3SG6A

Crystal structure of dimeric gcamp2-lia(linker 1)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
409
structure length
383
Chain Sequence
b'SRRKWNKTGHAVRAIGRLSSLIANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 125
structure length 383
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg6A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg6A01
3OP0A 1IH0A 5HKZA 1A75B 1XK4A 3PJ5A 1C4FA 2HQKA 1QIWA 2IB5A 1KK8B 1D1OA 3OGOA 2KAYA 4MSPA 3MGFA 4W69A 2M49B 1MR8A 4MRYA 3DQDA 2WHUA 2ZNEA 1M39A 1SMGA 3LVDA 3DQAA 1Q4BA 2ZKMX 4KW8A 3SSYA 1KFXS 5EXCI 1X02A 4IK4A 1JFJA 1F54A 1GGXA 1NUBA 2BBMA 4JWQA 1CMGA 5HYDA 1SL8A 1SCMB 2MAZA 5KSZA 1YVLA 1HQVA 1EMEA 1A4PA 2M97A 3DQ5A 3TS5C 1YUUA 4Q7TA 4LJBA 1B8LA 1TCOB 2A56B 4L1IA 2AAOA 1IQ5A 4N5XA 3SV5A 1Q4AA 5DTZA 1PSBA 4MEWA 5TNCA 2RH7A 3BUMB 1ODBA 4HE4A 3AAJA 3I5GB 3JVTC 1DF0A 5I8NA 1OXFA 2CBLA 1UHJA 1K93D 2JC2A 1W7IB 4XJKB 2ZRTA 5DTXA 3VGOA 1RMMA 2JRFA 1K9UA 4QJ3B 5DRGA 1OMDA 2F3ZA 4OKHA 2WIQA 1MXLC 3QRXA 3CTNA 4W6NA 1EMGA 4MZJA 2M1KB 1UURA 1RJVA 2WHTA 2KFFA 5F6TA 1LA0A 4W6IA 1TNXA 1BLQA 1C7WA 1PK0D 2JOJA 5DU0A 1DGUA 2K7CA 1A2XA 4IL1A 2WOSA 5DKQA 2G5ZB 1K9KA 1ZACA 1C07A 4B30A 2F2OA 2SCPA 3KCTA 3CGAA 1JBZA 1XQMA 2A46A 4W6PA 1B7TZ 1TNWA 1KQVA 3ZULA 3DQKA 4W7RA 2MHHA 1PVBA 1M31A 2KFHA 3TDZA 2WSNA 1MWNA 3LF4B 5I2OA 2I2RE 2JWWA 5EBJA 2LC5A 4P5OE 3CB9A 2OPOA 2LP2A 4W7AA 2LLSA 4ZCVA 2IOVA 1EH2A 4W6SA 3ZUJA 2ZN9A 4BDUA 2JXLA 3LK0A 1U5IB 3DF0A 3VHTB 4FTGA 1FPWA 3ST3A 3CD9A 1G8IA 3AAKA 4OHSA 2LVVA 3DQ2A 4W74A 2LV7A 3NSKA 1JFKA 2HQZA 2QRFA 2DD9A 4A4CA 4L9MA 2BL0B 1J7PA 3LS3A 3S05A 3CFFA 2LCPA 3V3DA 1UISA 2V4EB 3GEXA 1CM4A 4A4BA 4EULA 3KPXA 2CT9A 4W6GA 3DQJA 3M22A 4ANJA 2COLB 1YHHA 1QTXA 1RWYA 2KYFA 3JTDC 1K95A 1K90D 3AKOA 4Z4MA 1QX2A 5BTTB 2C9JA 4DXOA 5KTGA 3GOFA 3P8UA 4P76A 1CM1A 4GFTA 2MBXA 3PFVA 4DXPA 4KGFA 1B9AA 3SG6A 3EK7A 4CFQA 1VRKA 2ZN8A 1S5GZ 3BUXB 4PDZA 1XK4C 1IJ5A 1YX8A 1S3PA 2O5GA 3SRYA 2LLUA 3I5IC 1Q4DA 1AUIB 1MF8B 4QJ4B 3DQ7A 1J7QA 3ST2A 2LANA 3EVVA 2G6YA 3IQOA 1RTP1 5H89A 1G7KA 2HQ8A 2GV5A 2M3WA 1OE9B 4PE0A 1W7UA 4W6HA 4JGEA 4W75A 3U0NA 2LLTA 2QZ0A 4WRIA 1MQ1A 1WDCB 2YFPA 4PHJA 3TUYC 1DMOA 5IBWA 2H6VA 5H87A 1BODA 2KGRA 2RGIA 3DQMA 4JC2A 1MOUA 3SVCA 1PALA 4YBHB 2AMIA 1J1DA 2PXWA 2LHIA 5ER4X 2VADA 3TS5B 1ZUZA 3CS1A 2AWLA 3K21A 2OS8C 4IK1A 4W6AA 2IS9A 4D1EA 3CZTX 5HW9A 3DQNA 2K7OA 1CLBA 1QV1A 1G4YR 5DPHA 2A4JA 3W1DA 3DPWA 4MLWA 2JZIA 3JVTB 3DD4A 3EKHA 1S6ZA 4YRUA 1K2HA 2F8PA 2E6WA 4W6TA 4NDBA 2QT2A 5DRFA 1RM9A 1R6PA 4LQTA 3AI4A 1NX0A 1DJIA 3DQ9A 1LXFC 2POXA 4KW4A 3OB2B 2CTNA 4IK8A 4W6CA 3SSPA 4H47A 1NSHA 2A48A 2L0PA 5K89A 1F4OA 5JOLA 1PSRA 3HX4A 3WLCA 2Y1MA 1YJFA 1CTRA 5H88A 2LUXA 1QYQA 2O24A 4NQGA 1KCYA 4W7XA 1CFCA 1NWDA 1NYAA 1FW4A 1NPQA 1Y1UA 1AP4A 1XA9A 1F09A 1IG5A 1KYRA 3HCMA 2L50A 1KP5A 3DQ6A 1WRKA 3DQ3A 1ZGQA 1KSMA 2Z6YA 4AQJA 2PRUA 2BL0C 1NX2A 3U0MA 2LVIA 3GL4A 5DQMA 3P28A 1AJ5A 2GW4B 1ALWA 1A03A 2QLGB 2ICRA 2DD7A 3SG5A 1Y1XA 4W6KA 1K96A 3O2PA 2AWMA 1EL4A 4N1FA 3LVAA 3ST4A 1L7ZA 2JTTA 4KW9A 4IK5A 5LK4A 1B7TY 4KAGA 3BYAA 2DDDA 4M2OA 2G16B 2A54B 3GJ1A 1TN4A 5I2LA 4W6MA 1Y0VH 3JTDB 1AK8A 1XSSA 3I19A 2QU1A 3SSLA 3DPZA 2AH8A 4HRHA 2HFCA 4AS8A 1J55A 3DQ1A 4MZKA 5AERA 2IE2A 5FHVA 5AQBB 3EVRA 3PIBA 1H6RA 4L13A 1QV0A 2KAVA 4W6FA 2I94A 4JPZB 1NX1A 3A4UB 4LJDA 2HJOA 3W1CA 1KWOC 2DUIA 2HETA 1S6IA 4J8AA 1DJGA 4MZLA 1CLMA 1RFJA 4KPIA 1WDCC 3PN7C 3DQHA 1TCFA 2ARLA 3G9AA 2Q57A 3I5IB 1YTZC 3I5FC 2Z1OA 1BMOA 4BY5A 5HLOA 4W6LA 1SRAA 1UHKA 4EN1A 3EK4A 4ORAB 4I5JA 1ALVA 3SVRA 2LMVA 4PHNA 4OVNF 2BE6A 1C7VA 2JU0A 1UHIA 1WRZA 4OCIA 1IKUA 1K94A 1SYMA 3TUYB 4W72A 3WCKA 4DKNA 3E5TA 3ZNIA 5DPGA 4R6BA 2JT3A 4CFRA 2H5QA 4MVFA 1NP8A 2WISA 3O77A 2M8UA 2KBMA 4C0KA 3MSEB 1EG3A 1ZMZA 4BY4A 2P4MA 2QLEA 4JQ0D 2HPWA 3ST0A 2KYCA 1XAEA 1S5GY 2OS8B 4AOMA 1DGVA 3U0KA 1DF0B 1ZGPA 2HRSA 1QVIZ 1TOPA 4XL5A 1CFDA 2F33A 1R2UA 4PHMA 3SG7A 2WSOA 2O60A 2KDHA 1QXTA 2MLFC 4USLA 4ZFSA 3M0WA 4ZF4A 4ZCUA 4YGBB 1GFLA 2DUHA 3U8AA 2H61A 5D69A 1ZGOA 4FQOA 4HREE 1K8UA 5AXIA 2WCEA 3SVBA 1S36A 1XFVO 4JFGA 5J3XA 1EMLA 4W77A 1TTXA 3BOWA 2QACA 2H8QA 2VVJA 3GJ2A 2G3OA 1MXEA 4B30B 2LAPA 2AWJA 4GPLB 1BR4B 1YUTA 4IK9A 4Q7UA 2JXCA 3NEDA 2JT8A 1HT9A 3ZTFA 3U8CA 1PVAA 4YGEB 5HLVA 1SY9A 2KOTA 3BXBA 1LA3A 2LNKA 3KEVA 4MRXA 2NXQA 1JBAA 1SL7A 2LMTA 1MUXA 1OXDA 5DTYA 4PFEA 3WNXB 2Y1NA 3DQLA 2VZXA 1XFUO 1N0YA 3DF0B 5ER5A 1UP5A 1DT7B 1BFPA 2HGYA 2H9WA 2OTGC 2HQWA 3OX5A 5LTRA 2LVJA 5J2OA 5HZOA 1EMFA 4HQ9A 2FL1A 3LF3A 4PPKA 3PJ7A 3H4SE 1IWQA 4J89A 2D8NA 2M7LA 2OKWA 2TN4A 2KHNA 3SIAA 2K2AA 4OQWA 4H3MA 1F4QA 4YGAA 2GX0A 4AR7A 1SL9A 1F0BA 4OJ0A 5EHUA 3LSAA 3IR8A 4P1QA 4PALA 5D7FA 4HQCA 1SPYA 1F55A 2VRGA 4GESB 1IGVA 1GGWA 2L98A 4KF5A 2AUCA 4LJDC 3O6BA 3SVOA 5AFPA 3U8PA 2DUFA 4GAOA 1JF0A 2A50B 1AHRA 1XFZO 2BBNA 4EDSA 4UTSA 1JSAA 3DQOA 2OJKA 2JADA 2MJWB 1QIVA 1KWOB 4I2YA 2Q6PA 5BT0A 1JF2A 1N65A 1JC0A 5B8IB 3PN7B 4Z4KA 1F8HA 5HZSA 3I5FB 1E8AA 4GGNA 3DQ8A 3CR4X 1QASA 1W7SA 2G2BA 2K2FA 1DTLA 1OZSA 5CPVA 2LM5A 4E68A 2LVKA 2NCOA 3FWBA 5CSIA 4CIDA 2Y4QA 3FS7A 3F45A 4H48A 5PALA 1JBYA 4NDCA 3SVEA 3LLEA 4RYSA 1CDNA 1EJ3A 2YE0A 2HCGA 2HPSA 1V1GA 1XFXO 4HVFA 3TZ1A 2PALA 4GF6B 3UG0A 3SG4A 2CCMA 1LKJA 1QATA 4W7DA 3GK1A 3OSRA 3DVKA 1EMKA 1M63B 2V53A 5DQBA 3NSLA 4LW5A 2KI6C 2WC8A 3NT3A 3SJSA 2HGDA 2KFGA 2LHLA 4W7FA 1KFUL 3CR2A 2PSRA 3C1VA 4DUQA 2M29A 1WLMA 1WRLA 4XOWA 3GK2A 2ZNDA 3BXKA 4W6JA 3O4YA 2Z6XA 1FF1A 2FCDA 1XO5A 3SG2A 5DTLA 4ZINA 4DIRA 1H4UA 1CMFA 1JC2A 4ETOA 3OSQA 3SG3A 1UHHA 3CWGA 1YRUB 2ZFDA 3PALA 1Z1PA 2DOQA 2OGRA 1YUSA 4OR9B 1BR1B 1LVCD 3CR5X 4AQIA 3PATA 1CV7A 4N3DA 3BQ3A 4W73A 2Y5IA 5GQQC 1SR6C 4B5YA 2KQYA 1BT6A 4QJ5B 5EB6A 4Q9XA 3RM1A 1BOCA 5HZTA 1PRWA 1KFUS 1QVIY 3D0YA 3DQFA 4W6RA 1AVSA 2NLNA 4PHKA 2O29A 4KA9A 3EVUA 4PE7A 4XYNA 2JNXA 4DXMA 2FOTA 2YE1A 4YGDB 4GOBA 1YFPA 5BPJA 2QPTA 1FBVA 1YURA 3WHTB 2EC6B 2Y0GA 4W76A 1UUSA 3CBEA 1OMVA 3VRNA 3O78A 3TDIA 2BCXA 2OTGB 4DKMA 4HRGA 2G2SB 4ZIOA 1B47A 1S1EA 1ZOTB 2K7BA 4JF9A 2HF5A 4LQUA 3GK4X 1DJWA 1WLZA 2M1UA 1Q4EA 1H4BA 1G33A 4U8DA 3SVNA 3TMTA 3CD1A 1RECA 1TRFA 3SIBA 1A75A 1NIWA 1WY9A 2EMDA 2DUEA 3NF0A 4CLNA 2LUCA 3NSIA 3H1RA 1QYOA 1KK7Z 1QYFA 4J88A 5KU1A 2FZUA 5DPJA 1YX7A 4KF5C 2IB6A 2G9BA 3PLFB 3PM8A 2JTZA 5HGEA 1L2OC 3ADFA 1B9CA 1QLKA 5FYXA 2Q4UA 1KSOA 1YR5A 1SW8A 3DVMA 1IQ3A 1S6CA 1SNLA 2G6XA 1W7TA 2M9GA 4GGFA 1QX5B 2BTJA 3DQUA 5CSNA 4NDDA 2PXSA 5FVGA 2ZMWA 2R2IA 3OHMB 2NCPA 2Z6ZA 1BU3A 4YI9A 5DPIA 4CPVA 2KSPA 1K9PA 1S26D 4W6UA 1Z1QA 5EB7A 2L4HA 3I5HC 2BKHB 3E5VA 2KAXA 3CGLA 2OTBA 1DJYA 1RK9A 4R6DA 2O2BA 4ZBLA 1B8RA 4M2PA 3LK1A 4XJKA 5CSFA 3KO0A 1J7OA 4JRBA 4PPLA 4W6BA 3SSTA 1NCZA 3LCPC 3NSOA 1B4CA 1EMMA 3WXAA 1Q73A 2WCFA 1H8BA 1IRJA 4DXNA 1N2DA 1BF5A 5F9GA 3LVCA 2B1UA 1LINA 4YI8A 2ZO7A 1A29A 4N1GA 3GB3A 2WURA 1KYSA 4PPJA 3DQ4A 3KF9A 2AWKA 4W6OA 3E3RA 2BECA 2A47A 1CDMA 1FI6A 3DQEA 2DUGA 1CFFA 1UHNA 3U0LA 2EHBA 1QXPA 1TNQA 3DQIA 4ZB1A 4EMQA 3VROA 4RYWA 1MHOA 2LE9B 2CNPA 4F0ZB 3M24A 4H3NA 1OZOA 1S6JA 3CLNA 3E5WA 4ORCB 1QS7A 4IK3A 2WNDA 3AI5A 5JJGA 2QLIA 1XYDA 2JPTA 2ISDA 2GGZA 4PE1A 3NEZA 2BCAA 1RRXA 2KI4C 4DRWA 1MYWA 3FWCA 1B1GA 4IZNA 3BOWB 3EVPA 4TZGA 4W6DA 3EK8A 3LL8B 3SS0A 2F2PA 2WHSA 4PE4A 5EXBA 3WLDA 2A52B 2PASA 1Q4CA 4OY4A 4ZF5A 5DY6A 1ZFSA 1RROA 3ICBA 3OX6A 1U5IA 2G3DB 3VHTA 4MBEA 4C0LA 1KQMC 3BXAA 3OB1B 5HBDA 4EDOA 1CFPA 1Q80A 1SR6B 1EMAA 3SVDA 5BQLA 5HZUA 1OSAA 3TDUA 1FI5A 1XMZA 2EC6C 1QX7A 1MOVA 1BJFA 2L5XB 3H1OA 4W7CA 3SSHA 1CB1A 2V4EA 3VICA 1BG1A 1EMCA 2MRDA 2KBIA 2SASA 1NCXA 4HSZA 2QLHA 3EKJA 5BTTA 2BE4A 2JNFA 3UFZA 5EJUA 3SSKA 1SBJA 1F71A 2L2EA 4KGEA 4L12A 5LTPA 3TMRA 2G6EA 4XGYA 3ZUFA 1GQMA 3NXAA 1B8CA 3AKBA 1W7JB 1OOJA 1YHGA 2OKYA 1V1FA 1YJ2A 3ZWHA 2P6BB 4YGCB 4RTCA 4WQ2A 1NCYA 3BUNB 1KK8C 2WCBA 3VRPA 4Q7RA 2I18A 5DKRA 1SK6D 3BUWB 3ED8A 1PULA 4I5KA 5HKWA 2KQ6A 3FIAA 2H2KA 5LTQA 2AHAA 3RLZA 1Y6WA 4UPGA 3VK1A 1OXEA 2JT0A 2OTEA 1TNPA 1DJZA 3PJBA 1L2OB 1J1EA 2K61A 3IP2A 1CDPA 4ICBA 4I5LB 4P2YB 3RWTA 2GX2A 1HCJA 1XA5A 2DDCA 4GGFC 1SCMC 1GL4A 4XOVA 2EMNA 2K7DA 1GJYA 3RWAA 2B3PA 3IQQA 2JULA 1KYPA 1QLSA 4ORNA 2K8MB 4DXQA 5G08A 3KCSA 2JQ6A 2ZRSA 4JEOA 1XVJA 3SVSA 4M2QA 1GGZA 2BKIB 4TNCA 5T3IA 3I5GC 4U2VA 5AEQA 2H5RA 2GGMA 3DQCA 3I5HB 3VRQA 3CFAA 4W7EA 3AKAA 5I2QA 2E30A 4Q04A 4KEXA 2A53B 1DVIA 2EMOA 1KK7Y 2WORA 3BXCA 1M46A 2B3QA 2M7NA 5AANA 4GNKB 1DJXA 2F3YA 2GW3A 2ZO6A 2C9IA 2VVIA 4XVPA 5DKNA 1ZUXA 2LMUA 2H61C 5HKYA 1OMRA 1CKKA 2CXJA 2Q91A 2VAEA 3BX9A 1RMPA 3NT9A 1EG4A 2BCBA 4I5NB 4OV2A 1IJ6A 1Y1AA 1JUOA 3SSVA 2MLEC 3VRRA 5CSJA 1CDLA 1DJHA 1SCVA 4ORBB 2MA2A 3A8SA 4C0JA 3BUOB 2KGBC 2PMYA 4GBAA 1JWDA 3A8RA 2NZ0A 4DCKA 1YZWA 1YRTB 4R1EA 1QY3A 2KNEA 3PSRA 1YVHA 5FVIA 2KI4B 1UWOA 4GUKA 1XFYO 4LJCA 4H3LA 1EXRA 1SKTA 2YDZA 3KHEA 4ZF3A 5EXUA 1TIZA 3LA1A 3D10A 1CNPA 1EMBA 4NWSA 2KI6D 1KQMB 2H5PA 4KF4A 1JC1A 2K0JA 3WHUB 2H5OA 1RMOA 1AJ4A 2QLGA 3DPXA 2ZMUA 2FJUB 4DXIA 3D0YB 1HUYA 1OQPA 2L4IA 4TZAA 2V4EC 3SVUA 3IF7A 5KTYA 2EGDA 2M0RA 2FWQA 4WQ3A 1XFWO 2I7AA 4HQ8A 1M45A 5FVFA 1F70A 4OGSA 1YHIA 4DS7A 4Q9WA 3DVEA 2L51A 1KFXL 2FCEA 1CLLA 3K1KA 1NX3A 1J7RA 2LP3A 3DVJA 1QJTA 2VVHA 2PVBA 3CFHA 4PCWA 4MN0A
chains in the Genus database with same CATH superfamily
3OP0A 1IH0A 5HKZA 1A75B 1XK4A 3PJ5A 1C4FA 2HQKA 1QIWA 2IB5A 1KK8B 1D1OA 3OGOA 2KAYA 4MSPA 3MGFA 4W69A 2M49B 2ERBA 1MR8A 4MRYA 3DQDA 2WHUA 2QEVA 2ZNEA 1M39A 1SMGA 3LVDA 3DQAA 1Q4BA 2ZKMX 4KW8A 3SSYA 1LS8A 1KFXS 5EXCI 1X02A 4IK4A 1JFJA 1F54A 1GGXA 1NUBA 2BBMA 4JWQA 1CMGA 5HYDA 1SL8A 1SCMB 2MAZA 5KSZA 1YVLA 1HQVA 1EMEA 1A4PA 2M97A 3DQ5A 1T14A 3TS5C 1QWVA 1YUUA 4Q7TA 4LJBA 1B8LA 1TCOB 2A56B 4L1IA 2AAOA 1IQ5A 4N5XA 3SV5A 1Q4AA 5DTZA 1W9ZA 1PSBA 4MEWA 5TNCA 2RH7A 3BUMB 1ODBA 3NGVA 4HE4A 5FI2A 3AAJA 3I5GB 3JVTC 1DF0A 5I8NA 1OXFA 2CBLA 1UHJA 1K93D 2JC2A 1W7IB 1OOIX 4XJKB 2ZRTA 5DTXA 3VGOA 1RMMA 2JRFA 1K9UA 4QJ3B 5DRGA 1OMDA 2F3ZA 4OKHA 2WIQA 1MXLC 3QRXA 3CTNA 4W6NA 1EMGA 4MZJA 2M1KB 1UURA 1RJVA 2WHTA 2KFFA 5F6TA 1LA0A 4W6IA 1TNXA 1BLQA 1C7WA 1PK0D 2JOJA 5DU0A 1DGUA 2K7CA 1A2XA 4IL1A 2WOSA 3S0GA 5DKQA 2G5ZB 1K9KA 1ZACA 2P71A 1C07A 4B30A 2F2OA 2SCPA 3KCTA 3CGAA 1JBZA 1XQMA 2A46A 4W6PA 1B7TZ 1TNWA 1KQVA 3ZULA 3S0DA 3DQKA 4W7RA 2MHHA 1PVBA 1M31A 2KFHA 3TDZA 2WSNA 1MWNA 3LF4B 5I2OA 2I2RE 2JWWA 5EBJA 2LC5A 3CZ1A 3DYEA 4P5OE 3CB9A 3N7HA 2OPOA 2LP2A 4W7AA 2KLEA 2LLSA 4ZCVA 2IOVA 1EH2A 4W6SA 3ZUJA 2ZN9A 3FE9A 4BDUA 2JXLA 3LK0A 1U5IB 3DF0A 3VHTB 4FTGA 1FPWA 5HL1A 3ST3A 3CD9A 1G8IA 3AAKA 4OHSA 3D77A 1C3YA 2LVVA 3DQ2A 4W74A 2LV7A 3NSKA 1JFKA 2HQZA 2QRFA 2DD9A 4A4CA 4L9MA 2BL0B 1J7PA 3LS3A 3S05A 3CFFA 2LCPA 3V3DA 1UISA 2V4EB 3GEXA 1CM4A 4A4BA 4EULA 3S0FA 2H8VA 3KPXA 2CT9A 4W6GA 3DQJA 3M22A 4ANJA 2COLB 1YHHA 1QTXA 1RWYA 2KYFA 3JTDC 1K95A 1K90D 4PT1A 3AKOA 4Z4MA 1QX2A 5BTTB 2C9JA 4DXOA 5KTGA 3GOFA 3P8UA 4P76A 1CM1A 4GFTA 2MBXA 3PFVA 3S0BA 4DXPA 4KGFA 1B9AA 3SG6A 3EK7A 3D74A 4CFQA 1VRKA 2WCMA 3L47A 2ZN8A 1S5GZ 3BUXB 4PDZA 4F7FA 1XK4C 1IJ5A 1YX8A 1S3PA 2O5GA 3SRYA 2LLUA 3I5IC 1Q4DA 1AUIB 1MF8B 4QJ4B 3DQ7A 1J7QA 3ST2A 2LANA 3EVVA 2G6YA 3IQOA 1RTP1 5H89A 3L4AA 1G7KA 5FI6A 2HQ8A 2GV5A 2M3WA 1OE9B 4PE0A 1W7UA 4W6HA 4JGEA 4W75A 3U0NA 2LLTA 2QZ0A 4WRIA 1MQ1A 1WDCB 2YFPA 4PHJA 2PQLA 3TUYC 1DMOA 5IBWA 2H6VA 5H87A 1BODA 2KGRA 2RGIA 3DQMA 4JC2A 1MOUA 3SVCA 1PALA 4YBHB 2AMIA 1J1DA 2PXWA 2LHIA 5ER4X 2VADA 3TS5B 1ZUZA 3CS1A 2AWLA 3K21A 2OS8C 1DC1A 4IK1A 4W6AA 2IS9A 4D1EA 3CZTX 5HW9A 3DQNA 2K7OA 1CLBA 1QV1A 3S0AA 1G4YR 5DPHA 1SSEB 2A4JA 3W1DA 3DPWA 3EG5B 4MLWA 2JZIA 3JVTB 3DD4A 3EKHA 1S6ZA 4YRUA 1K2HA 2F8PA 2E6WA 4W6TA 2GTEA 4NDBA 2QT2A 5DRFA 1RM9A 1R6PA 4LQTA 3AI4A 1NX0A 1DJIA 1C3ZA 3DQ9A 1LXFC 1P28A 2POXA 4KW4A 3OB2B 2CTNA 4IK8A 3D73A 4W6CA 3SSPA 4H47A 1NSHA 2A48A 2L0PA 5K89A 1F4OA 3D76A 5JOLA 1PSRA 3R1PA 3HX4A 3WLCA 2Y1MA 1YJFA 2WCKA 1CTRA 5H88A 2LUXA 1QYQA 3OBVA 2O24A 4NQGA 1KCYA 4W7XA 1CFCA 1NWDA 1NYAA 2L2CA 3S0EA 1FW4A 1NPQA 1Y1UA 1AP4A 1XA9A 1OOHA 1F09A 1IG5A 1KYRA 3HCMA 1Z2CB 2L50A 1KP5A 3DQ6A 1WRKA 3DQ3A 1ZGQA 1KSMA 2Z6YA 3PJIA 3PM2A 4AQJA 2PRUA 2BL0C 1NX2A 3U0MA 2LVIA 3GL4A 5DQMA 3P28A 1AJ5A 3UNWA 2GW4B 1ALWA 1A03A 2QLGB 2ICRA 2DD7A 3SG5A 1Y1XA 1GM0A 4W6KA 1K96A 3O2PA 2AWMA 1EL4A 4N1FA 3LVAA 3ST4A 2L5YA 1L7ZA 2JTTA 4KW9A 4IK5A 1IIOA 5LK4A 1B7TY 2JPOA 4KAGA 3BYAA 2DDDA 4M2OA 2G16B 2A54B 3GJ1A 1TN4A 3B88A 5I2LA 1Y0VH 4W6MA 3JTDB 1AK8A 1XSSA 3I19A 2QU1A 3SSLA 3DPZA 2AH8A 4HRHA 2HFCA 4AS8A 1J55A 3DQ1A 4MZKA 5AERA 2IE2A 5FHVA 5AQBB 3EVRA 3CDNA 3PIBA 1H6RA 4L13A 1QV0A 2KAVA 3B7AA 4W6FA 2I94A 4JPZB 1NX1A 3A4UB 4LJDA 2HJOA 3W1CA 1KWOC 2DUIA 2HETA 1S6IA 4J8AA 1DJGA 4MZLA 1CLMA 1RFJA 4KPIA 3SS3A 1WDCC 3PN7C 3DQHA 1TCFA 2ARLA 3G9AA 2Q57A 3I5IB 1YTZC 3I5FC 2Z1OA 1BMOA 4BY5A 5HLOA 4W6LA 1SRAA 1UHKA 4OZDA 4EN1A 3EK4A 4ORAB 2WC5A 4I5JA 1ALVA 3SVRA 2LMVA 4PHNA 3DY9A 4OVNF 2BE6A 3VB1A 1C7VA 2JU0A 1UHIA 1WRZA 4OCIA 1IKUA 1K94A 1SYMA 3TUYB 4W72A 3WCKA 4DKNA 3E5TA 3ZNIA 5DPGA 4R6BA 2JT3A 4CFRA 2H5QA 4MVFA 1NP8A 2WISA 3O77A 2M8UA 2KBMA 4C0KA 3MSEB 1EG3A 1ZMZA 4BY4A 2P4MA 2QLEA 4JQ0D 2HPWA 3ST0A 1OOGA 2KYCA 3FE6A 1S5GY 2OS8B 1XAEA 3IVTA 4AOMA 1DGVA 3U0KA 3O4XA 1DF0B 1ZGPA 2HRSA 3V2LA 1QVIZ 1TOPA 4XL5A 1CFDA 2F33A 1R2UA 4PHMA 3SG7A 2WSOA 2O60A 2KDHA 1QXTA 2MLFC 4USLA 4ZFSA 3M0WA 4ZF4A 4ZCUA 4YGBB 1GFLA 2DUHA 3U8AA 2H61A 5D69A 1ZGOA 4FQOA 4HREE 2FJYA 1K8UA 5DICA 5AXIA 2WCEA 3SVBA 1S36A 1XFVO 4JFGA 5J3XA 1EMLA 4W77A 1TTXA 3BOWA 3QMEA 2QACA 2H8QA 2VVJA 3GJ2A 2G3OA 1MXEA 4B30B 2LAPA 2AWJA 4GPLB 1BR4B 1YUTA 3B87A 4IK9A 4Q7UA 2JXCA 3NEDA 2JT8A 1HT9A 3ZTFA 3U8CA 1PVAA 4YGEB 5HLVA 1SY9A 2KOTA 3BXBA 1LA3A 2LNKA 3KEVA 4MRXA 2NXQA 1JBAA 1SL7A 4JD9A 2LMTA 1MUXA 1OXDA 5DTYA 4PFEA 3WNXB 2Y1NA 3DQLA 2VZXA 1XFUO 1N0YA 1TUZA 3DF0B 5ER5A 1UP5A 1DT7B 1BFPA 2HGYA 2H9WA 2OTGC 2HQWA 3OX5A 5LTRA 2LVJA 5J2OA 5HZOA 1EMFA 4HQ9A 2FL1A 3LF3A 5FI7A 4PPKA 3PJ7A 3H4SE 1IWQA 4J89A 1ORGA 2D8NA 2M7LA 2OKWA 2TN4A 2KHNA 3SIAA 2K2AA 4OQWA 4H3MA 1F4QA 4YGAA 2GX0A 4AR7A 1SL9A 1F0BA 4OJ0A 5EHUA 3LSAA 3IR8A 4P1QA 4PALA 5D7FA 4HQCA 1SPYA 1F55A 2VRGA 4GESB 1IGVA 1GGWA 2L98A 4KF5A 2AUCA 4LJDC 3O6BA 3SVOA 5AFPA 3U8PA 4FQTA 2DUFA 4GAOA 1JF0A 2A50B 1AHRA 1XFZO 2BBNA 4EDSA 4UTSA 1JSAA 3DQOA 2OJKA 2JADA 2MJWB 1QIVA 2YGUA 1KWOB 4I2YA 1TUJA 2Q6PA 5BT0A 1JF2A 1N65A 1JC0A 5B8IB 3PN7B 4Z4KA 1F8HA 5HZSA 3I5FB 1E8AA 4GGNA 3DQ8A 3CR4X 2K60A 1QASA 1W7SA 2G2BA 2K2FA 1DTLA 1OZSA 5CPVA 2LM5A 4E68A 2LVKA 2NCOA 3FWBA 5CSIA 4CIDA 2Y4QA 3CZ0A 3FS7A 3F45A 4H48A 5PALA 1JBYA 4NDCA 3SVEA 3LLEA 4RYSA 2QEBA 1CDNA 1EJ3A 2YE0A 2HCGA 2HPSA 1V1GA 1XFXO 4HVFA 3TZ1A 2KLDA 2PALA 4GF6B 3UG0A 3SG4A 2CCMA 1LKJA 1QATA 4W7DA 3GK1A 3OSRA 3DVKA 3L4LA 3K1EA 4IJ7A 1EMKA 1M63B 2V53A 5D3OA 5DQBA 3UO9A 3BJHA 3NSLA 4LW5A 2KI6C 2WC8A 3NT3A 3SJSA 2HGDA 2KFGA 2LHLA 4W7FA 1DQEA 1KFUL 3CR2A 2PSRA 3C1VA 4DUQA 2M29A 1WLMA 1WRLA 4XOWA 3GK2A 2ZNDA 3BXKA 4W6JA 3O4YA 2Z6XA 1FF1A 2FCDA 1XO5A 3SG2A 5DTLA 4ZINA 3RZSA 4DIRA 1H4UA 1CMFA 1JC2A 1Z4HA 4ETOA 3OSQA 3SG3A 1UHHA 3CWGA 1YRUB 2ZFDA 3PALA 1Z1PA 2DOQA 2OGRA 1YUSA 4OR9B 1BR1B 1LVCD 3CR5X 4AQIA 3PATA 1CV7A 4N3DA 3BQ3A 4W73A 2Y5IA 5GQQC 1SR6C 4B5YA 2KQYA 1BT6A 4QJ5B 5EB6A 4Q9XA 3RM1A 1BOCA 3NHTA 5HZTA 1PRWA 2WCLA 1KFUS 1QVIY 3D0YA 3DQFA 4W6RA 1AVSA 2NLNA 4PHKA 2O29A 4KA9A 3EVUA 4PE7A 4XYNA 2JNXA 4DXMA 2FOTA 2YE1A 2KPHA 4YGDB 4GOBA 1YFPA 5BPJA 2QPTA 1FBVA 1YURA 3WHTB 2EC6B 2Y0GA 4W76A 1UUSA 3CBEA 1OMVA 3VRNA 3O78A 3TDIA 2BCXA 2OTGB 4DKMA 4HRGA 2G2SB 4ZIOA 1B47A 1S1EA 1ZOTB 2K7BA 4JF9A 2HF5A 4LQUA 3GK4X 1DJWA 1WLZA 2M1UA 1Q4EA 1H4BA 1G33A 4U8DA 3SVNA 3TMTA 2PYQA 3CD1A 1RECA 1TRFA 3SIBA 1A75A 1NIWA 1WY9A 2EMDA 2DUEA 3NF0A 3BFAA 4CLNA 2LUCA 3B6XA 3NSIA 3H1RA 1QYOA 1KK7Z 1QYFA 4J88A 5KU1A 2FZUA 5DPJA 1YX7A 4KF5C 2IB6A 2G9BA 3PLFB 3PM8A 2JTZA 5HGEA 1L2OC 3ADFA 1B9CA 1QLKA 5FYXA 2Q4UA 1KSOA 1YR5A 1SW8A 3DVMA 1IQ3A 1S6CA 1SNLA 2G6XA 1W7TA 2M9GA 4GGFA 1QX5B 2BTJA 3DQUA 5CSNA 4NDDA 2PXSA 5FVGA 2ZMWA 3CZ2A 2R2IA 3OHMB 2NCPA 2Z6ZA 1BU3A 4YI9A 5DPIA 4CPVA 2KSPA 1K9PA 1S26D 4W6UA 1Z1QA 5EB7A 2L4HA 3I5HC 2BKHB 3E5VA 2KAXA 3CGLA 3R1OA 2OTBA 1DJYA 1RK9A 4R6DA 3NHIA 2O2BA 4ZBLA 1B8RA 4M2PA 3LK1A 4XJKA 5CSFA 3KO0A 1J7OA 4JRBA 4PPLA 4W6BA 3SSTA 1NCZA 3LCPC 3NSOA 1B4CA 1EMMA 3WXAA 3Q8IA 1Q73A 2WCFA 1H8BA 1IRJA 4DXNA 1N2DA 1BF5A 5F9GA 1DELA 3LVCA 2B1UA 1LINA 4YI8A 2ZO7A 1A29A 4N1GA 3GB3A 2WURA 1KYSA 4PPJA 3DQ4A 3SS5A 3KF9A 2AWKA 4W6OA 3E3RA 2BECA 1TWOA 2A47A 1CDMA 2QDIA 1FI6A 3DQEA 2DUGA 1CFFA 1UHNA 3U0LA 2EHBA 1QXPA 1TNQA 3DQIA 4ZB1A 4EMQA 3VROA 4RYWA 1MHOA 2BAPA 2LE9B 2CNPA 4F0ZB 3M24A 4H3NA 1OZOA 1S6JA 3CLNA 3E5WA 4ORCB 1QS7A 4IK3A 2WNDA 3AI5A 5JJGA 2QLIA 1XYDA 2JPTA 2ISDA 2GGZA 4PE1A 3NEZA 2BCAA 1RRXA 2KI4C 4DRWA 1MYWA 3FWCA 1B1GA 4IZNA 3BOWB 3EVPA 4TZGA 4W6DA 3EK8A 3LL8B 3SS0A 2F2PA 2WHSA 4PE4A 5EXBA 3WLDA 2A52B 2PASA 1Q4CA 4OY4A 4ZF5A 5DY6A 1ZFSA 1RROA 3ICBA 3OX6A 1U5IA 2G3DB 3VHTA 4MBEA 4C0LA 1KQMC 3BXAA 3OB1B 5HBDA 4EDOA 4KYNA 1CFPA 1Q80A 1SR6B 1EMAA 3SVDA 5BQLA 5HZUA 1OSAA 3TDUA 1FI5A 1XMZA 2EC6C 1QX7A 1MOVA 1BJFA 2L5XB 3H1OA 4W7CA 3SSHA 1CB1A 1DEKA 3OGNA 2WCHA 2V4EA 2BNXA 1BG1A 3VICA 1EMCA 2MRDA 2KBIA 2SASA 1NCXA 4JKTA 4HSZA 2QLHA 3EKJA 5BTTA 2BE4A 2JNFA 3UFZA 5EJUA 3SSKA 1SBJA 1F71A 2L2EA 4KGEA 4L12A 5LTPA 3TMRA 2G6EA 4XGYA 3ZUFA 1GQMA 3NXAA 1B8CA 3AKBA 1W7JB 1OOJA 1YHGA 2OKYA 1V1FA 1YJ2A 3ZWHA 2P6BB 4YGCB 4RTCA 4WQ2A 3DZTA 1NCYA 3BUNB 1KK8C 2WCBA 3VRPA 4Q7RA 2I18A 5DKRA 2WCJA 1SK6D 3BUWB 2QEHA 3R72A 3ED8A 1PULA 4I5KA 5HKWA 2KQ6A 3FIAA 2H2KA 5LTQA 2AHAA 3RLZA 1Y6WA 4UPGA 3VK1A 1OXEA 2JT0A 2OTEA 1TNPA 1DJZA 2P70A 3PJBA 1L2OB 1J1EA 2K61A 3IP2A 1CDPA 4ICBA 4I5LB 4P2YB 3RWTA 2GX2A 1HCJA 1XA5A 2DDCA 4GGFC 1SCMC 1GL4A 4XOVA 3FE8A 2EMNA 2K7DA 1GJYA 3RWAA 1XFRA 2B3PA 3IQQA 2JULA 3D75A 1KYPA 1QLSA 4ORNA 2K8MB 4DXQA 5G08A 3KCSA 2JQ6A 2ZRSA 4JEOA 1XVJA 3SVSA 4M2QA 1GGZA 2BKIB 4TNCA 5T3IA 3I5GC 4U2VA 4INWA 5AEQA 2H5RA 2GGMA 3DQCA 3I5HB 3VRQA 3CFAA 3BFHA 4W7EA 3AKAA 5I2QA 2E30A 4Q04A 4KEXA 2A53B 1DVIA 2EMOA 1KK7Y 2QEOA 3CABA 2WORA 3BXCA 1M46A 2B3QA 3B86A 5AANA 2M7NA 4GNKB 3BFBA 1DJXA 2F3YA 2GW3A 2ZO6A 2C9IA 2VVIA 5EL2A 4XVPA 5DKNA 1ZUXA 2LMUA 2H61C 5HKYA 1OMRA 1CKKA 2CXJA 2Q91A 2VAEA 3BX9A 1RMPA 3NT9A 1EG4A 2BCBA 4I5NB 4OV2A 1IJ6A 1Y1AA 1JUOA 3SSVA 2MLEC 3VRRA 5CSJA 1CDLA 1DJHA 1SCVA 4ORBB 2MA2A 3A8SA 4C0JA 3BUOB 2KGBC 3CYZA 2PMYA 4GBAA 1JWDA 3A8RA 2NZ0A 4DCKA 1YZWA 3DXLA 1YRTB 4R1EA 1QY3A 2KNEA 3PSRA 1YVHA 5FVIA 2KI4B 1UWOA 4GUKA 1XFYO 4LJCA 4H3LA 1EXRA 1SKTA 2YDZA 3KHEA 4ZF3A 5EXUA 2WC6A 1TIZA 3D78A 3LA1A 3D10A 1CNPA 1EMBA 4NWSA 2KI6D 5I94A 1KQMB 2H5PA 4KF4A 1JC1A 2K0JA 3WHUB 2H5OA 1RMOA 1AJ4A 2QLGA 3DPXA 2ZMUA 4INXA 2FJUB 4DXIA 3D0YB 1HUYA 1OQPA 2L4IA 4TZAA 2V4EC 3SVUA 3IF7A 5KTYA 2EGDA 2M0RA 2FWQA 4WQ3A 1XFWO 2I7AA 4HQ8A 1M45A 5FVFA 3SS4A 1F70A 1OW4A 4OGSA 1YHIA 4DS7A 4Q9WA 3DVEA 2L51A 1KFXL 2FCEA 1CLLA 3K1KA 1NX3A 1J7RA 2LP3A 3DVJA 1QJTA 3R1VA 2VVHA 2PVBA 3CFHA 4PCWA 1OOFA 4MN0A
chains in the Genus database with same CATH topology
3OP0A 1IH0A 5HKZA 1A75B 1XK4A 3PJ5A 1C4FA 2HQKA 1QIWA 2IB5A 1KK8B 1D1OA 3OGOA 2KAYA 4MSPA 3MGFA 4W69A 2M49B 1MR8A 4MRYA 3DQDA 2WHUA 2ZNEA 1M39A 1SMGA 3LVDA 3DQAA 1Q4BA 2ZKMX 4KW8A 3SSYA 1KFXS 5EXCI 1X02A 4IK4A 1JFJA 1F54A 1GGXA 1NUBA 2BBMA 4JWQA 1CMGA 5HYDA 1SL8A 1SCMB 2MAZA 5KSZA 1YVLA 1HQVA 1EMEA 1A4PA 2M97A 3DQ5A 3TS5C 1YUUA 4Q7TA 4LJBA 1B8LA 1TCOB 2A56B 4L1IA 2AAOA 1IQ5A 4N5XA 3SV5A 1Q4AA 5DTZA 1PSBA 4MEWA 5TNCA 2RH7A 3BUMB 1ODBA 4HE4A 3AAJA 3I5GB 3JVTC 1DF0A 5I8NA 1OXFA 2CBLA 1UHJA 1K93D 2JC2A 1W7IB 4XJKB 2ZRTA 5DTXA 3VGOA 1RMMA 2JRFA 1K9UA 4QJ3B 5DRGA 1OMDA 2F3ZA 4OKHA 2WIQA 1MXLC 3QRXA 3CTNA 4W6NA 1EMGA 4MZJA 2M1KB 1UURA 1RJVA 2WHTA 2KFFA 5F6TA 1LA0A 4W6IA 1TNXA 1BLQA 1C7WA 1PK0D 2JOJA 5DU0A 1DGUA 2K7CA 1A2XA 4IL1A 2WOSA 5DKQA 2G5ZB 1K9KA 1ZACA 1C07A 4B30A 2F2OA 2SCPA 3KCTA 3CGAA 1JBZA 1XQMA 2A46A 4W6PA 1B7TZ 1TNWA 1KQVA 3ZULA 3DQKA 4W7RA 2MHHA 1PVBA 1M31A 2KFHA 3TDZA 2WSNA 1MWNA 3LF4B 5I2OA 2I2RE 2JWWA 5EBJA 2LC5A 4P5OE 3CB9A 2OPOA 2LP2A 4W7AA 2LLSA 4ZCVA 2IOVA 1EH2A 4W6SA 3ZUJA 2ZN9A 4BDUA 2JXLA 3LK0A 1U5IB 3DF0A 3VHTB 4FTGA 1FPWA 3ST3A 3CD9A 1G8IA 3AAKA 4OHSA 2LVVA 3DQ2A 4W74A 2LV7A 3NSKA 1JFKA 2HQZA 2QRFA 2DD9A 4A4CA 4L9MA 2BL0B 1J7PA 3LS3A 3S05A 3CFFA 2LCPA 3V3DA 1UISA 2V4EB 3GEXA 1CM4A 4A4BA 4EULA 3KPXA 2CT9A 4W6GA 3DQJA 3M22A 4ANJA 2COLB 1YHHA 1QTXA 1RWYA 2KYFA 3JTDC 1K95A 1K90D 3AKOA 4Z4MA 1QX2A 5BTTB 2C9JA 4DXOA 5KTGA 3GOFA 3P8UA 4P76A 1CM1A 4GFTA 2MBXA 3PFVA 4DXPA 4KGFA 1B9AA 3SG6A 3EK7A 4CFQA 1VRKA 2ZN8A 1S5GZ 3BUXB 4PDZA 1XK4C 1IJ5A 1YX8A 1S3PA 2O5GA 3SRYA 2LLUA 3I5IC 1Q4DA 1AUIB 1MF8B 4QJ4B 3DQ7A 1J7QA 3ST2A 2LANA 3EVVA 2G6YA 3IQOA 1RTP1 5H89A 1G7KA 2HQ8A 2GV5A 2M3WA 1OE9B 4PE0A 1W7UA 4W6HA 4JGEA 4W75A 3U0NA 2LLTA 2QZ0A 4WRIA 1MQ1A 1WDCB 2YFPA 4PHJA 3TUYC 1DMOA 5IBWA 2H6VA 5H87A 1BODA 2KGRA 2RGIA 3DQMA 4JC2A 1MOUA 3SVCA 1PALA 4YBHB 2AMIA 1J1DA 2PXWA 2LHIA 5ER4X 2VADA 3TS5B 1ZUZA 3CS1A 2AWLA 3K21A 2OS8C 4IK1A 4W6AA 2IS9A 4D1EA 3CZTX 5HW9A 3DQNA 2K7OA 1CLBA 1QV1A 1G4YR 5DPHA 2A4JA 3W1DA 3DPWA 4MLWA 2JZIA 3JVTB 3DD4A 3EKHA 1S6ZA 4YRUA 1K2HA 2F8PA 2E6WA 4W6TA 4NDBA 2QT2A 5DRFA 1RM9A 1R6PA 4LQTA 3AI4A 1NX0A 1DJIA 3DQ9A 1LXFC 2POXA 4KW4A 3OB2B 2CTNA 4IK8A 4W6CA 3SSPA 4H47A 1NSHA 2A48A 2L0PA 5K89A 1F4OA 5JOLA 1PSRA 3HX4A 3WLCA 2Y1MA 1YJFA 1CTRA 5H88A 2LUXA 1QYQA 2O24A 4NQGA 1KCYA 4W7XA 1CFCA 1NWDA 1NYAA 1FW4A 1NPQA 1Y1UA 1AP4A 1XA9A 1F09A 1IG5A 1KYRA 3HCMA 2L50A 1KP5A 3DQ6A 1WRKA 3DQ3A 1ZGQA 1KSMA 2Z6YA 4AQJA 2PRUA 2BL0C 1NX2A 3U0MA 2LVIA 3GL4A 5DQMA 3P28A 1AJ5A 2GW4B 1ALWA 1A03A 2QLGB 2ICRA 2DD7A 3SG5A 1Y1XA 4W6KA 1K96A 3O2PA 2AWMA 1EL4A 4N1FA 3LVAA 3ST4A 1L7ZA 2JTTA 4KW9A 4IK5A 5LK4A 1B7TY 4KAGA 3BYAA 2DDDA 4M2OA 2G16B 2A54B 3GJ1A 1TN4A 5I2LA 4W6MA 1Y0VH 3JTDB 1AK8A 1XSSA 3I19A 2QU1A 3SSLA 3DPZA 2AH8A 4HRHA 2HFCA 4AS8A 1J55A 3DQ1A 4MZKA 5AERA 2IE2A 5FHVA 5AQBB 3EVRA 3PIBA 1H6RA 4L13A 1QV0A 2KAVA 4W6FA 2I94A 4JPZB 1NX1A 3A4UB 4LJDA 2HJOA 3W1CA 1KWOC 2DUIA 2HETA 1S6IA 4J8AA 1DJGA 4MZLA 1CLMA 1RFJA 4KPIA 1WDCC 3PN7C 3DQHA 1TCFA 2ARLA 3G9AA 2Q57A 3I5IB 1YTZC 3I5FC 2Z1OA 1BMOA 4BY5A 5HLOA 4W6LA 1SRAA 1UHKA 4EN1A 3EK4A 4ORAB 4I5JA 1ALVA 3SVRA 2LMVA 4PHNA 4OVNF 2BE6A 1C7VA 2JU0A 1UHIA 1WRZA 4OCIA 1IKUA 1K94A 1SYMA 3TUYB 4W72A 3WCKA 4DKNA 3E5TA 3ZNIA 5DPGA 4R6BA 2JT3A 4CFRA 2H5QA 4MVFA 1NP8A 2WISA 3O77A 2M8UA 2KBMA 4C0KA 3MSEB 1EG3A 1ZMZA 4BY4A 2P4MA 2QLEA 4JQ0D 2HPWA 3ST0A 2KYCA 1XAEA 1S5GY 2OS8B 4AOMA 1DGVA 3U0KA 1DF0B 1ZGPA 2HRSA 1QVIZ 1TOPA 4XL5A 1CFDA 2F33A 1R2UA 4PHMA 3SG7A 2WSOA 2O60A 2KDHA 1QXTA 2MLFC 4USLA 4ZFSA 3M0WA 4ZF4A 4ZCUA 4YGBB 1GFLA 2DUHA 3U8AA 2H61A 5D69A 1ZGOA 4FQOA 4HREE 1K8UA 5AXIA 2WCEA 3SVBA 1S36A 1XFVO 4JFGA 5J3XA 1EMLA 4W77A 1TTXA 3BOWA 2QACA 2H8QA 2VVJA 3GJ2A 2G3OA 1MXEA 4B30B 2LAPA 2AWJA 4GPLB 1BR4B 1YUTA 4IK9A 4Q7UA 2JXCA 3NEDA 2JT8A 1HT9A 3ZTFA 3U8CA 1PVAA 4YGEB 5HLVA 1SY9A 2KOTA 3BXBA 1LA3A 2LNKA 3KEVA 4MRXA 2NXQA 1JBAA 1SL7A 2LMTA 1MUXA 1OXDA 5DTYA 4PFEA 3WNXB 2Y1NA 3DQLA 2VZXA 1XFUO 1N0YA 3DF0B 5ER5A 1UP5A 1DT7B 1BFPA 2HGYA 2H9WA 2OTGC 2HQWA 3OX5A 5LTRA 2LVJA 5J2OA 5HZOA 1EMFA 4HQ9A 2FL1A 3LF3A 4PPKA 3PJ7A 3H4SE 1IWQA 4J89A 2D8NA 2M7LA 2OKWA 2TN4A 2KHNA 3SIAA 2K2AA 4OQWA 4H3MA 1F4QA 4YGAA 2GX0A 4AR7A 1SL9A 1F0BA 4OJ0A 5EHUA 3LSAA 3IR8A 4P1QA 4PALA 5D7FA 4HQCA 1SPYA 1F55A 2VRGA 4GESB 1IGVA 1GGWA 2L98A 4KF5A 2AUCA 4LJDC 3O6BA 3SVOA 5AFPA 3U8PA 2DUFA 4GAOA 1JF0A 2A50B 1AHRA 1XFZO 2BBNA 4EDSA 4UTSA 1JSAA 3DQOA 2OJKA 2JADA 2MJWB 1QIVA 1KWOB 4I2YA 2Q6PA 5BT0A 1JF2A 1N65A 1JC0A 5B8IB 3PN7B 4Z4KA 1F8HA 5HZSA 3I5FB 1E8AA 4GGNA 3DQ8A 3CR4X 1QASA 1W7SA 2G2BA 2K2FA 1DTLA 1OZSA 5CPVA 2LM5A 4E68A 2LVKA 2NCOA 3FWBA 5CSIA 4CIDA 2Y4QA 3FS7A 3F45A 4H48A 5PALA 1JBYA 4NDCA 3SVEA 3LLEA 4RYSA 1CDNA 1EJ3A 2YE0A 2HCGA 2HPSA 1V1GA 1XFXO 4HVFA 3TZ1A 2PALA 4GF6B 3UG0A 3SG4A 2CCMA 1LKJA 1QATA 4W7DA 3GK1A 3OSRA 3DVKA 1EMKA 1M63B 2V53A 5DQBA 3NSLA 4LW5A 2KI6C 2WC8A 3NT3A 3SJSA 2HGDA 2KFGA 2LHLA 4W7FA 1KFUL 3CR2A 2PSRA 3C1VA 4DUQA 2M29A 1WLMA 1WRLA 4XOWA 3GK2A 2ZNDA 3BXKA 4W6JA 3O4YA 2Z6XA 1FF1A 2FCDA 1XO5A 3SG2A 5DTLA 4ZINA 4DIRA 1H4UA 1CMFA 1JC2A 4ETOA 3OSQA 3SG3A 1UHHA 3CWGA 1YRUB 2ZFDA 3PALA 1Z1PA 2DOQA 2OGRA 1YUSA 4OR9B 1BR1B 1LVCD 3CR5X 4AQIA 3PATA 1CV7A 4N3DA 3BQ3A 4W73A 2Y5IA 5GQQC 1SR6C 4B5YA 2KQYA 1BT6A 4QJ5B 5EB6A 4Q9XA 3RM1A 1BOCA 5HZTA 1PRWA 1KFUS 1QVIY 3D0YA 3DQFA 4W6RA 1AVSA 2NLNA 4PHKA 2O29A 4KA9A 3EVUA 4PE7A 4XYNA 2JNXA 4DXMA 2FOTA 2YE1A 4YGDB 4GOBA 1YFPA 5BPJA 2QPTA 1FBVA 1YURA 3WHTB 2EC6B 2Y0GA 4W76A 1UUSA 3CBEA 1OMVA 3VRNA 3O78A 3TDIA 2BCXA 2OTGB 4DKMA 4HRGA 2G2SB 4ZIOA 1B47A 1S1EA 1ZOTB 2K7BA 4JF9A 2HF5A 4LQUA 3GK4X 1DJWA 1WLZA 2M1UA 1Q4EA 1H4BA 1G33A 4U8DA 3SVNA 3TMTA 3CD1A 1RECA 1TRFA 3SIBA 1A75A 1NIWA 1WY9A 2EMDA 2DUEA 3NF0A 4CLNA 2LUCA 3NSIA 3H1RA 1QYOA 1KK7Z 1QYFA 4J88A 5KU1A 2FZUA 5DPJA 1YX7A 4KF5C 2IB6A 2G9BA 3PLFB 3PM8A 2JTZA 5HGEA 1L2OC 3ADFA 1B9CA 1QLKA 5FYXA 2Q4UA 1KSOA 1YR5A 1SW8A 3DVMA 1IQ3A 1S6CA 1SNLA 2G6XA 1W7TA 2M9GA 4GGFA 1QX5B 2BTJA 3DQUA 5CSNA 4NDDA 2PXSA 5FVGA 2ZMWA 2R2IA 3OHMB 2NCPA 2Z6ZA 1BU3A 4YI9A 5DPIA 4CPVA 2KSPA 1K9PA 1S26D 4W6UA 1Z1QA 5EB7A 2L4HA 3I5HC 2BKHB 3E5VA 2KAXA 3CGLA 2OTBA 1DJYA 1RK9A 4R6DA 2O2BA 4ZBLA 1B8RA 4M2PA 3LK1A 4XJKA 5CSFA 3KO0A 1J7OA 4JRBA 4PPLA 4W6BA 3SSTA 1NCZA 3LCPC 3NSOA 1B4CA 1EMMA 3WXAA 1Q73A 2WCFA 1H8BA 1IRJA 4DXNA 1N2DA 1BF5A 5F9GA 3LVCA 2B1UA 1LINA 4YI8A 2ZO7A 1A29A 4N1GA 3GB3A 2WURA 1KYSA 4PPJA 3DQ4A 3KF9A 2AWKA 4W6OA 3E3RA 2BECA 2A47A 1CDMA 1FI6A 3DQEA 2DUGA 1CFFA 1UHNA 3U0LA 2EHBA 1QXPA 1TNQA 3DQIA 4ZB1A 4EMQA 3VROA 4RYWA 1MHOA 2LE9B 2CNPA 4F0ZB 3M24A 4H3NA 1OZOA 1S6JA 3CLNA 3E5WA 4ORCB 1QS7A 4IK3A 2WNDA 3AI5A 5JJGA 2QLIA 1XYDA 2JPTA 2ISDA 2GGZA 4PE1A 3NEZA 2BCAA 1RRXA 2KI4C 4DRWA 1MYWA 3FWCA 1B1GA 4IZNA 3BOWB 3EVPA 4TZGA 4W6DA 3EK8A 3LL8B 3SS0A 2F2PA 2WHSA 4PE4A 5EXBA 3WLDA 2A52B 2PASA 1Q4CA 4OY4A 4ZF5A 5DY6A 1ZFSA 1RROA 3ICBA 3OX6A 1U5IA 2G3DB 3VHTA 4MBEA 4C0LA 1KQMC 3BXAA 3OB1B 5HBDA 4EDOA 1CFPA 1Q80A 1SR6B 1EMAA 3SVDA 5BQLA 5HZUA 1OSAA 3TDUA 1FI5A 1XMZA 2EC6C 1QX7A 1MOVA 1BJFA 2L5XB 3H1OA 4W7CA 3SSHA 1CB1A 2V4EA 3VICA 1BG1A 1EMCA 2MRDA 2KBIA 2SASA 1NCXA 4HSZA 2QLHA 3EKJA 5BTTA 2BE4A 2JNFA 3UFZA 5EJUA 3SSKA 1SBJA 1F71A 2L2EA 4KGEA 4L12A 5LTPA 3TMRA 2G6EA 4XGYA 3ZUFA 1GQMA 3NXAA 1B8CA 3AKBA 1W7JB 1OOJA 1YHGA 2OKYA 1V1FA 1YJ2A 3ZWHA 2P6BB 4YGCB 4RTCA 4WQ2A 1NCYA 3BUNB 1KK8C 2WCBA 3VRPA 4Q7RA 2I18A 5DKRA 1SK6D 3BUWB 3ED8A 1PULA 4I5KA 5HKWA 2KQ6A 3FIAA 2H2KA 5LTQA 2AHAA 3RLZA 1Y6WA 4UPGA 3VK1A 1OXEA 2JT0A 2OTEA 1TNPA 1DJZA 3PJBA 1L2OB 1J1EA 2K61A 3IP2A 1CDPA 4ICBA 4I5LB 4P2YB 3RWTA 2GX2A 1HCJA 1XA5A 2DDCA 4GGFC 1SCMC 1GL4A 4XOVA 2EMNA 2K7DA 1GJYA 3RWAA 2B3PA 3IQQA 2JULA 1KYPA 1QLSA 4ORNA 2K8MB 4DXQA 5G08A 3KCSA 2JQ6A 2ZRSA 4JEOA 1XVJA 3SVSA 4M2QA 1GGZA 2BKIB 4TNCA 5T3IA 3I5GC 4U2VA 5AEQA 2H5RA 2GGMA 3DQCA 3I5HB 3VRQA 3CFAA 4W7EA 3AKAA 5I2QA 2E30A 4Q04A 4KEXA 2A53B 1DVIA 2EMOA 1KK7Y 2WORA 3BXCA 1M46A 2B3QA 2M7NA 5AANA 4GNKB 1DJXA 2F3YA 2GW3A 2ZO6A 2C9IA 2VVIA 4XVPA 5DKNA 1ZUXA 2LMUA 2H61C 5HKYA 1OMRA 1CKKA 2CXJA 2Q91A 2VAEA 3BX9A 1RMPA 3NT9A 1EG4A 2BCBA 4I5NB 4OV2A 1IJ6A 1Y1AA 1JUOA 3SSVA 2MLEC 3VRRA 5CSJA 1CDLA 1DJHA 1SCVA 4ORBB 2MA2A 3A8SA 4C0JA 3BUOB 2KGBC 2PMYA 4GBAA 1JWDA 3A8RA 2NZ0A 4DCKA 1YZWA 1YRTB 4R1EA 1QY3A 2KNEA 3PSRA 1YVHA 5FVIA 2KI4B 1UWOA 4GUKA 1XFYO 4LJCA 4H3LA 1EXRA 1SKTA 2YDZA 3KHEA 4ZF3A 5EXUA 1TIZA 3LA1A 3D10A 1CNPA 1EMBA 4NWSA 2KI6D 1KQMB 2H5PA 4KF4A 1JC1A 2K0JA 3WHUB 2H5OA 1RMOA 1AJ4A 2QLGA 3DPXA 2ZMUA 2FJUB 4DXIA 3D0YB 1HUYA 1OQPA 2L4IA 4TZAA 2V4EC 3SVUA 3IF7A 5KTYA 2EGDA 2M0RA 2FWQA 4WQ3A 1XFWO 2I7AA 4HQ8A 1M45A 5FVFA 1F70A 4OGSA 1YHIA 4DS7A 4Q9WA 3DVEA 2L51A 1KFXL 2FCEA 1CLLA 3K1KA 1NX3A 1J7RA 2LP3A 3DVJA 1QJTA 2VVHA 2PVBA 3CFHA 4PCWA 4MN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP0 A;  1IH0 A;  5HKZ A;  1A75 B;  1XK4 A;  3PJ5 A;  1C4F A;  2HQK A;  1QIW A;  2IB5 A;  1KK8 B;  1D1O A;  3OGO A;  2KAY A;  4MSP A;  3MGF A;  4W69 A;  2M49 B;  1MR8 A;  4MRY A;  3DQD A;  2WHU A;  2ZNE A;  1M39 A;  1SMG A;  3LVD A;  3DQA A;  1Q4B A;  2ZKM X;  4KW8 A;  3SSY A;  1KFX S;  5EXC I;  1X02 A;  4IK4 A;  1JFJ A;  1F54 A;  1GGX A;  1NUB A;  2BBM A;  4JWQ A;  1CMG A;  5HYD A;  1SL8 A;  1SCM B;  2MAZ A;  5KSZ A;  1YVL A;  1HQV A;  1EME A;  1A4P A;  2M97 A;  3DQ5 A;  3TS5 C;  1YUU A;  4Q7T A;  4LJB A;  1B8L A;  1TCO B;  2A56 B;  4L1I A;  2AAO A;  1IQ5 A;  4N5X A;  3SV5 A;  1Q4A A;  5DTZ A;  1PSB A;  4MEW A;  5TNC A;  2RH7 A;  3BUM B;  1ODB A;  4HE4 A;  3AAJ A;  3I5G B;  3JVT C;  1DF0 A;  5I8N A;  1OXF A;  2CBL A;  1UHJ A;  1K93 D;  2JC2 A;  1W7I B;  4XJK B;  2ZRT A;  5DTX A;  3VGO A;  1RMM A;  2JRF A;  1K9U A;  4QJ3 B;  5DRG A;  1OMD A;  2F3Z A;  4OKH A;  2WIQ A;  1MXL C;  3QRX A;  3CTN A;  4W6N A;  1EMG A;  4MZJ A;  2M1K B;  1UUR A;  1RJV A;  2WHT A;  2KFF A;  5F6T A;  1LA0 A;  4W6I A;  1TNX A;  1BLQ A;  1C7W A;  1PK0 D;  2JOJ A;  5DU0 A;  1DGU A;  2K7C A;  1A2X A;  4IL1 A;  2WOS A;  5DKQ A;  2G5Z B;  1K9K A;  1ZAC A;  1C07 A;  4B30 A;  2F2O A;  2SCP A;  3KCT A;  3CGA A;  1JBZ A;  1XQM A;  2A46 A;  4W6P A;  1B7T Z;  1TNW A;  1KQV A;  3ZUL A;  3DQK A;  4W7R A;  2MHH A;  1PVB A;  1M31 A;  2KFH A;  3TDZ A;  2WSN A;  1MWN A;  3LF4 B;  5I2O A;  2I2R E;  2JWW A;  5EBJ A;  2LC5 A;  4P5O E;  3CB9 A;  2OPO A;  2LP2 A;  4W7A A;  2LLS A;  4ZCV A;  2IOV A;  1EH2 A;  4W6S A;  3ZUJ A;  2ZN9 A;  4BDU A;  2JXL A;  3LK0 A;  1U5I B;  3DF0 A;  3VHT B;  4FTG A;  1FPW A;  3ST3 A;  3CD9 A;  1G8I A;  3AAK A;  4OHS A;  2LVV A;  3DQ2 A;  4W74 A;  2LV7 A;  3NSK A;  1JFK A;  2HQZ A;  2QRF A;  2DD9 A;  4A4C A;  4L9M A;  2BL0 B;  1J7P A;  3LS3 A;  3S05 A;  3CFF A;  2LCP A;  3V3D A;  1UIS A;  2V4E B;  3GEX A;  1CM4 A;  4A4B A;  4EUL A;  3KPX A;  2CT9 A;  4W6G A;  3DQJ A;  3M22 A;  4ANJ A;  2COL B;  1YHH A;  1QTX A;  1RWY A;  2KYF A;  3JTD C;  1K95 A;  1K90 D;  3AKO A;  4Z4M A;  1QX2 A;  5BTT B;  2C9J A;  4DXO A;  5KTG A;  3GOF A;  3P8U A;  4P76 A;  1CM1 A;  4GFT A;  2MBX A;  3PFV A;  4DXP A;  4KGF A;  1B9A A;  3SG6 A;  3EK7 A;  4CFQ A;  1VRK A;  2ZN8 A;  1S5G Z;  3BUX B;  4PDZ A;  1XK4 C;  1IJ5 A;  1YX8 A;  1S3P A;  2O5G A;  3SRY A;  2LLU A;  3I5I C;  1Q4D A;  1AUI B;  1MF8 B;  4QJ4 B;  3DQ7 A;  1J7Q A;  3ST2 A;  2LAN A;  3EVV A;  2G6Y A;  3IQO A;  1RTP 1;  5H89 A;  1G7K A;  2HQ8 A;  2GV5 A;  2M3W A;  1OE9 B;  4PE0 A;  1W7U A;  4W6H A;  4JGE A;  4W75 A;  3U0N A;  2LLT A;  2QZ0 A;  4WRI A;  1MQ1 A;  1WDC B;  2YFP A;  4PHJ A;  3TUY C;  1DMO A;  5IBW A;  2H6V A;  5H87 A;  1BOD A;  2KGR A;  2RGI A;  3DQM A;  4JC2 A;  1MOU A;  3SVC A;  1PAL A;  4YBH B;  2AMI A;  1J1D A;  2PXW A;  2LHI A;  5ER4 X;  2VAD A;  3TS5 B;  1ZUZ A;  3CS1 A;  2AWL A;  3K21 A;  2OS8 C;  4IK1 A;  4W6A A;  2IS9 A;  4D1E A;  3CZT X;  5HW9 A;  3DQN A;  2K7O A;  1CLB A;  1QV1 A;  1G4Y R;  5DPH A;  2A4J A;  3W1D A;  3DPW A;  4MLW A;  2JZI A;  3JVT B;  3DD4 A;  3EKH A;  1S6Z A;  4YRU A;  1K2H A;  2F8P A;  2E6W A;  4W6T A;  4NDB A;  2QT2 A;  5DRF A;  1RM9 A;  1R6P A;  4LQT A;  3AI4 A;  1NX0 A;  1DJI A;  3DQ9 A;  1LXF C;  2POX A;  4KW4 A;  3OB2 B;  2CTN A;  4IK8 A;  4W6C A;  3SSP A;  4H47 A;  1NSH A;  2A48 A;  2L0P A;  5K89 A;  1F4O A;  5JOL A;  1PSR A;  3HX4 A;  3WLC A;  2Y1M A;  1YJF A;  1CTR A;  5H88 A;  2LUX A;  1QYQ A;  2O24 A;  4NQG A;  1KCY A;  4W7X A;  1CFC A;  1NWD A;  1NYA A;  1FW4 A;  1NPQ A;  1Y1U A;  1AP4 A;  1XA9 A;  1F09 A;  1IG5 A;  1KYR A;  3HCM A;  2L50 A;  1KP5 A;  3DQ6 A;  1WRK A;  3DQ3 A;  1ZGQ A;  1KSM A;  2Z6Y A;  4AQJ A;  2PRU A;  2BL0 C;  1NX2 A;  3U0M A;  2LVI A;  3GL4 A;  5DQM A;  3P28 A;  1AJ5 A;  2GW4 B;  1ALW A;  1A03 A;  2QLG B;  2ICR A;  2DD7 A;  3SG5 A;  1Y1X A;  4W6K A;  1K96 A;  3O2P A;  2AWM A;  1EL4 A;  4N1F A;  3LVA A;  3ST4 A;  1L7Z A;  2JTT A;  4KW9 A;  4IK5 A;  5LK4 A;  1B7T Y;  4KAG A;  3BYA A;  2DDD A;  4M2O A;  2G16 B;  2A54 B;  3GJ1 A;  1TN4 A;  5I2L A;  4W6M A;  1Y0V H;  3JTD B;  1AK8 A;  1XSS A;  3I19 A;  2QU1 A;  3SSL A;  3DPZ A;  2AH8 A;  4HRH A;  2HFC A;  4AS8 A;  1J55 A;  3DQ1 A;  4MZK A;  5AER A;  2IE2 A;  5FHV A;  5AQB B;  3EVR A;  3PIB A;  1H6R A;  4L13 A;  1QV0 A;  2KAV A;  4W6F A;  2I94 A;  4JPZ B;  1NX1 A;  3A4U B;  4LJD A;  2HJO A;  3W1C A;  1KWO C;  2DUI A;  2HET A;  1S6I A;  4J8A A;  1DJG A;  4MZL A;  1CLM A;  1RFJ A;  4KPI A;  1WDC C;  3PN7 C;  3DQH A;  1TCF A;  2ARL A;  3G9A A;  2Q57 A;  3I5I B;  1YTZ C;  3I5F C;  2Z1O A;  1BMO A;  4BY5 A;  5HLO A;  4W6L A;  1SRA A;  1UHK A;  4EN1 A;  3EK4 A;  4ORA B;  4I5J A;  1ALV A;  3SVR A;  2LMV A;  4PHN A;  4OVN F;  2BE6 A;  1C7V A;  2JU0 A;  1UHI A;  1WRZ A;  4OCI A;  1IKU A;  1K94 A;  1SYM A;  3TUY B;  4W72 A;  3WCK A;  4DKN A;  3E5T A;  3ZNI A;  5DPG A;  4R6B A;  2JT3 A;  4CFR A;  2H5Q A;  4MVF A;  1NP8 A;  2WIS A;  3O77 A;  2M8U A;  2KBM A;  4C0K A;  3MSE B;  1EG3 A;  1ZMZ A;  4BY4 A;  2P4M A;  2QLE A;  4JQ0 D;  2HPW A;  3ST0 A;  2KYC A;  1XAE A;  1S5G Y;  2OS8 B;  4AOM A;  1DGV A;  3U0K A;  1DF0 B;  1ZGP A;  2HRS A;  1QVI Z;  1TOP A;  4XL5 A;  1CFD A;  2F33 A;  1R2U A;  4PHM A;  3SG7 A;  2WSO A;  2O60 A;  2KDH A;  1QXT A;  2MLF C;  4USL A;  4ZFS A;  3M0W A;  4ZF4 A;  4ZCU A;  4YGB B;  1GFL A;  2DUH A;  3U8A A;  2H61 A;  5D69 A;  1ZGO A;  4FQO A;  4HRE E;  1K8U A;  5AXI A;  2WCE A;  3SVB A;  1S36 A;  1XFV O;  4JFG A;  5J3X A;  1EML A;  4W77 A;  1TTX A;  3BOW A;  2QAC A;  2H8Q A;  2VVJ A;  3GJ2 A;  2G3O A;  1MXE A;  4B30 B;  2LAP A;  2AWJ A;  4GPL B;  1BR4 B;  1YUT A;  4IK9 A;  4Q7U A;  2JXC A;  3NED A;  2JT8 A;  1HT9 A;  3ZTF A;  3U8C A;  1PVA A;  4YGE B;  5HLV A;  1SY9 A;  2KOT A;  3BXB A;  1LA3 A;  2LNK A;  3KEV A;  4MRX A;  2NXQ A;  1JBA A;  1SL7 A;  2LMT A;  1MUX A;  1OXD A;  5DTY A;  4PFE A;  3WNX B;  2Y1N A;  3DQL A;  2VZX A;  1XFU O;  1N0Y A;  3DF0 B;  5ER5 A;  1UP5 A;  1DT7 B;  1BFP A;  2HGY A;  2H9W A;  2OTG C;  2HQW A;  3OX5 A;  5LTR A;  2LVJ A;  5J2O A;  5HZO A;  1EMF A;  4HQ9 A;  2FL1 A;  3LF3 A;  4PPK A;  3PJ7 A;  3H4S E;  1IWQ A;  4J89 A;  2D8N A;  2M7L A;  2OKW A;  2TN4 A;  2KHN A;  3SIA A;  2K2A A;  4OQW A;  4H3M A;  1F4Q A;  4YGA A;  2GX0 A;  4AR7 A;  1SL9 A;  1F0B A;  4OJ0 A;  5EHU A;  3LSA A;  3IR8 A;  4P1Q A;  4PAL A;  5D7F A;  4HQC A;  1SPY A;  1F55 A;  2VRG A;  4GES B;  1IGV A;  1GGW A;  2L98 A;  4KF5 A;  2AUC A;  4LJD C;  3O6B A;  3SVO A;  5AFP A;  3U8P A;  2DUF A;  4GAO A;  1JF0 A;  2A50 B;  1AHR A;  1XFZ O;  2BBN A;  4EDS A;  4UTS A;  1JSA A;  3DQO A;  2OJK A;  2JAD A;  2MJW B;  1QIV A;  1KWO B;  4I2Y A;  2Q6P A;  5BT0 A;  1JF2 A;  1N65 A;  1JC0 A;  5B8I B;  3PN7 B;  4Z4K A;  1F8H A;  5HZS A;  3I5F B;  1E8A A;  4GGN A;  3DQ8 A;  3CR4 X;  1QAS A;  1W7S A;  2G2B A;  2K2F A;  1DTL A;  1OZS A;  5CPV A;  2LM5 A;  4E68 A;  2LVK A;  2NCO A;  3FWB A;  5CSI A;  4CID A;  2Y4Q A;  3FS7 A;  3F45 A;  4H48 A;  5PAL A;  1JBY A;  4NDC A;  3SVE A;  3LLE A;  4RYS A;  1CDN A;  1EJ3 A;  2YE0 A;  2HCG A;  2HPS A;  1V1G A;  1XFX O;  4HVF A;  3TZ1 A;  2PAL A;  4GF6 B;  3UG0 A;  3SG4 A;  2CCM A;  1LKJ A;  1QAT A;  4W7D A;  3GK1 A;  3OSR A;  3DVK A;  1EMK A;  1M63 B;  2V53 A;  5DQB A;  3NSL A;  4LW5 A;  2KI6 C;  2WC8 A;  3NT3 A;  3SJS A;  2HGD A;  2KFG A;  2LHL A;  4W7F A;  1KFU L;  3CR2 A;  2PSR A;  3C1V A;  4DUQ A;  2M29 A;  1WLM A;  1WRL A;  4XOW A;  3GK2 A;  2ZND A;  3BXK A;  4W6J A;  3O4Y A;  2Z6X A;  1FF1 A;  2FCD A;  1XO5 A;  3SG2 A;  5DTL A;  4ZIN A;  4DIR A;  1H4U A;  1CMF A;  1JC2 A;  4ETO A;  3OSQ A;  3SG3 A;  1UHH A;  3CWG A;  1YRU B;  2ZFD A;  3PAL A;  1Z1P A;  2DOQ A;  2OGR A;  1YUS A;  4OR9 B;  1BR1 B;  1LVC D;  3CR5 X;  4AQI A;  3PAT A;  1CV7 A;  4N3D A;  3BQ3 A;  4W73 A;  2Y5I A;  5GQQ C;  1SR6 C;  4B5Y A;  2KQY A;  1BT6 A;  4QJ5 B;  5EB6 A;  4Q9X A;  3RM1 A;  1BOC A;  5HZT A;  1PRW A;  1KFU S;  1QVI Y;  3D0Y A;  3DQF A;  4W6R A;  1AVS A;  2NLN A;  4PHK A;  2O29 A;  4KA9 A;  3EVU A;  4PE7 A;  4XYN A;  2JNX A;  4DXM A;  2FOT A;  2YE1 A;  4YGD B;  4GOB A;  1YFP A;  5BPJ A;  2QPT A;  1FBV A;  1YUR A;  3WHT B;  2EC6 B;  2Y0G A;  4W76 A;  1UUS A;  3CBE A;  1OMV A;  3VRN A;  3O78 A;  3TDI A;  2BCX A;  2OTG B;  4DKM A;  4HRG A;  2G2S B;  4ZIO A;  1B47 A;  1S1E A;  1ZOT B;  2K7B A;  4JF9 A;  2HF5 A;  4LQU A;  3GK4 X;  1DJW A;  1WLZ A;  2M1U A;  1Q4E A;  1H4B A;  1G33 A;  4U8D A;  3SVN A;  3TMT A;  3CD1 A;  1REC A;  1TRF A;  3SIB A;  1A75 A;  1NIW A;  1WY9 A;  2EMD A;  2DUE A;  3NF0 A;  4CLN A;  2LUC A;  3NSI A;  3H1R A;  1QYO A;  1KK7 Z;  1QYF A;  4J88 A;  5KU1 A;  2FZU A;  5DPJ A;  1YX7 A;  4KF5 C;  2IB6 A;  2G9B A;  3PLF B;  3PM8 A;  2JTZ A;  5HGE A;  1L2O C;  3ADF A;  1B9C A;  1QLK A;  5FYX A;  2Q4U A;  1KSO A;  1YR5 A;  1SW8 A;  3DVM A;  1IQ3 A;  1S6C A;  1SNL A;  2G6X A;  1W7T A;  2M9G A;  4GGF A;  1QX5 B;  2BTJ A;  3DQU A;  5CSN A;  4NDD A;  2PXS A;  5FVG A;  2ZMW A;  2R2I A;  3OHM B;  2NCP A;  2Z6Z A;  1BU3 A;  4YI9 A;  5DPI A;  4CPV A;  2KSP A;  1K9P A;  1S26 D;  4W6U A;  1Z1Q A;  5EB7 A;  2L4H A;  3I5H C;  2BKH B;  3E5V A;  2KAX A;  3CGL A;  2OTB A;  1DJY A;  1RK9 A;  4R6D A;  2O2B A;  4ZBL A;  1B8R A;  4M2P A;  3LK1 A;  4XJK A;  5CSF A;  3KO0 A;  1J7O A;  4JRB A;  4PPL A;  4W6B A;  3SST A;  1NCZ A;  3LCP C;  3NSO A;  1B4C A;  1EMM A;  3WXA A;  1Q73 A;  2WCF A;  1H8B A;  1IRJ A;  4DXN A;  1N2D A;  1BF5 A;  5F9G A;  3LVC A;  2B1U A;  1LIN A;  4YI8 A;  2ZO7 A;  1A29 A;  4N1G A;  3GB3 A;  2WUR A;  1KYS A;  4PPJ A;  3DQ4 A;  3KF9 A;  2AWK A;  4W6O A;  3E3R A;  2BEC A;  2A47 A;  1CDM A;  1FI6 A;  3DQE A;  2DUG A;  1CFF A;  1UHN A;  3U0L A;  2EHB A;  1QXP A;  1TNQ A;  3DQI A;  4ZB1 A;  4EMQ A;  3VRO A;  4RYW A;  1MHO A;  2LE9 B;  2CNP A;  4F0Z B;  3M24 A;  4H3N A;  1OZO A;  1S6J A;  3CLN A;  3E5W A;  4ORC B;  1QS7 A;  4IK3 A;  2WND A;  3AI5 A;  5JJG A;  2QLI A;  1XYD A;  2JPT A;  2ISD A;  2GGZ A;  4PE1 A;  3NEZ A;  2BCA A;  1RRX A;  2KI4 C;  4DRW A;  1MYW A;  3FWC A;  1B1G A;  4IZN A;  3BOW B;  3EVP A;  4TZG A;  4W6D A;  3EK8 A;  3LL8 B;  3SS0 A;  2F2P A;  2WHS A;  4PE4 A;  5EXB A;  3WLD A;  2A52 B;  2PAS A;  1Q4C A;  4OY4 A;  4ZF5 A;  5DY6 A;  1ZFS A;  1RRO A;  3ICB A;  3OX6 A;  1U5I A;  2G3D B;  3VHT A;  4MBE A;  4C0L A;  1KQM C;  3BXA A;  3OB1 B;  5HBD A;  4EDO A;  1CFP A;  1Q80 A;  1SR6 B;  1EMA A;  3SVD A;  5BQL A;  5HZU A;  1OSA A;  3TDU A;  1FI5 A;  1XMZ A;  2EC6 C;  1QX7 A;  1MOV A;  1BJF A;  2L5X B;  3H1O A;  4W7C A;  3SSH A;  1CB1 A;  2V4E A;  3VIC A;  1BG1 A;  1EMC A;  2MRD A;  2KBI A;  2SAS A;  1NCX A;  4HSZ A;  2QLH A;  3EKJ A;  5BTT A;  2BE4 A;  2JNF A;  3UFZ A;  5EJU A;  3SSK A;  1SBJ A;  1F71 A;  2L2E A;  4KGE A;  4L12 A;  5LTP A;  3TMR A;  2G6E A;  4XGY A;  3ZUF A;  1GQM A;  3NXA A;  1B8C A;  3AKB A;  1W7J B;  1OOJ A;  1YHG A;  2OKY A;  1V1F A;  1YJ2 A;  3ZWH A;  2P6B B;  4YGC B;  4RTC A;  4WQ2 A;  1NCY A;  3BUN B;  1KK8 C;  2WCB A;  3VRP A;  4Q7R A;  2I18 A;  5DKR A;  1SK6 D;  3BUW B;  3ED8 A;  1PUL A;  4I5K A;  5HKW A;  2KQ6 A;  3FIA A;  2H2K A;  5LTQ A;  2AHA A;  3RLZ A;  1Y6W A;  4UPG A;  3VK1 A;  1OXE A;  2JT0 A;  2OTE A;  1TNP A;  1DJZ A;  3PJB A;  1L2O B;  1J1E A;  2K61 A;  3IP2 A;  1CDP A;  4ICB A;  4I5L B;  4P2Y B;  3RWT A;  2GX2 A;  1HCJ A;  1XA5 A;  2DDC A;  4GGF C;  1SCM C;  1GL4 A;  4XOV A;  2EMN A;  2K7D A;  1GJY A;  3RWA A;  2B3P A;  3IQQ A;  2JUL A;  1KYP A;  1QLS A;  4ORN A;  2K8M B;  4DXQ A;  5G08 A;  3KCS A;  2JQ6 A;  2ZRS A;  4JEO A;  1XVJ A;  3SVS A;  4M2Q A;  1GGZ A;  2BKI B;  4TNC A;  5T3I A;  3I5G C;  4U2V A;  5AEQ A;  2H5R A;  2GGM A;  3DQC A;  3I5H B;  3VRQ A;  3CFA A;  4W7E A;  3AKA A;  5I2Q A;  2E30 A;  4Q04 A;  4KEX A;  2A53 B;  1DVI A;  2EMO A;  1KK7 Y;  2WOR A;  3BXC A;  1M46 A;  2B3Q A;  2M7N A;  5AAN A;  4GNK B;  1DJX A;  2F3Y A;  2GW3 A;  2ZO6 A;  2C9I A;  2VVI A;  4XVP A;  5DKN A;  1ZUX A;  2LMU A;  2H61 C;  5HKY A;  1OMR A;  1CKK A;  2CXJ A;  2Q91 A;  2VAE A;  3BX9 A;  1RMP A;  3NT9 A;  1EG4 A;  2BCB A;  4I5N B;  4OV2 A;  1IJ6 A;  1Y1A A;  1JUO A;  3SSV A;  2MLE C;  3VRR A;  5CSJ A;  1CDL A;  1DJH A;  1SCV A;  4ORB B;  2MA2 A;  3A8S A;  4C0J A;  3BUO B;  2KGB C;  2PMY A;  4GBA A;  1JWD A;  3A8R A;  2NZ0 A;  4DCK A;  1YZW A;  1YRT B;  4R1E A;  1QY3 A;  2KNE A;  3PSR A;  1YVH A;  5FVI A;  2KI4 B;  1UWO A;  4GUK A;  1XFY O;  4LJC A;  4H3L A;  1EXR A;  1SKT A;  2YDZ A;  3KHE A;  4ZF3 A;  5EXU A;  1TIZ A;  3LA1 A;  3D10 A;  1CNP A;  1EMB A;  4NWS A;  2KI6 D;  1KQM B;  2H5P A;  4KF4 A;  1JC1 A;  2K0J A;  3WHU B;  2H5O A;  1RMO A;  1AJ4 A;  2QLG A;  3DPX A;  2ZMU A;  2FJU B;  4DXI A;  3D0Y B;  1HUY A;  1OQP A;  2L4I A;  4TZA A;  2V4E C;  3SVU A;  3IF7 A;  5KTY A;  2EGD A;  2M0R A;  2FWQ A;  4WQ3 A;  1XFW O;  2I7A A;  4HQ8 A;  1M45 A;  5FVF A;  1F70 A;  4OGS A;  1YHI A;  4DS7 A;  4Q9W A;  3DVE A;  2L51 A;  1KFX L;  2FCE A;  1CLL A;  3K1K A;  1NX3 A;  1J7R A;  2LP3 A;  3DVJ A;  1QJT A;  2VVH A;  2PVB A;  3CFH A;  4PCW A;  4MN0 A; 
#chains in the Genus database with same CATH topology
 3OP0 A;  1IH0 A;  5HKZ A;  1A75 B;  1XK4 A;  3PJ5 A;  1C4F A;  2HQK A;  1QIW A;  2IB5 A;  1KK8 B;  1D1O A;  3OGO A;  2KAY A;  4MSP A;  3MGF A;  4W69 A;  2M49 B;  2ERB A;  1MR8 A;  4MRY A;  3DQD A;  2WHU A;  2QEV A;  2ZNE A;  1M39 A;  1SMG A;  3LVD A;  3DQA A;  1Q4B A;  2ZKM X;  4KW8 A;  3SSY A;  1LS8 A;  1KFX S;  5EXC I;  1X02 A;  4IK4 A;  1JFJ A;  1F54 A;  1GGX A;  1NUB A;  2BBM A;  4JWQ A;  1CMG A;  5HYD A;  1SL8 A;  1SCM B;  2MAZ A;  5KSZ A;  1YVL A;  1HQV A;  1EME A;  1A4P A;  2M97 A;  3DQ5 A;  1T14 A;  3TS5 C;  1QWV A;  1YUU A;  4Q7T A;  4LJB A;  1B8L A;  1TCO B;  2A56 B;  4L1I A;  2AAO A;  1IQ5 A;  4N5X A;  3SV5 A;  1Q4A A;  5DTZ A;  1W9Z A;  1PSB A;  4MEW A;  5TNC A;  2RH7 A;  3BUM B;  1ODB A;  3NGV A;  4HE4 A;  5FI2 A;  3AAJ A;  3I5G B;  3JVT C;  1DF0 A;  5I8N A;  1OXF A;  2CBL A;  1UHJ A;  1K93 D;  2JC2 A;  1W7I B;  1OOI X;  4XJK B;  2ZRT A;  5DTX A;  3VGO A;  1RMM A;  2JRF A;  1K9U A;  4QJ3 B;  5DRG A;  1OMD A;  2F3Z A;  4OKH A;  2WIQ A;  1MXL C;  3QRX A;  3CTN A;  4W6N A;  1EMG A;  4MZJ A;  2M1K B;  1UUR A;  1RJV A;  2WHT A;  2KFF A;  5F6T A;  1LA0 A;  4W6I A;  1TNX A;  1BLQ A;  1C7W A;  1PK0 D;  2JOJ A;  5DU0 A;  1DGU A;  2K7C A;  1A2X A;  4IL1 A;  2WOS A;  3S0G A;  5DKQ A;  2G5Z B;  1K9K A;  1ZAC A;  2P71 A;  1C07 A;  4B30 A;  2F2O A;  2SCP A;  3KCT A;  3CGA A;  1JBZ A;  1XQM A;  2A46 A;  4W6P A;  1B7T Z;  1TNW A;  1KQV A;  3ZUL A;  3S0D A;  3DQK A;  4W7R A;  2MHH A;  1PVB A;  1M31 A;  2KFH A;  3TDZ A;  2WSN A;  1MWN A;  3LF4 B;  5I2O A;  2I2R E;  2JWW A;  5EBJ A;  2LC5 A;  3CZ1 A;  3DYE A;  4P5O E;  3CB9 A;  3N7H A;  2OPO A;  2LP2 A;  4W7A A;  2KLE A;  2LLS A;  4ZCV A;  2IOV A;  1EH2 A;  4W6S A;  3ZUJ A;  2ZN9 A;  3FE9 A;  4BDU A;  2JXL A;  3LK0 A;  1U5I B;  3DF0 A;  3VHT B;  4FTG A;  1FPW A;  5HL1 A;  3ST3 A;  3CD9 A;  1G8I A;  3AAK A;  4OHS A;  3D77 A;  1C3Y A;  2LVV A;  3DQ2 A;  4W74 A;  2LV7 A;  3NSK A;  1JFK A;  2HQZ A;  2QRF A;  2DD9 A;  4A4C A;  4L9M A;  2BL0 B;  1J7P A;  3LS3 A;  3S05 A;  3CFF A;  2LCP A;  3V3D A;  1UIS A;  2V4E B;  3GEX A;  1CM4 A;  4A4B A;  4EUL A;  3S0F A;  2H8V A;  3KPX A;  2CT9 A;  4W6G A;  3DQJ A;  3M22 A;  4ANJ A;  2COL B;  1YHH A;  1QTX A;  1RWY A;  2KYF A;  3JTD C;  1K95 A;  1K90 D;  4PT1 A;  3AKO A;  4Z4M A;  1QX2 A;  5BTT B;  2C9J A;  4DXO A;  5KTG A;  3GOF A;  3P8U A;  4P76 A;  1CM1 A;  4GFT A;  2MBX A;  3PFV A;  3S0B A;  4DXP A;  4KGF A;  1B9A A;  3SG6 A;  3EK7 A;  3D74 A;  4CFQ A;  1VRK A;  2WCM A;  3L47 A;  2ZN8 A;  1S5G Z;  3BUX B;  4PDZ A;  4F7F A;  1XK4 C;  1IJ5 A;  1YX8 A;  1S3P A;  2O5G A;  3SRY A;  2LLU A;  3I5I C;  1Q4D A;  1AUI B;  1MF8 B;  4QJ4 B;  3DQ7 A;  1J7Q A;  3ST2 A;  2LAN A;  3EVV A;  2G6Y A;  3IQO A;  1RTP 1;  5H89 A;  3L4A A;  1G7K A;  5FI6 A;  2HQ8 A;  2GV5 A;  2M3W A;  1OE9 B;  4PE0 A;  1W7U A;  4W6H A;  4JGE A;  4W75 A;  3U0N A;  2LLT A;  2QZ0 A;  4WRI A;  1MQ1 A;  1WDC B;  2YFP A;  4PHJ A;  2PQL A;  3TUY C;  1DMO A;  5IBW A;  2H6V A;  5H87 A;  1BOD A;  2KGR A;  2RGI A;  3DQM A;  4JC2 A;  1MOU A;  3SVC A;  1PAL A;  4YBH B;  2AMI A;  1J1D A;  2PXW A;  2LHI A;  5ER4 X;  2VAD A;  3TS5 B;  1ZUZ A;  3CS1 A;  2AWL A;  3K21 A;  2OS8 C;  1DC1 A;  4IK1 A;  4W6A A;  2IS9 A;  4D1E A;  3CZT X;  5HW9 A;  3DQN A;  2K7O A;  1CLB A;  1QV1 A;  3S0A A;  1G4Y R;  5DPH A;  1SSE B;  2A4J A;  3W1D A;  3DPW A;  3EG5 B;  4MLW A;  2JZI A;  3JVT B;  3DD4 A;  3EKH A;  1S6Z A;  4YRU A;  1K2H A;  2F8P A;  2E6W A;  4W6T A;  2GTE A;  4NDB A;  2QT2 A;  5DRF A;  1RM9 A;  1R6P A;  4LQT A;  3AI4 A;  1NX0 A;  1DJI A;  1C3Z A;  3DQ9 A;  1LXF C;  1P28 A;  2POX A;  4KW4 A;  3OB2 B;  2CTN A;  4IK8 A;  3D73 A;  4W6C A;  3SSP A;  4H47 A;  1NSH A;  2A48 A;  2L0P A;  5K89 A;  1F4O A;  3D76 A;  5JOL A;  1PSR A;  3R1P A;  3HX4 A;  3WLC A;  2Y1M A;  1YJF A;  2WCK A;  1CTR A;  5H88 A;  2LUX A;  1QYQ A;  3OBV A;  2O24 A;  4NQG A;  1KCY A;  4W7X A;  1CFC A;  1NWD A;  1NYA A;  2L2C A;  3S0E A;  1FW4 A;  1NPQ A;  1Y1U A;  1AP4 A;  1XA9 A;  1OOH A;  1F09 A;  1IG5 A;  1KYR A;  3HCM A;  1Z2C B;  2L50 A;  1KP5 A;  3DQ6 A;  1WRK A;  3DQ3 A;  1ZGQ A;  1KSM A;  2Z6Y A;  3PJI A;  3PM2 A;  4AQJ A;  2PRU A;  2BL0 C;  1NX2 A;  3U0M A;  2LVI A;  3GL4 A;  5DQM A;  3P28 A;  1AJ5 A;  3UNW A;  2GW4 B;  1ALW A;  1A03 A;  2QLG B;  2ICR A;  2DD7 A;  3SG5 A;  1Y1X A;  1GM0 A;  4W6K A;  1K96 A;  3O2P A;  2AWM A;  1EL4 A;  4N1F A;  3LVA A;  3ST4 A;  2L5Y A;  1L7Z A;  2JTT A;  4KW9 A;  4IK5 A;  1IIO A;  5LK4 A;  1B7T Y;  2JPO A;  4KAG A;  3BYA A;  2DDD A;  4M2O A;  2G16 B;  2A54 B;  3GJ1 A;  1TN4 A;  3B88 A;  5I2L A;  1Y0V H;  4W6M A;  3JTD B;  1AK8 A;  1XSS A;  3I19 A;  2QU1 A;  3SSL A;  3DPZ A;  2AH8 A;  4HRH A;  2HFC A;  4AS8 A;  1J55 A;  3DQ1 A;  4MZK A;  5AER A;  2IE2 A;  5FHV A;  5AQB B;  3EVR A;  3CDN A;  3PIB A;  1H6R A;  4L13 A;  1QV0 A;  2KAV A;  3B7A A;  4W6F A;  2I94 A;  4JPZ B;  1NX1 A;  3A4U B;  4LJD A;  2HJO A;  3W1C A;  1KWO C;  2DUI A;  2HET A;  1S6I A;  4J8A A;  1DJG A;  4MZL A;  1CLM A;  1RFJ A;  4KPI A;  3SS3 A;  1WDC C;  3PN7 C;  3DQH A;  1TCF A;  2ARL A;  3G9A A;  2Q57 A;  3I5I B;  1YTZ C;  3I5F C;  2Z1O A;  1BMO A;  4BY5 A;  5HLO A;  4W6L A;  1SRA A;  1UHK A;  4OZD A;  4EN1 A;  3EK4 A;  4ORA B;  2WC5 A;  4I5J A;  1ALV A;  3SVR A;  2LMV A;  4PHN A;  3DY9 A;  4OVN F;  2BE6 A;  3VB1 A;  1C7V A;  2JU0 A;  1UHI A;  1WRZ A;  4OCI A;  1IKU A;  1K94 A;  1SYM A;  3TUY B;  4W72 A;  3WCK A;  4DKN A;  3E5T A;  3ZNI A;  5DPG A;  4R6B A;  2JT3 A;  4CFR A;  2H5Q A;  4MVF A;  1NP8 A;  2WIS A;  3O77 A;  2M8U A;  2KBM A;  4C0K A;  3MSE B;  1EG3 A;  1ZMZ A;  4BY4 A;  2P4M A;  2QLE A;  4JQ0 D;  2HPW A;  3ST0 A;  1OOG A;  2KYC A;  3FE6 A;  1S5G Y;  2OS8 B;  1XAE A;  3IVT A;  4AOM A;  1DGV A;  3U0K A;  3O4X A;  1DF0 B;  1ZGP A;  2HRS A;  3V2L A;  1QVI Z;  1TOP A;  4XL5 A;  1CFD A;  2F33 A;  1R2U A;  4PHM A;  3SG7 A;  2WSO A;  2O60 A;  2KDH A;  1QXT A;  2MLF C;  4USL A;  4ZFS A;  3M0W A;  4ZF4 A;  4ZCU A;  4YGB B;  1GFL A;  2DUH A;  3U8A A;  2H61 A;  5D69 A;  1ZGO A;  4FQO A;  4HRE E;  2FJY A;  1K8U A;  5DIC A;  5AXI A;  2WCE A;  3SVB A;  1S36 A;  1XFV O;  4JFG A;  5J3X A;  1EML A;  4W77 A;  1TTX A;  3BOW A;  3QME A;  2QAC A;  2H8Q A;  2VVJ A;  3GJ2 A;  2G3O A;  1MXE A;  4B30 B;  2LAP A;  2AWJ A;  4GPL B;  1BR4 B;  1YUT A;  3B87 A;  4IK9 A;  4Q7U A;  2JXC A;  3NED A;  2JT8 A;  1HT9 A;  3ZTF A;  3U8C A;  1PVA A;  4YGE B;  5HLV A;  1SY9 A;  2KOT A;  3BXB A;  1LA3 A;  2LNK A;  3KEV A;  4MRX A;  2NXQ A;  1JBA A;  1SL7 A;  4JD9 A;  2LMT A;  1MUX A;  1OXD A;  5DTY A;  4PFE A;  3WNX B;  2Y1N A;  3DQL A;  2VZX A;  1XFU O;  1N0Y A;  1TUZ A;  3DF0 B;  5ER5 A;  1UP5 A;  1DT7 B;  1BFP A;  2HGY A;  2H9W A;  2OTG C;  2HQW A;  3OX5 A;  5LTR A;  2LVJ A;  5J2O A;  5HZO A;  1EMF A;  4HQ9 A;  2FL1 A;  3LF3 A;  5FI7 A;  4PPK A;  3PJ7 A;  3H4S E;  1IWQ A;  4J89 A;  1ORG A;  2D8N A;  2M7L A;  2OKW A;  2TN4 A;  2KHN A;  3SIA A;  2K2A A;  4OQW A;  4H3M A;  1F4Q A;  4YGA A;  2GX0 A;  4AR7 A;  1SL9 A;  1F0B A;  4OJ0 A;  5EHU A;  3LSA A;  3IR8 A;  4P1Q A;  4PAL A;  5D7F A;  4HQC A;  1SPY A;  1F55 A;  2VRG A;  4GES B;  1IGV A;  1GGW A;  2L98 A;  4KF5 A;  2AUC A;  4LJD C;  3O6B A;  3SVO A;  5AFP A;  3U8P A;  4FQT A;  2DUF A;  4GAO A;  1JF0 A;  2A50 B;  1AHR A;  1XFZ O;  2BBN A;  4EDS A;  4UTS A;  1JSA A;  3DQO A;  2OJK A;  2JAD A;  2MJW B;  1QIV A;  2YGU A;  1KWO B;  4I2Y A;  1TUJ A;  2Q6P A;  5BT0 A;  1JF2 A;  1N65 A;  1JC0 A;  5B8I B;  3PN7 B;  4Z4K A;  1F8H A;  5HZS A;  3I5F B;  1E8A A;  4GGN A;  3DQ8 A;  3CR4 X;  2K60 A;  1QAS A;  1W7S A;  2G2B A;  2K2F A;  1DTL A;  1OZS A;  5CPV A;  2LM5 A;  4E68 A;  2LVK A;  2NCO A;  3FWB A;  5CSI A;  4CID A;  2Y4Q A;  3CZ0 A;  3FS7 A;  3F45 A;  4H48 A;  5PAL A;  1JBY A;  4NDC A;  3SVE A;  3LLE A;  4RYS A;  2QEB A;  1CDN A;  1EJ3 A;  2YE0 A;  2HCG A;  2HPS A;  1V1G A;  1XFX O;  4HVF A;  3TZ1 A;  2KLD A;  2PAL A;  4GF6 B;  3UG0 A;  3SG4 A;  2CCM A;  1LKJ A;  1QAT A;  4W7D A;  3GK1 A;  3OSR A;  3DVK A;  3L4L A;  3K1E A;  4IJ7 A;  1EMK A;  1M63 B;  2V53 A;  5D3O A;  5DQB A;  3UO9 A;  3BJH A;  3NSL A;  4LW5 A;  2KI6 C;  2WC8 A;  3NT3 A;  3SJS A;  2HGD A;  2KFG A;  2LHL A;  4W7F A;  1DQE A;  1KFU L;  3CR2 A;  2PSR A;  3C1V A;  4DUQ A;  2M29 A;  1WLM A;  1WRL A;  4XOW A;  3GK2 A;  2ZND A;  3BXK A;  4W6J A;  3O4Y A;  2Z6X A;  1FF1 A;  2FCD A;  1XO5 A;  3SG2 A;  5DTL A;  4ZIN A;  3RZS A;  4DIR A;  1H4U A;  1CMF A;  1JC2 A;  1Z4H A;  4ETO A;  3OSQ A;  3SG3 A;  1UHH A;  3CWG A;  1YRU B;  2ZFD A;  3PAL A;  1Z1P A;  2DOQ A;  2OGR A;  1YUS A;  4OR9 B;  1BR1 B;  1LVC D;  3CR5 X;  4AQI A;  3PAT A;  1CV7 A;  4N3D A;  3BQ3 A;  4W73 A;  2Y5I A;  5GQQ C;  1SR6 C;  4B5Y A;  2KQY A;  1BT6 A;  4QJ5 B;  5EB6 A;  4Q9X A;  3RM1 A;  1BOC A;  3NHT A;  5HZT A;  1PRW A;  2WCL A;  1KFU S;  1QVI Y;  3D0Y A;  3DQF A;  4W6R A;  1AVS A;  2NLN A;  4PHK A;  2O29 A;  4KA9 A;  3EVU A;  4PE7 A;  4XYN A;  2JNX A;  4DXM A;  2FOT A;  2YE1 A;  2KPH A;  4YGD B;  4GOB A;  1YFP A;  5BPJ A;  2QPT A;  1FBV A;  1YUR A;  3WHT B;  2EC6 B;  2Y0G A;  4W76 A;  1UUS A;  3CBE A;  1OMV A;  3VRN A;  3O78 A;  3TDI A;  2BCX A;  2OTG B;  4DKM A;  4HRG A;  2G2S B;  4ZIO A;  1B47 A;  1S1E A;  1ZOT B;  2K7B A;  4JF9 A;  2HF5 A;  4LQU A;  3GK4 X;  1DJW A;  1WLZ A;  2M1U A;  1Q4E A;  1H4B A;  1G33 A;  4U8D A;  3SVN A;  3TMT A;  2PYQ A;  3CD1 A;  1REC A;  1TRF A;  3SIB A;  1A75 A;  1NIW A;  1WY9 A;  2EMD A;  2DUE A;  3NF0 A;  3BFA A;  4CLN A;  2LUC A;  3B6X A;  3NSI A;  3H1R A;  1QYO A;  1KK7 Z;  1QYF A;  4J88 A;  5KU1 A;  2FZU A;  5DPJ A;  1YX7 A;  4KF5 C;  2IB6 A;  2G9B A;  3PLF B;  3PM8 A;  2JTZ A;  5HGE A;  1L2O C;  3ADF A;  1B9C A;  1QLK A;  5FYX A;  2Q4U A;  1KSO A;  1YR5 A;  1SW8 A;  3DVM A;  1IQ3 A;  1S6C A;  1SNL A;  2G6X A;  1W7T A;  2M9G A;  4GGF A;  1QX5 B;  2BTJ A;  3DQU A;  5CSN A;  4NDD A;  2PXS A;  5FVG A;  2ZMW A;  3CZ2 A;  2R2I A;  3OHM B;  2NCP A;  2Z6Z A;  1BU3 A;  4YI9 A;  5DPI A;  4CPV A;  2KSP A;  1K9P A;  1S26 D;  4W6U A;  1Z1Q A;  5EB7 A;  2L4H A;  3I5H C;  2BKH B;  3E5V A;  2KAX A;  3CGL A;  3R1O A;  2OTB A;  1DJY A;  1RK9 A;  4R6D A;  3NHI A;  2O2B A;  4ZBL A;  1B8R A;  4M2P A;  3LK1 A;  4XJK A;  5CSF A;  3KO0 A;  1J7O A;  4JRB A;  4PPL A;  4W6B A;  3SST A;  1NCZ A;  3LCP C;  3NSO A;  1B4C A;  1EMM A;  3WXA A;  3Q8I A;  1Q73 A;  2WCF A;  1H8B A;  1IRJ A;  4DXN A;  1N2D A;  1BF5 A;  5F9G A;  1DEL A;  3LVC A;  2B1U A;  1LIN A;  4YI8 A;  2ZO7 A;  1A29 A;  4N1G A;  3GB3 A;  2WUR A;  1KYS A;  4PPJ A;  3DQ4 A;  3SS5 A;  3KF9 A;  2AWK A;  4W6O A;  3E3R A;  2BEC A;  1TWO A;  2A47 A;  1CDM A;  2QDI A;  1FI6 A;  3DQE A;  2DUG A;  1CFF A;  1UHN A;  3U0L A;  2EHB A;  1QXP A;  1TNQ A;  3DQI A;  4ZB1 A;  4EMQ A;  3VRO A;  4RYW A;  1MHO A;  2BAP A;  2LE9 B;  2CNP A;  4F0Z B;  3M24 A;  4H3N A;  1OZO A;  1S6J A;  3CLN A;  3E5W A;  4ORC B;  1QS7 A;  4IK3 A;  2WND A;  3AI5 A;  5JJG A;  2QLI A;  1XYD A;  2JPT A;  2ISD A;  2GGZ A;  4PE1 A;  3NEZ A;  2BCA A;  1RRX A;  2KI4 C;  4DRW A;  1MYW A;  3FWC A;  1B1G A;  4IZN A;  3BOW B;  3EVP A;  4TZG A;  4W6D A;  3EK8 A;  3LL8 B;  3SS0 A;  2F2P A;  2WHS A;  4PE4 A;  5EXB A;  3WLD A;  2A52 B;  2PAS A;  1Q4C A;  4OY4 A;  4ZF5 A;  5DY6 A;  1ZFS A;  1RRO A;  3ICB A;  3OX6 A;  1U5I A;  2G3D B;  3VHT A;  4MBE A;  4C0L A;  1KQM C;  3BXA A;  3OB1 B;  5HBD A;  4EDO A;  4KYN A;  1CFP A;  1Q80 A;  1SR6 B;  1EMA A;  3SVD A;  5BQL A;  5HZU A;  1OSA A;  3TDU A;  1FI5 A;  1XMZ A;  2EC6 C;  1QX7 A;  1MOV A;  1BJF A;  2L5X B;  3H1O A;  4W7C A;  3SSH A;  1CB1 A;  1DEK A;  3OGN A;  2WCH A;  2V4E A;  2BNX A;  1BG1 A;  3VIC A;  1EMC A;  2MRD A;  2KBI A;  2SAS A;  1NCX A;  4JKT A;  4HSZ A;  2QLH A;  3EKJ A;  5BTT A;  2BE4 A;  2JNF A;  3UFZ A;  5EJU A;  3SSK A;  1SBJ A;  1F71 A;  2L2E A;  4KGE A;  4L12 A;  5LTP A;  3TMR A;  2G6E A;  4XGY A;  3ZUF A;  1GQM A;  3NXA A;  1B8C A;  3AKB A;  1W7J B;  1OOJ A;  1YHG A;  2OKY A;  1V1F A;  1YJ2 A;  3ZWH A;  2P6B B;  4YGC B;  4RTC A;  4WQ2 A;  3DZT A;  1NCY A;  3BUN B;  1KK8 C;  2WCB A;  3VRP A;  4Q7R A;  2I18 A;  5DKR A;  2WCJ A;  1SK6 D;  3BUW B;  2QEH A;  3R72 A;  3ED8 A;  1PUL A;  4I5K A;  5HKW A;  2KQ6 A;  3FIA A;  2H2K A;  5LTQ A;  2AHA A;  3RLZ A;  1Y6W A;  4UPG A;  3VK1 A;  1OXE A;  2JT0 A;  2OTE A;  1TNP A;  1DJZ A;  2P70 A;  3PJB A;  1L2O B;  1J1E A;  2K61 A;  3IP2 A;  1CDP A;  4ICB A;  4I5L B;  4P2Y B;  3RWT A;  2GX2 A;  1HCJ A;  1XA5 A;  2DDC A;  4GGF C;  1SCM C;  1GL4 A;  4XOV A;  3FE8 A;  2EMN A;  2K7D A;  1GJY A;  3RWA A;  1XFR A;  2B3P A;  3IQQ A;  2JUL A;  3D75 A;  1KYP A;  1QLS A;  4ORN A;  2K8M B;  4DXQ A;  5G08 A;  3KCS A;  2JQ6 A;  2ZRS A;  4JEO A;  1XVJ A;  3SVS A;  4M2Q A;  1GGZ A;  2BKI B;  4TNC A;  5T3I A;  3I5G C;  4U2V A;  4INW A;  5AEQ A;  2H5R A;  2GGM A;  3DQC A;  3I5H B;  3VRQ A;  3CFA A;  3BFH A;  4W7E A;  3AKA A;  5I2Q A;  2E30 A;  4Q04 A;  4KEX A;  2A53 B;  1DVI A;  2EMO A;  1KK7 Y;  2QEO A;  3CAB A;  2WOR A;  3BXC A;  1M46 A;  2B3Q A;  3B86 A;  5AAN A;  2M7N A;  4GNK B;  3BFB A;  1DJX A;  2F3Y A;  2GW3 A;  2ZO6 A;  2C9I A;  2VVI A;  5EL2 A;  4XVP A;  5DKN A;  1ZUX A;  2LMU A;  2H61 C;  5HKY A;  1OMR A;  1CKK A;  2CXJ A;  2Q91 A;  2VAE A;  3BX9 A;  1RMP A;  3NT9 A;  1EG4 A;  2BCB A;  4I5N B;  4OV2 A;  1IJ6 A;  1Y1A A;  1JUO A;  3SSV A;  2MLE C;  3VRR A;  5CSJ A;  1CDL A;  1DJH A;  1SCV A;  4ORB B;  2MA2 A;  3A8S A;  4C0J A;  3BUO B;  2KGB C;  3CYZ A;  2PMY A;  4GBA A;  1JWD A;  3A8R A;  2NZ0 A;  4DCK A;  1YZW A;  3DXL A;  1YRT B;  4R1E A;  1QY3 A;  2KNE A;  3PSR A;  1YVH A;  5FVI A;  2KI4 B;  1UWO A;  4GUK A;  1XFY O;  4LJC A;  4H3L A;  1EXR A;  1SKT A;  2YDZ A;  3KHE A;  4ZF3 A;  5EXU A;  2WC6 A;  1TIZ A;  3D78 A;  3LA1 A;  3D10 A;  1CNP A;  1EMB A;  4NWS A;  2KI6 D;  5I94 A;  1KQM B;  2H5P A;  4KF4 A;  1JC1 A;  2K0J A;  3WHU B;  2H5O A;  1RMO A;  1AJ4 A;  2QLG A;  3DPX A;  2ZMU A;  4INX A;  2FJU B;  4DXI A;  3D0Y B;  1HUY A;  1OQP A;  2L4I A;  4TZA A;  2V4E C;  3SVU A;  3IF7 A;  5KTY A;  2EGD A;  2M0R A;  2FWQ A;  4WQ3 A;  1XFW O;  2I7A A;  4HQ8 A;  1M45 A;  5FVF A;  3SS4 A;  1F70 A;  1OW4 A;  4OGS A;  1YHI A;  4DS7 A;  4Q9W A;  3DVE A;  2L51 A;  1KFX L;  2FCE A;  1CLL A;  3K1K A;  1NX3 A;  1J7R A;  2LP3 A;  3DVJ A;  1QJT A;  3R1V A;  2VVH A;  2PVB A;  3CFH A;  4PCW A;  1OOF A;  4MN0 A; 
#chains in the Genus database with same CATH homology
 3OP0 A;  1IH0 A;  5HKZ A;  1A75 B;  1XK4 A;  3PJ5 A;  1C4F A;  2HQK A;  1QIW A;  2IB5 A;  1KK8 B;  1D1O A;  3OGO A;  2KAY A;  4MSP A;  3MGF A;  4W69 A;  2M49 B;  1MR8 A;  4MRY A;  3DQD A;  2WHU A;  2ZNE A;  1M39 A;  1SMG A;  3LVD A;  3DQA A;  1Q4B A;  2ZKM X;  4KW8 A;  3SSY A;  1KFX S;  5EXC I;  1X02 A;  4IK4 A;  1JFJ A;  1F54 A;  1GGX A;  1NUB A;  2BBM A;  4JWQ A;  1CMG A;  5HYD A;  1SL8 A;  1SCM B;  2MAZ A;  5KSZ A;  1YVL A;  1HQV A;  1EME A;  1A4P A;  2M97 A;  3DQ5 A;  3TS5 C;  1YUU A;  4Q7T A;  4LJB A;  1B8L A;  1TCO B;  2A56 B;  4L1I A;  2AAO A;  1IQ5 A;  4N5X A;  3SV5 A;  1Q4A A;  5DTZ A;  1PSB A;  4MEW A;  5TNC A;  2RH7 A;  3BUM B;  1ODB A;  4HE4 A;  3AAJ A;  3I5G B;  3JVT C;  1DF0 A;  5I8N A;  1OXF A;  2CBL A;  1UHJ A;  1K93 D;  2JC2 A;  1W7I B;  4XJK B;  2ZRT A;  5DTX A;  3VGO A;  1RMM A;  2JRF A;  1K9U A;  4QJ3 B;  5DRG A;  1OMD A;  2F3Z A;  4OKH A;  2WIQ A;  1MXL C;  3QRX A;  3CTN A;  4W6N A;  1EMG A;  4MZJ A;  2M1K B;  1UUR A;  1RJV A;  2WHT A;  2KFF A;  5F6T A;  1LA0 A;  4W6I A;  1TNX A;  1BLQ A;  1C7W A;  1PK0 D;  2JOJ A;  5DU0 A;  1DGU A;  2K7C A;  1A2X A;  4IL1 A;  2WOS A;  5DKQ A;  2G5Z B;  1K9K A;  1ZAC A;  1C07 A;  4B30 A;  2F2O A;  2SCP A;  3KCT A;  3CGA A;  1JBZ A;  1XQM A;  2A46 A;  4W6P A;  1B7T Z;  1TNW A;  1KQV A;  3ZUL A;  3DQK A;  4W7R A;  2MHH A;  1PVB A;  1M31 A;  2KFH A;  3TDZ A;  2WSN A;  1MWN A;  3LF4 B;  5I2O A;  2I2R E;  2JWW A;  5EBJ A;  2LC5 A;  4P5O E;  3CB9 A;  2OPO A;  2LP2 A;  4W7A A;  2LLS A;  4ZCV A;  2IOV A;  1EH2 A;  4W6S A;  3ZUJ A;  2ZN9 A;  4BDU A;  2JXL A;  3LK0 A;  1U5I B;  3DF0 A;  3VHT B;  4FTG A;  1FPW A;  3ST3 A;  3CD9 A;  1G8I A;  3AAK A;  4OHS A;  2LVV A;  3DQ2 A;  4W74 A;  2LV7 A;  3NSK A;  1JFK A;  2HQZ A;  2QRF A;  2DD9 A;  4A4C A;  4L9M A;  2BL0 B;  1J7P A;  3LS3 A;  3S05 A;  3CFF A;  2LCP A;  3V3D A;  1UIS A;  2V4E B;  3GEX A;  1CM4 A;  4A4B A;  4EUL A;  3KPX A;  2CT9 A;  4W6G A;  3DQJ A;  3M22 A;  4ANJ A;  2COL B;  1YHH A;  1QTX A;  1RWY A;  2KYF A;  3JTD C;  1K95 A;  1K90 D;  3AKO A;  4Z4M A;  1QX2 A;  5BTT B;  2C9J A;  4DXO A;  5KTG A;  3GOF A;  3P8U A;  4P76 A;  1CM1 A;  4GFT A;  2MBX A;  3PFV A;  4DXP A;  4KGF A;  1B9A A;  3SG6 A;  3EK7 A;  4CFQ A;  1VRK A;  2ZN8 A;  1S5G Z;  3BUX B;  4PDZ A;  1XK4 C;  1IJ5 A;  1YX8 A;  1S3P A;  2O5G A;  3SRY A;  2LLU A;  3I5I C;  1Q4D A;  1AUI B;  1MF8 B;  4QJ4 B;  3DQ7 A;  1J7Q A;  3ST2 A;  2LAN A;  3EVV A;  2G6Y A;  3IQO A;  1RTP 1;  5H89 A;  1G7K A;  2HQ8 A;  2GV5 A;  2M3W A;  1OE9 B;  4PE0 A;  1W7U A;  4W6H A;  4JGE A;  4W75 A;  3U0N A;  2LLT A;  2QZ0 A;  4WRI A;  1MQ1 A;  1WDC B;  2YFP A;  4PHJ A;  3TUY C;  1DMO A;  5IBW A;  2H6V A;  5H87 A;  1BOD A;  2KGR A;  2RGI A;  3DQM A;  4JC2 A;  1MOU A;  3SVC A;  1PAL A;  4YBH B;  2AMI A;  1J1D A;  2PXW A;  2LHI A;  5ER4 X;  2VAD A;  3TS5 B;  1ZUZ A;  3CS1 A;  2AWL A;  3K21 A;  2OS8 C;  4IK1 A;  4W6A A;  2IS9 A;  4D1E A;  3CZT X;  5HW9 A;  3DQN A;  2K7O A;  1CLB A;  1QV1 A;  1G4Y R;  5DPH A;  2A4J A;  3W1D A;  3DPW A;  4MLW A;  2JZI A;  3JVT B;  3DD4 A;  3EKH A;  1S6Z A;  4YRU A;  1K2H A;  2F8P A;  2E6W A;  4W6T A;  4NDB A;  2QT2 A;  5DRF A;  1RM9 A;  1R6P A;  4LQT A;  3AI4 A;  1NX0 A;  1DJI A;  3DQ9 A;  1LXF C;  2POX A;  4KW4 A;  3OB2 B;  2CTN A;  4IK8 A;  4W6C A;  3SSP A;  4H47 A;  1NSH A;  2A48 A;  2L0P A;  5K89 A;  1F4O A;  5JOL A;  1PSR A;  3HX4 A;  3WLC A;  2Y1M A;  1YJF A;  1CTR A;  5H88 A;  2LUX A;  1QYQ A;  2O24 A;  4NQG A;  1KCY A;  4W7X A;  1CFC A;  1NWD A;  1NYA A;  1FW4 A;  1NPQ A;  1Y1U A;  1AP4 A;  1XA9 A;  1F09 A;  1IG5 A;  1KYR A;  3HCM A;  2L50 A;  1KP5 A;  3DQ6 A;  1WRK A;  3DQ3 A;  1ZGQ A;  1KSM A;  2Z6Y A;  4AQJ A;  2PRU A;  2BL0 C;  1NX2 A;  3U0M A;  2LVI A;  3GL4 A;  5DQM A;  3P28 A;  1AJ5 A;  2GW4 B;  1ALW A;  1A03 A;  2QLG B;  2ICR A;  2DD7 A;  3SG5 A;  1Y1X A;  4W6K A;  1K96 A;  3O2P A;  2AWM A;  1EL4 A;  4N1F A;  3LVA A;  3ST4 A;  1L7Z A;  2JTT A;  4KW9 A;  4IK5 A;  5LK4 A;  1B7T Y;  4KAG A;  3BYA A;  2DDD A;  4M2O A;  2G16 B;  2A54 B;  3GJ1 A;  1TN4 A;  5I2L A;  4W6M A;  1Y0V H;  3JTD B;  1AK8 A;  1XSS A;  3I19 A;  2QU1 A;  3SSL A;  3DPZ A;  2AH8 A;  4HRH A;  2HFC A;  4AS8 A;  1J55 A;  3DQ1 A;  4MZK A;  5AER A;  2IE2 A;  5FHV A;  5AQB B;  3EVR A;  3PIB A;  1H6R A;  4L13 A;  1QV0 A;  2KAV A;  4W6F A;  2I94 A;  4JPZ B;  1NX1 A;  3A4U B;  4LJD A;  2HJO A;  3W1C A;  1KWO C;  2DUI A;  2HET A;  1S6I A;  4J8A A;  1DJG A;  4MZL A;  1CLM A;  1RFJ A;  4KPI A;  1WDC C;  3PN7 C;  3DQH A;  1TCF A;  2ARL A;  3G9A A;  2Q57 A;  3I5I B;  1YTZ C;  3I5F C;  2Z1O A;  1BMO A;  4BY5 A;  5HLO A;  4W6L A;  1SRA A;  1UHK A;  4EN1 A;  3EK4 A;  4ORA B;  4I5J A;  1ALV A;  3SVR A;  2LMV A;  4PHN A;  4OVN F;  2BE6 A;  1C7V A;  2JU0 A;  1UHI A;  1WRZ A;  4OCI A;  1IKU A;  1K94 A;  1SYM A;  3TUY B;  4W72 A;  3WCK A;  4DKN A;  3E5T A;  3ZNI A;  5DPG A;  4R6B A;  2JT3 A;  4CFR A;  2H5Q A;  4MVF A;  1NP8 A;  2WIS A;  3O77 A;  2M8U A;  2KBM A;  4C0K A;  3MSE B;  1EG3 A;  1ZMZ A;  4BY4 A;  2P4M A;  2QLE A;  4JQ0 D;  2HPW A;  3ST0 A;  2KYC A;  1XAE A;  1S5G Y;  2OS8 B;  4AOM A;  1DGV A;  3U0K A;  1DF0 B;  1ZGP A;  2HRS A;  1QVI Z;  1TOP A;  4XL5 A;  1CFD A;  2F33 A;  1R2U A;  4PHM A;  3SG7 A;  2WSO A;  2O60 A;  2KDH A;  1QXT A;  2MLF C;  4USL A;  4ZFS A;  3M0W A;  4ZF4 A;  4ZCU A;  4YGB B;  1GFL A;  2DUH A;  3U8A A;  2H61 A;  5D69 A;  1ZGO A;  4FQO A;  4HRE E;  1K8U A;  5AXI A;  2WCE A;  3SVB A;  1S36 A;  1XFV O;  4JFG A;  5J3X A;  1EML A;  4W77 A;  1TTX A;  3BOW A;  2QAC A;  2H8Q A;  2VVJ A;  3GJ2 A;  2G3O A;  1MXE A;  4B30 B;  2LAP A;  2AWJ A;  4GPL B;  1BR4 B;  1YUT A;  4IK9 A;  4Q7U A;  2JXC A;  3NED A;  2JT8 A;  1HT9 A;  3ZTF A;  3U8C A;  1PVA A;  4YGE B;  5HLV A;  1SY9 A;  2KOT A;  3BXB A;  1LA3 A;  2LNK A;  3KEV A;  4MRX A;  2NXQ A;  1JBA A;  1SL7 A;  2LMT A;  1MUX A;  1OXD A;  5DTY A;  4PFE A;  3WNX B;  2Y1N A;  3DQL A;  2VZX A;  1XFU O;  1N0Y A;  3DF0 B;  5ER5 A;  1UP5 A;  1DT7 B;  1BFP A;  2HGY A;  2H9W A;  2OTG C;  2HQW A;  3OX5 A;  5LTR A;  2LVJ A;  5J2O A;  5HZO A;  1EMF A;  4HQ9 A;  2FL1 A;  3LF3 A;  4PPK A;  3PJ7 A;  3H4S E;  1IWQ A;  4J89 A;  2D8N A;  2M7L A;  2OKW A;  2TN4 A;  2KHN A;  3SIA A;  2K2A A;  4OQW A;  4H3M A;  1F4Q A;  4YGA A;  2GX0 A;  4AR7 A;  1SL9 A;  1F0B A;  4OJ0 A;  5EHU A;  3LSA A;  3IR8 A;  4P1Q A;  4PAL A;  5D7F A;  4HQC A;  1SPY A;  1F55 A;  2VRG A;  4GES B;  1IGV A;  1GGW A;  2L98 A;  4KF5 A;  2AUC A;  4LJD C;  3O6B A;  3SVO A;  5AFP A;  3U8P A;  2DUF A;  4GAO A;  1JF0 A;  2A50 B;  1AHR A;  1XFZ O;  2BBN A;  4EDS A;  4UTS A;  1JSA A;  3DQO A;  2OJK A;  2JAD A;  2MJW B;  1QIV A;  1KWO B;  4I2Y A;  2Q6P A;  5BT0 A;  1JF2 A;  1N65 A;  1JC0 A;  5B8I B;  3PN7 B;  4Z4K A;  1F8H A;  5HZS A;  3I5F B;  1E8A A;  4GGN A;  3DQ8 A;  3CR4 X;  1QAS A;  1W7S A;  2G2B A;  2K2F A;  1DTL A;  1OZS A;  5CPV A;  2LM5 A;  4E68 A;  2LVK A;  2NCO A;  3FWB A;  5CSI A;  4CID A;  2Y4Q A;  3FS7 A;  3F45 A;  4H48 A;  5PAL A;  1JBY A;  4NDC A;  3SVE A;  3LLE A;  4RYS A;  1CDN A;  1EJ3 A;  2YE0 A;  2HCG A;  2HPS A;  1V1G A;  1XFX O;  4HVF A;  3TZ1 A;  2PAL A;  4GF6 B;  3UG0 A;  3SG4 A;  2CCM A;  1LKJ A;  1QAT A;  4W7D A;  3GK1 A;  3OSR A;  3DVK A;  1EMK A;  1M63 B;  2V53 A;  5DQB A;  3NSL A;  4LW5 A;  2KI6 C;  2WC8 A;  3NT3 A;  3SJS A;  2HGD A;  2KFG A;  2LHL A;  4W7F A;  1KFU L;  3CR2 A;  2PSR A;  3C1V A;  4DUQ A;  2M29 A;  1WLM A;  1WRL A;  4XOW A;  3GK2 A;  2ZND A;  3BXK A;  4W6J A;  3O4Y A;  2Z6X A;  1FF1 A;  2FCD A;  1XO5 A;  3SG2 A;  5DTL A;  4ZIN A;  4DIR A;  1H4U A;  1CMF A;  1JC2 A;  4ETO A;  3OSQ A;  3SG3 A;  1UHH A;  3CWG A;  1YRU B;  2ZFD A;  3PAL A;  1Z1P A;  2DOQ A;  2OGR A;  1YUS A;  4OR9 B;  1BR1 B;  1LVC D;  3CR5 X;  4AQI A;  3PAT A;  1CV7 A;  4N3D A;  3BQ3 A;  4W73 A;  2Y5I A;  5GQQ C;  1SR6 C;  4B5Y A;  2KQY A;  1BT6 A;  4QJ5 B;  5EB6 A;  4Q9X A;  3RM1 A;  1BOC A;  5HZT A;  1PRW A;  1KFU S;  1QVI Y;  3D0Y A;  3DQF A;  4W6R A;  1AVS A;  2NLN A;  4PHK A;  2O29 A;  4KA9 A;  3EVU A;  4PE7 A;  4XYN A;  2JNX A;  4DXM A;  2FOT A;  2YE1 A;  4YGD B;  4GOB A;  1YFP A;  5BPJ A;  2QPT A;  1FBV A;  1YUR A;  3WHT B;  2EC6 B;  2Y0G A;  4W76 A;  1UUS A;  3CBE A;  1OMV A;  3VRN A;  3O78 A;  3TDI A;  2BCX A;  2OTG B;  4DKM A;  4HRG A;  2G2S B;  4ZIO A;  1B47 A;  1S1E A;  1ZOT B;  2K7B A;  4JF9 A;  2HF5 A;  4LQU A;  3GK4 X;  1DJW A;  1WLZ A;  2M1U A;  1Q4E A;  1H4B A;  1G33 A;  4U8D A;  3SVN A;  3TMT A;  3CD1 A;  1REC A;  1TRF A;  3SIB A;  1A75 A;  1NIW A;  1WY9 A;  2EMD A;  2DUE A;  3NF0 A;  4CLN A;  2LUC A;  3NSI A;  3H1R A;  1QYO A;  1KK7 Z;  1QYF A;  4J88 A;  5KU1 A;  2FZU A;  5DPJ A;  1YX7 A;  4KF5 C;  2IB6 A;  2G9B A;  3PLF B;  3PM8 A;  2JTZ A;  5HGE A;  1L2O C;  3ADF A;  1B9C A;  1QLK A;  5FYX A;  2Q4U A;  1KSO A;  1YR5 A;  1SW8 A;  3DVM A;  1IQ3 A;  1S6C A;  1SNL A;  2G6X A;  1W7T A;  2M9G A;  4GGF A;  1QX5 B;  2BTJ A;  3DQU A;  5CSN A;  4NDD A;  2PXS A;  5FVG A;  2ZMW A;  2R2I A;  3OHM B;  2NCP A;  2Z6Z A;  1BU3 A;  4YI9 A;  5DPI A;  4CPV A;  2KSP A;  1K9P A;  1S26 D;  4W6U A;  1Z1Q A;  5EB7 A;  2L4H A;  3I5H C;  2BKH B;  3E5V A;  2KAX A;  3CGL A;  2OTB A;  1DJY A;  1RK9 A;  4R6D A;  2O2B A;  4ZBL A;  1B8R A;  4M2P A;  3LK1 A;  4XJK A;  5CSF A;  3KO0 A;  1J7O A;  4JRB A;  4PPL A;  4W6B A;  3SST A;  1NCZ A;  3LCP C;  3NSO A;  1B4C A;  1EMM A;  3WXA A;  1Q73 A;  2WCF A;  1H8B A;  1IRJ A;  4DXN A;  1N2D A;  1BF5 A;  5F9G A;  3LVC A;  2B1U A;  1LIN A;  4YI8 A;  2ZO7 A;  1A29 A;  4N1G A;  3GB3 A;  2WUR A;  1KYS A;  4PPJ A;  3DQ4 A;  3KF9 A;  2AWK A;  4W6O A;  3E3R A;  2BEC A;  2A47 A;  1CDM A;  1FI6 A;  3DQE A;  2DUG A;  1CFF A;  1UHN A;  3U0L A;  2EHB A;  1QXP A;  1TNQ A;  3DQI A;  4ZB1 A;  4EMQ A;  3VRO A;  4RYW A;  1MHO A;  2LE9 B;  2CNP A;  4F0Z B;  3M24 A;  4H3N A;  1OZO A;  1S6J A;  3CLN A;  3E5W A;  4ORC B;  1QS7 A;  4IK3 A;  2WND A;  3AI5 A;  5JJG A;  2QLI A;  1XYD A;  2JPT A;  2ISD A;  2GGZ A;  4PE1 A;  3NEZ A;  2BCA A;  1RRX A;  2KI4 C;  4DRW A;  1MYW A;  3FWC A;  1B1G A;  4IZN A;  3BOW B;  3EVP A;  4TZG A;  4W6D A;  3EK8 A;  3LL8 B;  3SS0 A;  2F2P A;  2WHS A;  4PE4 A;  5EXB A;  3WLD A;  2A52 B;  2PAS A;  1Q4C A;  4OY4 A;  4ZF5 A;  5DY6 A;  1ZFS A;  1RRO A;  3ICB A;  3OX6 A;  1U5I A;  2G3D B;  3VHT A;  4MBE A;  4C0L A;  1KQM C;  3BXA A;  3OB1 B;  5HBD A;  4EDO A;  1CFP A;  1Q80 A;  1SR6 B;  1EMA A;  3SVD A;  5BQL A;  5HZU A;  1OSA A;  3TDU A;  1FI5 A;  1XMZ A;  2EC6 C;  1QX7 A;  1MOV A;  1BJF A;  2L5X B;  3H1O A;  4W7C A;  3SSH A;  1CB1 A;  2V4E A;  3VIC A;  1BG1 A;  1EMC A;  2MRD A;  2KBI A;  2SAS A;  1NCX A;  4HSZ A;  2QLH A;  3EKJ A;  5BTT A;  2BE4 A;  2JNF A;  3UFZ A;  5EJU A;  3SSK A;  1SBJ A;  1F71 A;  2L2E A;  4KGE A;  4L12 A;  5LTP A;  3TMR A;  2G6E A;  4XGY A;  3ZUF A;  1GQM A;  3NXA A;  1B8C A;  3AKB A;  1W7J B;  1OOJ A;  1YHG A;  2OKY A;  1V1F A;  1YJ2 A;  3ZWH A;  2P6B B;  4YGC B;  4RTC A;  4WQ2 A;  1NCY A;  3BUN B;  1KK8 C;  2WCB A;  3VRP A;  4Q7R A;  2I18 A;  5DKR A;  1SK6 D;  3BUW B;  3ED8 A;  1PUL A;  4I5K A;  5HKW A;  2KQ6 A;  3FIA A;  2H2K A;  5LTQ A;  2AHA A;  3RLZ A;  1Y6W A;  4UPG A;  3VK1 A;  1OXE A;  2JT0 A;  2OTE A;  1TNP A;  1DJZ A;  3PJB A;  1L2O B;  1J1E A;  2K61 A;  3IP2 A;  1CDP A;  4ICB A;  4I5L B;  4P2Y B;  3RWT A;  2GX2 A;  1HCJ A;  1XA5 A;  2DDC A;  4GGF C;  1SCM C;  1GL4 A;  4XOV A;  2EMN A;  2K7D A;  1GJY A;  3RWA A;  2B3P A;  3IQQ A;  2JUL A;  1KYP A;  1QLS A;  4ORN A;  2K8M B;  4DXQ A;  5G08 A;  3KCS A;  2JQ6 A;  2ZRS A;  4JEO A;  1XVJ A;  3SVS A;  4M2Q A;  1GGZ A;  2BKI B;  4TNC A;  5T3I A;  3I5G C;  4U2V A;  5AEQ A;  2H5R A;  2GGM A;  3DQC A;  3I5H B;  3VRQ A;  3CFA A;  4W7E A;  3AKA A;  5I2Q A;  2E30 A;  4Q04 A;  4KEX A;  2A53 B;  1DVI A;  2EMO A;  1KK7 Y;  2WOR A;  3BXC A;  1M46 A;  2B3Q A;  2M7N A;  5AAN A;  4GNK B;  1DJX A;  2F3Y A;  2GW3 A;  2ZO6 A;  2C9I A;  2VVI A;  4XVP A;  5DKN A;  1ZUX A;  2LMU A;  2H61 C;  5HKY A;  1OMR A;  1CKK A;  2CXJ A;  2Q91 A;  2VAE A;  3BX9 A;  1RMP A;  3NT9 A;  1EG4 A;  2BCB A;  4I5N B;  4OV2 A;  1IJ6 A;  1Y1A A;  1JUO A;  3SSV A;  2MLE C;  3VRR A;  5CSJ A;  1CDL A;  1DJH A;  1SCV A;  4ORB B;  2MA2 A;  3A8S A;  4C0J A;  3BUO B;  2KGB C;  2PMY A;  4GBA A;  1JWD A;  3A8R A;  2NZ0 A;  4DCK A;  1YZW A;  1YRT B;  4R1E A;  1QY3 A;  2KNE A;  3PSR A;  1YVH A;  5FVI A;  2KI4 B;  1UWO A;  4GUK A;  1XFY O;  4LJC A;  4H3L A;  1EXR A;  1SKT A;  2YDZ A;  3KHE A;  4ZF3 A;  5EXU A;  1TIZ A;  3LA1 A;  3D10 A;  1CNP A;  1EMB A;  4NWS A;  2KI6 D;  1KQM B;  2H5P A;  4KF4 A;  1JC1 A;  2K0J A;  3WHU B;  2H5O A;  1RMO A;  1AJ4 A;  2QLG A;  3DPX A;  2ZMU A;  2FJU B;  4DXI A;  3D0Y B;  1HUY A;  1OQP A;  2L4I A;  4TZA A;  2V4E C;  3SVU A;  3IF7 A;  5KTY A;  2EGD A;  2M0R A;  2FWQ A;  4WQ3 A;  1XFW O;  2I7A A;  4HQ8 A;  1M45 A;  5FVF A;  1F70 A;  4OGS A;  1YHI A;  4DS7 A;  4Q9W A;  3DVE A;  2L51 A;  1KFX L;  2FCE A;  1CLL A;  3K1K A;  1NX3 A;  1J7R A;  2LP3 A;  3DVJ A;  1QJT A;  2VVH A;  2PVB A;  3CFH A;  4PCW A;  4MN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...