3SG6A

Crystal structure of dimeric gcamp2-lia(linker 1)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
409
structure length
383
Chain Sequence
b'SRRKWNKTGHAVRAIGRLSSLIANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 125
structure length 383
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg6A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg6A01
1M31A 4HQCA 3ADFA 1EG3A 1QJTA 1HQVA 2K61A 5CSFA 1MOUA 3EVPA 1K8UA 3CD9A 5AQBB 3PN7C 4HRGA 4N5XA 3V3DA 1AK8A 2IS9A 3OHMB 3PJ5A 3SVNA 2G16B 2LMTA 4W6JA 1QVIZ 5AEQA 5HKWA 2M0RA 3OSQA 4W73A 2ZN8A 2AWJA 4FTGA 3H4SE 1XAEA 4EDSA 4I2YA 1Z1PA 4Q9XA 3O6BA 4C0LA 2HFCA 3VHTA 5JOLA 4JWQA 4W7FA 3BXKA 1GGZA 2ZFDA 1RJVA 2BL0C 2LVKA 4J89A 1Q4DA 1A03A 4Q04A 2VAEA 1EMKA 1KYSA 1YX8A 4OCIA 2WCBA 3DVJA 3CFAA 4MRXA 1W7IB 4OY4A 3DQNA 1NCZA 5AANA 2B1UA 2LV7A 4ZIOA 3SS0A 1TOPA 1K9KA 1Y1AA 5DTLA 4B5YA 2MBXA 3DF0A 4W7RA 1ALVA 3EVVA 1CDNA 1C7VA 2JXLA 4HREE 3OGOA 2IOVA 4XJKA 3DPWA 4EN1A 4Q7UA 1NSHA 3CGAA 4ZB1A 2D8NA 5CSJA 3E3RA 3S05A 2JNFA 2Q6PA 2WCEA 4HSZA 3W1CA 5ER5A 1XO5A 1WRLA 3IQOA 2KGBC 4UTSA 5EXBA 3DD4A 2FCDA 3ZTFA 2NLNA 1M39A 2Z6YA 1IWQA 2K7OA 2H9WA 1QYQA 2QLHA 1EMMA 1FPWA 2Q57A 1PSBA 1G4YR 3DQMA 2WHSA 4XVPA 3NSIA 5PALA 2GV5A 2K7CA 4FQOA 4A4CA 2HETA 4OR9B 2DDDA 2SASA 3SG5A 1OQPA 5DQBA 4W6HA 4W6TA 2FL1A 1XK4C 3KEVA 3VGOA 1KSOA 1WRZA 4PDZA 1SMGA 1Q4EA 4RYSA 4KA9A 5EBJA 2L4HA 2LUCA 1ZGQA 5EJUA 2V4EC 1UHJA 4H3MA 3DQJA 5BTTA 2G3DB 2JNXA 2ARLA 4ZF3A 2LUXA 2I2RE 5HZSA 3AAJA 3KCSA 4CIDA 3SSYA 3RM1A 3I5IC 1FBVA 2AAOA 1SRAA 1KK7Z 4L13A 3CLNA 4TZGA 1MXLC 3E5TA 1K94A 2HGYA 3DQ5A 1BODA 2KFGA 2MA2A 3NF0A 1YRUB 3CFHA 4PPJA 1KK8C 3D0YB 4PE0A 3H1OA 5DPGA 1LINA 5CSIA 2F3ZA 4W77A 4C0KA 1QATA 1CM1A 4DIRA 1H4UA 1SCMB 3HCMA 5H88A 2M49B 2H6VA 3I5GB 1G33A 1RTP1 1AHRA 2CXJA 1XFZO 1DJIA 4JC2A 1RMMA 3NSLA 1SYMA 2O24A 1YJ2A 3UG0A 1BFPA 5BT0A 1MF8B 5T3IA 4UPGA 1B7TY 2GX2A 4KF5A 3RWTA 1KYPA 3VHTB 3GB3A 5LK4A 4W6NA 1G7KA 4AR7A 3AKOA 3DQEA 2A52B 3UFZA 3O77A 1LXFC 4CFQA 1QYFA 2M97A 2A50B 3LA1A 4YI8A 1HUYA 1IG5A 3OX5A 1WLMA 1KWOC 4I5LB 1XQMA 1DT7B 2Z1OA 5HBDA 1B9AA 2H2KA 3TUYB 4ZFSA 2LANA 1YR5A 4PALA 3DF0B 2A53B 4MZLA 3DVKA 2IB6A 2JQ6A 2L98A 2BCBA 2WHTA 2VADA 2VVHA 1K96A 3LLEA 2HPWA 1FW4A 1KYRA 1ZUXA 2BKHB 2OGRA 4YGEB 5EB6A 1KCYA 4QJ4B 4IK9A 1CFFA 1RM9A 2H61C 3CR4X 1SK6D 2YE0A 2RGIA 1OZSA 2WIQA 1A75A 5G08A 3K21A 2QRFA 1J1DA 1YHGA 3SVOA 2VRGA 4B30A 4M2OA 1BJFA 1RRXA 1DJXA 1OXDA 1F54A 1BF5A 2LLUA 3DQ7A 4YRUA 4W7DA 2VVJA 2QACA 2K7DA 3DQ4A 1S5GY 2ZNEA 1M63B 1OOJA 3NT9A 1K9PA 2EMOA 2M8UA 4Q9WA 2KI4C 1BMOA 3GEXA 1TNWA 2V53A 1NX0A 2OTGC 4DRWA 1JFKA 2I94A 4W75A 3QRXA 3A8SA 3I5HB 3ZUFA 1SL7A 2LP3A 4JEOA 1KQMB 1CM4A 2Z6ZA 3U8AA 1MUXA 1YX7A 3BUOB 5DKNA 5HZTA 2L2EA 2HGDA 2P4MA 2JTZA 1EH2A 1YUSA 5FVGA 1NIWA 1RMPA 3SVCA 2M7LA 3LVCA 3GOFA 1F55A 1IH0A 1YVLA 1CNPA 1DVIA 1QS7A 5H87A 4IK5A 2KI6D 3DVMA 3IR8A 3KF9A 2GW3A 2E30A 3M0WA 2FOTA 4P76A 1K2HA 3DPZA 2ZNDA 5DTXA 4AOMA 1C4FA 4GGNA 1UISA 1LA0A 1XK4A 2L4IA 1FF1A 4PHMA 1F71A 1ALWA 1F8HA 4JGEA 2BECA 3SVRA 5FYXA 3OX6A 2LAPA 3CTNA 4LJCA 3LK1A 3BOWA 2QLIA 3GK1A 2ZN9A 1LVCD 2KAXA 4JRBA 3P8UA 3M22A 5BPJA 1CLLA 3U0NA 4MZJA 4LJDA 2YDZA 2Y4QA 1OSAA 3TZ1A 2QLGA 5DKQA 2DD9A 4DS7A 1XFUO 2OPOA 3FIAA 2JTTA 2KYFA 3D0YA 4NDCA 4IK8A 2HQZA 2LHIA 3TS5C 4I5JA 1WDCB 4IK3A 1L2OC 2MAZA 4YGDB 3AI5A 4R6DA 3AKAA 4WRIA 3U8CA 1QTXA 1Y0VH 3PATA 2PSRA 3SV5A 1XSSA 3PJBA 2C9IA 4N3DA 3PFVA 5D7FA 2CCMA 3SIBA 2ZKMX 2IB5A 4MN0A 1VRKA 3GK4X 3P28A 1OXEA 3LVDA 1NCXA 2BBMA 2K2FA 4JPZB 3SVUA 3DQOA 1OMDA 2WCFA 4ORCB 1JBZA 4I5KA 1H4BA 2FWQA 1YURA 4DXQA 1NX1A 5KTGA 1IKUA 4ETOA 5CSNA 2JXCA 2WSNA 3DQ1A 2MHHA 2BKIB 3JVTC 5DRFA 3CD1A 4ICBA 1YHHA 3RLZA 2M1KB 2BL0B 1A75B 4D1EA 1XFVO 3BYAA 4OV2A 2KFHA 3DQ9A 4B30B 1X02A 3ST4A 4W6OA 4Z4KA 1JSAA 2OKYA 1XFYO 3WXAA 3AKBA 1CFPA 3CR5X 2PMYA 5I8NA 3DQDA 1NWDA 1K9UA 3LK0A 2ZO6A 2M3WA 1CDPA 2F33A 1S36A 2WHUA 5HW9A 1BR1B 1AJ4A 5DRGA 1IQ5A 1F4QA 4KPIA 1SR6C 2JWWA 4OKHA 4L12A 3SSHA 1CKKA 4AQJA 3AAKA 1UWOA 2JZIA 4N1GA 2WORA 2G6YA 1EMGA 4OGSA 3MSEB 2Y0GA 4ANJA 4W6MA 1PRWA 1NX2A 1G8IA 4P5OE 1A2XA 4U8DA 1MHOA 2O2BA 2OJKA 2KQ6A 1XYDA 3SG6A 1DJGA 3LF3A 3O2PA 3TDZA 1W7SA 4W6BA 1Y6WA 1E8AA 1GGXA 1YVHA 1ZUZA 4KGEA 1JUOA 5I2OA 5KU1A 4ZCUA 2Y5IA 3DQKA 4GUKA 1J7OA 3EK8A 1QXTA 1EJ3A 2ZRTA 4PHNA 3KHEA 4W6RA 1NUBA 1IJ6A 1K95A 4KW9A 1L7ZA 3BOWB 1QV0A 3SG2A 3CWGA 5LTRA 3BUWB 1U5IB 4BDUA 1JF2A 1V1GA 4W6FA 2BCAA 3A4UB 3NXAA 2KQYA 4WQ3A 1JFJA 1QASA 3SSPA 3SG3A 3DQCA 1BT6A 2QLGB 5K89A 4CFRA 2MLFC 2LVVA 4NDBA 2A4JA 1BOCA 3VRNA 2AH8A 2KAVA 5F6TA 1TRFA 1Q4BA 3H1RA 1TCFA 4HRHA 1QVIY 3SSKA 1PK0D 3GJ2A 3IP2A 3JTDC 1KK8B 2ZMUA 4BY5A 1KFXS 2QT2A 1EMEA 2AHAA 3BQ3A 2AMIA 4HVFA 1Q80A 3ZWHA 2I18A 1TN4A 1KP5A 3U0MA 4JF9A 1Y1UA 3ST2A 3WHUB 1FI6A 2Q91A 3ST0A 2LC5A 2OS8C 4Q7RA 4H48A 3ED8A 2TN4A 1GQMA 1B1GA 2M1UA 4WQ2A 5B8IB 5J3XA 3FWBA 1ZOTB 1XA5A 2LMVA 1KFUL 2R2IA 1B4CA 2G6EA 3BUMB 1CLMA 2M7NA 4EMQA 1EL4A 2LLSA 1SL9A 3NSOA 4CLNA 1A29A 1S26D 3CZTX 1SBJA 4R1EA 4JFGA 4PE1A 1RWYA 2G5ZB 1NYAA 1M45A 1B8LA 1IQ3A 2Q4UA 5D69A 5DTZA 1KWOB 1DF0A 2KNEA 1CMFA 3DQUA 2ISDA 1RMOA 1S1EA 1UP5A 4KGFA 2KFFA 1JC1A 1B47A 3DQLA 1PVAA 5LTPA 4H3LA 1QX7A 1ZACA 1UHHA 2H5QA 4GNKB 5EXUA 5LTQA 1YRTB 1J7RA 1K93D 2F8PA 1HT9A 1TCOB 2DUIA 4E68A 2LCPA 4ORNA 3EKHA 2OTBA 1QLSA 4OVNF 4OJ0A 2NCPA 3PLFB 2HQKA 5DPIA 2JULA 3EVRA 3SG7A 2SCPA 1EMBA 5ER4X 1MQ1A 2MRDA 2LVIA 2G2SB 4W76A 3VK1A 2QPTA 2LP2A 1J1EA 1XFWO 4W6GA 2G2BA 2PXWA 5TNCA 1ZGPA 3CBEA 4DXMA 5DY6A 5FVFA 2DOQA 2EC6B 4XGYA 1DTLA 1M46A 2AWKA 3IF7A 1B9CA 1ZMZA 3O78A 2MJWB 5HGEA 3I5HC 3FWCA 5DPHA 1RK9A 1SL8A 3RWAA 2KI4B 4Z4MA 3U0LA 4IL1A 1YUTA 4OHSA 4NDDA 1GJYA 5JJGA 2OTGB 1WY9A 3SJSA 2ZMWA 4HQ8A 2NZ0A 1EMCA 1XMZA 1JC2A 3PM8A 2HCGA 1NCYA 2VVIA 3BXCA 3NT3A 2O29A 1W7JB 3W1DA 1XA9A 1J7PA 2MLEC 2DD7A 3M24A 3WHTB 2CNPA 2B3PA 4J8AA 2I7AA 3LCPC 3PSRA 4M2QA 1ZFSA 4LQUA 1DJWA 2V4EA 5FHVA 4W6KA 2YFPA 4DKNA 3LVAA 3BXBA 3MGFA 2KHNA 2AWLA 1U5IA 1QV1A 5EB7A 1JWDA 2HRSA 4GOBA 1MWNA 2JPTA 1OMVA 5AERA 1C7WA 3ST3A 4MBEA 4HQ9A 4KF5C 1CTRA 1EMAA 5EHUA 4MZKA 2YE1A 5HZOA 1QYOA 3I5FB 1NP8A 1NX3A 1F09A 4GESB 2EMDA 5GQQC 2HPSA 3TDUA 1OXFA 1EMFA 1R2UA 2CT9A 3D10A 3OSRA 1RECA 4PPLA 5HZUA 4DXPA 2H8QA 1QY3A 2QLEA 3TS5B 2KGRA 4NQGA 1QIWA 1L2OB 1YUUA 1SKTA 3E5VA 3NEZA 1CFCA 2B3QA 3U8PA 4DXNA 3CR2A 4NWSA 1DF0B 1PALA 3LF4B 1TTXA 4R6BA 2WSOA 2F2PA 3PN7B 4L1IA 4PHKA 1LA3A 4DKMA 4ZF5A 5H89A 3FS7A 3OB2B 1BG1A 1RFJA 1BU3A 3E5WA 2L5XB 3PJ7A 2HQ8A 5I2QA 1XFXO 1FI5A 4C0JA 2EHBA 1H8BA 3WCKA 4LW5A 1UURA 1S6JA 2PVBA 2IE2A 2K7BA 2WOSA 4W72A 2JT0A 4PFEA 2EGDA 4XOVA 2K0JA 4KEXA 2WURA 4W6SA 1MOVA 2LM5A 4MEWA 1WRKA 3A8RA 4W7CA 3ZUJA 4PCWA 2L50A 4TNCA 2HQWA 4GBAA 2F3YA 1B7TZ 1UHIA 2A48A 4RYWA 2JRFA 3JVTB 1SPYA 5HKZA 4W7AA 2JU0A 3NSKA 1DGVA 2VZXA 1PSRA 2KI6C 1YHIA 4ZF4A 2Z6XA 5J2OA 1MXEA 5CPVA 4YBHB 4F0ZB 1A4PA 1MR8A 1MYWA 4W7XA 4XL5A 1XVJA 3DQAA 2JOJA 1CB1A 1BR4B 2H5PA 2WNDA 2RH7A 4YGBB 2BCXA 2DDCA 1SR6B 4A4BA 2H61A 3EK4A 5EXCI 2PRUA 2WC8A 1JC0A 3TMRA 1LKJA 2CTNA 1SCVA 3ZNIA 3EVUA 1F70A 5KSZA 2GGMA 4QJ5B 4U2VA 1WLZA 3K1KA 1S6IA 5AXIA 2M9GA 4W6PA 1YFPA 3SVSA 4EULA 3VRRA 3BX9A 2AUCA 3ICBA 1K90D 1AVSA 2DUFA 2BE4A 4YGAA 2KBIA 2G9BA 5AFPA 2V4EB 1S5GZ 2P6BB 1CV7A 2LE9B 2FZUA 4W6LA 2KDHA 1IJ5A 1GFLA 4W7EA 4GGFC 2LHLA 1DJYA 4LJDC 3C1VA 3EK7A 3I5IB 1Q73A 1Q4AA 1ODBA 2PALA 1UHNA 5HLVA 4GFTA 4N1FA 4GF6B 2KAYA 2BBNA 1Q4CA 3VRPA 3G9AA 1SCMC 4USLA 2G3OA 2LMUA 1F4OA 4KF4A 4KW8A 3DQ6A 3I5GC 3WLCA 2GGZA 5DPJA 1CDMA 4KW4A 5HKYA 2OTEA 1N2DA 1GGWA 3DQ8A 1RROA 1CLBA 4ZCVA 2JC2A 1R6PA 1N65A 4DUQA 3VROA 3JTDB 5DTYA 5HYDA 2O5GA 5DU0A 3NEDA 2Y1NA 3DQ2A 3TMTA 1J7QA 1EG4A 1KFUS 2FJUB 4KAGA 1KFXL 1B8CA 2H5OA 1QLKA 3O4YA 2Y1MA 4DCKA 1JBAA 2KBMA 3SSLA 3WNXB 1JF0A 3DQ3A 1AJ5A 3DQIA 1TNPA 2OS8B 3DQFA 3VRQA 3CGLA 1KSMA 4YGCB 3BUXB 3GK2A 2EMNA 3TUYC 2K8MB 1PVBA 2A46A 1DJZA 1EXRA 4AS8A 4MLWA 1CMGA 3SRYA 2KYCA 4ZBLA 3SSTA 2A56B 3I19A 4TZAA 2E6WA 3KCTA 2ZO7A 4GAOA 1BLQA 4W6CA 3CB9A 2HF5A 1PULA 4BY4A 1J55A 1YJFA 3CS1A 2ICRA 1AUIB 4XJKB 1TIZA 3LSAA 2PASA 4H3NA 4W6AA 4ZINA 1GL4A 2O60A 2G6XA 5DQMA 2LNKA 5IBWA 1S6ZA 1CDLA 4MRYA 4MSPA 1QX5B 2JT3A 3SVBA 1TNQA 4MVFA 3KO0A 4L9MA 2WISA 2NCOA 4W6IA 5I2LA 4XOWA 2A54B 4H47A 1HCJA 1DGUA 2GX0A 2QU1A 2JT8A 3EKJA 4W6UA 2L0PA 2NXQA 1NPQA 2DUHA 2OKWA 4OQWA 2BTJA 3HX4A 2C9JA 3WLDA 2COLB 2CBLA 5DKRA 4W6DA 4PPKA 4DXIA 3PIBA 2EC6C 3GL4A 5F9GA 3OB1B 2KOTA 2KSPA 3CFFA 1QXPA 1W7TA 2POXA 2LVJA 2LLTA 2ZRSA 4M2PA 1H6RA 1KK7Y 4QJ3B 1Z1QA 4JQ0D 1OE9B 2DUEA 2PXSA 1DMOA 4Q7TA 1KQMC 4XYNA 2BE6A 4ORBB 2H5RA 1S3PA 1C07A 2K2AA 1UUSA 2AWMA 5BTTB 3DVEA 1KQVA 2HJOA 1AP4A 5KTYA 4RTCA 1JBYA 4AQIA 3SG4A 1YZWA 3U0KA 4LJBA 4GPLB 2M29A 4I5NB 4YI9A 1TNXA 3BXAA 3LL8B 3VICA 4ORAB 3GJ1A 4W69A 1QX2A 5BQLA 4HE4A 4PE7A 3BUNB 3ZULA 3SSVA 4EDOA 2QZ0A 2JADA 1OMRA 1SNLA 4DXOA 1OZOA 3PALA 1N0YA 3OP0A 4P2YB 4PHJA 3DQHA 2L51A 1DJHA 1V1FA 1SW8A 1S6CA 4PE4A 1QIVA 1EMLA 1W7UA 1Y1XA 4IK1A 5FVIA 3AI4A 1YTZC 1D1OA 4IZNA 1IRJA 3DPXA 3IQQA 3KPXA 3TDIA 4CPVA 4W74A 3SVEA 3F45A 2DUGA 4IK4A 3LS3A 1SY9A 4P1QA 3SIAA 2A47A 3I5FC 4J88A 4LQTA 4GGFA 5HLOA 1WDCC 2GW4B 1CFDA 2F2OA 3SVDA 1F0BA 1IGVA 1UHKA 1B8RA 2FCEA 1ZGOA
chains in the Genus database with same CATH superfamily
1M31A 4HQCA 3ADFA 1EG3A 1QJTA 1HQVA 2K61A 3B87A 5CSFA 1MOUA 3EVPA 1K8UA 3CD9A 5AQBB 3PN7C 4HRGA 4N5XA 3V3DA 1AK8A 2IS9A 3OHMB 3PJ5A 3SVNA 2G16B 2LMTA 4W6JA 1QVIZ 5AEQA 5HKWA 2M0RA 3OSQA 4W73A 2ZN8A 2AWJA 4FTGA 3H4SE 1XAEA 4EDSA 4I2YA 1Z1PA 4Q9XA 3O6BA 4C0LA 2HFCA 3VHTA 5JOLA 4JWQA 4W7FA 3BXKA 1GGZA 2ZFDA 1RJVA 2BL0C 2LVKA 4J89A 1Q4DA 1A03A 4Q04A 2VAEA 2PQLA 1KYSA 1EMKA 3D76A 1YX8A 4OCIA 2WCBA 3DVJA 3CFAA 4MRXA 1W7IB 1C3ZA 4OY4A 3DQNA 1NCZA 5AANA 2B1UA 2LV7A 4ZIOA 3SS0A 1TOPA 1K9KA 1Y1AA 5DTLA 4B5YA 2MBXA 3PM2A 3DF0A 4W7RA 1ALVA 3EVVA 1CDNA 1C7VA 2JXLA 4HREE 3OGOA 2IOVA 4XJKA 3DPWA 2FJYA 4EN1A 4Q7UA 1NSHA 3CGAA 4ZB1A 2D8NA 5CSJA 3E3RA 3S05A 1P28A 2JNFA 2Q6PA 2WCEA 4HSZA 3W1CA 5ER5A 1XO5A 1WRLA 3IQOA 2KGBC 4UTSA 5EXBA 3DD4A 2FCDA 3ZTFA 2NLNA 1M39A 2Z6YA 1LS8A 1IWQA 2K7OA 2H9WA 1QYQA 2QLHA 1EMMA 1FPWA 2Q57A 1PSBA 3R1PA 1G4YR 3DQMA 2WHSA 4XVPA 3NSIA 5PALA 2GV5A 2K7CA 4FQOA 3OGNA 4A4CA 2HETA 4OR9B 2DDDA 2SASA 3SG5A 1OOGA 1OQPA 5DQBA 4W6HA 4W6TA 2YGUA 2FL1A 1XK4C 3KEVA 3VGOA 1KSOA 1WRZA 4PDZA 1SMGA 1Q4EA 3CZ0A 4RYSA 4KA9A 5EBJA 3R1VA 2L4HA 2LUCA 1ZGQA 5EJUA 2V4EC 1UHJA 4H3MA 3DQJA 5BTTA 2G3DB 2JNXA 2ARLA 4ZF3A 2LUXA 2I2RE 5HZSA 3AAJA 3KCSA 4CIDA 3SSYA 3RM1A 3I5IC 1FBVA 2AAOA 1SRAA 1KK7Z 4L13A 3CLNA 4TZGA 1MXLC 3E5TA 1K94A 2HGYA 3DQ5A 1BODA 2KFGA 2MA2A 3NF0A 2KPHA 1YRUB 3CFHA 2WCMA 4PPJA 1KK8C 3D0YB 4PE0A 3H1OA 5DPGA 1LINA 5CSIA 2F3ZA 4W77A 4C0KA 1QATA 1CM1A 4DIRA 1H4UA 1SCMB 3HCMA 5H88A 2M49B 2H6VA 3I5GB 1G33A 1RTP1 1AHRA 3PJIA 2CXJA 1XFZO 1DJIA 3B6XA 4JC2A 1RMMA 3NSLA 1SYMA 3DYEA 2O24A 1YJ2A 3UG0A 1BFPA 5BT0A 1MF8B 5T3IA 3BJHA 4UPGA 1B7TY 2GX2A 4KF5A 3RWTA 1KYPA 3VHTB 2WCHA 3GB3A 5LK4A 4W6NA 1G7KA 4AR7A 3AKOA 3DQEA 2A52B 3UFZA 3O77A 1LXFC 4CFQA 1QYFA 3N7HA 3K1EA 2M97A 2A50B 3LA1A 4YI8A 1HUYA 1IG5A 3OX5A 1WLMA 1KWOC 4I5LB 3D78A 1XQMA 1DT7B 2Z1OA 5HBDA 1B9AA 2H2KA 3TUYB 4ZFSA 2LANA 1YR5A 2BAPA 4PALA 3DF0B 2A53B 4MZLA 3DVKA 2IB6A 2JQ6A 2L98A 2BCBA 2WHTA 3NHIA 2VADA 2VVHA 1K96A 3LLEA 2HPWA 1FW4A 1KYRA 1ZUXA 2BKHB 2OGRA 4YGEB 5EB6A 1KCYA 4QJ4B 4IK9A 1CFFA 1RM9A 2H61C 2WCKA 3CR4X 1SK6D 2YE0A 2RGIA 1OZSA 2WIQA 1A75A 5G08A 3K21A 3CZ1A 1J1DA 1YHGA 2QRFA 3SVOA 2VRGA 4B30A 4M2OA 1BJFA 1RRXA 1DJXA 1OXDA 1F54A 1BF5A 2LLUA 3DQ7A 4YRUA 4W7DA 2VVJA 2QACA 2K7DA 3DQ4A 1S5GY 2ZNEA 1M63B 1OOJA 3NT9A 1K9PA 4FQTA 3BFBA 2EMOA 1OOHA 2M8UA 2KI4C 4Q9WA 1BMOA 3GEXA 1TNWA 2V53A 1NX0A 2OTGC 4DRWA 1JFKA 2I94A 4W75A 3QRXA 3A8SA 3I5HB 3ZUFA 1SL7A 2LP3A 4JEOA 1KQMB 1CM4A 3B7AA 2H8VA 2Z6ZA 3U8AA 1MUXA 1YX7A 2KLEA 3BUOB 5DKNA 5HZTA 2L2EA 2HGDA 2P4MA 2JTZA 1EH2A 1YUSA 5FVGA 1NIWA 1RMPA 3SVCA 2M7LA 3LVCA 3GOFA 1F55A 1TWOA 1IH0A 1YVLA 1CNPA 1DVIA 1QS7A 4INXA 5H87A 4IK5A 3VB1A 2KI6D 3DVMA 3IR8A 3KF9A 2GW3A 2E30A 3M0WA 2FOTA 4P76A 1K2HA 3DPZA 2ZNDA 5DTXA 4AOMA 1C4FA 4GGNA 1UISA 1LA0A 1XK4A 2L4IA 1FF1A 4INWA 4PHMA 1F71A 1ALWA 1F8HA 4JGEA 2BECA 3SVRA 5FYXA 3OX6A 2LAPA 3CTNA 4LJCA 3LK1A 3BOWA 2QLIA 3FE8A 3GK1A 2ZN9A 1LVCD 2KAXA 4JRBA 3P8UA 3M22A 5BPJA 1CLLA 3U0NA 4MZJA 4LJDA 2YDZA 2Y4QA 1OSAA 3TZ1A 2QLGA 5DKQA 2DD9A 4DS7A 1XFUO 2OPOA 3FIAA 2JTTA 2KYFA 3D0YA 4NDCA 4IK8A 2HQZA 2LHIA 4KYNA 3TS5C 4I5JA 1WDCB 4IK3A 1L2OC 2MAZA 4YGDB 3AI5A 4R6DA 3AKAA 4WRIA 3U8CA 1QTXA 1Y0VH 3PATA 2PSRA 3SV5A 1XSSA 3PJBA 2C9IA 4N3DA 3PFVA 5D7FA 2CCMA 3SIBA 2ZKMX 2IB5A 4MN0A 1VRKA 3GK4X 3P28A 1OXEA 3LVDA 1NCXA 2BBMA 3RZSA 2K2FA 4JPZB 3SVUA 3DQOA 1OMDA 2WCFA 4ORCB 1JBZA 4I5KA 1H4BA 2FWQA 1YURA 4DXQA 1NX1A 2WCJA 5KTGA 1IKUA 4ETOA 5CSNA 2JXCA 2WSNA 3DQ1A 2MHHA 2BKIB 3JVTC 5DRFA 3CD1A 1DELA 4ICBA 1YHHA 3RLZA 2M1KB 2BL0B 1A75B 4D1EA 1XFVO 3BYAA 4OV2A 3UO9A 2KFHA 3DQ9A 4B30B 1X02A 3ST4A 4W6OA 5D3OA 4Z4KA 1JSAA 2OKYA 1XFYO 4JKTA 3WXAA 3AKBA 1CFPA 3S0DA 3CR5X 2PMYA 5I8NA 3DQDA 1DEKA 1NWDA 1K9UA 3LK0A 2ZO6A 2M3WA 1CDPA 2F33A 1S36A 2WHUA 5HW9A 1BR1B 2K60A 1AJ4A 5DRGA 1IQ5A 1F4QA 4KPIA 1SR6C 2JWWA 4OKHA 4L12A 3SSHA 1CKKA 4AQJA 3AAKA 1UWOA 2JZIA 4N1GA 2WORA 2G6YA 1EMGA 4OGSA 3R1OA 3MSEB 2Y0GA 4ANJA 4W6MA 1PRWA 1NX2A 1G8IA 4P5OE 1A2XA 4U8DA 1MHOA 2O2BA 2OJKA 2KQ6A 1XYDA 3SG6A 1DJGA 3CZ2A 3LF3A 3O2PA 3TDZA 1W7SA 4W6BA 1Y6WA 1E8AA 1GGXA 1YVHA 1ZUZA 4KGEA 1JUOA 5I2OA 3NHTA 5KU1A 4ZCUA 2Y5IA 3DQKA 4GUKA 1J7OA 3EK8A 1QXTA 1EJ3A 2ZRTA 2WCLA 4PHNA 3KHEA 4W6RA 1NUBA 1IJ6A 1K95A 4KW9A 1L7ZA 3BOWB 1QV0A 3SG2A 3CWGA 5LTRA 3BUWB 1U5IB 4BDUA 1JF2A 1V1GA 4W6FA 2BCAA 3A4UB 1DQEA 3NXAA 2KQYA 4WQ3A 2P71A 1JFJA 1QASA 3SSPA 1TUZA 3SG3A 3NGVA 3DQCA 1ORGA 1BT6A 1OOIX 2QLGB 5K89A 4CFRA 2MLFC 2LVVA 4NDBA 2A4JA 1BOCA 3VRNA 2AH8A 2KAVA 5F6TA 1TRFA 1Q4BA 3H1RA 1TCFA 4HRHA 1QVIY 2L5YA 3SSKA 1PK0D 3O4XA 3GJ2A 3EG5B 3IP2A 3JTDC 1KK8B 2ZMUA 4BY5A 1Z2CB 1KFXS 2QT2A 1EMEA 2AHAA 3BQ3A 2AMIA 4HVFA 1Q80A 3ZWHA 2I18A 1TN4A 1KP5A 3U0MA 4JF9A 1Y1UA 3ST2A 3WHUB 1FI6A 2Q91A 3ST0A 2LC5A 2OS8C 3BFHA 4Q7RA 4H48A 3D73A 3ED8A 2TN4A 1GQMA 1B1GA 2M1UA 4WQ2A 5B8IB 5J3XA 3FWBA 1ZOTB 1XA5A 2LMVA 1KFUL 2R2IA 2WC6A 1B4CA 2G6EA 1XFRA 3BUMB 1CLMA 2M7NA 4EMQA 1W9ZA 1EL4A 2LLSA 1SL9A 3B88A 3NSOA 4CLNA 1A29A 1S26D 3CZTX 1SBJA 4R1EA 4JFGA 4PE1A 1RWYA 2G5ZB 1NYAA 1M45A 1B8LA 1IQ3A 3S0EA 2Q4UA 5D69A 5DTZA 1KWOB 1DF0A 2KNEA 1CMFA 3DQUA 2ISDA 1RMOA 1S1EA 1UP5A 4KGFA 2KFFA 1JC1A 1B47A 3DQLA 1PVAA 5LTPA 3UNWA 4H3LA 1QX7A 1ZACA 1UHHA 2H5QA 3S0GA 4GNKB 5EXUA 5LTQA 1YRTB 1J7RA 1K93D 2F8PA 1HT9A 1TCOB 2DUIA 4E68A 1Z4HA 2LCPA 4ORNA 3EKHA 2OTBA 1QLSA 4OVNF 4PT1A 4OJ0A 2NCPA 3PLFB 2HQKA 5DPIA 2JULA 3EVRA 3SG7A 2SCPA 1EMBA 5ER4X 1MQ1A 2MRDA 2L2CA 2LVIA 2G2SB 4W76A 3VK1A 2QEOA 2QPTA 2LP2A 1J1EA 1XFWO 4W6GA 2G2BA 2PXWA 2WC5A 5TNCA 1ZGPA 3CBEA 4DXMA 5DY6A 5FVFA 2DOQA 2EC6B 3D74A 4XGYA 1DTLA 1M46A 2AWKA 3IF7A 1OOFA 1B9CA 1ZMZA 5HL1A 3O78A 2MJWB 5HGEA 3Q8IA 3I5HC 3FWCA 5DPHA 3B86A 1RK9A 1SL8A 3RWAA 2KI4B 4Z4MA 3U0LA 4IL1A 1YUTA 4OHSA 4NDDA 1GJYA 5JJGA 2OTGB 1WY9A 3SJSA 2ZMWA 4HQ8A 2NZ0A 1EMCA 1XMZA 1JC2A 3PM8A 2HCGA 1NCYA 2VVIA 3BXCA 1OW4A 3NT3A 2O29A 1W7JB 2QEHA 3W1DA 1XA9A 1J7PA 2MLEC 2DD7A 2ERBA 3M24A 3WHTB 2CNPA 3S0AA 2B3PA 4J8AA 2I7AA 3LCPC 3PSRA 4M2QA 1ZFSA 4LQUA 1DJWA 2V4EA 5FHVA 3L4AA 4W6KA 2YFPA 4DKNA 3LVAA 3BXBA 3MGFA 2KHNA 2AWLA 1U5IA 1QV1A 5EB7A 3S0FA 1JWDA 2HRSA 5FI6A 4GOBA 1MWNA 2JPTA 5I94A 1OMVA 5AERA 1C7WA 3ST3A 4MBEA 4HQ9A 2BNXA 4KF5C 1CTRA 1EMAA 5EHUA 4MZKA 2YE1A 5HZOA 1QYOA 5FI2A 3I5FB 1NP8A 3FE9A 1NX3A 1F09A 4GESB 2EMDA 5GQQC 2HPSA 3TDUA 1OXFA 1EMFA 1R2UA 5EL2A 2CT9A 3D10A 3OSRA 1RECA 4PPLA 5HZUA 4DXPA 2H8QA 1QY3A 2QLEA 3TS5B 2KGRA 4NQGA 1QIWA 1L2OB 1YUUA 1SKTA 3E5VA 3NEZA 1CFCA 5DICA 2B3QA 3U8PA 4DXNA 3CR2A 4NWSA 4F7FA 1DF0B 1PALA 3LF4B 1TTXA 2WSOA 4R6BA 2F2PA 3PN7B 4L1IA 4PHKA 1LA3A 4DKMA 4ZF5A 5H89A 3FS7A 3OB2B 1BG1A 3E5WA 1RFJA 1BU3A 2L5XB 2HQ8A 3PJ7A 5I2QA 1XFXO 1FI5A 4C0JA 2EHBA 1H8BA 3WCKA 4LW5A 1UURA 1S6JA 2PVBA 2IE2A 2K7BA 2WOSA 4W72A 1TUJA 2JT0A 4PFEA 2EGDA 4XOVA 2K0JA 4KEXA 2WURA 4W6SA 1MOVA 2LM5A 4MEWA 1WRKA 3A8RA 4W7CA 3ZUJA 4PCWA 2L50A 4TNCA 2HQWA 4GBAA 2F3YA 1B7TZ 1UHIA 2A48A 4RYWA 2JRFA 3JVTB 1SPYA 5HKZA 4W7AA 2JU0A 3NSKA 1DGVA 3SS5A 2VZXA 1PSRA 2KI6C 1YHIA 4ZF4A 3L4LA 2Z6XA 5J2OA 1MXEA 2JPOA 5CPVA 4YBHB 4F0ZB 1A4PA 1MR8A 1C3YA 1MYWA 4W7XA 4XL5A 1XVJA 3DQAA 2JOJA 1CB1A 1BR4B 2H5PA 2WNDA 2RH7A 4YGBB 2BCXA 2DDCA 1SR6B 4A4BA 2H61A 3EK4A 5EXCI 2PRUA 2WC8A 1JC0A 3TMRA 1LKJA 2CTNA 3D77A 1SCVA 3ZNIA 3EVUA 1F70A 5KSZA 2GGMA 4QJ5B 4U2VA 1WLZA 1GM0A 3K1KA 1S6IA 5FI7A 5AXIA 2M9GA 4W6PA 1YFPA 3SVSA 4EULA 3R72A 3VRRA 3BX9A 2AUCA 3ICBA 1K90D 1AVSA 2DUFA 2BE4A 4YGAA 2KBIA 2G9BA 5AFPA 3OBVA 2V4EB 1S5GZ 2P6BB 3DY9A 1CV7A 2LE9B 2FZUA 4W6LA 2KDHA 1IJ5A 1GFLA 4W7EA 4GGFC 2LHLA 1DJYA 4LJDC 2P70A 3C1VA 3EK7A 3IVTA 3I5IB 1Q73A 2QEVA 1Q4AA 1ODBA 2PALA 1UHNA 3CABA 5HLVA 2KLDA 3FE6A 4GFTA 4N1FA 4GF6B 2KAYA 2BBNA 1Q4CA 3QMEA 3VRPA 3G9AA 1SCMC 4USLA 2G3OA 3DZTA 2LMUA 1F4OA 1T14A 4KF4A 4KW8A 3DQ6A 3I5GC 3WLCA 2GGZA 5DPJA 1CDMA 4KW4A 5HKYA 2OTEA 1N2DA 1GGWA 3DQ8A 1RROA 1CLBA 4ZCVA 2JC2A 1R6PA 1N65A 4DUQA 3VROA 3JTDB 5DTYA 5HYDA 2O5GA 5DU0A 3NEDA 2Y1NA 3DQ2A 3TMTA 1J7QA 1EG4A 1KFUS 2FJUB 4KAGA 1KFXL 1B8CA 2H5OA 1QLKA 3O4YA 2Y1MA 4DCKA 1JBAA 2KBMA 3SSLA 3DQ3A 1JF0A 3WNXB 1AJ5A 3DQIA 1TNPA 2OS8B 3DQFA 3VRQA 3CGLA 1KSMA 4YGCB 3BUXB 3GK2A 2EMNA 3TUYC 2K8MB 1PVBA 2A46A 1DJZA 1EXRA 4AS8A 4MLWA 1CMGA 3SRYA 2KYCA 4ZBLA 3SSTA 2A56B 3I19A 4TZAA 2E6WA 3KCTA 2ZO7A 3SS3A 4GAOA 1BLQA 4W6CA 3CB9A 2HF5A 1PULA 4BY4A 1J55A 1YJFA 3CYZA 3CS1A 2ICRA 1AUIB 4XJKB 1TIZA 3LSAA 2PASA 4H3NA 4W6AA 4ZINA 1GL4A 2O60A 2G6XA 4OZDA 5DQMA 2LNKA 5IBWA 1S6ZA 1CDLA 3V2LA 4MRYA 4MSPA 1QX5B 2JT3A 3SVBA 1TNQA 3SS4A 4MVFA 3KO0A 4L9MA 2WISA 2NCOA 4W6IA 5I2LA 1QWVA 4XOWA 2A54B 4H47A 1HCJA 1DGUA 2GX0A 2QU1A 2JT8A 3EKJA 4W6UA 2GTEA 2L0PA 2NXQA 1NPQA 2DUHA 2OKWA 4OQWA 2BTJA 3HX4A 2C9JA 3WLDA 4JD9A 2COLB 2CBLA 5DKRA 4W6DA 4PPKA 4DXIA 3PIBA 2EC6C 3GL4A 5F9GA 3OB1B 2KOTA 2KSPA 3CFFA 1QXPA 1W7TA 2POXA 2LVJA 2LLTA 2ZRSA 4M2PA 1H6RA 1KK7Y 4QJ3B 1Z1QA 4JQ0D 1OE9B 2DUEA 2PXSA 1DMOA 4Q7TA 1KQMC 4XYNA 2QEBA 2BE6A 4ORBB 2H5RA 1S3PA 1C07A 2K2AA 1UUSA 2AWMA 5BTTB 3DVEA 1KQVA 2HJOA 1AP4A 5KTYA 4RTCA 1JBYA 4AQIA 3SG4A 1YZWA 2PYQA 3U0KA 4LJBA 4GPLB 3DXLA 2M29A 4I5NB 4YI9A 3BFAA 1TNXA 3BXAA 3LL8B 3VICA 4ORAB 3GJ1A 4W69A 1QX2A 5BQLA 4HE4A 4PE7A 3BUNB 3ZULA 3SSVA 4EDOA 2QZ0A 2JADA 1OMRA 1SNLA 3S0BA 4DXOA 1OZOA 3D75A 3PALA 1N0YA 3OP0A 4P2YB 4PHJA 3DQHA 2L51A 1IIOA 1DJHA 1V1FA 1SW8A 1S6CA 4IJ7A 4PE4A 1QIVA 1EMLA 1W7UA 1Y1XA 4IK1A 5FVIA 3AI4A 1YTZC 1D1OA 4IZNA 1IRJA 3DPXA 3IQQA 3KPXA 3TDIA 4CPVA 3CDNA 4W74A 3SVEA 3F45A 2DUGA 4IK4A 3LS3A 1SY9A 4P1QA 1SSEB 3SIAA 2A47A 3I5FC 4J88A 4LQTA 4GGFA 5HLOA 1WDCC 2QDIA 2GW4B 1CFDA 2F2OA 3SVDA 1F0BA 1IGVA 1UHKA 1B8RA 2FCEA 1DC1A 3L47A 1ZGOA
chains in the Genus database with same CATH topology
1M31A 4HQCA 3ADFA 1EG3A 1QJTA 1HQVA 2K61A 5CSFA 1MOUA 3EVPA 1K8UA 3CD9A 5AQBB 3PN7C 4HRGA 4N5XA 3V3DA 1AK8A 2IS9A 3OHMB 3PJ5A 3SVNA 2G16B 2LMTA 4W6JA 1QVIZ 5AEQA 5HKWA 2M0RA 3OSQA 4W73A 2ZN8A 2AWJA 4FTGA 3H4SE 1XAEA 4EDSA 4I2YA 1Z1PA 4Q9XA 3O6BA 4C0LA 2HFCA 3VHTA 5JOLA 4JWQA 4W7FA 3BXKA 1GGZA 2ZFDA 1RJVA 2BL0C 2LVKA 4J89A 1Q4DA 1A03A 4Q04A 2VAEA 1EMKA 1KYSA 1YX8A 4OCIA 2WCBA 3DVJA 3CFAA 4MRXA 1W7IB 4OY4A 3DQNA 1NCZA 5AANA 2B1UA 2LV7A 4ZIOA 3SS0A 1TOPA 1K9KA 1Y1AA 5DTLA 4B5YA 2MBXA 3DF0A 4W7RA 1ALVA 3EVVA 1CDNA 1C7VA 2JXLA 4HREE 3OGOA 2IOVA 4XJKA 3DPWA 4EN1A 4Q7UA 1NSHA 3CGAA 4ZB1A 2D8NA 5CSJA 3E3RA 3S05A 2JNFA 2Q6PA 2WCEA 4HSZA 3W1CA 5ER5A 1XO5A 1WRLA 3IQOA 2KGBC 4UTSA 5EXBA 3DD4A 2FCDA 3ZTFA 2NLNA 1M39A 2Z6YA 1IWQA 2K7OA 2H9WA 1QYQA 2QLHA 1EMMA 1FPWA 2Q57A 1PSBA 1G4YR 3DQMA 2WHSA 4XVPA 3NSIA 5PALA 2GV5A 2K7CA 4FQOA 4A4CA 2HETA 4OR9B 2DDDA 2SASA 3SG5A 1OQPA 5DQBA 4W6HA 4W6TA 2FL1A 1XK4C 3KEVA 3VGOA 1KSOA 1WRZA 4PDZA 1SMGA 1Q4EA 4RYSA 4KA9A 5EBJA 2L4HA 2LUCA 1ZGQA 5EJUA 2V4EC 1UHJA 4H3MA 3DQJA 5BTTA 2G3DB 2JNXA 2ARLA 4ZF3A 2LUXA 2I2RE 5HZSA 3AAJA 3KCSA 4CIDA 3SSYA 3RM1A 3I5IC 1FBVA 2AAOA 1SRAA 1KK7Z 4L13A 3CLNA 4TZGA 1MXLC 3E5TA 1K94A 2HGYA 3DQ5A 1BODA 2KFGA 2MA2A 3NF0A 1YRUB 3CFHA 4PPJA 1KK8C 3D0YB 4PE0A 3H1OA 5DPGA 1LINA 5CSIA 2F3ZA 4W77A 4C0KA 1QATA 1CM1A 4DIRA 1H4UA 1SCMB 3HCMA 5H88A 2M49B 2H6VA 3I5GB 1G33A 1RTP1 1AHRA 2CXJA 1XFZO 1DJIA 4JC2A 1RMMA 3NSLA 1SYMA 2O24A 1YJ2A 3UG0A 1BFPA 5BT0A 1MF8B 5T3IA 4UPGA 1B7TY 2GX2A 4KF5A 3RWTA 1KYPA 3VHTB 3GB3A 5LK4A 4W6NA 1G7KA 4AR7A 3AKOA 3DQEA 2A52B 3UFZA 3O77A 1LXFC 4CFQA 1QYFA 2M97A 2A50B 3LA1A 4YI8A 1HUYA 1IG5A 3OX5A 1WLMA 1KWOC 4I5LB 1XQMA 1DT7B 2Z1OA 5HBDA 1B9AA 2H2KA 3TUYB 4ZFSA 2LANA 1YR5A 4PALA 3DF0B 2A53B 4MZLA 3DVKA 2IB6A 2JQ6A 2L98A 2BCBA 2WHTA 2VADA 2VVHA 1K96A 3LLEA 2HPWA 1FW4A 1KYRA 1ZUXA 2BKHB 2OGRA 4YGEB 5EB6A 1KCYA 4QJ4B 4IK9A 1CFFA 1RM9A 2H61C 3CR4X 1SK6D 2YE0A 2RGIA 1OZSA 2WIQA 1A75A 5G08A 3K21A 2QRFA 1J1DA 1YHGA 3SVOA 2VRGA 4B30A 4M2OA 1BJFA 1RRXA 1DJXA 1OXDA 1F54A 1BF5A 2LLUA 3DQ7A 4YRUA 4W7DA 2VVJA 2QACA 2K7DA 3DQ4A 1S5GY 2ZNEA 1M63B 1OOJA 3NT9A 1K9PA 2EMOA 2M8UA 4Q9WA 2KI4C 1BMOA 3GEXA 1TNWA 2V53A 1NX0A 2OTGC 4DRWA 1JFKA 2I94A 4W75A 3QRXA 3A8SA 3I5HB 3ZUFA 1SL7A 2LP3A 4JEOA 1KQMB 1CM4A 2Z6ZA 3U8AA 1MUXA 1YX7A 3BUOB 5DKNA 5HZTA 2L2EA 2HGDA 2P4MA 2JTZA 1EH2A 1YUSA 5FVGA 1NIWA 1RMPA 3SVCA 2M7LA 3LVCA 3GOFA 1F55A 1IH0A 1YVLA 1CNPA 1DVIA 1QS7A 5H87A 4IK5A 2KI6D 3DVMA 3IR8A 3KF9A 2GW3A 2E30A 3M0WA 2FOTA 4P76A 1K2HA 3DPZA 2ZNDA 5DTXA 4AOMA 1C4FA 4GGNA 1UISA 1LA0A 1XK4A 2L4IA 1FF1A 4PHMA 1F71A 1ALWA 1F8HA 4JGEA 2BECA 3SVRA 5FYXA 3OX6A 2LAPA 3CTNA 4LJCA 3LK1A 3BOWA 2QLIA 3GK1A 2ZN9A 1LVCD 2KAXA 4JRBA 3P8UA 3M22A 5BPJA 1CLLA 3U0NA 4MZJA 4LJDA 2YDZA 2Y4QA 1OSAA 3TZ1A 2QLGA 5DKQA 2DD9A 4DS7A 1XFUO 2OPOA 3FIAA 2JTTA 2KYFA 3D0YA 4NDCA 4IK8A 2HQZA 2LHIA 3TS5C 4I5JA 1WDCB 4IK3A 1L2OC 2MAZA 4YGDB 3AI5A 4R6DA 3AKAA 4WRIA 3U8CA 1QTXA 1Y0VH 3PATA 2PSRA 3SV5A 1XSSA 3PJBA 2C9IA 4N3DA 3PFVA 5D7FA 2CCMA 3SIBA 2ZKMX 2IB5A 4MN0A 1VRKA 3GK4X 3P28A 1OXEA 3LVDA 1NCXA 2BBMA 2K2FA 4JPZB 3SVUA 3DQOA 1OMDA 2WCFA 4ORCB 1JBZA 4I5KA 1H4BA 2FWQA 1YURA 4DXQA 1NX1A 5KTGA 1IKUA 4ETOA 5CSNA 2JXCA 2WSNA 3DQ1A 2MHHA 2BKIB 3JVTC 5DRFA 3CD1A 4ICBA 1YHHA 3RLZA 2M1KB 2BL0B 1A75B 4D1EA 1XFVO 3BYAA 4OV2A 2KFHA 3DQ9A 4B30B 1X02A 3ST4A 4W6OA 4Z4KA 1JSAA 2OKYA 1XFYO 3WXAA 3AKBA 1CFPA 3CR5X 2PMYA 5I8NA 3DQDA 1NWDA 1K9UA 3LK0A 2ZO6A 2M3WA 1CDPA 2F33A 1S36A 2WHUA 5HW9A 1BR1B 1AJ4A 5DRGA 1IQ5A 1F4QA 4KPIA 1SR6C 2JWWA 4OKHA 4L12A 3SSHA 1CKKA 4AQJA 3AAKA 1UWOA 2JZIA 4N1GA 2WORA 2G6YA 1EMGA 4OGSA 3MSEB 2Y0GA 4ANJA 4W6MA 1PRWA 1NX2A 1G8IA 4P5OE 1A2XA 4U8DA 1MHOA 2O2BA 2OJKA 2KQ6A 1XYDA 3SG6A 1DJGA 3LF3A 3O2PA 3TDZA 1W7SA 4W6BA 1Y6WA 1E8AA 1GGXA 1YVHA 1ZUZA 4KGEA 1JUOA 5I2OA 5KU1A 4ZCUA 2Y5IA 3DQKA 4GUKA 1J7OA 3EK8A 1QXTA 1EJ3A 2ZRTA 4PHNA 3KHEA 4W6RA 1NUBA 1IJ6A 1K95A 4KW9A 1L7ZA 3BOWB 1QV0A 3SG2A 3CWGA 5LTRA 3BUWB 1U5IB 4BDUA 1JF2A 1V1GA 4W6FA 2BCAA 3A4UB 3NXAA 2KQYA 4WQ3A 1JFJA 1QASA 3SSPA 3SG3A 3DQCA 1BT6A 2QLGB 5K89A 4CFRA 2MLFC 2LVVA 4NDBA 2A4JA 1BOCA 3VRNA 2AH8A 2KAVA 5F6TA 1TRFA 1Q4BA 3H1RA 1TCFA 4HRHA 1QVIY 3SSKA 1PK0D 3GJ2A 3IP2A 3JTDC 1KK8B 2ZMUA 4BY5A 1KFXS 2QT2A 1EMEA 2AHAA 3BQ3A 2AMIA 4HVFA 1Q80A 3ZWHA 2I18A 1TN4A 1KP5A 3U0MA 4JF9A 1Y1UA 3ST2A 3WHUB 1FI6A 2Q91A 3ST0A 2LC5A 2OS8C 4Q7RA 4H48A 3ED8A 2TN4A 1GQMA 1B1GA 2M1UA 4WQ2A 5B8IB 5J3XA 3FWBA 1ZOTB 1XA5A 2LMVA 1KFUL 2R2IA 1B4CA 2G6EA 3BUMB 1CLMA 2M7NA 4EMQA 1EL4A 2LLSA 1SL9A 3NSOA 4CLNA 1A29A 1S26D 3CZTX 1SBJA 4R1EA 4JFGA 4PE1A 1RWYA 2G5ZB 1NYAA 1M45A 1B8LA 1IQ3A 2Q4UA 5D69A 5DTZA 1KWOB 1DF0A 2KNEA 1CMFA 3DQUA 2ISDA 1RMOA 1S1EA 1UP5A 4KGFA 2KFFA 1JC1A 1B47A 3DQLA 1PVAA 5LTPA 4H3LA 1QX7A 1ZACA 1UHHA 2H5QA 4GNKB 5EXUA 5LTQA 1YRTB 1J7RA 1K93D 2F8PA 1HT9A 1TCOB 2DUIA 4E68A 2LCPA 4ORNA 3EKHA 2OTBA 1QLSA 4OVNF 4OJ0A 2NCPA 3PLFB 2HQKA 5DPIA 2JULA 3EVRA 3SG7A 2SCPA 1EMBA 5ER4X 1MQ1A 2MRDA 2LVIA 2G2SB 4W76A 3VK1A 2QPTA 2LP2A 1J1EA 1XFWO 4W6GA 2G2BA 2PXWA 5TNCA 1ZGPA 3CBEA 4DXMA 5DY6A 5FVFA 2DOQA 2EC6B 4XGYA 1DTLA 1M46A 2AWKA 3IF7A 1B9CA 1ZMZA 3O78A 2MJWB 5HGEA 3I5HC 3FWCA 5DPHA 1RK9A 1SL8A 3RWAA 2KI4B 4Z4MA 3U0LA 4IL1A 1YUTA 4OHSA 4NDDA 1GJYA 5JJGA 2OTGB 1WY9A 3SJSA 2ZMWA 4HQ8A 2NZ0A 1EMCA 1XMZA 1JC2A 3PM8A 2HCGA 1NCYA 2VVIA 3BXCA 3NT3A 2O29A 1W7JB 3W1DA 1XA9A 1J7PA 2MLEC 2DD7A 3M24A 3WHTB 2CNPA 2B3PA 4J8AA 2I7AA 3LCPC 3PSRA 4M2QA 1ZFSA 4LQUA 1DJWA 2V4EA 5FHVA 4W6KA 2YFPA 4DKNA 3LVAA 3BXBA 3MGFA 2KHNA 2AWLA 1U5IA 1QV1A 5EB7A 1JWDA 2HRSA 4GOBA 1MWNA 2JPTA 1OMVA 5AERA 1C7WA 3ST3A 4MBEA 4HQ9A 4KF5C 1CTRA 1EMAA 5EHUA 4MZKA 2YE1A 5HZOA 1QYOA 3I5FB 1NP8A 1NX3A 1F09A 4GESB 2EMDA 5GQQC 2HPSA 3TDUA 1OXFA 1EMFA 1R2UA 2CT9A 3D10A 3OSRA 1RECA 4PPLA 5HZUA 4DXPA 2H8QA 1QY3A 2QLEA 3TS5B 2KGRA 4NQGA 1QIWA 1L2OB 1YUUA 1SKTA 3E5VA 3NEZA 1CFCA 2B3QA 3U8PA 4DXNA 3CR2A 4NWSA 1DF0B 1PALA 3LF4B 1TTXA 4R6BA 2WSOA 2F2PA 3PN7B 4L1IA 4PHKA 1LA3A 4DKMA 4ZF5A 5H89A 3FS7A 3OB2B 1BG1A 1RFJA 1BU3A 3E5WA 2L5XB 3PJ7A 2HQ8A 5I2QA 1XFXO 1FI5A 4C0JA 2EHBA 1H8BA 3WCKA 4LW5A 1UURA 1S6JA 2PVBA 2IE2A 2K7BA 2WOSA 4W72A 2JT0A 4PFEA 2EGDA 4XOVA 2K0JA 4KEXA 2WURA 4W6SA 1MOVA 2LM5A 4MEWA 1WRKA 3A8RA 4W7CA 3ZUJA 4PCWA 2L50A 4TNCA 2HQWA 4GBAA 2F3YA 1B7TZ 1UHIA 2A48A 4RYWA 2JRFA 3JVTB 1SPYA 5HKZA 4W7AA 2JU0A 3NSKA 1DGVA 2VZXA 1PSRA 2KI6C 1YHIA 4ZF4A 2Z6XA 5J2OA 1MXEA 5CPVA 4YBHB 4F0ZB 1A4PA 1MR8A 1MYWA 4W7XA 4XL5A 1XVJA 3DQAA 2JOJA 1CB1A 1BR4B 2H5PA 2WNDA 2RH7A 4YGBB 2BCXA 2DDCA 1SR6B 4A4BA 2H61A 3EK4A 5EXCI 2PRUA 2WC8A 1JC0A 3TMRA 1LKJA 2CTNA 1SCVA 3ZNIA 3EVUA 1F70A 5KSZA 2GGMA 4QJ5B 4U2VA 1WLZA 3K1KA 1S6IA 5AXIA 2M9GA 4W6PA 1YFPA 3SVSA 4EULA 3VRRA 3BX9A 2AUCA 3ICBA 1K90D 1AVSA 2DUFA 2BE4A 4YGAA 2KBIA 2G9BA 5AFPA 2V4EB 1S5GZ 2P6BB 1CV7A 2LE9B 2FZUA 4W6LA 2KDHA 1IJ5A 1GFLA 4W7EA 4GGFC 2LHLA 1DJYA 4LJDC 3C1VA 3EK7A 3I5IB 1Q73A 1Q4AA 1ODBA 2PALA 1UHNA 5HLVA 4GFTA 4N1FA 4GF6B 2KAYA 2BBNA 1Q4CA 3VRPA 3G9AA 1SCMC 4USLA 2G3OA 2LMUA 1F4OA 4KF4A 4KW8A 3DQ6A 3I5GC 3WLCA 2GGZA 5DPJA 1CDMA 4KW4A 5HKYA 2OTEA 1N2DA 1GGWA 3DQ8A 1RROA 1CLBA 4ZCVA 2JC2A 1R6PA 1N65A 4DUQA 3VROA 3JTDB 5DTYA 5HYDA 2O5GA 5DU0A 3NEDA 2Y1NA 3DQ2A 3TMTA 1J7QA 1EG4A 1KFUS 2FJUB 4KAGA 1KFXL 1B8CA 2H5OA 1QLKA 3O4YA 2Y1MA 4DCKA 1JBAA 2KBMA 3SSLA 3WNXB 1JF0A 3DQ3A 1AJ5A 3DQIA 1TNPA 2OS8B 3DQFA 3VRQA 3CGLA 1KSMA 4YGCB 3BUXB 3GK2A 2EMNA 3TUYC 2K8MB 1PVBA 2A46A 1DJZA 1EXRA 4AS8A 4MLWA 1CMGA 3SRYA 2KYCA 4ZBLA 3SSTA 2A56B 3I19A 4TZAA 2E6WA 3KCTA 2ZO7A 4GAOA 1BLQA 4W6CA 3CB9A 2HF5A 1PULA 4BY4A 1J55A 1YJFA 3CS1A 2ICRA 1AUIB 4XJKB 1TIZA 3LSAA 2PASA 4H3NA 4W6AA 4ZINA 1GL4A 2O60A 2G6XA 5DQMA 2LNKA 5IBWA 1S6ZA 1CDLA 4MRYA 4MSPA 1QX5B 2JT3A 3SVBA 1TNQA 4MVFA 3KO0A 4L9MA 2WISA 2NCOA 4W6IA 5I2LA 4XOWA 2A54B 4H47A 1HCJA 1DGUA 2GX0A 2QU1A 2JT8A 3EKJA 4W6UA 2L0PA 2NXQA 1NPQA 2DUHA 2OKWA 4OQWA 2BTJA 3HX4A 2C9JA 3WLDA 2COLB 2CBLA 5DKRA 4W6DA 4PPKA 4DXIA 3PIBA 2EC6C 3GL4A 5F9GA 3OB1B 2KOTA 2KSPA 3CFFA 1QXPA 1W7TA 2POXA 2LVJA 2LLTA 2ZRSA 4M2PA 1H6RA 1KK7Y 4QJ3B 1Z1QA 4JQ0D 1OE9B 2DUEA 2PXSA 1DMOA 4Q7TA 1KQMC 4XYNA 2BE6A 4ORBB 2H5RA 1S3PA 1C07A 2K2AA 1UUSA 2AWMA 5BTTB 3DVEA 1KQVA 2HJOA 1AP4A 5KTYA 4RTCA 1JBYA 4AQIA 3SG4A 1YZWA 3U0KA 4LJBA 4GPLB 2M29A 4I5NB 4YI9A 1TNXA 3BXAA 3LL8B 3VICA 4ORAB 3GJ1A 4W69A 1QX2A 5BQLA 4HE4A 4PE7A 3BUNB 3ZULA 3SSVA 4EDOA 2QZ0A 2JADA 1OMRA 1SNLA 4DXOA 1OZOA 3PALA 1N0YA 3OP0A 4P2YB 4PHJA 3DQHA 2L51A 1DJHA 1V1FA 1SW8A 1S6CA 4PE4A 1QIVA 1EMLA 1W7UA 1Y1XA 4IK1A 5FVIA 3AI4A 1YTZC 1D1OA 4IZNA 1IRJA 3DPXA 3IQQA 3KPXA 3TDIA 4CPVA 4W74A 3SVEA 3F45A 2DUGA 4IK4A 3LS3A 1SY9A 4P1QA 3SIAA 2A47A 3I5FC 4J88A 4LQTA 4GGFA 5HLOA 1WDCC 2GW4B 1CFDA 2F2OA 3SVDA 1F0BA 1IGVA 1UHKA 1B8RA 2FCEA 1ZGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M31 A;  4HQC A;  3ADF A;  1EG3 A;  1QJT A;  1HQV A;  2K61 A;  5CSF A;  1MOU A;  3EVP A;  1K8U A;  3CD9 A;  5AQB B;  3PN7 C;  4HRG A;  4N5X A;  3V3D A;  1AK8 A;  2IS9 A;  3OHM B;  3PJ5 A;  3SVN A;  2G16 B;  2LMT A;  4W6J A;  1QVI Z;  5AEQ A;  5HKW A;  2M0R A;  3OSQ A;  4W73 A;  2ZN8 A;  2AWJ A;  4FTG A;  3H4S E;  1XAE A;  4EDS A;  4I2Y A;  1Z1P A;  4Q9X A;  3O6B A;  4C0L A;  2HFC A;  3VHT A;  5JOL A;  4JWQ A;  4W7F A;  3BXK A;  1GGZ A;  2ZFD A;  1RJV A;  2BL0 C;  2LVK A;  4J89 A;  1Q4D A;  1A03 A;  4Q04 A;  2VAE A;  1EMK A;  1KYS A;  1YX8 A;  4OCI A;  2WCB A;  3DVJ A;  3CFA A;  4MRX A;  1W7I B;  4OY4 A;  3DQN A;  1NCZ A;  5AAN A;  2B1U A;  2LV7 A;  4ZIO A;  3SS0 A;  1TOP A;  1K9K A;  1Y1A A;  5DTL A;  4B5Y A;  2MBX A;  3DF0 A;  4W7R A;  1ALV A;  3EVV A;  1CDN A;  1C7V A;  2JXL A;  4HRE E;  3OGO A;  2IOV A;  4XJK A;  3DPW A;  4EN1 A;  4Q7U A;  1NSH A;  3CGA A;  4ZB1 A;  2D8N A;  5CSJ A;  3E3R A;  3S05 A;  2JNF A;  2Q6P A;  2WCE A;  4HSZ A;  3W1C A;  5ER5 A;  1XO5 A;  1WRL A;  3IQO A;  2KGB C;  4UTS A;  5EXB A;  3DD4 A;  2FCD A;  3ZTF A;  2NLN A;  1M39 A;  2Z6Y A;  1IWQ A;  2K7O A;  2H9W A;  1QYQ A;  2QLH A;  1EMM A;  1FPW A;  2Q57 A;  1PSB A;  1G4Y R;  3DQM A;  2WHS A;  4XVP A;  3NSI A;  5PAL A;  2GV5 A;  2K7C A;  4FQO A;  4A4C A;  2HET A;  4OR9 B;  2DDD A;  2SAS A;  3SG5 A;  1OQP A;  5DQB A;  4W6H A;  4W6T A;  2FL1 A;  1XK4 C;  3KEV A;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  1SMG A;  1Q4E A;  4RYS A;  4KA9 A;  5EBJ A;  2L4H A;  2LUC A;  1ZGQ A;  5EJU A;  2V4E C;  1UHJ A;  4H3M A;  3DQJ A;  5BTT A;  2G3D B;  2JNX A;  2ARL A;  4ZF3 A;  2LUX A;  2I2R E;  5HZS A;  3AAJ A;  3KCS A;  4CID A;  3SSY A;  3RM1 A;  3I5I C;  1FBV A;  2AAO A;  1SRA A;  1KK7 Z;  4L13 A;  3CLN A;  4TZG A;  1MXL C;  3E5T A;  1K94 A;  2HGY A;  3DQ5 A;  1BOD A;  2KFG A;  2MA2 A;  3NF0 A;  1YRU B;  3CFH A;  4PPJ A;  1KK8 C;  3D0Y B;  4PE0 A;  3H1O A;  5DPG A;  1LIN A;  5CSI A;  2F3Z A;  4W77 A;  4C0K A;  1QAT A;  1CM1 A;  4DIR A;  1H4U A;  1SCM B;  3HCM A;  5H88 A;  2M49 B;  2H6V A;  3I5G B;  1G33 A;  1RTP 1;  1AHR A;  2CXJ A;  1XFZ O;  1DJI A;  4JC2 A;  1RMM A;  3NSL A;  1SYM A;  2O24 A;  1YJ2 A;  3UG0 A;  1BFP A;  5BT0 A;  1MF8 B;  5T3I A;  4UPG A;  1B7T Y;  2GX2 A;  4KF5 A;  3RWT A;  1KYP A;  3VHT B;  3GB3 A;  5LK4 A;  4W6N A;  1G7K A;  4AR7 A;  3AKO A;  3DQE A;  2A52 B;  3UFZ A;  3O77 A;  1LXF C;  4CFQ A;  1QYF A;  2M97 A;  2A50 B;  3LA1 A;  4YI8 A;  1HUY A;  1IG5 A;  3OX5 A;  1WLM A;  1KWO C;  4I5L B;  1XQM A;  1DT7 B;  2Z1O A;  5HBD A;  1B9A A;  2H2K A;  3TUY B;  4ZFS A;  2LAN A;  1YR5 A;  4PAL A;  3DF0 B;  2A53 B;  4MZL A;  3DVK A;  2IB6 A;  2JQ6 A;  2L98 A;  2BCB A;  2WHT A;  2VAD A;  2VVH A;  1K96 A;  3LLE A;  2HPW A;  1FW4 A;  1KYR A;  1ZUX A;  2BKH B;  2OGR A;  4YGE B;  5EB6 A;  1KCY A;  4QJ4 B;  4IK9 A;  1CFF A;  1RM9 A;  2H61 C;  3CR4 X;  1SK6 D;  2YE0 A;  2RGI A;  1OZS A;  2WIQ A;  1A75 A;  5G08 A;  3K21 A;  2QRF A;  1J1D A;  1YHG A;  3SVO A;  2VRG A;  4B30 A;  4M2O A;  1BJF A;  1RRX A;  1DJX A;  1OXD A;  1F54 A;  1BF5 A;  2LLU A;  3DQ7 A;  4YRU A;  4W7D A;  2VVJ A;  2QAC A;  2K7D A;  3DQ4 A;  1S5G Y;  2ZNE A;  1M63 B;  1OOJ A;  3NT9 A;  1K9P A;  2EMO A;  2M8U A;  4Q9W A;  2KI4 C;  1BMO A;  3GEX A;  1TNW A;  2V53 A;  1NX0 A;  2OTG C;  4DRW A;  1JFK A;  2I94 A;  4W75 A;  3QRX A;  3A8S A;  3I5H B;  3ZUF A;  1SL7 A;  2LP3 A;  4JEO A;  1KQM B;  1CM4 A;  2Z6Z A;  3U8A A;  1MUX A;  1YX7 A;  3BUO B;  5DKN A;  5HZT A;  2L2E A;  2HGD A;  2P4M A;  2JTZ A;  1EH2 A;  1YUS A;  5FVG A;  1NIW A;  1RMP A;  3SVC A;  2M7L A;  3LVC A;  3GOF A;  1F55 A;  1IH0 A;  1YVL A;  1CNP A;  1DVI A;  1QS7 A;  5H87 A;  4IK5 A;  2KI6 D;  3DVM A;  3IR8 A;  3KF9 A;  2GW3 A;  2E30 A;  3M0W A;  2FOT A;  4P76 A;  1K2H A;  3DPZ A;  2ZND A;  5DTX A;  4AOM A;  1C4F A;  4GGN A;  1UIS A;  1LA0 A;  1XK4 A;  2L4I A;  1FF1 A;  4PHM A;  1F71 A;  1ALW A;  1F8H A;  4JGE A;  2BEC A;  3SVR A;  5FYX A;  3OX6 A;  2LAP A;  3CTN A;  4LJC A;  3LK1 A;  3BOW A;  2QLI A;  3GK1 A;  2ZN9 A;  1LVC D;  2KAX A;  4JRB A;  3P8U A;  3M22 A;  5BPJ A;  1CLL A;  3U0N A;  4MZJ A;  4LJD A;  2YDZ A;  2Y4Q A;  1OSA A;  3TZ1 A;  2QLG A;  5DKQ A;  2DD9 A;  4DS7 A;  1XFU O;  2OPO A;  3FIA A;  2JTT A;  2KYF A;  3D0Y A;  4NDC A;  4IK8 A;  2HQZ A;  2LHI A;  3TS5 C;  4I5J A;  1WDC B;  4IK3 A;  1L2O C;  2MAZ A;  4YGD B;  3AI5 A;  4R6D A;  3AKA A;  4WRI A;  3U8C A;  1QTX A;  1Y0V H;  3PAT A;  2PSR A;  3SV5 A;  1XSS A;  3PJB A;  2C9I A;  4N3D A;  3PFV A;  5D7F A;  2CCM A;  3SIB A;  2ZKM X;  2IB5 A;  4MN0 A;  1VRK A;  3GK4 X;  3P28 A;  1OXE A;  3LVD A;  1NCX A;  2BBM A;  2K2F A;  4JPZ B;  3SVU A;  3DQO A;  1OMD A;  2WCF A;  4ORC B;  1JBZ A;  4I5K A;  1H4B A;  2FWQ A;  1YUR A;  4DXQ A;  1NX1 A;  5KTG A;  1IKU A;  4ETO A;  5CSN A;  2JXC A;  2WSN A;  3DQ1 A;  2MHH A;  2BKI B;  3JVT C;  5DRF A;  3CD1 A;  4ICB A;  1YHH A;  3RLZ A;  2M1K B;  2BL0 B;  1A75 B;  4D1E A;  1XFV O;  3BYA A;  4OV2 A;  2KFH A;  3DQ9 A;  4B30 B;  1X02 A;  3ST4 A;  4W6O A;  4Z4K A;  1JSA A;  2OKY A;  1XFY O;  3WXA A;  3AKB A;  1CFP A;  3CR5 X;  2PMY A;  5I8N A;  3DQD A;  1NWD A;  1K9U A;  3LK0 A;  2ZO6 A;  2M3W A;  1CDP A;  2F33 A;  1S36 A;  2WHU A;  5HW9 A;  1BR1 B;  1AJ4 A;  5DRG A;  1IQ5 A;  1F4Q A;  4KPI A;  1SR6 C;  2JWW A;  4OKH A;  4L12 A;  3SSH A;  1CKK A;  4AQJ A;  3AAK A;  1UWO A;  2JZI A;  4N1G A;  2WOR A;  2G6Y A;  1EMG A;  4OGS A;  3MSE B;  2Y0G A;  4ANJ A;  4W6M A;  1PRW A;  1NX2 A;  1G8I A;  4P5O E;  1A2X A;  4U8D A;  1MHO A;  2O2B A;  2OJK A;  2KQ6 A;  1XYD A;  3SG6 A;  1DJG A;  3LF3 A;  3O2P A;  3TDZ A;  1W7S A;  4W6B A;  1Y6W A;  1E8A A;  1GGX A;  1YVH A;  1ZUZ A;  4KGE A;  1JUO A;  5I2O A;  5KU1 A;  4ZCU A;  2Y5I A;  3DQK A;  4GUK A;  1J7O A;  3EK8 A;  1QXT A;  1EJ3 A;  2ZRT A;  4PHN A;  3KHE A;  4W6R A;  1NUB A;  1IJ6 A;  1K95 A;  4KW9 A;  1L7Z A;  3BOW B;  1QV0 A;  3SG2 A;  3CWG A;  5LTR A;  3BUW B;  1U5I B;  4BDU A;  1JF2 A;  1V1G A;  4W6F A;  2BCA A;  3A4U B;  3NXA A;  2KQY A;  4WQ3 A;  1JFJ A;  1QAS A;  3SSP A;  3SG3 A;  3DQC A;  1BT6 A;  2QLG B;  5K89 A;  4CFR A;  2MLF C;  2LVV A;  4NDB A;  2A4J A;  1BOC A;  3VRN A;  2AH8 A;  2KAV A;  5F6T A;  1TRF A;  1Q4B A;  3H1R A;  1TCF A;  4HRH A;  1QVI Y;  3SSK A;  1PK0 D;  3GJ2 A;  3IP2 A;  3JTD C;  1KK8 B;  2ZMU A;  4BY5 A;  1KFX S;  2QT2 A;  1EME A;  2AHA A;  3BQ3 A;  2AMI A;  4HVF A;  1Q80 A;  3ZWH A;  2I18 A;  1TN4 A;  1KP5 A;  3U0M A;  4JF9 A;  1Y1U A;  3ST2 A;  3WHU B;  1FI6 A;  2Q91 A;  3ST0 A;  2LC5 A;  2OS8 C;  4Q7R A;  4H48 A;  3ED8 A;  2TN4 A;  1GQM A;  1B1G A;  2M1U A;  4WQ2 A;  5B8I B;  5J3X A;  3FWB A;  1ZOT B;  1XA5 A;  2LMV A;  1KFU L;  2R2I A;  1B4C A;  2G6E A;  3BUM B;  1CLM A;  2M7N A;  4EMQ A;  1EL4 A;  2LLS A;  1SL9 A;  3NSO A;  4CLN A;  1A29 A;  1S26 D;  3CZT X;  1SBJ A;  4R1E A;  4JFG A;  4PE1 A;  1RWY A;  2G5Z B;  1NYA A;  1M45 A;  1B8L A;  1IQ3 A;  2Q4U A;  5D69 A;  5DTZ A;  1KWO B;  1DF0 A;  2KNE A;  1CMF A;  3DQU A;  2ISD A;  1RMO A;  1S1E A;  1UP5 A;  4KGF A;  2KFF A;  1JC1 A;  1B47 A;  3DQL A;  1PVA A;  5LTP A;  4H3L A;  1QX7 A;  1ZAC A;  1UHH A;  2H5Q A;  4GNK B;  5EXU A;  5LTQ A;  1YRT B;  1J7R A;  1K93 D;  2F8P A;  1HT9 A;  1TCO B;  2DUI A;  4E68 A;  2LCP A;  4ORN A;  3EKH A;  2OTB A;  1QLS A;  4OVN F;  4OJ0 A;  2NCP A;  3PLF B;  2HQK A;  5DPI A;  2JUL A;  3EVR A;  3SG7 A;  2SCP A;  1EMB A;  5ER4 X;  1MQ1 A;  2MRD A;  2LVI A;  2G2S B;  4W76 A;  3VK1 A;  2QPT A;  2LP2 A;  1J1E A;  1XFW O;  4W6G A;  2G2B A;  2PXW A;  5TNC A;  1ZGP A;  3CBE A;  4DXM A;  5DY6 A;  5FVF A;  2DOQ A;  2EC6 B;  4XGY A;  1DTL A;  1M46 A;  2AWK A;  3IF7 A;  1B9C A;  1ZMZ A;  3O78 A;  2MJW B;  5HGE A;  3I5H C;  3FWC A;  5DPH A;  1RK9 A;  1SL8 A;  3RWA A;  2KI4 B;  4Z4M A;  3U0L A;  4IL1 A;  1YUT A;  4OHS A;  4NDD A;  1GJY A;  5JJG A;  2OTG B;  1WY9 A;  3SJS A;  2ZMW A;  4HQ8 A;  2NZ0 A;  1EMC A;  1XMZ A;  1JC2 A;  3PM8 A;  2HCG A;  1NCY A;  2VVI A;  3BXC A;  3NT3 A;  2O29 A;  1W7J B;  3W1D A;  1XA9 A;  1J7P A;  2MLE C;  2DD7 A;  3M24 A;  3WHT B;  2CNP A;  2B3P A;  4J8A A;  2I7A A;  3LCP C;  3PSR A;  4M2Q A;  1ZFS A;  4LQU A;  1DJW A;  2V4E A;  5FHV A;  4W6K A;  2YFP A;  4DKN A;  3LVA A;  3BXB A;  3MGF A;  2KHN A;  2AWL A;  1U5I A;  1QV1 A;  5EB7 A;  1JWD A;  2HRS A;  4GOB A;  1MWN A;  2JPT A;  1OMV A;  5AER A;  1C7W A;  3ST3 A;  4MBE A;  4HQ9 A;  4KF5 C;  1CTR A;  1EMA A;  5EHU A;  4MZK A;  2YE1 A;  5HZO A;  1QYO A;  3I5F B;  1NP8 A;  1NX3 A;  1F09 A;  4GES B;  2EMD A;  5GQQ C;  2HPS A;  3TDU A;  1OXF A;  1EMF A;  1R2U A;  2CT9 A;  3D10 A;  3OSR A;  1REC A;  4PPL A;  5HZU A;  4DXP A;  2H8Q A;  1QY3 A;  2QLE A;  3TS5 B;  2KGR A;  4NQG A;  1QIW A;  1L2O B;  1YUU A;  1SKT A;  3E5V A;  3NEZ A;  1CFC A;  2B3Q A;  3U8P A;  4DXN A;  3CR2 A;  4NWS A;  1DF0 B;  1PAL A;  3LF4 B;  1TTX A;  4R6B A;  2WSO A;  2F2P A;  3PN7 B;  4L1I A;  4PHK A;  1LA3 A;  4DKM A;  4ZF5 A;  5H89 A;  3FS7 A;  3OB2 B;  1BG1 A;  1RFJ A;  1BU3 A;  3E5W A;  2L5X B;  3PJ7 A;  2HQ8 A;  5I2Q A;  1XFX O;  1FI5 A;  4C0J A;  2EHB A;  1H8B A;  3WCK A;  4LW5 A;  1UUR A;  1S6J A;  2PVB A;  2IE2 A;  2K7B A;  2WOS A;  4W72 A;  2JT0 A;  4PFE A;  2EGD A;  4XOV A;  2K0J A;  4KEX A;  2WUR A;  4W6S A;  1MOV A;  2LM5 A;  4MEW A;  1WRK A;  3A8R A;  4W7C A;  3ZUJ A;  4PCW A;  2L50 A;  4TNC A;  2HQW A;  4GBA A;  2F3Y A;  1B7T Z;  1UHI A;  2A48 A;  4RYW A;  2JRF A;  3JVT B;  1SPY A;  5HKZ A;  4W7A A;  2JU0 A;  3NSK A;  1DGV A;  2VZX A;  1PSR A;  2KI6 C;  1YHI A;  4ZF4 A;  2Z6X A;  5J2O A;  1MXE A;  5CPV A;  4YBH B;  4F0Z B;  1A4P A;  1MR8 A;  1MYW A;  4W7X A;  4XL5 A;  1XVJ A;  3DQA A;  2JOJ A;  1CB1 A;  1BR4 B;  2H5P A;  2WND A;  2RH7 A;  4YGB B;  2BCX A;  2DDC A;  1SR6 B;  4A4B A;  2H61 A;  3EK4 A;  5EXC I;  2PRU A;  2WC8 A;  1JC0 A;  3TMR A;  1LKJ A;  2CTN A;  1SCV A;  3ZNI A;  3EVU A;  1F70 A;  5KSZ A;  2GGM A;  4QJ5 B;  4U2V A;  1WLZ A;  3K1K A;  1S6I A;  5AXI A;  2M9G A;  4W6P A;  1YFP A;  3SVS A;  4EUL A;  3VRR A;  3BX9 A;  2AUC A;  3ICB A;  1K90 D;  1AVS A;  2DUF A;  2BE4 A;  4YGA A;  2KBI A;  2G9B A;  5AFP A;  2V4E B;  1S5G Z;  2P6B B;  1CV7 A;  2LE9 B;  2FZU A;  4W6L A;  2KDH A;  1IJ5 A;  1GFL A;  4W7E A;  4GGF C;  2LHL A;  1DJY A;  4LJD C;  3C1V A;  3EK7 A;  3I5I B;  1Q73 A;  1Q4A A;  1ODB A;  2PAL A;  1UHN A;  5HLV A;  4GFT A;  4N1F A;  4GF6 B;  2KAY A;  2BBN A;  1Q4C A;  3VRP A;  3G9A A;  1SCM C;  4USL A;  2G3O A;  2LMU A;  1F4O A;  4KF4 A;  4KW8 A;  3DQ6 A;  3I5G C;  3WLC A;  2GGZ A;  5DPJ A;  1CDM A;  4KW4 A;  5HKY A;  2OTE A;  1N2D A;  1GGW A;  3DQ8 A;  1RRO A;  1CLB A;  4ZCV A;  2JC2 A;  1R6P A;  1N65 A;  4DUQ A;  3VRO A;  3JTD B;  5DTY A;  5HYD A;  2O5G A;  5DU0 A;  3NED A;  2Y1N A;  3DQ2 A;  3TMT A;  1J7Q A;  1EG4 A;  1KFU S;  2FJU B;  4KAG A;  1KFX L;  1B8C A;  2H5O A;  1QLK A;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  2KBM A;  3SSL A;  3WNX B;  1JF0 A;  3DQ3 A;  1AJ5 A;  3DQI A;  1TNP A;  2OS8 B;  3DQF A;  3VRQ A;  3CGL A;  1KSM A;  4YGC B;  3BUX B;  3GK2 A;  2EMN A;  3TUY C;  2K8M B;  1PVB A;  2A46 A;  1DJZ A;  1EXR A;  4AS8 A;  4MLW A;  1CMG A;  3SRY A;  2KYC A;  4ZBL A;  3SST A;  2A56 B;  3I19 A;  4TZA A;  2E6W A;  3KCT A;  2ZO7 A;  4GAO A;  1BLQ A;  4W6C A;  3CB9 A;  2HF5 A;  1PUL A;  4BY4 A;  1J55 A;  1YJF A;  3CS1 A;  2ICR A;  1AUI B;  4XJK B;  1TIZ A;  3LSA A;  2PAS A;  4H3N A;  4W6A A;  4ZIN A;  1GL4 A;  2O60 A;  2G6X A;  5DQM A;  2LNK A;  5IBW A;  1S6Z A;  1CDL A;  4MRY A;  4MSP A;  1QX5 B;  2JT3 A;  3SVB A;  1TNQ A;  4MVF A;  3KO0 A;  4L9M A;  2WIS A;  2NCO A;  4W6I A;  5I2L A;  4XOW A;  2A54 B;  4H47 A;  1HCJ A;  1DGU A;  2GX0 A;  2QU1 A;  2JT8 A;  3EKJ A;  4W6U A;  2L0P A;  2NXQ A;  1NPQ A;  2DUH A;  2OKW A;  4OQW A;  2BTJ A;  3HX4 A;  2C9J A;  3WLD A;  2COL B;  2CBL A;  5DKR A;  4W6D A;  4PPK A;  4DXI A;  3PIB A;  2EC6 C;  3GL4 A;  5F9G A;  3OB1 B;  2KOT A;  2KSP A;  3CFF A;  1QXP A;  1W7T A;  2POX A;  2LVJ A;  2LLT A;  2ZRS A;  4M2P A;  1H6R A;  1KK7 Y;  4QJ3 B;  1Z1Q A;  4JQ0 D;  1OE9 B;  2DUE A;  2PXS A;  1DMO A;  4Q7T A;  1KQM C;  4XYN A;  2BE6 A;  4ORB B;  2H5R A;  1S3P A;  1C07 A;  2K2A A;  1UUS A;  2AWM A;  5BTT B;  3DVE A;  1KQV A;  2HJO A;  1AP4 A;  5KTY A;  4RTC A;  1JBY A;  4AQI A;  3SG4 A;  1YZW A;  3U0K A;  4LJB A;  4GPL B;  2M29 A;  4I5N B;  4YI9 A;  1TNX A;  3BXA A;  3LL8 B;  3VIC A;  4ORA B;  3GJ1 A;  4W69 A;  1QX2 A;  5BQL A;  4HE4 A;  4PE7 A;  3BUN B;  3ZUL A;  3SSV A;  4EDO A;  2QZ0 A;  2JAD A;  1OMR A;  1SNL A;  4DXO A;  1OZO A;  3PAL A;  1N0Y A;  3OP0 A;  4P2Y B;  4PHJ A;  3DQH A;  2L51 A;  1DJH A;  1V1F A;  1SW8 A;  1S6C A;  4PE4 A;  1QIV A;  1EML A;  1W7U A;  1Y1X A;  4IK1 A;  5FVI A;  3AI4 A;  1YTZ C;  1D1O A;  4IZN A;  1IRJ A;  3DPX A;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  4W74 A;  3SVE A;  3F45 A;  2DUG A;  4IK4 A;  3LS3 A;  1SY9 A;  4P1Q A;  3SIA A;  2A47 A;  3I5F C;  4J88 A;  4LQT A;  4GGF A;  5HLO A;  1WDC C;  2GW4 B;  1CFD A;  2F2O A;  3SVD A;  1F0B A;  1IGV A;  1UHK A;  1B8R A;  2FCE A;  1ZGO A; 
#chains in the Genus database with same CATH topology
 1M31 A;  4HQC A;  3ADF A;  1EG3 A;  1QJT A;  1HQV A;  2K61 A;  3B87 A;  5CSF A;  1MOU A;  3EVP A;  1K8U A;  3CD9 A;  5AQB B;  3PN7 C;  4HRG A;  4N5X A;  3V3D A;  1AK8 A;  2IS9 A;  3OHM B;  3PJ5 A;  3SVN A;  2G16 B;  2LMT A;  4W6J A;  1QVI Z;  5AEQ A;  5HKW A;  2M0R A;  3OSQ A;  4W73 A;  2ZN8 A;  2AWJ A;  4FTG A;  3H4S E;  1XAE A;  4EDS A;  4I2Y A;  1Z1P A;  4Q9X A;  3O6B A;  4C0L A;  2HFC A;  3VHT A;  5JOL A;  4JWQ A;  4W7F A;  3BXK A;  1GGZ A;  2ZFD A;  1RJV A;  2BL0 C;  2LVK A;  4J89 A;  1Q4D A;  1A03 A;  4Q04 A;  2VAE A;  2PQL A;  1KYS A;  1EMK A;  3D76 A;  1YX8 A;  4OCI A;  2WCB A;  3DVJ A;  3CFA A;  4MRX A;  1W7I B;  1C3Z A;  4OY4 A;  3DQN A;  1NCZ A;  5AAN A;  2B1U A;  2LV7 A;  4ZIO A;  3SS0 A;  1TOP A;  1K9K A;  1Y1A A;  5DTL A;  4B5Y A;  2MBX A;  3PM2 A;  3DF0 A;  4W7R A;  1ALV A;  3EVV A;  1CDN A;  1C7V A;  2JXL A;  4HRE E;  3OGO A;  2IOV A;  4XJK A;  3DPW A;  2FJY A;  4EN1 A;  4Q7U A;  1NSH A;  3CGA A;  4ZB1 A;  2D8N A;  5CSJ A;  3E3R A;  3S05 A;  1P28 A;  2JNF A;  2Q6P A;  2WCE A;  4HSZ A;  3W1C A;  5ER5 A;  1XO5 A;  1WRL A;  3IQO A;  2KGB C;  4UTS A;  5EXB A;  3DD4 A;  2FCD A;  3ZTF A;  2NLN A;  1M39 A;  2Z6Y A;  1LS8 A;  1IWQ A;  2K7O A;  2H9W A;  1QYQ A;  2QLH A;  1EMM A;  1FPW A;  2Q57 A;  1PSB A;  3R1P A;  1G4Y R;  3DQM A;  2WHS A;  4XVP A;  3NSI A;  5PAL A;  2GV5 A;  2K7C A;  4FQO A;  3OGN A;  4A4C A;  2HET A;  4OR9 B;  2DDD A;  2SAS A;  3SG5 A;  1OOG A;  1OQP A;  5DQB A;  4W6H A;  4W6T A;  2YGU A;  2FL1 A;  1XK4 C;  3KEV A;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  1SMG A;  1Q4E A;  3CZ0 A;  4RYS A;  4KA9 A;  5EBJ A;  3R1V A;  2L4H A;  2LUC A;  1ZGQ A;  5EJU A;  2V4E C;  1UHJ A;  4H3M A;  3DQJ A;  5BTT A;  2G3D B;  2JNX A;  2ARL A;  4ZF3 A;  2LUX A;  2I2R E;  5HZS A;  3AAJ A;  3KCS A;  4CID A;  3SSY A;  3RM1 A;  3I5I C;  1FBV A;  2AAO A;  1SRA A;  1KK7 Z;  4L13 A;  3CLN A;  4TZG A;  1MXL C;  3E5T A;  1K94 A;  2HGY A;  3DQ5 A;  1BOD A;  2KFG A;  2MA2 A;  3NF0 A;  2KPH A;  1YRU B;  3CFH A;  2WCM A;  4PPJ A;  1KK8 C;  3D0Y B;  4PE0 A;  3H1O A;  5DPG A;  1LIN A;  5CSI A;  2F3Z A;  4W77 A;  4C0K A;  1QAT A;  1CM1 A;  4DIR A;  1H4U A;  1SCM B;  3HCM A;  5H88 A;  2M49 B;  2H6V A;  3I5G B;  1G33 A;  1RTP 1;  1AHR A;  3PJI A;  2CXJ A;  1XFZ O;  1DJI A;  3B6X A;  4JC2 A;  1RMM A;  3NSL A;  1SYM A;  3DYE A;  2O24 A;  1YJ2 A;  3UG0 A;  1BFP A;  5BT0 A;  1MF8 B;  5T3I A;  3BJH A;  4UPG A;  1B7T Y;  2GX2 A;  4KF5 A;  3RWT A;  1KYP A;  3VHT B;  2WCH A;  3GB3 A;  5LK4 A;  4W6N A;  1G7K A;  4AR7 A;  3AKO A;  3DQE A;  2A52 B;  3UFZ A;  3O77 A;  1LXF C;  4CFQ A;  1QYF A;  3N7H A;  3K1E A;  2M97 A;  2A50 B;  3LA1 A;  4YI8 A;  1HUY A;  1IG5 A;  3OX5 A;  1WLM A;  1KWO C;  4I5L B;  3D78 A;  1XQM A;  1DT7 B;  2Z1O A;  5HBD A;  1B9A A;  2H2K A;  3TUY B;  4ZFS A;  2LAN A;  1YR5 A;  2BAP A;  4PAL A;  3DF0 B;  2A53 B;  4MZL A;  3DVK A;  2IB6 A;  2JQ6 A;  2L98 A;  2BCB A;  2WHT A;  3NHI A;  2VAD A;  2VVH A;  1K96 A;  3LLE A;  2HPW A;  1FW4 A;  1KYR A;  1ZUX A;  2BKH B;  2OGR A;  4YGE B;  5EB6 A;  1KCY A;  4QJ4 B;  4IK9 A;  1CFF A;  1RM9 A;  2H61 C;  2WCK A;  3CR4 X;  1SK6 D;  2YE0 A;  2RGI A;  1OZS A;  2WIQ A;  1A75 A;  5G08 A;  3K21 A;  3CZ1 A;  1J1D A;  1YHG A;  2QRF A;  3SVO A;  2VRG A;  4B30 A;  4M2O A;  1BJF A;  1RRX A;  1DJX A;  1OXD A;  1F54 A;  1BF5 A;  2LLU A;  3DQ7 A;  4YRU A;  4W7D A;  2VVJ A;  2QAC A;  2K7D A;  3DQ4 A;  1S5G Y;  2ZNE A;  1M63 B;  1OOJ A;  3NT9 A;  1K9P A;  4FQT A;  3BFB A;  2EMO A;  1OOH A;  2M8U A;  2KI4 C;  4Q9W A;  1BMO A;  3GEX A;  1TNW A;  2V53 A;  1NX0 A;  2OTG C;  4DRW A;  1JFK A;  2I94 A;  4W75 A;  3QRX A;  3A8S A;  3I5H B;  3ZUF A;  1SL7 A;  2LP3 A;  4JEO A;  1KQM B;  1CM4 A;  3B7A A;  2H8V A;  2Z6Z A;  3U8A A;  1MUX A;  1YX7 A;  2KLE A;  3BUO B;  5DKN A;  5HZT A;  2L2E A;  2HGD A;  2P4M A;  2JTZ A;  1EH2 A;  1YUS A;  5FVG A;  1NIW A;  1RMP A;  3SVC A;  2M7L A;  3LVC A;  3GOF A;  1F55 A;  1TWO A;  1IH0 A;  1YVL A;  1CNP A;  1DVI A;  1QS7 A;  4INX A;  5H87 A;  4IK5 A;  3VB1 A;  2KI6 D;  3DVM A;  3IR8 A;  3KF9 A;  2GW3 A;  2E30 A;  3M0W A;  2FOT A;  4P76 A;  1K2H A;  3DPZ A;  2ZND A;  5DTX A;  4AOM A;  1C4F A;  4GGN A;  1UIS A;  1LA0 A;  1XK4 A;  2L4I A;  1FF1 A;  4INW A;  4PHM A;  1F71 A;  1ALW A;  1F8H A;  4JGE A;  2BEC A;  3SVR A;  5FYX A;  3OX6 A;  2LAP A;  3CTN A;  4LJC A;  3LK1 A;  3BOW A;  2QLI A;  3FE8 A;  3GK1 A;  2ZN9 A;  1LVC D;  2KAX A;  4JRB A;  3P8U A;  3M22 A;  5BPJ A;  1CLL A;  3U0N A;  4MZJ A;  4LJD A;  2YDZ A;  2Y4Q A;  1OSA A;  3TZ1 A;  2QLG A;  5DKQ A;  2DD9 A;  4DS7 A;  1XFU O;  2OPO A;  3FIA A;  2JTT A;  2KYF A;  3D0Y A;  4NDC A;  4IK8 A;  2HQZ A;  2LHI A;  4KYN A;  3TS5 C;  4I5J A;  1WDC B;  4IK3 A;  1L2O C;  2MAZ A;  4YGD B;  3AI5 A;  4R6D A;  3AKA A;  4WRI A;  3U8C A;  1QTX A;  1Y0V H;  3PAT A;  2PSR A;  3SV5 A;  1XSS A;  3PJB A;  2C9I A;  4N3D A;  3PFV A;  5D7F A;  2CCM A;  3SIB A;  2ZKM X;  2IB5 A;  4MN0 A;  1VRK A;  3GK4 X;  3P28 A;  1OXE A;  3LVD A;  1NCX A;  2BBM A;  3RZS A;  2K2F A;  4JPZ B;  3SVU A;  3DQO A;  1OMD A;  2WCF A;  4ORC B;  1JBZ A;  4I5K A;  1H4B A;  2FWQ A;  1YUR A;  4DXQ A;  1NX1 A;  2WCJ A;  5KTG A;  1IKU A;  4ETO A;  5CSN A;  2JXC A;  2WSN A;  3DQ1 A;  2MHH A;  2BKI B;  3JVT C;  5DRF A;  3CD1 A;  1DEL A;  4ICB A;  1YHH A;  3RLZ A;  2M1K B;  2BL0 B;  1A75 B;  4D1E A;  1XFV O;  3BYA A;  4OV2 A;  3UO9 A;  2KFH A;  3DQ9 A;  4B30 B;  1X02 A;  3ST4 A;  4W6O A;  5D3O A;  4Z4K A;  1JSA A;  2OKY A;  1XFY O;  4JKT A;  3WXA A;  3AKB A;  1CFP A;  3S0D A;  3CR5 X;  2PMY A;  5I8N A;  3DQD A;  1DEK A;  1NWD A;  1K9U A;  3LK0 A;  2ZO6 A;  2M3W A;  1CDP A;  2F33 A;  1S36 A;  2WHU A;  5HW9 A;  1BR1 B;  2K60 A;  1AJ4 A;  5DRG A;  1IQ5 A;  1F4Q A;  4KPI A;  1SR6 C;  2JWW A;  4OKH A;  4L12 A;  3SSH A;  1CKK A;  4AQJ A;  3AAK A;  1UWO A;  2JZI A;  4N1G A;  2WOR A;  2G6Y A;  1EMG A;  4OGS A;  3R1O A;  3MSE B;  2Y0G A;  4ANJ A;  4W6M A;  1PRW A;  1NX2 A;  1G8I A;  4P5O E;  1A2X A;  4U8D A;  1MHO A;  2O2B A;  2OJK A;  2KQ6 A;  1XYD A;  3SG6 A;  1DJG A;  3CZ2 A;  3LF3 A;  3O2P A;  3TDZ A;  1W7S A;  4W6B A;  1Y6W A;  1E8A A;  1GGX A;  1YVH A;  1ZUZ A;  4KGE A;  1JUO A;  5I2O A;  3NHT A;  5KU1 A;  4ZCU A;  2Y5I A;  3DQK A;  4GUK A;  1J7O A;  3EK8 A;  1QXT A;  1EJ3 A;  2ZRT A;  2WCL A;  4PHN A;  3KHE A;  4W6R A;  1NUB A;  1IJ6 A;  1K95 A;  4KW9 A;  1L7Z A;  3BOW B;  1QV0 A;  3SG2 A;  3CWG A;  5LTR A;  3BUW B;  1U5I B;  4BDU A;  1JF2 A;  1V1G A;  4W6F A;  2BCA A;  3A4U B;  1DQE A;  3NXA A;  2KQY A;  4WQ3 A;  2P71 A;  1JFJ A;  1QAS A;  3SSP A;  1TUZ A;  3SG3 A;  3NGV A;  3DQC A;  1ORG A;  1BT6 A;  1OOI X;  2QLG B;  5K89 A;  4CFR A;  2MLF C;  2LVV A;  4NDB A;  2A4J A;  1BOC A;  3VRN A;  2AH8 A;  2KAV A;  5F6T A;  1TRF A;  1Q4B A;  3H1R A;  1TCF A;  4HRH A;  1QVI Y;  2L5Y A;  3SSK A;  1PK0 D;  3O4X A;  3GJ2 A;  3EG5 B;  3IP2 A;  3JTD C;  1KK8 B;  2ZMU A;  4BY5 A;  1Z2C B;  1KFX S;  2QT2 A;  1EME A;  2AHA A;  3BQ3 A;  2AMI A;  4HVF A;  1Q80 A;  3ZWH A;  2I18 A;  1TN4 A;  1KP5 A;  3U0M A;  4JF9 A;  1Y1U A;  3ST2 A;  3WHU B;  1FI6 A;  2Q91 A;  3ST0 A;  2LC5 A;  2OS8 C;  3BFH A;  4Q7R A;  4H48 A;  3D73 A;  3ED8 A;  2TN4 A;  1GQM A;  1B1G A;  2M1U A;  4WQ2 A;  5B8I B;  5J3X A;  3FWB A;  1ZOT B;  1XA5 A;  2LMV A;  1KFU L;  2R2I A;  2WC6 A;  1B4C A;  2G6E A;  1XFR A;  3BUM B;  1CLM A;  2M7N A;  4EMQ A;  1W9Z A;  1EL4 A;  2LLS A;  1SL9 A;  3B88 A;  3NSO A;  4CLN A;  1A29 A;  1S26 D;  3CZT X;  1SBJ A;  4R1E A;  4JFG A;  4PE1 A;  1RWY A;  2G5Z B;  1NYA A;  1M45 A;  1B8L A;  1IQ3 A;  3S0E A;  2Q4U A;  5D69 A;  5DTZ A;  1KWO B;  1DF0 A;  2KNE A;  1CMF A;  3DQU A;  2ISD A;  1RMO A;  1S1E A;  1UP5 A;  4KGF A;  2KFF A;  1JC1 A;  1B47 A;  3DQL A;  1PVA A;  5LTP A;  3UNW A;  4H3L A;  1QX7 A;  1ZAC A;  1UHH A;  2H5Q A;  3S0G A;  4GNK B;  5EXU A;  5LTQ A;  1YRT B;  1J7R A;  1K93 D;  2F8P A;  1HT9 A;  1TCO B;  2DUI A;  4E68 A;  1Z4H A;  2LCP A;  4ORN A;  3EKH A;  2OTB A;  1QLS A;  4OVN F;  4PT1 A;  4OJ0 A;  2NCP A;  3PLF B;  2HQK A;  5DPI A;  2JUL A;  3EVR A;  3SG7 A;  2SCP A;  1EMB A;  5ER4 X;  1MQ1 A;  2MRD A;  2L2C A;  2LVI A;  2G2S B;  4W76 A;  3VK1 A;  2QEO A;  2QPT A;  2LP2 A;  1J1E A;  1XFW O;  4W6G A;  2G2B A;  2PXW A;  2WC5 A;  5TNC A;  1ZGP A;  3CBE A;  4DXM A;  5DY6 A;  5FVF A;  2DOQ A;  2EC6 B;  3D74 A;  4XGY A;  1DTL A;  1M46 A;  2AWK A;  3IF7 A;  1OOF A;  1B9C A;  1ZMZ A;  5HL1 A;  3O78 A;  2MJW B;  5HGE A;  3Q8I A;  3I5H C;  3FWC A;  5DPH A;  3B86 A;  1RK9 A;  1SL8 A;  3RWA A;  2KI4 B;  4Z4M A;  3U0L A;  4IL1 A;  1YUT A;  4OHS A;  4NDD A;  1GJY A;  5JJG A;  2OTG B;  1WY9 A;  3SJS A;  2ZMW A;  4HQ8 A;  2NZ0 A;  1EMC A;  1XMZ A;  1JC2 A;  3PM8 A;  2HCG A;  1NCY A;  2VVI A;  3BXC A;  1OW4 A;  3NT3 A;  2O29 A;  1W7J B;  2QEH A;  3W1D A;  1XA9 A;  1J7P A;  2MLE C;  2DD7 A;  2ERB A;  3M24 A;  3WHT B;  2CNP A;  3S0A A;  2B3P A;  4J8A A;  2I7A A;  3LCP C;  3PSR A;  4M2Q A;  1ZFS A;  4LQU A;  1DJW A;  2V4E A;  5FHV A;  3L4A A;  4W6K A;  2YFP A;  4DKN A;  3LVA A;  3BXB A;  3MGF A;  2KHN A;  2AWL A;  1U5I A;  1QV1 A;  5EB7 A;  3S0F A;  1JWD A;  2HRS A;  5FI6 A;  4GOB A;  1MWN A;  2JPT A;  5I94 A;  1OMV A;  5AER A;  1C7W A;  3ST3 A;  4MBE A;  4HQ9 A;  2BNX A;  4KF5 C;  1CTR A;  1EMA A;  5EHU A;  4MZK A;  2YE1 A;  5HZO A;  1QYO A;  5FI2 A;  3I5F B;  1NP8 A;  3FE9 A;  1NX3 A;  1F09 A;  4GES B;  2EMD A;  5GQQ C;  2HPS A;  3TDU A;  1OXF A;  1EMF A;  1R2U A;  5EL2 A;  2CT9 A;  3D10 A;  3OSR A;  1REC A;  4PPL A;  5HZU A;  4DXP A;  2H8Q A;  1QY3 A;  2QLE A;  3TS5 B;  2KGR A;  4NQG A;  1QIW A;  1L2O B;  1YUU A;  1SKT A;  3E5V A;  3NEZ A;  1CFC A;  5DIC A;  2B3Q A;  3U8P A;  4DXN A;  3CR2 A;  4NWS A;  4F7F A;  1DF0 B;  1PAL A;  3LF4 B;  1TTX A;  2WSO A;  4R6B A;  2F2P A;  3PN7 B;  4L1I A;  4PHK A;  1LA3 A;  4DKM A;  4ZF5 A;  5H89 A;  3FS7 A;  3OB2 B;  1BG1 A;  3E5W A;  1RFJ A;  1BU3 A;  2L5X B;  2HQ8 A;  3PJ7 A;  5I2Q A;  1XFX O;  1FI5 A;  4C0J A;  2EHB A;  1H8B A;  3WCK A;  4LW5 A;  1UUR A;  1S6J A;  2PVB A;  2IE2 A;  2K7B A;  2WOS A;  4W72 A;  1TUJ A;  2JT0 A;  4PFE A;  2EGD A;  4XOV A;  2K0J A;  4KEX A;  2WUR A;  4W6S A;  1MOV A;  2LM5 A;  4MEW A;  1WRK A;  3A8R A;  4W7C A;  3ZUJ A;  4PCW A;  2L50 A;  4TNC A;  2HQW A;  4GBA A;  2F3Y A;  1B7T Z;  1UHI A;  2A48 A;  4RYW A;  2JRF A;  3JVT B;  1SPY A;  5HKZ A;  4W7A A;  2JU0 A;  3NSK A;  1DGV A;  3SS5 A;  2VZX A;  1PSR A;  2KI6 C;  1YHI A;  4ZF4 A;  3L4L A;  2Z6X A;  5J2O A;  1MXE A;  2JPO A;  5CPV A;  4YBH B;  4F0Z B;  1A4P A;  1MR8 A;  1C3Y A;  1MYW A;  4W7X A;  4XL5 A;  1XVJ A;  3DQA A;  2JOJ A;  1CB1 A;  1BR4 B;  2H5P A;  2WND A;  2RH7 A;  4YGB B;  2BCX A;  2DDC A;  1SR6 B;  4A4B A;  2H61 A;  3EK4 A;  5EXC I;  2PRU A;  2WC8 A;  1JC0 A;  3TMR A;  1LKJ A;  2CTN A;  3D77 A;  1SCV A;  3ZNI A;  3EVU A;  1F70 A;  5KSZ A;  2GGM A;  4QJ5 B;  4U2V A;  1WLZ A;  1GM0 A;  3K1K A;  1S6I A;  5FI7 A;  5AXI A;  2M9G A;  4W6P A;  1YFP A;  3SVS A;  4EUL A;  3R72 A;  3VRR A;  3BX9 A;  2AUC A;  3ICB A;  1K90 D;  1AVS A;  2DUF A;  2BE4 A;  4YGA A;  2KBI A;  2G9B A;  5AFP A;  3OBV A;  2V4E B;  1S5G Z;  2P6B B;  3DY9 A;  1CV7 A;  2LE9 B;  2FZU A;  4W6L A;  2KDH A;  1IJ5 A;  1GFL A;  4W7E A;  4GGF C;  2LHL A;  1DJY A;  4LJD C;  2P70 A;  3C1V A;  3EK7 A;  3IVT A;  3I5I B;  1Q73 A;  2QEV A;  1Q4A A;  1ODB A;  2PAL A;  1UHN A;  3CAB A;  5HLV A;  2KLD A;  3FE6 A;  4GFT A;  4N1F A;  4GF6 B;  2KAY A;  2BBN A;  1Q4C A;  3QME A;  3VRP A;  3G9A A;  1SCM C;  4USL A;  2G3O A;  3DZT A;  2LMU A;  1F4O A;  1T14 A;  4KF4 A;  4KW8 A;  3DQ6 A;  3I5G C;  3WLC A;  2GGZ A;  5DPJ A;  1CDM A;  4KW4 A;  5HKY A;  2OTE A;  1N2D A;  1GGW A;  3DQ8 A;  1RRO A;  1CLB A;  4ZCV A;  2JC2 A;  1R6P A;  1N65 A;  4DUQ A;  3VRO A;  3JTD B;  5DTY A;  5HYD A;  2O5G A;  5DU0 A;  3NED A;  2Y1N A;  3DQ2 A;  3TMT A;  1J7Q A;  1EG4 A;  1KFU S;  2FJU B;  4KAG A;  1KFX L;  1B8C A;  2H5O A;  1QLK A;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  2KBM A;  3SSL A;  3DQ3 A;  1JF0 A;  3WNX B;  1AJ5 A;  3DQI A;  1TNP A;  2OS8 B;  3DQF A;  3VRQ A;  3CGL A;  1KSM A;  4YGC B;  3BUX B;  3GK2 A;  2EMN A;  3TUY C;  2K8M B;  1PVB A;  2A46 A;  1DJZ A;  1EXR A;  4AS8 A;  4MLW A;  1CMG A;  3SRY A;  2KYC A;  4ZBL A;  3SST A;  2A56 B;  3I19 A;  4TZA A;  2E6W A;  3KCT A;  2ZO7 A;  3SS3 A;  4GAO A;  1BLQ A;  4W6C A;  3CB9 A;  2HF5 A;  1PUL A;  4BY4 A;  1J55 A;  1YJF A;  3CYZ A;  3CS1 A;  2ICR A;  1AUI B;  4XJK B;  1TIZ A;  3LSA A;  2PAS A;  4H3N A;  4W6A A;  4ZIN A;  1GL4 A;  2O60 A;  2G6X A;  4OZD A;  5DQM A;  2LNK A;  5IBW A;  1S6Z A;  1CDL A;  3V2L A;  4MRY A;  4MSP A;  1QX5 B;  2JT3 A;  3SVB A;  1TNQ A;  3SS4 A;  4MVF A;  3KO0 A;  4L9M A;  2WIS A;  2NCO A;  4W6I A;  5I2L A;  1QWV A;  4XOW A;  2A54 B;  4H47 A;  1HCJ A;  1DGU A;  2GX0 A;  2QU1 A;  2JT8 A;  3EKJ A;  4W6U A;  2GTE A;  2L0P A;  2NXQ A;  1NPQ A;  2DUH A;  2OKW A;  4OQW A;  2BTJ A;  3HX4 A;  2C9J A;  3WLD A;  4JD9 A;  2COL B;  2CBL A;  5DKR A;  4W6D A;  4PPK A;  4DXI A;  3PIB A;  2EC6 C;  3GL4 A;  5F9G A;  3OB1 B;  2KOT A;  2KSP A;  3CFF A;  1QXP A;  1W7T A;  2POX A;  2LVJ A;  2LLT A;  2ZRS A;  4M2P A;  1H6R A;  1KK7 Y;  4QJ3 B;  1Z1Q A;  4JQ0 D;  1OE9 B;  2DUE A;  2PXS A;  1DMO A;  4Q7T A;  1KQM C;  4XYN A;  2QEB A;  2BE6 A;  4ORB B;  2H5R A;  1S3P A;  1C07 A;  2K2A A;  1UUS A;  2AWM A;  5BTT B;  3DVE A;  1KQV A;  2HJO A;  1AP4 A;  5KTY A;  4RTC A;  1JBY A;  4AQI A;  3SG4 A;  1YZW A;  2PYQ A;  3U0K A;  4LJB A;  4GPL B;  3DXL A;  2M29 A;  4I5N B;  4YI9 A;  3BFA A;  1TNX A;  3BXA A;  3LL8 B;  3VIC A;  4ORA B;  3GJ1 A;  4W69 A;  1QX2 A;  5BQL A;  4HE4 A;  4PE7 A;  3BUN B;  3ZUL A;  3SSV A;  4EDO A;  2QZ0 A;  2JAD A;  1OMR A;  1SNL A;  3S0B A;  4DXO A;  1OZO A;  3D75 A;  3PAL A;  1N0Y A;  3OP0 A;  4P2Y B;  4PHJ A;  3DQH A;  2L51 A;  1IIO A;  1DJH A;  1V1F A;  1SW8 A;  1S6C A;  4IJ7 A;  4PE4 A;  1QIV A;  1EML A;  1W7U A;  1Y1X A;  4IK1 A;  5FVI A;  3AI4 A;  1YTZ C;  1D1O A;  4IZN A;  1IRJ A;  3DPX A;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  3CDN A;  4W74 A;  3SVE A;  3F45 A;  2DUG A;  4IK4 A;  3LS3 A;  1SY9 A;  4P1Q A;  1SSE B;  3SIA A;  2A47 A;  3I5F C;  4J88 A;  4LQT A;  4GGF A;  5HLO A;  1WDC C;  2QDI A;  2GW4 B;  1CFD A;  2F2O A;  3SVD A;  1F0B A;  1IGV A;  1UHK A;  1B8R A;  2FCE A;  1DC1 A;  3L47 A;  1ZGO A; 
#chains in the Genus database with same CATH homology
 1M31 A;  4HQC A;  3ADF A;  1EG3 A;  1QJT A;  1HQV A;  2K61 A;  5CSF A;  1MOU A;  3EVP A;  1K8U A;  3CD9 A;  5AQB B;  3PN7 C;  4HRG A;  4N5X A;  3V3D A;  1AK8 A;  2IS9 A;  3OHM B;  3PJ5 A;  3SVN A;  2G16 B;  2LMT A;  4W6J A;  1QVI Z;  5AEQ A;  5HKW A;  2M0R A;  3OSQ A;  4W73 A;  2ZN8 A;  2AWJ A;  4FTG A;  3H4S E;  1XAE A;  4EDS A;  4I2Y A;  1Z1P A;  4Q9X A;  3O6B A;  4C0L A;  2HFC A;  3VHT A;  5JOL A;  4JWQ A;  4W7F A;  3BXK A;  1GGZ A;  2ZFD A;  1RJV A;  2BL0 C;  2LVK A;  4J89 A;  1Q4D A;  1A03 A;  4Q04 A;  2VAE A;  1EMK A;  1KYS A;  1YX8 A;  4OCI A;  2WCB A;  3DVJ A;  3CFA A;  4MRX A;  1W7I B;  4OY4 A;  3DQN A;  1NCZ A;  5AAN A;  2B1U A;  2LV7 A;  4ZIO A;  3SS0 A;  1TOP A;  1K9K A;  1Y1A A;  5DTL A;  4B5Y A;  2MBX A;  3DF0 A;  4W7R A;  1ALV A;  3EVV A;  1CDN A;  1C7V A;  2JXL A;  4HRE E;  3OGO A;  2IOV A;  4XJK A;  3DPW A;  4EN1 A;  4Q7U A;  1NSH A;  3CGA A;  4ZB1 A;  2D8N A;  5CSJ A;  3E3R A;  3S05 A;  2JNF A;  2Q6P A;  2WCE A;  4HSZ A;  3W1C A;  5ER5 A;  1XO5 A;  1WRL A;  3IQO A;  2KGB C;  4UTS A;  5EXB A;  3DD4 A;  2FCD A;  3ZTF A;  2NLN A;  1M39 A;  2Z6Y A;  1IWQ A;  2K7O A;  2H9W A;  1QYQ A;  2QLH A;  1EMM A;  1FPW A;  2Q57 A;  1PSB A;  1G4Y R;  3DQM A;  2WHS A;  4XVP A;  3NSI A;  5PAL A;  2GV5 A;  2K7C A;  4FQO A;  4A4C A;  2HET A;  4OR9 B;  2DDD A;  2SAS A;  3SG5 A;  1OQP A;  5DQB A;  4W6H A;  4W6T A;  2FL1 A;  1XK4 C;  3KEV A;  3VGO A;  1KSO A;  1WRZ A;  4PDZ A;  1SMG A;  1Q4E A;  4RYS A;  4KA9 A;  5EBJ A;  2L4H A;  2LUC A;  1ZGQ A;  5EJU A;  2V4E C;  1UHJ A;  4H3M A;  3DQJ A;  5BTT A;  2G3D B;  2JNX A;  2ARL A;  4ZF3 A;  2LUX A;  2I2R E;  5HZS A;  3AAJ A;  3KCS A;  4CID A;  3SSY A;  3RM1 A;  3I5I C;  1FBV A;  2AAO A;  1SRA A;  1KK7 Z;  4L13 A;  3CLN A;  4TZG A;  1MXL C;  3E5T A;  1K94 A;  2HGY A;  3DQ5 A;  1BOD A;  2KFG A;  2MA2 A;  3NF0 A;  1YRU B;  3CFH A;  4PPJ A;  1KK8 C;  3D0Y B;  4PE0 A;  3H1O A;  5DPG A;  1LIN A;  5CSI A;  2F3Z A;  4W77 A;  4C0K A;  1QAT A;  1CM1 A;  4DIR A;  1H4U A;  1SCM B;  3HCM A;  5H88 A;  2M49 B;  2H6V A;  3I5G B;  1G33 A;  1RTP 1;  1AHR A;  2CXJ A;  1XFZ O;  1DJI A;  4JC2 A;  1RMM A;  3NSL A;  1SYM A;  2O24 A;  1YJ2 A;  3UG0 A;  1BFP A;  5BT0 A;  1MF8 B;  5T3I A;  4UPG A;  1B7T Y;  2GX2 A;  4KF5 A;  3RWT A;  1KYP A;  3VHT B;  3GB3 A;  5LK4 A;  4W6N A;  1G7K A;  4AR7 A;  3AKO A;  3DQE A;  2A52 B;  3UFZ A;  3O77 A;  1LXF C;  4CFQ A;  1QYF A;  2M97 A;  2A50 B;  3LA1 A;  4YI8 A;  1HUY A;  1IG5 A;  3OX5 A;  1WLM A;  1KWO C;  4I5L B;  1XQM A;  1DT7 B;  2Z1O A;  5HBD A;  1B9A A;  2H2K A;  3TUY B;  4ZFS A;  2LAN A;  1YR5 A;  4PAL A;  3DF0 B;  2A53 B;  4MZL A;  3DVK A;  2IB6 A;  2JQ6 A;  2L98 A;  2BCB A;  2WHT A;  2VAD A;  2VVH A;  1K96 A;  3LLE A;  2HPW A;  1FW4 A;  1KYR A;  1ZUX A;  2BKH B;  2OGR A;  4YGE B;  5EB6 A;  1KCY A;  4QJ4 B;  4IK9 A;  1CFF A;  1RM9 A;  2H61 C;  3CR4 X;  1SK6 D;  2YE0 A;  2RGI A;  1OZS A;  2WIQ A;  1A75 A;  5G08 A;  3K21 A;  2QRF A;  1J1D A;  1YHG A;  3SVO A;  2VRG A;  4B30 A;  4M2O A;  1BJF A;  1RRX A;  1DJX A;  1OXD A;  1F54 A;  1BF5 A;  2LLU A;  3DQ7 A;  4YRU A;  4W7D A;  2VVJ A;  2QAC A;  2K7D A;  3DQ4 A;  1S5G Y;  2ZNE A;  1M63 B;  1OOJ A;  3NT9 A;  1K9P A;  2EMO A;  2M8U A;  4Q9W A;  2KI4 C;  1BMO A;  3GEX A;  1TNW A;  2V53 A;  1NX0 A;  2OTG C;  4DRW A;  1JFK A;  2I94 A;  4W75 A;  3QRX A;  3A8S A;  3I5H B;  3ZUF A;  1SL7 A;  2LP3 A;  4JEO A;  1KQM B;  1CM4 A;  2Z6Z A;  3U8A A;  1MUX A;  1YX7 A;  3BUO B;  5DKN A;  5HZT A;  2L2E A;  2HGD A;  2P4M A;  2JTZ A;  1EH2 A;  1YUS A;  5FVG A;  1NIW A;  1RMP A;  3SVC A;  2M7L A;  3LVC A;  3GOF A;  1F55 A;  1IH0 A;  1YVL A;  1CNP A;  1DVI A;  1QS7 A;  5H87 A;  4IK5 A;  2KI6 D;  3DVM A;  3IR8 A;  3KF9 A;  2GW3 A;  2E30 A;  3M0W A;  2FOT A;  4P76 A;  1K2H A;  3DPZ A;  2ZND A;  5DTX A;  4AOM A;  1C4F A;  4GGN A;  1UIS A;  1LA0 A;  1XK4 A;  2L4I A;  1FF1 A;  4PHM A;  1F71 A;  1ALW A;  1F8H A;  4JGE A;  2BEC A;  3SVR A;  5FYX A;  3OX6 A;  2LAP A;  3CTN A;  4LJC A;  3LK1 A;  3BOW A;  2QLI A;  3GK1 A;  2ZN9 A;  1LVC D;  2KAX A;  4JRB A;  3P8U A;  3M22 A;  5BPJ A;  1CLL A;  3U0N A;  4MZJ A;  4LJD A;  2YDZ A;  2Y4Q A;  1OSA A;  3TZ1 A;  2QLG A;  5DKQ A;  2DD9 A;  4DS7 A;  1XFU O;  2OPO A;  3FIA A;  2JTT A;  2KYF A;  3D0Y A;  4NDC A;  4IK8 A;  2HQZ A;  2LHI A;  3TS5 C;  4I5J A;  1WDC B;  4IK3 A;  1L2O C;  2MAZ A;  4YGD B;  3AI5 A;  4R6D A;  3AKA A;  4WRI A;  3U8C A;  1QTX A;  1Y0V H;  3PAT A;  2PSR A;  3SV5 A;  1XSS A;  3PJB A;  2C9I A;  4N3D A;  3PFV A;  5D7F A;  2CCM A;  3SIB A;  2ZKM X;  2IB5 A;  4MN0 A;  1VRK A;  3GK4 X;  3P28 A;  1OXE A;  3LVD A;  1NCX A;  2BBM A;  2K2F A;  4JPZ B;  3SVU A;  3DQO A;  1OMD A;  2WCF A;  4ORC B;  1JBZ A;  4I5K A;  1H4B A;  2FWQ A;  1YUR A;  4DXQ A;  1NX1 A;  5KTG A;  1IKU A;  4ETO A;  5CSN A;  2JXC A;  2WSN A;  3DQ1 A;  2MHH A;  2BKI B;  3JVT C;  5DRF A;  3CD1 A;  4ICB A;  1YHH A;  3RLZ A;  2M1K B;  2BL0 B;  1A75 B;  4D1E A;  1XFV O;  3BYA A;  4OV2 A;  2KFH A;  3DQ9 A;  4B30 B;  1X02 A;  3ST4 A;  4W6O A;  4Z4K A;  1JSA A;  2OKY A;  1XFY O;  3WXA A;  3AKB A;  1CFP A;  3CR5 X;  2PMY A;  5I8N A;  3DQD A;  1NWD A;  1K9U A;  3LK0 A;  2ZO6 A;  2M3W A;  1CDP A;  2F33 A;  1S36 A;  2WHU A;  5HW9 A;  1BR1 B;  1AJ4 A;  5DRG A;  1IQ5 A;  1F4Q A;  4KPI A;  1SR6 C;  2JWW A;  4OKH A;  4L12 A;  3SSH A;  1CKK A;  4AQJ A;  3AAK A;  1UWO A;  2JZI A;  4N1G A;  2WOR A;  2G6Y A;  1EMG A;  4OGS A;  3MSE B;  2Y0G A;  4ANJ A;  4W6M A;  1PRW A;  1NX2 A;  1G8I A;  4P5O E;  1A2X A;  4U8D A;  1MHO A;  2O2B A;  2OJK A;  2KQ6 A;  1XYD A;  3SG6 A;  1DJG A;  3LF3 A;  3O2P A;  3TDZ A;  1W7S A;  4W6B A;  1Y6W A;  1E8A A;  1GGX A;  1YVH A;  1ZUZ A;  4KGE A;  1JUO A;  5I2O A;  5KU1 A;  4ZCU A;  2Y5I A;  3DQK A;  4GUK A;  1J7O A;  3EK8 A;  1QXT A;  1EJ3 A;  2ZRT A;  4PHN A;  3KHE A;  4W6R A;  1NUB A;  1IJ6 A;  1K95 A;  4KW9 A;  1L7Z A;  3BOW B;  1QV0 A;  3SG2 A;  3CWG A;  5LTR A;  3BUW B;  1U5I B;  4BDU A;  1JF2 A;  1V1G A;  4W6F A;  2BCA A;  3A4U B;  3NXA A;  2KQY A;  4WQ3 A;  1JFJ A;  1QAS A;  3SSP A;  3SG3 A;  3DQC A;  1BT6 A;  2QLG B;  5K89 A;  4CFR A;  2MLF C;  2LVV A;  4NDB A;  2A4J A;  1BOC A;  3VRN A;  2AH8 A;  2KAV A;  5F6T A;  1TRF A;  1Q4B A;  3H1R A;  1TCF A;  4HRH A;  1QVI Y;  3SSK A;  1PK0 D;  3GJ2 A;  3IP2 A;  3JTD C;  1KK8 B;  2ZMU A;  4BY5 A;  1KFX S;  2QT2 A;  1EME A;  2AHA A;  3BQ3 A;  2AMI A;  4HVF A;  1Q80 A;  3ZWH A;  2I18 A;  1TN4 A;  1KP5 A;  3U0M A;  4JF9 A;  1Y1U A;  3ST2 A;  3WHU B;  1FI6 A;  2Q91 A;  3ST0 A;  2LC5 A;  2OS8 C;  4Q7R A;  4H48 A;  3ED8 A;  2TN4 A;  1GQM A;  1B1G A;  2M1U A;  4WQ2 A;  5B8I B;  5J3X A;  3FWB A;  1ZOT B;  1XA5 A;  2LMV A;  1KFU L;  2R2I A;  1B4C A;  2G6E A;  3BUM B;  1CLM A;  2M7N A;  4EMQ A;  1EL4 A;  2LLS A;  1SL9 A;  3NSO A;  4CLN A;  1A29 A;  1S26 D;  3CZT X;  1SBJ A;  4R1E A;  4JFG A;  4PE1 A;  1RWY A;  2G5Z B;  1NYA A;  1M45 A;  1B8L A;  1IQ3 A;  2Q4U A;  5D69 A;  5DTZ A;  1KWO B;  1DF0 A;  2KNE A;  1CMF A;  3DQU A;  2ISD A;  1RMO A;  1S1E A;  1UP5 A;  4KGF A;  2KFF A;  1JC1 A;  1B47 A;  3DQL A;  1PVA A;  5LTP A;  4H3L A;  1QX7 A;  1ZAC A;  1UHH A;  2H5Q A;  4GNK B;  5EXU A;  5LTQ A;  1YRT B;  1J7R A;  1K93 D;  2F8P A;  1HT9 A;  1TCO B;  2DUI A;  4E68 A;  2LCP A;  4ORN A;  3EKH A;  2OTB A;  1QLS A;  4OVN F;  4OJ0 A;  2NCP A;  3PLF B;  2HQK A;  5DPI A;  2JUL A;  3EVR A;  3SG7 A;  2SCP A;  1EMB A;  5ER4 X;  1MQ1 A;  2MRD A;  2LVI A;  2G2S B;  4W76 A;  3VK1 A;  2QPT A;  2LP2 A;  1J1E A;  1XFW O;  4W6G A;  2G2B A;  2PXW A;  5TNC A;  1ZGP A;  3CBE A;  4DXM A;  5DY6 A;  5FVF A;  2DOQ A;  2EC6 B;  4XGY A;  1DTL A;  1M46 A;  2AWK A;  3IF7 A;  1B9C A;  1ZMZ A;  3O78 A;  2MJW B;  5HGE A;  3I5H C;  3FWC A;  5DPH A;  1RK9 A;  1SL8 A;  3RWA A;  2KI4 B;  4Z4M A;  3U0L A;  4IL1 A;  1YUT A;  4OHS A;  4NDD A;  1GJY A;  5JJG A;  2OTG B;  1WY9 A;  3SJS A;  2ZMW A;  4HQ8 A;  2NZ0 A;  1EMC A;  1XMZ A;  1JC2 A;  3PM8 A;  2HCG A;  1NCY A;  2VVI A;  3BXC A;  3NT3 A;  2O29 A;  1W7J B;  3W1D A;  1XA9 A;  1J7P A;  2MLE C;  2DD7 A;  3M24 A;  3WHT B;  2CNP A;  2B3P A;  4J8A A;  2I7A A;  3LCP C;  3PSR A;  4M2Q A;  1ZFS A;  4LQU A;  1DJW A;  2V4E A;  5FHV A;  4W6K A;  2YFP A;  4DKN A;  3LVA A;  3BXB A;  3MGF A;  2KHN A;  2AWL A;  1U5I A;  1QV1 A;  5EB7 A;  1JWD A;  2HRS A;  4GOB A;  1MWN A;  2JPT A;  1OMV A;  5AER A;  1C7W A;  3ST3 A;  4MBE A;  4HQ9 A;  4KF5 C;  1CTR A;  1EMA A;  5EHU A;  4MZK A;  2YE1 A;  5HZO A;  1QYO A;  3I5F B;  1NP8 A;  1NX3 A;  1F09 A;  4GES B;  2EMD A;  5GQQ C;  2HPS A;  3TDU A;  1OXF A;  1EMF A;  1R2U A;  2CT9 A;  3D10 A;  3OSR A;  1REC A;  4PPL A;  5HZU A;  4DXP A;  2H8Q A;  1QY3 A;  2QLE A;  3TS5 B;  2KGR A;  4NQG A;  1QIW A;  1L2O B;  1YUU A;  1SKT A;  3E5V A;  3NEZ A;  1CFC A;  2B3Q A;  3U8P A;  4DXN A;  3CR2 A;  4NWS A;  1DF0 B;  1PAL A;  3LF4 B;  1TTX A;  4R6B A;  2WSO A;  2F2P A;  3PN7 B;  4L1I A;  4PHK A;  1LA3 A;  4DKM A;  4ZF5 A;  5H89 A;  3FS7 A;  3OB2 B;  1BG1 A;  1RFJ A;  1BU3 A;  3E5W A;  2L5X B;  3PJ7 A;  2HQ8 A;  5I2Q A;  1XFX O;  1FI5 A;  4C0J A;  2EHB A;  1H8B A;  3WCK A;  4LW5 A;  1UUR A;  1S6J A;  2PVB A;  2IE2 A;  2K7B A;  2WOS A;  4W72 A;  2JT0 A;  4PFE A;  2EGD A;  4XOV A;  2K0J A;  4KEX A;  2WUR A;  4W6S A;  1MOV A;  2LM5 A;  4MEW A;  1WRK A;  3A8R A;  4W7C A;  3ZUJ A;  4PCW A;  2L50 A;  4TNC A;  2HQW A;  4GBA A;  2F3Y A;  1B7T Z;  1UHI A;  2A48 A;  4RYW A;  2JRF A;  3JVT B;  1SPY A;  5HKZ A;  4W7A A;  2JU0 A;  3NSK A;  1DGV A;  2VZX A;  1PSR A;  2KI6 C;  1YHI A;  4ZF4 A;  2Z6X A;  5J2O A;  1MXE A;  5CPV A;  4YBH B;  4F0Z B;  1A4P A;  1MR8 A;  1MYW A;  4W7X A;  4XL5 A;  1XVJ A;  3DQA A;  2JOJ A;  1CB1 A;  1BR4 B;  2H5P A;  2WND A;  2RH7 A;  4YGB B;  2BCX A;  2DDC A;  1SR6 B;  4A4B A;  2H61 A;  3EK4 A;  5EXC I;  2PRU A;  2WC8 A;  1JC0 A;  3TMR A;  1LKJ A;  2CTN A;  1SCV A;  3ZNI A;  3EVU A;  1F70 A;  5KSZ A;  2GGM A;  4QJ5 B;  4U2V A;  1WLZ A;  3K1K A;  1S6I A;  5AXI A;  2M9G A;  4W6P A;  1YFP A;  3SVS A;  4EUL A;  3VRR A;  3BX9 A;  2AUC A;  3ICB A;  1K90 D;  1AVS A;  2DUF A;  2BE4 A;  4YGA A;  2KBI A;  2G9B A;  5AFP A;  2V4E B;  1S5G Z;  2P6B B;  1CV7 A;  2LE9 B;  2FZU A;  4W6L A;  2KDH A;  1IJ5 A;  1GFL A;  4W7E A;  4GGF C;  2LHL A;  1DJY A;  4LJD C;  3C1V A;  3EK7 A;  3I5I B;  1Q73 A;  1Q4A A;  1ODB A;  2PAL A;  1UHN A;  5HLV A;  4GFT A;  4N1F A;  4GF6 B;  2KAY A;  2BBN A;  1Q4C A;  3VRP A;  3G9A A;  1SCM C;  4USL A;  2G3O A;  2LMU A;  1F4O A;  4KF4 A;  4KW8 A;  3DQ6 A;  3I5G C;  3WLC A;  2GGZ A;  5DPJ A;  1CDM A;  4KW4 A;  5HKY A;  2OTE A;  1N2D A;  1GGW A;  3DQ8 A;  1RRO A;  1CLB A;  4ZCV A;  2JC2 A;  1R6P A;  1N65 A;  4DUQ A;  3VRO A;  3JTD B;  5DTY A;  5HYD A;  2O5G A;  5DU0 A;  3NED A;  2Y1N A;  3DQ2 A;  3TMT A;  1J7Q A;  1EG4 A;  1KFU S;  2FJU B;  4KAG A;  1KFX L;  1B8C A;  2H5O A;  1QLK A;  3O4Y A;  2Y1M A;  4DCK A;  1JBA A;  2KBM A;  3SSL A;  3WNX B;  1JF0 A;  3DQ3 A;  1AJ5 A;  3DQI A;  1TNP A;  2OS8 B;  3DQF A;  3VRQ A;  3CGL A;  1KSM A;  4YGC B;  3BUX B;  3GK2 A;  2EMN A;  3TUY C;  2K8M B;  1PVB A;  2A46 A;  1DJZ A;  1EXR A;  4AS8 A;  4MLW A;  1CMG A;  3SRY A;  2KYC A;  4ZBL A;  3SST A;  2A56 B;  3I19 A;  4TZA A;  2E6W A;  3KCT A;  2ZO7 A;  4GAO A;  1BLQ A;  4W6C A;  3CB9 A;  2HF5 A;  1PUL A;  4BY4 A;  1J55 A;  1YJF A;  3CS1 A;  2ICR A;  1AUI B;  4XJK B;  1TIZ A;  3LSA A;  2PAS A;  4H3N A;  4W6A A;  4ZIN A;  1GL4 A;  2O60 A;  2G6X A;  5DQM A;  2LNK A;  5IBW A;  1S6Z A;  1CDL A;  4MRY A;  4MSP A;  1QX5 B;  2JT3 A;  3SVB A;  1TNQ A;  4MVF A;  3KO0 A;  4L9M A;  2WIS A;  2NCO A;  4W6I A;  5I2L A;  4XOW A;  2A54 B;  4H47 A;  1HCJ A;  1DGU A;  2GX0 A;  2QU1 A;  2JT8 A;  3EKJ A;  4W6U A;  2L0P A;  2NXQ A;  1NPQ A;  2DUH A;  2OKW A;  4OQW A;  2BTJ A;  3HX4 A;  2C9J A;  3WLD A;  2COL B;  2CBL A;  5DKR A;  4W6D A;  4PPK A;  4DXI A;  3PIB A;  2EC6 C;  3GL4 A;  5F9G A;  3OB1 B;  2KOT A;  2KSP A;  3CFF A;  1QXP A;  1W7T A;  2POX A;  2LVJ A;  2LLT A;  2ZRS A;  4M2P A;  1H6R A;  1KK7 Y;  4QJ3 B;  1Z1Q A;  4JQ0 D;  1OE9 B;  2DUE A;  2PXS A;  1DMO A;  4Q7T A;  1KQM C;  4XYN A;  2BE6 A;  4ORB B;  2H5R A;  1S3P A;  1C07 A;  2K2A A;  1UUS A;  2AWM A;  5BTT B;  3DVE A;  1KQV A;  2HJO A;  1AP4 A;  5KTY A;  4RTC A;  1JBY A;  4AQI A;  3SG4 A;  1YZW A;  3U0K A;  4LJB A;  4GPL B;  2M29 A;  4I5N B;  4YI9 A;  1TNX A;  3BXA A;  3LL8 B;  3VIC A;  4ORA B;  3GJ1 A;  4W69 A;  1QX2 A;  5BQL A;  4HE4 A;  4PE7 A;  3BUN B;  3ZUL A;  3SSV A;  4EDO A;  2QZ0 A;  2JAD A;  1OMR A;  1SNL A;  4DXO A;  1OZO A;  3PAL A;  1N0Y A;  3OP0 A;  4P2Y B;  4PHJ A;  3DQH A;  2L51 A;  1DJH A;  1V1F A;  1SW8 A;  1S6C A;  4PE4 A;  1QIV A;  1EML A;  1W7U A;  1Y1X A;  4IK1 A;  5FVI A;  3AI4 A;  1YTZ C;  1D1O A;  4IZN A;  1IRJ A;  3DPX A;  3IQQ A;  3KPX A;  3TDI A;  4CPV A;  4W74 A;  3SVE A;  3F45 A;  2DUG A;  4IK4 A;  3LS3 A;  1SY9 A;  4P1Q A;  3SIA A;  2A47 A;  3I5F C;  4J88 A;  4LQT A;  4GGF A;  5HLO A;  1WDC C;  2GW4 B;  1CFD A;  2F2O A;  3SVD A;  1F0B A;  1IGV A;  1UHK A;  1B8R A;  2FCE A;  1ZGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...