1TNX A;  2M97 A;  2NZ0 A;  1MF8 B;  1SCM C;  1CDM A;  4PPJ A;  4H3L A;  1KFX L;  1ZFS A;  3EK8 A;  4CLN A;  4GGF A;  4KPI A;  1DJI A;  1WRL A;  1XVJ A;  1EME A;  5HKZ A;  2WCB A;  4LQT A;  4W7C A;  1CFC A;  2NXQ A;  4W7X A;  2KFF A;  1EMM A;  1KSM A;  3S05 A;  1MUX A;  1H6R A;  5KU1 A;  1GGX A;  1OQP A;  1B8L A;  3MGF A;  4W6I A;  2M7L A;  1JF0 A;  3TS5 C;  3CFF A;  2LHL A;  5AFP A;  5AAN A;  2OTG C;  1L7Z A;  4GPL B;  3FWB A;  1IJ6 A;  1J7P A;  1OMR A;  3I5G B;  1NX2 A;  4EMQ A;  2LLT A;  2HFC A;  2LC5 A;  2DD7 A;  2VVJ A;  2Z6X A;  3DQJ A;  2KDH A;  4L1I A;  3LS3 A;  1BU3 A;  2DOQ A;  4LJD C;  1GFL A;  4KF5 C;  3BXC A;  2F3Z A;  2LV7 A;  2NLN A;  4OJ0 A;  3SG3 A;  2HQZ A;  3PJB A;  4OHS A;  4DXN A;  5HGE A;  1YUT A;  3EVV A;  4KW9 A;  1HCJ A;  2JT3 A;  2I7A A;  3SV5 A;  2QLG B;  2Q4U A;  3F45 A;  2WSN A;  1S6C A;  3OP0 A;  3WHU B;  4MZK A;  1BLQ A;  2A53 B;  2I94 A;  2M1U A;  1EMG A;  1RRX A;  3O78 A;  3D10 A;  4W7R A;  3KCT A;  2HQK A;  1OXE A;  1UHI A;  2GX2 A;  1QTX A;  4M2Q A;  1QXT A;  4IZN A;  2O24 A;  1PSB A;  2CBL A;  3SRY A;  2G3D B;  2FZU A;  1FI5 A;  4DXI A;  3TUY C;  5DTY A;  3DQH A;  2H2K A;  2BCX A;  5CSI A;  1TNP A;  1G8I A;  1KK7 Z;  3KCS A;  1EMA A;  3EVP A;  1CLB A;  1KQM B;  4PE1 A;  1B8C A;  1FBV A;  2V53 A;  2B1U A;  4ORA B;  1A75 A;  4I2Y A;  5H87 A;  1H4U A;  1RWY A;  1UP5 A;  2EC6 B;  2PRU A;  4ZF4 A;  1MR8 A;  2IB5 A;  2EMD A;  4XYN A;  3EVU A;  3P8U A;  1DF0 B;  2AAO A;  3NF0 A;  1KYP A;  1LA0 A;  2BTJ A;  2AMI A;  3H1R A;  3SIB A;  1SL7 A;  4MEW A;  4EDO A;  3CFA A;  5DQM A;  4PHK A;  1AHR A;  1AJ4 A;  2HGY A;  5DPH A;  2QAC A;  5EB7 A;  1DT7 B;  2JOJ A;  2JUL A;  3U8P A;  3I5F B;  2GX0 A;  2NCO A;  5K89 A;  1VRK A;  2HF5 A;  3AKB A;  3M24 A;  4KGE A;  1BG1 A;  2WIQ A;  2PAL A;  2GGZ A;  1C7V A;  4B5Y A;  4D1E A;  3PJ5 A;  4LJD A;  5AXI A;  4KF5 A;  4YRU A;  1OXF A;  3SVE A;  2Q57 A;  1SY9 A;  4XJK A;  4W6U A;  4JC2 A;  3PFV A;  3BXB A;  4GAO A;  1OXD A;  5AER A;  2H6V A;  4W6K A;  4XVP A;  4AOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...