3SG6A

Crystal structure of dimeric gcamp2-lia(linker 1)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
409
structure length
383
Chain Sequence
SRRKWNKTGHAVRAIGRLSSLIANVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 125
structure length 383
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg6A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg6A01
2KI4B 3VRNA 1B4CA 1KWOC 1NYAA 1DJXA 1EMLA 3I5HC 4W6BA 1J7PA 1QVIZ 1ALWA 5KTGA 2QT2A 3D0YA 1U5IA 4DCKA 3RWAA 2LVJA 5I2OA 4JC2A 2KOTA 2VAEA 5DQBA 1DVIA 2CCMA 1HCJA 2TN4A 1S6CA 5H88A 2KFFA 1SR6C 1NP8A 3DF0A 2KGBC 1YX7A 1NSHA 2EC6C 4W6RA 2HQWA 1XAEA 3BUXB 1QTXA 1SRAA 2GW3A 4B30A 3SSHA 5BT0A 5I2QA 1Q4CA 4W73A 3SSTA 1MR8A 2OGRA 4LJBA 4W7FA 5GQQC 4KGEA 3DQHA 3LSAA 1OMVA 5FHVA 2BCBA 4ZCUA 3DQJA 5HLVA 1L2OB 3OB1B 1KFUS 4DXMA 2PVBA 5K89A 1CLLA 1JF2A 1JFJA 4DKNA 1DT7B 1JC0A 1XK4A 4KF4A 3MSEB 1YR5A 1B8CA 2QRFA 1S5GY 2IB6A 2WCEA 2YE0A 1YJFA 5T3IA 4ICBA 1CDLA 2LCPA 4ZIOA 3LVCA 3SVDA 3O4YA 1QXPA 2GX0A 1V1GA 4QJ4B 4W6LA 2G6EA 1YX8A 1J1DA 4MZJA 4ORBB 2M7LA 1KK7Y 3SG3A 1KSMA 1BMOA 1BODA 3PFVA 1Y1UA 1UHJA 1YRUB 1BJFA 1QJTA 2WSNA 1ODBA 3ZNIA 5DTLA 2JQ6A 5EXUA 1CMFA 3S05A 3CLNA 4YI8A 3SVBA 1CDMA 3WLDA 2F33A 3OHMB 3UFZA 5HW9A 4W6JA 4B30B 2AAOA 3DQ9A 2ZMUA 2AWKA 3DQ5A 3SVUA 5LK4A 3NT9A 1K90D 3D0YB 2G6YA 1MXEA 4W6UA 3KHEA 1JWDA 4P1QA 2OKWA 3GEXA 2Y1NA 2H5PA 2GV5A 1IQ3A 2BCAA 4PE0A 1S36A 4CFRA 5FVIA 1DF0A 1QYFA 3E5WA 2K7CA 1F8HA 1RMMA 1DF0B 2JRFA 1TNQA 3CD9A 2P4MA 2PALA 4I5NB 1XFVO 1NX3A 2KYCA 1S6IA 2AMIA 4P5OE 4ZFSA 1OXFA 5HZTA 2R2IA 2JC2A 1NCXA 1Q4DA 1PSBA 3KF9A 3OSQA 2L4HA 4N1FA 3G9AA 2KSPA 4Q7UA 4I5KA 4OQWA 4C0LA 4ORNA 4A4CA 3ZTFA 2Q57A 2BBMA 3IQOA 3ZUFA 4YGEB 1SL9A 5EXBA 3K21A 5ER5A 4Q9XA 2LHIA 2OS8C 1CV7A 3DQ7A 2AWMA 2CT9A 3CWGA 1PVBA 3KCSA 1VRKA 3CR4X 2ZNDA 4ZBLA 1HQVA 3SJSA 3I5IB 1W7IB 2PRUA 1QS7A 4DXQA 4RYSA 2MAZA 5HKWA 5AERA 2LVVA 1B7TY 2VZXA 2NLNA 5EB7A 5PALA 2GX2A 5KU1A 3CR5X 3LK1A 1RMOA 1QXTA 4AS8A 3PATA 2C9JA 2FJUB 2BKIB 4L12A 4HQCA 1YVLA 2DUIA 3BX9A 4GESB 2C9IA 2LVKA 3DVKA 5JOLA 1OMRA 1F55A 4W7RA 4W6TA 4PDZA 1H8BA 1LXFC 2DUFA 1CM1A 3D10A 2NXQA 1UHIA 5KSZA 3U0MA 1K94A 1AK8A 4W6IA 1BF5A 1KFXL 2KFGA 1UHNA 4NDBA 3W1CA 2KAXA 5D69A 5KTYA 1Y1AA 2PXSA 4L13A 5BTTA 5I2LA 2LC5A 2Z1OA 4HRHA 4LW5A 2G16B 1F09A 4YRUA 1IQ5A 3TS5B 4MN0A 3DPXA 1KQVA 1IKUA 3ST2A 4H3NA 1G33A 5DU0A 4NQGA 4YGBB 1Q73A 2DDCA 4BY4A 2WSOA 1PVAA 1CDPA 1DJIA 4J88A 2ZKMX 2O60A 2EMOA 1EMCA 5EB6A 2PASA 2MLEC 5DQMA 4USLA 4ANJA 1KSOA 1JBYA 2LP3A 4QJ3B 3DQ1A 3NSKA 4OKHA 1JC1A 3DQ6A 3ZULA 1GGWA 2OS8B 4KF5C 3KO0A 2CTNA 1A4PA 1OXEA 4XYNA 2HGDA 3SVNA 3PALA 3P28A 1YRTB 2M29A 3EK7A 2YFPA 3DQ3A 3PLFB 4YI9A 4KEXA 2ARLA 3BUWB 4W6HA 3QRXA 3I5FB 1UISA 2A4JA 4M2QA 2ISDA 4PE7A 4J89A 3SSPA 3U8AA 1MF8B 3GOFA 5DKNA 1BT6A 5FYXA 5LTRA 1W7SA 3AKAA 3JTDC 2A54B 4H47A 3NSLA 2WURA 1KYSA 2OTBA 2GGMA 2Z6ZA 1A2XA 3ZWHA 2AHAA 4B5YA 4UPGA 1CFDA 1KFXS 3NXAA 3VRPA 4NWSA 4PALA 3DQIA 2JOJA 1F4QA 1BR4B 1Z1QA 2CBLA 1PULA 1ZACA 1F0BA 1YUSA 1WLZA 1IGVA 1BR1B 1XFZO 4PHNA 4MRYA 2K2FA 1TN4A 4Q7RA 1A75B 3DQ2A 2NCOA 3U0KA 3CR2A 5AANA 1GQMA 3JTDB 1J55A 4P76A 1RROA 5DKRA 3TMTA 4KGFA 2H61C 2JT8A 5CPVA 2K2AA 2AUCA 1U5IB 5DTYA 3FS7A 2E6WA 2M3WA 1B1GA 1KP5A 4IK1A 2VADA 2K7BA 4OVNF 3M24A 1XSSA 4ZF5A 3DVJA 3EK4A 1TCFA 3EK8A 1S6ZA 2G6XA 2COLB 1NX1A 4Q04A 2MA2A 1EH2A 3U8CA 4M2OA 3LCPC 2EMNA 1EG3A 5G08A 2DUGA 1K95A 4HQ9A 1S26D 2EGDA 1JBAA 3VK1A 3M22A 2JTTA 3NEZA 3SRYA 1K9UA 1NX2A 2VVJA 5DPJA 4IK5A 1RMPA 1MXLC 4EULA 2NZ0A 5HYDA 2QZ0A 2M9GA 2V4EB 3LS3A 1ZGPA 1AP4A 4EN1A 3AKOA 4PE4A 1K2HA 4A4BA 3IR8A 1QASA 4DIRA 3EKJA 1UHHA 3AAJA 1QX2A 2EMDA 1XK4C 4NDDA 4Z4KA 1AJ4A 3OX6A 4OJ0A 1EMGA 1GGZA 2KAVA 2M97A 5IBWA 2JU0A 2M1KB 5DRFA 2LAPA 2A47A 4JGEA 2QLIA 4ZB1A 1H4BA 1UUSA 1M46A 1OMDA 1XFUO 1CFFA 1SK6D 2BE6A 2K7OA 4JWQA 4ZINA 4HREE 1GJYA 2FZUA 2LANA 1CKKA 3M0WA 4PHKA 5HBDA 4W74A 2WORA 1NWDA 5HZSA 1SCMB 1G4YR 1KK8B 2RGIA 4OV2A 1RK9A 1CNPA 2D8NA 4AR7A 1IJ6A 3HX4A 1CB1A 4AQJA 1TTXA 4W7EA 1YVHA 1G7KA 4OR9B 2L4IA 3AI5A 1C7VA 1WY9A 3EVUA 3DQUA 4ZCVA 3BOWB 4FQOA 5HGEA 4L9MA 2AWJA 3GB3A 1YHHA 4OHSA 2JPTA 4AOMA 1XVJA 1YURA 1QY3A 4CFQA 4HVFA 1NPQA 2MJWB 1CM4A 1ZOTB 1NIWA 2ZNEA 2MBXA 3GJ2A 1XO5A 1X02A 1JSAA 4HQ8A 1NX0A 5HZUA 1DJYA 1R6PA 2OJKA 2KQ6A 2JZIA 5AXIA 3SSLA 1A03A 5B8IB 2O29A 5DPIA 5BPJA 3A4UB 3SSKA 1SKTA 3KEVA 4PHJA 3H1RA 2ZO7A 3SVOA 5FVFA 1YJ2A 1N2DA 1JF0A 3CFHA 2H2KA 1Q4BA 3LL8B 3EVVA 4GOBA 4C0JA 1RM9A 1KCYA 1EL4A 2MRDA 3AI4A 3SSYA 1UP5A 2H5RA 2KBIA 5DPHA 1IG5A 2QU1A 2PXWA 4TNCA 2WHUA 3SIBA 3PN7B 2FCDA 2G5ZB 4XVPA 4M2PA 1OE9B 2VVHA 1LINA 2KYFA 1LA0A 1JC2A 4LJDA 1DGVA 4IK9A 2KI4C 3OP0A 1SL8A 1F54A 1QX5B 4TZAA 4EMQA 1FI5A 4DXOA 2LLTA 4IK3A 2WCFA 1B47A 1L2OC 1RWYA 4MEWA 1OOJA 4Q7TA 4LQUA 5CSNA 1HT9A 5DTZA 4W6NA 3LVDA 1SL7A 4Z4MA 1TCOB 3RM1A 1GGXA 2K8MB 4MZKA 4R1EA 4CLNA 3NT3A 1K8UA 1ZUXA 1BLQA 3KCTA 2ZO6A 2JTZA 1MQ1A 2KI6D 1F4OA 1CMGA 4W72A 1Y0VH 4PCWA 4BY5A 2DDDA 2LM5A 1UHKA 2OPOA 1CDNA 1TNWA 1PSRA 3IP2A 3DQ4A 2WCBA 4AQIA 1FPWA 1J7RA 3I5HB 2HGYA 4W6SA 1JUOA 3BUNB 2JT0A 2A56B 1CFPA 4WRIA 3I19A 4H3MA 2DOQA 3DQCA 5EHUA 3I5GB 2QACA 2KHNA 3PJBA 1LVCD 3CB9A 1SPYA 5DY6A 2ZN9A 4L1IA 3ZUJA 1PRWA 1IJ5A 4PE1A 5J3XA 2BE4A 1QIWA 2H5OA 2DD7A 3O78A 1OSAA 4R6BA 1BG1A 1WDCC 5HZOA 4NDCA 3O6BA 1QYOA 5TNCA 2B3QA 1DJZA 1OZOA 4MRXA 1E8AA 1J7QA 3WLCA 2WNDA 3E5VA 4F0ZB 4UTSA 1NCZA 2H5QA 3CTNA 4RTCA 2QLHA 1MWNA 4N5XA 3SVEA 3ADFA 2WHTA 4IZNA 2QLEA 1BOCA 1K96A 1JFKA 3DQ8A 3PIBA 1TNPA 2BL0B 3TZ1A 3VHTB 1ZFSA 4DS7A 2L2EA 3OSRA 4I2YA 3SS0A 2K7DA 3GJ1A 2Q6PA 4W7DA 3BXCA 2NCPA 1EG4A 5HKYA 1CFCA 3DQEA 4W6KA 1C7WA 1DGUA 3DVEA 5EXCI 1GL4A 2VRGA 4ETOA 3LF3A 4YGAA 2Q4UA 3PSRA 4H3LA 2H9WA 4MZLA 3CGLA 1QX7A 4P2YB 4KPIA 4W6GA 4W77A 4LJDC 1JBZA 2HQZA 3ST3A 1ZUZA 1XA5A 3OB2B 1CLMA 1SY9A 4GGNA 1W7UA 3TUYB 1GFLA 4PPKA 3V3DA 1S6JA 4HRGA 2A52B 1LA3A 2QLGA 4OGSA 5AQBB 3U0LA 1Q4AA 4LJCA 4W6FA 3DD4A 4CIDA 4D1EA 3CBEA 3ST0A 4PHMA 1YTZC 5LTQA 4BDUA 4GF6B 1A29A 1SCVA 2Y0GA 3DPZA 2LE9B 2OTGC 3A8SA 1WRKA 3SIAA 3WNXB 3OGOA 4I5LB 2KAYA 2K61A 4XJKB 2YDZA 4GPLB 1KWOB 2PMYA 2G9BA 4MSPA 3OX5A 3SG5A 4XOWA 2JNFA 2G2BA 1FW4A 3WXAA 1MUXA 5CSJA 2VVIA 4W75A 3SG4A 3I5GC 1SYMA 2MHHA 2A48A 2DD9A 1F70A 4XL5A 2LMUA 1SMGA 4MBEA 3FWCA 2HF5A 3EKHA 4J8AA 3AKBA 1NUBA 2G3OA 3TMRA 1OQPA 4GAOA 3BYAA 4KF5A 4IK4A 2IE2A 1S5GZ 2I7AA 4HE4A 4RYWA 4Q9WA 1Q4EA 1MHOA 1MOVA 4I5JA 1M31A 3H4SE 2OTEA 1RFJA 2DUHA 4KAGA 3I5IC 1ZGOA 1N0YA 5DKQA 2HETA 1UWOA 2KBMA 2YE1A 5ER4X 5HKZA 3TUYC 1DMOA 3E5TA 4OY4A 1RRXA 3U0NA 2WC8A 2JWWA 2M1UA 2KFHA 1XA9A 3PN7C 1J1EA 3SG6A 4ZF3A 1J7OA 3SVSA 2FCEA 5EJUA 3TDIA 3W1DA 2QLGB 1DTLA 1Y1XA 1TIZA 2OTGB 3A8RA 1H4UA 1BU3A 2RH7A 2ICRA 2ZN8A 4PFEA 3DPWA 2LNKA 5DRGA 3GK1A 2G3DB 1XMZA 5JJGA 3ED8A 2HPWA 4JF9A 4XGYA 3RWTA 3SG2A 3LVAA 3PJ5A 1OXDA 4KW8A 2JT3A 2BL0C 4XJKA 2KI6C 4YGCB 1MYWA 4GGFC 2Y5IA 3VICA 1QLSA 2L51A 2FWQA 3DF0B 1MOUA 2M8UA 4ORAB 1EMKA 3DQDA 1TRFA 3PM8A 2M49B 1EMBA 3PJ7A 3BUOB 2F3ZA 1RJVA 1RECA 1WRZA 5J2OA 3TDZA 2Z6XA 1AHRA 3GK2A 2K0JA 1IH0A 2LUXA 1WRLA 1H6RA 4YGDB 5CSFA 5EBJA 2A46A 2M7NA 4DXIA 4QJ5B 4OCIA 2MLFC 3BUMB 2I94A 4GUKA 3TS5C 1Y6WA 1B9AA 5AEQA 3IF7A 1G8IA 2BKHB 2H6VA 4LQTA 1QLKA 2E30A 2P6BB 4WQ3A 2JXCA 2ZRSA 1ALVA 1N65A 1M63B 1Z1PA 2LLUA 3I5FC 4EDSA 1EJ3A 2KQYA 3DQKA 4DUQA 1XFWO 3GL4A 5FVGA 2EC6B 3VROA 1KK8C 2ZMWA 1W7TA 1XFXO 2B1UA 2BBNA 1QIVA 1RTP1 4W69A 5H89A 3FWBA 4EDOA 1FF1A 3VHTA 2O24A 2BTJA 1KQMC 3KPXA 3O2PA 1XQMA 3BOWA 2LLSA 5LTPA 2AH8A 1KQMB 5BQLA 1KK7Z 3LK0A 2KNEA 2AWLA 1SR6B 2WISA 4FTGA 4U2VA 2OKYA 2HRSA 1F71A 1M45A 1W7JB 2BECA 2LV7A 5I8NA 3CFFA 2L50A 1CTRA 5DTXA 5H87A 1SCMC 5F6TA 4DXNA 3H1OA 3BQ3A 3NSIA 4N1GA 3VRRA 5BTTB 1KFUL 3BXBA 2Q91A 2QPTA 4IL1A 2F2PA 1CLBA 2WIQA 2GGZA 3DVMA 3ICBA 1YHIA 1V1FA 4JEOA 1B8RA 3CS1A 1SNLA 1SBJA 4JQ0D 3IQQA 1NCYA 4N3DA 1YUUA 2V53A 3SV5A 1K9PA 1KYRA 2IS9A 4W7CA 1UURA 4DXPA 2WHSA 3CFAA 2PSRA 2ZFDA 5D7FA 3DQOA 4W6DA 1IWQA 1S3PA 3MGFA 3EVRA 3JVTB 4ORCB 1TOPA 2A53B 1B9CA 1YFPA 1M39A 3AAKA 3CGAA 3VGOA 2IOVA 1EMAA 4C0KA 3EVPA 4DRWA 4KW4A 2Z6YA 4U8DA 1C07A 2IB5A 2LMTA 3VRQA 3SVRA 1EMMA 4IK8A 5DPGA 2LMVA 4E68A 1ZGQA 3P8UA 1D1OA 2EHBA 3SVCA 1PK0D 4KW9A 5F9GA 1B8LA 4MVFA 1DJWA 4W6MA 1TNXA 3O77A 2L0PA 4GFTA 2B3PA 2F3YA 1AVSA 2F8PA 4W6CA 3DQAA 3TDUA 3NF0A 3RLZA 2HPSA 1OZSA 3JVTC 2FOTA 2L98A 4ZF4A 3LA1A 4WQ2A 1KYPA 1FI6A 4W7XA 1QV0A 3DQFA 1C4FA 4W6OA 3BXKA 2Y4QA 3GK4X 2F2OA 4MLWA 2KDHA 1YZWA 1EXRA 1B7TZ 1LKJA 2I2RE 1AUIB 3DQLA 3ST4A 1EMEA 2ZRTA 2HFCA 2HCGA 4TZGA 2I18A 4PPJA 2POXA 2A50B 2LHLA 1WLMA 1HUYA 1DJGA 1S1EA 2CXJA 3LF4B 2KGRA 1XFYO 3SSVA 1WDCB 4JFGA 3HCMA 2HQ8A 1FBVA 3DQNA 2HQKA 3UG0A 3NEDA 1AJ5A 1QVIY 3F45A 4JPZB 4DKMA 4W6AA 1EMFA 4YBHB 2L5XB 4H48A 5HLOA 2JADA 1YUTA 2O5GA 4W76A 2GW4B 2BCXA 5AFPA 1SW8A 1XYDA 2LP2A 3FIAA 2V4EA 1PALA 1QV1A 2H61A 2HJOA 4GBAA 4KA9A 1YHGA 4CPVA 3C1VA 2H8QA 3U8PA 2G2SB 2V4EC 1DJHA 2CNPA 2Y1MA 4PPLA 3CD1A 1BFPA 2M0RA 1QATA 4R6DA 1K93D 1ZMZA 2SCPA 3SG7A 2WOSA 2SASA 1QYQA 1A75A 2JNXA 4HSZA 3BXAA 2LVIA 3WHTB 2FL1A 3K1KA 3CZTX 3NSOA 4W7AA 3WCKA 1Q80A 2O2BA 3E3RA 4GNKB 1R2UA 4JRBA 4W6PA 3DQMA 5CSIA 1L7ZA 3WHUB 1IRJA 2LUCA 2JXLA 1K9KA 2JULA 2DUEA 3LLEA 4GGFA 4XOVA
chains in the Genus database with same CATH superfamily
1DQEA 2WCMA 2KI4B 3VRNA 2BAPA 1B4CA 1KWOC 1NYAA 1DJXA 1EMLA 3I5HC 4W6BA 1J7PA 1QVIZ 1ALWA 5KTGA 4INWA 2QT2A 3D0YA 1U5IA 4DCKA 3RWAA 2LVJA 5I2OA 1ORGA 4JC2A 2KOTA 2WCLA 2VAEA 5DQBA 1DVIA 2CCMA 1QWVA 1HCJA 2TN4A 1S6CA 5H88A 2KFFA 1SR6C 1NP8A 3DF0A 2KGBC 1YX7A 1NSHA 2EC6C 4W6RA 2HQWA 1IIOA 1XAEA 3BUXB 1QTXA 1SRAA 2P71A 2GW3A 4B30A 2KLDA 3SSHA 5BT0A 5I2QA 1Q4CA 4W73A 3SSTA 1MR8A 2OGRA 4LJBA 4W7FA 5GQQC 4KGEA 3DQHA 3LSAA 1OMVA 5FHVA 2BCBA 4ZCUA 3DQJA 5HLVA 1L2OB 3OB1B 1KFUS 4DXMA 2PVBA 5K89A 1CLLA 1JF2A 1JFJA 4DKNA 1DT7B 3NHTA 1JC0A 1XK4A 4KF4A 3MSEB 1YR5A 1B8CA 2QRFA 1S5GY 2IB6A 2WCEA 2YE0A 1YJFA 5T3IA 4JD9A 4ICBA 1CDLA 2LCPA 4ZIOA 3LVCA 3O4YA 3SVDA 1QXPA 2GX0A 1V1GA 4QJ4B 4W6LA 2G6EA 1YX8A 1J1DA 4MZJA 4ORBB 2M7LA 1KK7Y 3SG3A 1KSMA 1BMOA 1BODA 3PFVA 1Y1UA 1UHJA 1YRUB 1BJFA 1QJTA 2WSNA 1ODBA 3ZNIA 5DTLA 2JQ6A 5EXUA 1CMFA 3S05A 3CLNA 4YI8A 3SVBA 1CDMA 3WLDA 3R1PA 2F33A 3OHMB 1GM0A 3UFZA 5HW9A 4W6JA 4B30B 2AAOA 3DQ9A 2ZMUA 2AWKA 3DQ5A 3SVUA 3S0AA 5LK4A 3NT9A 1K90D 3D0YB 2G6YA 1MXEA 4W6UA 3KHEA 1JWDA 4P1QA 2OKWA 3GEXA 2Y1NA 2H5PA 2GV5A 1IQ3A 2BCAA 4PE0A 1S36A 4CFRA 5FVIA 1DF0A 1QYFA 3E5WA 2K7CA 1F8HA 1RMMA 1DF0B 2JRFA 1TNQA 3CD9A 5FI6A 2P4MA 2PALA 4I5NB 1XFVO 1NX3A 2KYCA 1S6IA 2AMIA 4P5OE 1OXFA 4ZFSA 5HZTA 2R2IA 2JC2A 1NCXA 1Q4DA 1PSBA 3KF9A 3OSQA 2L4HA 4N1FA 3G9AA 2KSPA 4Q7UA 1DEKA 4I5KA 4OQWA 4C0LA 4ORNA 4A4CA 3ZTFA 2Q57A 2BBMA 3IQOA 2YGUA 3ZUFA 4OZDA 4YGEB 1SL9A 5EXBA 3K21A 5ER5A 4Q9XA 2LHIA 2OS8C 1CV7A 3DQ7A 2AWMA 2CT9A 3CWGA 1PVBA 3KCSA 1VRKA 3CR4X 2ZNDA 4ZBLA 1HQVA 3SJSA 3I5IB 1W7IB 2PRUA 1QS7A 4RYSA 4DXQA 2MAZA 5HKWA 5AERA 3L4AA 2LVVA 1B7TY 2VZXA 2WC6A 2NLNA 5EB7A 5PALA 2GX2A 5KU1A 3CR5X 3LK1A 1RMOA 1QXTA 4AS8A 3PATA 2C9JA 2FJUB 3UO9A 2BKIB 4L12A 4HQCA 1YVLA 2DUIA 3BX9A 4GESB 2C9IA 2LVKA 3DVKA 5JOLA 1OMRA 1F55A 4W7RA 3S0BA 4W6TA 4PDZA 1H8BA 1LXFC 2DUFA 1CM1A 3D10A 2NXQA 1UHIA 5KSZA 3U0MA 1K94A 1AK8A 4W6IA 1BF5A 1KFXL 2KFGA 1UHNA 4NDBA 3W1CA 2KAXA 5D69A 5KTYA 3D73A 1Y1AA 2PXSA 4L13A 5BTTA 5I2LA 2LC5A 2Z1OA 4HRHA 4LW5A 2WC5A 2G16B 1F09A 4YRUA 1IQ5A 3TS5B 4MN0A 3DPXA 1KQVA 1IKUA 3ST2A 4H3NA 1G33A 5DU0A 4NQGA 4YGBB 1Q73A 2DDCA 4BY4A 2WSOA 1PVAA 1CDPA 1DJIA 3NHIA 4J88A 2ZKMX 2O60A 2EMOA 1EMCA 5EB6A 2PASA 2MLEC 5DQMA 4USLA 4ANJA 1KSOA 1JBYA 2LP3A 4QJ3B 3DQ1A 3NSKA 5I94A 4OKHA 1JC1A 3DQ6A 3B7AA 3D76A 3ZULA 1GGWA 2OS8B 4KF5C 3KO0A 2CTNA 1A4PA 1OXEA 4XYNA 2HGDA 3SVNA 3BFHA 3PALA 3P28A 1YRTB 2M29A 3EK7A 2YFPA 3DQ3A 3PLFB 4JKTA 4YI9A 4KEXA 2ARLA 3BUWB 4W6HA 3QRXA 3I5FB 1UISA 2A4JA 4M2QA 2ISDA 4PE7A 4J89A 3SSPA 3U8AA 1MF8B 3GOFA 5DKNA 1BT6A 5FYXA 5LTRA 1W7SA 3AKAA 3JTDC 2A54B 4H47A 3NSLA 2WURA 1KYSA 2OTBA 2GGMA 2Z6ZA 1A2XA 3ZWHA 2AHAA 1C3ZA 4B5YA 4UPGA 1CFDA 1KFXS 3NXAA 3VRPA 4NWSA 4PALA 3DQIA 2JOJA 1F4QA 3FE9A 1DELA 1BR4B 1Z1QA 2CBLA 3D75A 1PULA 1ZACA 1F0BA 1YUSA 1WLZA 1IGVA 1BR1B 1XFZO 4PHNA 4MRYA 2K2FA 1TN4A 4Q7RA 1A75B 3DQ2A 2NCOA 3U0KA 3CR2A 5AANA 1GQMA 3CABA 5HL1A 3JTDB 1J55A 2K60A 4P76A 1RROA 5DKRA 3TMTA 4KGFA 1T14A 2H61C 2JT8A 3R72A 5CPVA 2KPHA 2K2AA 2AUCA 1U5IB 5DTYA 3FS7A 2E6WA 3S0EA 2M3WA 1B1GA 1KP5A 4IK1A 2VADA 2K7BA 4OVNF 3M24A 1XSSA 4ZF5A 3DVJA 3EK4A 1TCFA 3EK8A 1S6ZA 2G6XA 2COLB 1NX1A 4Q04A 2MA2A 1EH2A 2H8VA 3U8CA 3B86A 4KYNA 4M2OA 3LCPC 2EMNA 1EG3A 5G08A 2DUGA 1K95A 4HQ9A 3UNWA 1S26D 2EGDA 1JBAA 3BJHA 3VK1A 3M22A 2JTTA 3NEZA 3SRYA 1K9UA 1NX2A 2VVJA 5DPJA 4IK5A 1RMPA 1MXLC 4EULA 3DXLA 2NZ0A 5HYDA 2QZ0A 2M9GA 2V4EB 3S0FA 3LS3A 1ZGPA 1AP4A 4EN1A 3S0GA 3AKOA 3OBVA 4PE4A 1K2HA 4A4BA 3IR8A 1QASA 4DIRA 3EKJA 1UHHA 3AAJA 1QX2A 2EMDA 1XK4C 4NDDA 4Z4KA 1AJ4A 3OX6A 4OJ0A 1EMGA 1GGZA 2KAVA 2M97A 5IBWA 2JU0A 2M1KB 5DRFA 2LAPA 2A47A 4JGEA 2QLIA 4ZB1A 1TUJA 1H4BA 1UUSA 1M46A 1OMDA 1XFUO 1CFFA 1SK6D 2BE6A 2K7OA 4JWQA 4ZINA 4HREE 1GJYA 2FZUA 2LANA 1CKKA 3M0WA 5FI7A 4PHKA 5HBDA 4W74A 2WORA 1NWDA 5HZSA 1SCMB 1G4YR 1KK8B 2RGIA 4OV2A 1RK9A 1CNPA 2D8NA 3K1EA 5EL2A 4AR7A 1IJ6A 3HX4A 1CB1A 4AQJA 1TTXA 3D77A 4W7EA 1YVHA 3O4XA 1G7KA 4OR9B 2L4IA 3AI5A 1C7VA 1WY9A 3EVUA 3OGNA 2PQLA 3DQUA 4ZCVA 3BOWB 4FQOA 4L9MA 5HGEA 2AWJA 3GB3A 1YHHA 4OHSA 2JPTA 4AOMA 1XVJA 1YURA 2WCKA 5FI2A 2QEBA 1QY3A 4CFQA 4HVFA 1NPQA 2MJWB 3DZTA 1CM4A 1ZOTB 3N7HA 3FE8A 1NIWA 2ZNEA 2MBXA 3GJ2A 1XO5A 1X02A 1JSAA 4HQ8A 1OOFA 1NX0A 2WCHA 5HZUA 1DJYA 1R6PA 2OJKA 2KQ6A 2JZIA 5AXIA 3SSLA 1A03A 5B8IB 2O29A 5DPIA 5BPJA 3A4UB 3SSKA 1SKTA 3KEVA 4PHJA 3H1RA 2ZO7A 3SVOA 1TWOA 5FVFA 1YJ2A 1N2DA 1JF0A 3CFHA 2H2KA 1Q4BA 3LL8B 3EVVA 4GOBA 4C0JA 1RM9A 2L2CA 1EL4A 1KCYA 3AI4A 2MRDA 3SSYA 1UP5A 2H5RA 2KBIA 5DPHA 1IG5A 2QU1A 2PXWA 4TNCA 2WHUA 3SIBA 3PN7B 2FCDA 2G5ZB 4XVPA 4M2PA 1OE9B 2VVHA 1LINA 2KYFA 1LA0A 1JC2A 4LJDA 1DGVA 4IK9A 2KI4C 3OP0A 1SL8A 1F54A 1QX5B 4TZAA 4EMQA 1FI5A 4DXOA 2LLTA 4IK3A 2WCFA 1B47A 1L2OC 1RWYA 4MEWA 1OOJA 3QMEA 4Q7TA 4LQUA 5CSNA 1HT9A 5DTZA 4W6NA 2BNXA 3LVDA 1SL7A 4Z4MA 1TCOB 3RM1A 1GGXA 2K8MB 4MZKA 4R1EA 4CLNA 3NT3A 1K8UA 1ZUXA 1BLQA 3KCTA 2ZO6A 2JTZA 1OW4A 1MQ1A 2KI6D 1F4OA 1CMGA 1TUZA 1Z2CB 4W72A 1Y0VH 4PCWA 4BY5A 2DDDA 2LM5A 1UHKA 2OPOA 1CDNA 1TNWA 1PSRA 3IP2A 2QEOA 3DQ4A 2WCBA 4AQIA 1FPWA 1J7RA 3I5HB 2HGYA 4W6SA 1JUOA 3SS3A 3BUNB 2JT0A 2A56B 2PYQA 1CFPA 4WRIA 3I19A 4H3MA 2DOQA 3DQCA 5EHUA 3I5GB 2QACA 2KHNA 3PJBA 1LVCD 3CB9A 1SPYA 5DY6A 2ZN9A 4L1IA 3ZUJA 1PRWA 1LS8A 1IJ5A 4PE1A 5J3XA 2BE4A 1QIWA 2H5OA 3EG5B 2DD7A 3O78A 1OSAA 4R6BA 1BG1A 1WDCC 5HZOA 4F7FA 4NDCA 3O6BA 1QYOA 5TNCA 2B3QA 1DJZA 1OZOA 4MRXA 1E8AA 1J7QA 3WLCA 2WNDA 3E5VA 4F0ZB 4UTSA 1NCZA 2H5QA 3CTNA 4RTCA 2QLHA 1MWNA 4N5XA 3SVEA 1OOIX 3ADFA 2KLEA 2WHTA 4IZNA 2QLEA 1BOCA 1K96A 1JFKA 3DQ8A 3PIBA 1TNPA 2BL0B 1DC1A 3TZ1A 3VHTB 1ZFSA 4DS7A 2L2EA 3OSRA 4I2YA 3D74A 3SS0A 2K7DA 3GJ1A 2Q6PA 4W7DA 3BXCA 2NCPA 1EG4A 5HKYA 1CFCA 3DQEA 4W6KA 1C7WA 1DGUA 3DVEA 5EXCI 1GL4A 2VRGA 3B87A 4ETOA 3LF3A 4YGAA 2Q4UA 3PSRA 4H3LA 2H9WA 4MZLA 3CGLA 3SS5A 1QX7A 3CYZA 4P2YB 4KPIA 4W6GA 4W77A 4LJDC 1JBZA 2HQZA 3ST3A 1ZUZA 1XA5A 3OB2B 1CLMA 1SY9A 4GGNA 1W7UA 4PPKA 3TUYB 1GFLA 3V3DA 1S6JA 4HRGA 2A52B 1LA3A 2QLGA 4OGSA 5AQBB 3U0LA 1Q4AA 4LJCA 4W6FA 3DD4A 4CIDA 4D1EA 3CBEA 3ST0A 4PHMA 1YTZC 5LTQA 4BDUA 4GF6B 1A29A 1SCVA 3BFBA 2Y0GA 3DPZA 2LE9B 2OTGC 3A8SA 1WRKA 3DYEA 3SIAA 3WNXB 3OGOA 4I5LB 2KAYA 2K61A 4XJKB 2L5YA 2YDZA 4GPLB 1KWOB 2PMYA 2G9BA 4MSPA 3OX5A 3SG5A 4XOWA 2JNFA 2G2BA 1FW4A 3WXAA 3CDNA 1MUXA 2QDIA 5CSJA 3RZSA 2VVIA 4W75A 3SG4A 4IJ7A 3I5GC 1SYMA 2MHHA 2A48A 3B6XA 2DD9A 1F70A 4XL5A 2LMUA 2FJYA 3CZ0A 1SMGA 4MBEA 3B88A 3FWCA 2HF5A 3EKHA 4J8AA 1W9ZA 3AKBA 1NUBA 2G3OA 3TMRA 1OQPA 4GAOA 3BYAA 4KF5A 4IK4A 2IE2A 1S5GZ 2I7AA 4HE4A 3PJIA 4RYWA 4Q9WA 1Q4EA 1MHOA 1MOVA 4I5JA 1M31A 3H4SE 2OTEA 1RFJA 2DUHA 4KAGA 3I5IC 1ZGOA 1N0YA 5DKQA 2HETA 4FQTA 1UWOA 2KBMA 2YE1A 5ER4X 5HKZA 3TUYC 1DMOA 3E5TA 4OY4A 1RRXA 3U0NA 2WC8A 2JWWA 2M1UA 2KFHA 1XA9A 3PN7C 3R1OA 1J1EA 3SG6A 4ZF3A 1J7OA 3SVSA 2FCEA 5EJUA 3TDIA 2QLGB 1DTLA 1Y1XA 3W1DA 1TIZA 1OOGA 2OTGB 3A8RA 1H4UA 1XFRA 1BU3A 2RH7A 2ICRA 2ZN8A 4PFEA 3L4LA 3DPWA 2LNKA 3GK1A 5DRGA 2G3DB 3VB1A 1XMZA 5JJGA 3ED8A 2HPWA 4JF9A 4XGYA 3RWTA 3SG2A 2QEVA 3LVAA 3PJ5A 1OXDA 4KW8A 2JT3A 2BL0C 4XJKA 2KI6C 4YGCB 1MYWA 4GGFC 2Y5IA 3VICA 1QLSA 2L51A 2FWQA 3DF0B 1MOUA 2M8UA 4ORAB 1EMKA 3DQDA 1TRFA 3PM8A 2M49B 1EMBA 3PJ7A 3BUOB 2F3ZA 1RJVA 1RECA 1WRZA 5J2OA 3TDZA 2Z6XA 1AHRA 3GK2A 2K0JA 1IH0A 2LUXA 1WRLA 1H6RA 4YGDB 5CSFA 5EBJA 2A46A 2M7NA 4DXIA 4QJ5B 4OCIA 2MLFC 3BUMB 3FE6A 2I94A 3V2LA 4GUKA 3TS5C 1Y6WA 1B9AA 5AEQA 3IF7A 1G8IA 2BKHB 2H6VA 4LQTA 1QLKA 2E30A 2P6BB 4WQ3A 2JXCA 2ZRSA 1ALVA 1N65A 1M63B 1Z1PA 2LLUA 3I5FC 4EDSA 1EJ3A 2KQYA 3DQKA 4DUQA 1XFWO 3GL4A 5FVGA 2EC6B 3VROA 1KK8C 2ZMWA 3CZ2A 1W7TA 1XFXO 2B1UA 2BBNA 1QIVA 1RTP1 4W69A 5H89A 3FWBA 4EDOA 1FF1A 3VHTA 2O24A 2BTJA 1KQMC 3KPXA 3O2PA 1XQMA 3BOWA 2LLSA 5LTPA 2AH8A 1KQMB 5BQLA 1KK7Z 3LK0A 2KNEA 2AWLA 1SR6B 2WISA 4FTGA 4U2VA 2OKYA 2HRSA 1F71A 1M45A 1W7JB 2BECA 2LV7A 5I8NA 3CFFA 2L50A 1CTRA 5DTXA 2P70A 5D3OA 5H87A 1SCMC 5F6TA 4DXNA 3H1OA 3BQ3A 3NSIA 4N1GA 3VRRA 5BTTB 1KFUL 3BXBA 2Q91A 2QPTA 4IL1A 2F2PA 1CLBA 2WIQA 2GGZA 3DVMA 3ICBA 1YHIA 3IVTA 1OOHA 3DY9A 1V1FA 4JEOA 1B8RA 3CS1A 3BFAA 1SNLA 1SBJA 4JQ0D 3IQQA 3Q8IA 1NCYA 4N3DA 1YUUA 2V53A 3SV5A 1K9PA 1KYRA 2IS9A 4W7CA 1UURA 4DXPA 2WHSA 3CFAA 2PSRA 2ZFDA 5D7FA 3DQOA 4W6DA 1IWQA 1S3PA 3MGFA 3EVRA 3JVTB 4ORCB 1TOPA 2A53B 1B9CA 1YFPA 1M39A 3AAKA 1Z4HA 3CGAA 3VGOA 2IOVA 1EMAA 4C0KA 3EVPA 4DRWA 4KW4A 2Z6YA 4U8DA 1C07A 2IB5A 2LMTA 3L47A 3VRQA 3SVRA 1EMMA 4IK8A 5DPGA 3PM2A 2LMVA 4E68A 1ZGQA 5DICA 3P8UA 1D1OA 2EHBA 3SVCA 3CZ1A 1PK0D 4KW9A 5F9GA 1B8LA 2ERBA 4MVFA 1DJWA 4W6MA 1TNXA 3O77A 2L0PA 4GFTA 2B3PA 2F3YA 1AVSA 2F8PA 4W6CA 3DQAA 3TDUA 3NF0A 3NGVA 3RLZA 2HPSA 1OZSA 3JVTC 2FOTA 2L98A 3LA1A 4ZF4A 4WQ2A 1KYPA 1FI6A 4W7XA 3S0DA 1QV0A 3DQFA 1C4FA 4W6OA 3BXKA 2Y4QA 3GK4X 2F2OA 4MLWA 2KDHA 1YZWA 1EXRA 1B7TZ 1LKJA 2I2RE 1AUIB 3DQLA 3ST4A 1EMEA 2ZRTA 2HFCA 2HCGA 4TZGA 2I18A 4PT1A 4PPJA 2POXA 2A50B 2LHLA 1WLMA 3D78A 1HUYA 1DJGA 1S1EA 1C3YA 2CXJA 3LF4B 2KGRA 1XFYO 3SSVA 1WDCB 4JFGA 3HCMA 2HQ8A 2GTEA 1FBVA 3DQNA 2HQKA 3UG0A 3NEDA 1AJ5A 1QVIY 3F45A 4JPZB 4DKMA 4W6AA 1EMFA 2WCJA 4INXA 4YBHB 2L5XB 4H48A 5HLOA 2JADA 1YUTA 2O5GA 4W76A 2GW4B 2BCXA 5AFPA 1SW8A 1XYDA 2LP2A 3FIAA 2V4EA 1PALA 1QV1A 2H61A 2HJOA 4GBAA 4KA9A 1YHGA 4CPVA 3C1VA 1SSEB 2H8QA 3U8PA 2G2SB 2QEHA 2V4EC 1DJHA 2CNPA 2Y1MA 4PPLA 3CD1A 1BFPA 2M0RA 1QATA 4R6DA 1K93D 3SS4A 1ZMZA 2SCPA 1P28A 3SG7A 2WOSA 2SASA 1QYQA 1A75A 2JNXA 4HSZA 3BXAA 2LVIA 3WHTB 2FL1A 3K1KA 3CZTX 3NSOA 3R1VA 4W7AA 3WCKA 1Q80A 2O2BA 3E3RA 4GNKB 1R2UA 4JRBA 2JPOA 4W6PA 3DQMA 5CSIA 1L7ZA 3WHUB 1IRJA 2LUCA 2JXLA 1K9KA 2JULA 2DUEA 3LLEA 4GGFA 4XOVA
chains in the Genus database with same CATH topology
2KI4B 3VRNA 1B4CA 1KWOC 1NYAA 1DJXA 1EMLA 3I5HC 4W6BA 1J7PA 1QVIZ 1ALWA 5KTGA 2QT2A 3D0YA 1U5IA 4DCKA 3RWAA 2LVJA 5I2OA 4JC2A 2KOTA 2VAEA 5DQBA 1DVIA 2CCMA 1HCJA 2TN4A 1S6CA 5H88A 2KFFA 1SR6C 1NP8A 3DF0A 2KGBC 1YX7A 1NSHA 2EC6C 4W6RA 2HQWA 1XAEA 3BUXB 1QTXA 1SRAA 2GW3A 4B30A 3SSHA 5BT0A 5I2QA 1Q4CA 4W73A 3SSTA 1MR8A 2OGRA 4LJBA 4W7FA 5GQQC 4KGEA 3DQHA 3LSAA 1OMVA 5FHVA 2BCBA 4ZCUA 3DQJA 5HLVA 1L2OB 3OB1B 1KFUS 4DXMA 2PVBA 5K89A 1CLLA 1JF2A 1JFJA 4DKNA 1DT7B 1JC0A 1XK4A 4KF4A 3MSEB 1YR5A 1B8CA 2QRFA 1S5GY 2IB6A 2WCEA 2YE0A 1YJFA 5T3IA 4ICBA 1CDLA 2LCPA 4ZIOA 3LVCA 3SVDA 3O4YA 1QXPA 2GX0A 1V1GA 4QJ4B 4W6LA 2G6EA 1YX8A 1J1DA 4MZJA 4ORBB 2M7LA 1KK7Y 3SG3A 1KSMA 1BMOA 1BODA 3PFVA 1Y1UA 1UHJA 1YRUB 1BJFA 1QJTA 2WSNA 1ODBA 3ZNIA 5DTLA 2JQ6A 5EXUA 1CMFA 3S05A 3CLNA 4YI8A 3SVBA 1CDMA 3WLDA 2F33A 3OHMB 3UFZA 5HW9A 4W6JA 4B30B 2AAOA 3DQ9A 2ZMUA 2AWKA 3DQ5A 3SVUA 5LK4A 3NT9A 1K90D 3D0YB 2G6YA 1MXEA 4W6UA 3KHEA 1JWDA 4P1QA 2OKWA 3GEXA 2Y1NA 2H5PA 2GV5A 1IQ3A 2BCAA 4PE0A 1S36A 4CFRA 5FVIA 1DF0A 1QYFA 3E5WA 2K7CA 1F8HA 1RMMA 1DF0B 2JRFA 1TNQA 3CD9A 2P4MA 2PALA 4I5NB 1XFVO 1NX3A 2KYCA 1S6IA 2AMIA 4P5OE 4ZFSA 1OXFA 5HZTA 2R2IA 2JC2A 1NCXA 1Q4DA 1PSBA 3KF9A 3OSQA 2L4HA 4N1FA 3G9AA 2KSPA 4Q7UA 4I5KA 4OQWA 4C0LA 4ORNA 4A4CA 3ZTFA 2Q57A 2BBMA 3IQOA 3ZUFA 4YGEB 1SL9A 5EXBA 3K21A 5ER5A 4Q9XA 2LHIA 2OS8C 1CV7A 3DQ7A 2AWMA 2CT9A 3CWGA 1PVBA 3KCSA 1VRKA 3CR4X 2ZNDA 4ZBLA 1HQVA 3SJSA 3I5IB 1W7IB 2PRUA 1QS7A 4DXQA 4RYSA 2MAZA 5HKWA 5AERA 2LVVA 1B7TY 2VZXA 2NLNA 5EB7A 5PALA 2GX2A 5KU1A 3CR5X 3LK1A 1RMOA 1QXTA 4AS8A 3PATA 2C9JA 2FJUB 2BKIB 4L12A 4HQCA 1YVLA 2DUIA 3BX9A 4GESB 2C9IA 2LVKA 3DVKA 5JOLA 1OMRA 1F55A 4W7RA 4W6TA 4PDZA 1H8BA 1LXFC 2DUFA 1CM1A 3D10A 2NXQA 1UHIA 5KSZA 3U0MA 1K94A 1AK8A 4W6IA 1BF5A 1KFXL 2KFGA 1UHNA 4NDBA 3W1CA 2KAXA 5D69A 5KTYA 1Y1AA 2PXSA 4L13A 5BTTA 5I2LA 2LC5A 2Z1OA 4HRHA 4LW5A 2G16B 1F09A 4YRUA 1IQ5A 3TS5B 4MN0A 3DPXA 1KQVA 1IKUA 3ST2A 4H3NA 1G33A 5DU0A 4NQGA 4YGBB 1Q73A 2DDCA 4BY4A 2WSOA 1PVAA 1CDPA 1DJIA 4J88A 2ZKMX 2O60A 2EMOA 1EMCA 5EB6A 2PASA 2MLEC 5DQMA 4USLA 4ANJA 1KSOA 1JBYA 2LP3A 4QJ3B 3DQ1A 3NSKA 4OKHA 1JC1A 3DQ6A 3ZULA 1GGWA 2OS8B 4KF5C 3KO0A 2CTNA 1A4PA 1OXEA 4XYNA 2HGDA 3SVNA 3PALA 3P28A 1YRTB 2M29A 3EK7A 2YFPA 3DQ3A 3PLFB 4YI9A 4KEXA 2ARLA 3BUWB 4W6HA 3QRXA 3I5FB 1UISA 2A4JA 4M2QA 2ISDA 4PE7A 4J89A 3SSPA 3U8AA 1MF8B 3GOFA 5DKNA 1BT6A 5FYXA 5LTRA 1W7SA 3AKAA 3JTDC 2A54B 4H47A 3NSLA 2WURA 1KYSA 2OTBA 2GGMA 2Z6ZA 1A2XA 3ZWHA 2AHAA 4B5YA 4UPGA 1CFDA 1KFXS 3NXAA 3VRPA 4NWSA 4PALA 3DQIA 2JOJA 1F4QA 1BR4B 1Z1QA 2CBLA 1PULA 1ZACA 1F0BA 1YUSA 1WLZA 1IGVA 1BR1B 1XFZO 4PHNA 4MRYA 2K2FA 1TN4A 4Q7RA 1A75B 3DQ2A 2NCOA 3U0KA 3CR2A 5AANA 1GQMA 3JTDB 1J55A 4P76A 1RROA 5DKRA 3TMTA 4KGFA 2H61C 2JT8A 5CPVA 2K2AA 2AUCA 1U5IB 5DTYA 3FS7A 2E6WA 2M3WA 1B1GA 1KP5A 4IK1A 2VADA 2K7BA 4OVNF 3M24A 1XSSA 4ZF5A 3DVJA 3EK4A 1TCFA 3EK8A 1S6ZA 2G6XA 2COLB 1NX1A 4Q04A 2MA2A 1EH2A 3U8CA 4M2OA 3LCPC 2EMNA 1EG3A 5G08A 2DUGA 1K95A 4HQ9A 1S26D 2EGDA 1JBAA 3VK1A 3M22A 2JTTA 3NEZA 3SRYA 1K9UA 1NX2A 2VVJA 5DPJA 4IK5A 1RMPA 1MXLC 4EULA 2NZ0A 5HYDA 2QZ0A 2M9GA 2V4EB 3LS3A 1ZGPA 1AP4A 4EN1A 3AKOA 4PE4A 1K2HA 4A4BA 3IR8A 1QASA 4DIRA 3EKJA 1UHHA 3AAJA 1QX2A 2EMDA 1XK4C 4NDDA 4Z4KA 1AJ4A 3OX6A 4OJ0A 1EMGA 1GGZA 2KAVA 2M97A 5IBWA 2JU0A 2M1KB 5DRFA 2LAPA 2A47A 4JGEA 2QLIA 4ZB1A 1H4BA 1UUSA 1M46A 1OMDA 1XFUO 1CFFA 1SK6D 2BE6A 2K7OA 4JWQA 4ZINA 4HREE 1GJYA 2FZUA 2LANA 1CKKA 3M0WA 4PHKA 5HBDA 4W74A 2WORA 1NWDA 5HZSA 1SCMB 1G4YR 1KK8B 2RGIA 4OV2A 1RK9A 1CNPA 2D8NA 4AR7A 1IJ6A 3HX4A 1CB1A 4AQJA 1TTXA 4W7EA 1YVHA 1G7KA 4OR9B 2L4IA 3AI5A 1C7VA 1WY9A 3EVUA 3DQUA 4ZCVA 3BOWB 4FQOA 5HGEA 4L9MA 2AWJA 3GB3A 1YHHA 4OHSA 2JPTA 4AOMA 1XVJA 1YURA 1QY3A 4CFQA 4HVFA 1NPQA 2MJWB 1CM4A 1ZOTB 1NIWA 2ZNEA 2MBXA 3GJ2A 1XO5A 1X02A 1JSAA 4HQ8A 1NX0A 5HZUA 1DJYA 1R6PA 2OJKA 2KQ6A 2JZIA 5AXIA 3SSLA 1A03A 5B8IB 2O29A 5DPIA 5BPJA 3A4UB 3SSKA 1SKTA 3KEVA 4PHJA 3H1RA 2ZO7A 3SVOA 5FVFA 1YJ2A 1N2DA 1JF0A 3CFHA 2H2KA 1Q4BA 3LL8B 3EVVA 4GOBA 4C0JA 1RM9A 1KCYA 1EL4A 2MRDA 3AI4A 3SSYA 1UP5A 2H5RA 2KBIA 5DPHA 1IG5A 2QU1A 2PXWA 4TNCA 2WHUA 3SIBA 3PN7B 2FCDA 2G5ZB 4XVPA 4M2PA 1OE9B 2VVHA 1LINA 2KYFA 1LA0A 1JC2A 4LJDA 1DGVA 4IK9A 2KI4C 3OP0A 1SL8A 1F54A 1QX5B 4TZAA 4EMQA 1FI5A 4DXOA 2LLTA 4IK3A 2WCFA 1B47A 1L2OC 1RWYA 4MEWA 1OOJA 4Q7TA 4LQUA 5CSNA 1HT9A 5DTZA 4W6NA 3LVDA 1SL7A 4Z4MA 1TCOB 3RM1A 1GGXA 2K8MB 4MZKA 4R1EA 4CLNA 3NT3A 1K8UA 1ZUXA 1BLQA 3KCTA 2ZO6A 2JTZA 1MQ1A 2KI6D 1F4OA 1CMGA 4W72A 1Y0VH 4PCWA 4BY5A 2DDDA 2LM5A 1UHKA 2OPOA 1CDNA 1TNWA 1PSRA 3IP2A 3DQ4A 2WCBA 4AQIA 1FPWA 1J7RA 3I5HB 2HGYA 4W6SA 1JUOA 3BUNB 2JT0A 2A56B 1CFPA 4WRIA 3I19A 4H3MA 2DOQA 3DQCA 5EHUA 3I5GB 2QACA 2KHNA 3PJBA 1LVCD 3CB9A 1SPYA 5DY6A 2ZN9A 4L1IA 3ZUJA 1PRWA 1IJ5A 4PE1A 5J3XA 2BE4A 1QIWA 2H5OA 2DD7A 3O78A 1OSAA 4R6BA 1BG1A 1WDCC 5HZOA 4NDCA 3O6BA 1QYOA 5TNCA 2B3QA 1DJZA 1OZOA 4MRXA 1E8AA 1J7QA 3WLCA 2WNDA 3E5VA 4F0ZB 4UTSA 1NCZA 2H5QA 3CTNA 4RTCA 2QLHA 1MWNA 4N5XA 3SVEA 3ADFA 2WHTA 4IZNA 2QLEA 1BOCA 1K96A 1JFKA 3DQ8A 3PIBA 1TNPA 2BL0B 3TZ1A 3VHTB 1ZFSA 4DS7A 2L2EA 3OSRA 4I2YA 3SS0A 2K7DA 3GJ1A 2Q6PA 4W7DA 3BXCA 2NCPA 1EG4A 5HKYA 1CFCA 3DQEA 4W6KA 1C7WA 1DGUA 3DVEA 5EXCI 1GL4A 2VRGA 4ETOA 3LF3A 4YGAA 2Q4UA 3PSRA 4H3LA 2H9WA 4MZLA 3CGLA 1QX7A 4P2YB 4KPIA 4W6GA 4W77A 4LJDC 1JBZA 2HQZA 3ST3A 1ZUZA 1XA5A 3OB2B 1CLMA 1SY9A 4GGNA 1W7UA 3TUYB 1GFLA 4PPKA 3V3DA 1S6JA 4HRGA 2A52B 1LA3A 2QLGA 4OGSA 5AQBB 3U0LA 1Q4AA 4LJCA 4W6FA 3DD4A 4CIDA 4D1EA 3CBEA 3ST0A 4PHMA 1YTZC 5LTQA 4BDUA 4GF6B 1A29A 1SCVA 2Y0GA 3DPZA 2LE9B 2OTGC 3A8SA 1WRKA 3SIAA 3WNXB 3OGOA 4I5LB 2KAYA 2K61A 4XJKB 2YDZA 4GPLB 1KWOB 2PMYA 2G9BA 4MSPA 3OX5A 3SG5A 4XOWA 2JNFA 2G2BA 1FW4A 3WXAA 1MUXA 5CSJA 2VVIA 4W75A 3SG4A 3I5GC 1SYMA 2MHHA 2A48A 2DD9A 1F70A 4XL5A 2LMUA 1SMGA 4MBEA 3FWCA 2HF5A 3EKHA 4J8AA 3AKBA 1NUBA 2G3OA 3TMRA 1OQPA 4GAOA 3BYAA 4KF5A 4IK4A 2IE2A 1S5GZ 2I7AA 4HE4A 4RYWA 4Q9WA 1Q4EA 1MHOA 1MOVA 4I5JA 1M31A 3H4SE 2OTEA 1RFJA 2DUHA 4KAGA 3I5IC 1ZGOA 1N0YA 5DKQA 2HETA 1UWOA 2KBMA 2YE1A 5ER4X 5HKZA 3TUYC 1DMOA 3E5TA 4OY4A 1RRXA 3U0NA 2WC8A 2JWWA 2M1UA 2KFHA 1XA9A 3PN7C 1J1EA 3SG6A 4ZF3A 1J7OA 3SVSA 2FCEA 5EJUA 3TDIA 3W1DA 2QLGB 1DTLA 1Y1XA 1TIZA 2OTGB 3A8RA 1H4UA 1BU3A 2RH7A 2ICRA 2ZN8A 4PFEA 3DPWA 2LNKA 5DRGA 3GK1A 2G3DB 1XMZA 5JJGA 3ED8A 2HPWA 4JF9A 4XGYA 3RWTA 3SG2A 3LVAA 3PJ5A 1OXDA 4KW8A 2JT3A 2BL0C 4XJKA 2KI6C 4YGCB 1MYWA 4GGFC 2Y5IA 3VICA 1QLSA 2L51A 2FWQA 3DF0B 1MOUA 2M8UA 4ORAB 1EMKA 3DQDA 1TRFA 3PM8A 2M49B 1EMBA 3PJ7A 3BUOB 2F3ZA 1RJVA 1RECA 1WRZA 5J2OA 3TDZA 2Z6XA 1AHRA 3GK2A 2K0JA 1IH0A 2LUXA 1WRLA 1H6RA 4YGDB 5CSFA 5EBJA 2A46A 2M7NA 4DXIA 4QJ5B 4OCIA 2MLFC 3BUMB 2I94A 4GUKA 3TS5C 1Y6WA 1B9AA 5AEQA 3IF7A 1G8IA 2BKHB 2H6VA 4LQTA 1QLKA 2E30A 2P6BB 4WQ3A 2JXCA 2ZRSA 1ALVA 1N65A 1M63B 1Z1PA 2LLUA 3I5FC 4EDSA 1EJ3A 2KQYA 3DQKA 4DUQA 1XFWO 3GL4A 5FVGA 2EC6B 3VROA 1KK8C 2ZMWA 1W7TA 1XFXO 2B1UA 2BBNA 1QIVA 1RTP1 4W69A 5H89A 3FWBA 4EDOA 1FF1A 3VHTA 2O24A 2BTJA 1KQMC 3KPXA 3O2PA 1XQMA 3BOWA 2LLSA 5LTPA 2AH8A 1KQMB 5BQLA 1KK7Z 3LK0A 2KNEA 2AWLA 1SR6B 2WISA 4FTGA 4U2VA 2OKYA 2HRSA 1F71A 1M45A 1W7JB 2BECA 2LV7A 5I8NA 3CFFA 2L50A 1CTRA 5DTXA 5H87A 1SCMC 5F6TA 4DXNA 3H1OA 3BQ3A 3NSIA 4N1GA 3VRRA 5BTTB 1KFUL 3BXBA 2Q91A 2QPTA 4IL1A 2F2PA 1CLBA 2WIQA 2GGZA 3DVMA 3ICBA 1YHIA 1V1FA 4JEOA 1B8RA 3CS1A 1SNLA 1SBJA 4JQ0D 3IQQA 1NCYA 4N3DA 1YUUA 2V53A 3SV5A 1K9PA 1KYRA 2IS9A 4W7CA 1UURA 4DXPA 2WHSA 3CFAA 2PSRA 2ZFDA 5D7FA 3DQOA 4W6DA 1IWQA 1S3PA 3MGFA 3EVRA 3JVTB 4ORCB 1TOPA 2A53B 1B9CA 1YFPA 1M39A 3AAKA 3CGAA 3VGOA 2IOVA 1EMAA 4C0KA 3EVPA 4DRWA 4KW4A 2Z6YA 4U8DA 1C07A 2IB5A 2LMTA 3VRQA 3SVRA 1EMMA 4IK8A 5DPGA 2LMVA 4E68A 1ZGQA 3P8UA 1D1OA 2EHBA 3SVCA 1PK0D 4KW9A 5F9GA 1B8LA 4MVFA 1DJWA 4W6MA 1TNXA 3O77A 2L0PA 4GFTA 2B3PA 2F3YA 1AVSA 2F8PA 4W6CA 3DQAA 3TDUA 3NF0A 3RLZA 2HPSA 1OZSA 3JVTC 2FOTA 2L98A 4ZF4A 3LA1A 4WQ2A 1KYPA 1FI6A 4W7XA 1QV0A 3DQFA 1C4FA 4W6OA 3BXKA 2Y4QA 3GK4X 2F2OA 4MLWA 2KDHA 1YZWA 1EXRA 1B7TZ 1LKJA 2I2RE 1AUIB 3DQLA 3ST4A 1EMEA 2ZRTA 2HFCA 2HCGA 4TZGA 2I18A 4PPJA 2POXA 2A50B 2LHLA 1WLMA 1HUYA 1DJGA 1S1EA 2CXJA 3LF4B 2KGRA 1XFYO 3SSVA 1WDCB 4JFGA 3HCMA 2HQ8A 1FBVA 3DQNA 2HQKA 3UG0A 3NEDA 1AJ5A 1QVIY 3F45A 4JPZB 4DKMA 4W6AA 1EMFA 4YBHB 2L5XB 4H48A 5HLOA 2JADA 1YUTA 2O5GA 4W76A 2GW4B 2BCXA 5AFPA 1SW8A 1XYDA 2LP2A 3FIAA 2V4EA 1PALA 1QV1A 2H61A 2HJOA 4GBAA 4KA9A 1YHGA 4CPVA 3C1VA 2H8QA 3U8PA 2G2SB 2V4EC 1DJHA 2CNPA 2Y1MA 4PPLA 3CD1A 1BFPA 2M0RA 1QATA 4R6DA 1K93D 1ZMZA 2SCPA 3SG7A 2WOSA 2SASA 1QYQA 1A75A 2JNXA 4HSZA 3BXAA 2LVIA 3WHTB 2FL1A 3K1KA 3CZTX 3NSOA 4W7AA 3WCKA 1Q80A 2O2BA 3E3RA 4GNKB 1R2UA 4JRBA 4W6PA 3DQMA 5CSIA 1L7ZA 3WHUB 1IRJA 2LUCA 2JXLA 1K9KA 2JULA 2DUEA 3LLEA 4GGFA 4XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI4 B;  3VRN A;  1B4C A;  1KWO C;  1NYA A;  1DJX A;  1EML A;  3I5H C;  4W6B A;  1J7P A;  1QVI Z;  1ALW A;  5KTG A;  2QT2 A;  3D0Y A;  1U5I A;  4DCK A;  3RWA A;  2LVJ A;  5I2O A;  4JC2 A;  2KOT A;  2VAE A;  5DQB A;  1DVI A;  2CCM A;  1HCJ A;  2TN4 A;  1S6C A;  5H88 A;  2KFF A;  1SR6 C;  1NP8 A;  3DF0 A;  2KGB C;  1YX7 A;  1NSH A;  2EC6 C;  4W6R A;  2HQW A;  1XAE A;  3BUX B;  1QTX A;  1SRA A;  2GW3 A;  4B30 A;  3SSH A;  5BT0 A;  5I2Q A;  1Q4C A;  4W73 A;  3SST A;  1MR8 A;  2OGR A;  4LJB A;  4W7F A;  5GQQ C;  4KGE A;  3DQH A;  3LSA A;  1OMV A;  5FHV A;  2BCB A;  4ZCU A;  3DQJ A;  5HLV A;  1L2O B;  3OB1 B;  1KFU S;  4DXM A;  2PVB A;  5K89 A;  1CLL A;  1JF2 A;  1JFJ A;  4DKN A;  1DT7 B;  1JC0 A;  1XK4 A;  4KF4 A;  3MSE B;  1YR5 A;  1B8C A;  2QRF A;  1S5G Y;  2IB6 A;  2WCE A;  2YE0 A;  1YJF A;  5T3I A;  4ICB A;  1CDL A;  2LCP A;  4ZIO A;  3LVC A;  3SVD A;  3O4Y A;  1QXP A;  2GX0 A;  1V1G A;  4QJ4 B;  4W6L A;  2G6E A;  1YX8 A;  1J1D A;  4MZJ A;  4ORB B;  2M7L A;  1KK7 Y;  3SG3 A;  1KSM A;  1BMO A;  1BOD A;  3PFV A;  1Y1U A;  1UHJ A;  1YRU B;  1BJF A;  1QJT A;  2WSN A;  1ODB A;  3ZNI A;  5DTL A;  2JQ6 A;  5EXU A;  1CMF A;  3S05 A;  3CLN A;  4YI8 A;  3SVB A;  1CDM A;  3WLD A;  2F33 A;  3OHM B;  3UFZ A;  5HW9 A;  4W6J A;  4B30 B;  2AAO A;  3DQ9 A;  2ZMU A;  2AWK A;  3DQ5 A;  3SVU A;  5LK4 A;  3NT9 A;  1K90 D;  3D0Y B;  2G6Y A;  1MXE A;  4W6U A;  3KHE A;  1JWD A;  4P1Q A;  2OKW A;  3GEX A;  2Y1N A;  2H5P A;  2GV5 A;  1IQ3 A;  2BCA A;  4PE0 A;  1S36 A;  4CFR A;  5FVI A;  1DF0 A;  1QYF A;  3E5W A;  2K7C A;  1F8H A;  1RMM A;  1DF0 B;  2JRF A;  1TNQ A;  3CD9 A;  2P4M A;  2PAL A;  4I5N B;  1XFV O;  1NX3 A;  2KYC A;  1S6I A;  2AMI A;  4P5O E;  4ZFS A;  1OXF A;  5HZT A;  2R2I A;  2JC2 A;  1NCX A;  1Q4D A;  1PSB A;  3KF9 A;  3OSQ A;  2L4H A;  4N1F A;  3G9A A;  2KSP A;  4Q7U A;  4I5K A;  4OQW A;  4C0L A;  4ORN A;  4A4C A;  3ZTF A;  2Q57 A;  2BBM A;  3IQO A;  3ZUF A;  4YGE B;  1SL9 A;  5EXB A;  3K21 A;  5ER5 A;  4Q9X A;  2LHI A;  2OS8 C;  1CV7 A;  3DQ7 A;  2AWM A;  2CT9 A;  3CWG A;  1PVB A;  3KCS A;  1VRK A;  3CR4 X;  2ZND A;  4ZBL A;  1HQV A;  3SJS A;  3I5I B;  1W7I B;  2PRU A;  1QS7 A;  4DXQ A;  4RYS A;  2MAZ A;  5HKW A;  5AER A;  2LVV A;  1B7T Y;  2VZX A;  2NLN A;  5EB7 A;  5PAL A;  2GX2 A;  5KU1 A;  3CR5 X;  3LK1 A;  1RMO A;  1QXT A;  4AS8 A;  3PAT A;  2C9J A;  2FJU B;  2BKI B;  4L12 A;  4HQC A;  1YVL A;  2DUI A;  3BX9 A;  4GES B;  2C9I A;  2LVK A;  3DVK A;  5JOL A;  1OMR A;  1F55 A;  4W7R A;  4W6T A;  4PDZ A;  1H8B A;  1LXF C;  2DUF A;  1CM1 A;  3D10 A;  2NXQ A;  1UHI A;  5KSZ A;  3U0M A;  1K94 A;  1AK8 A;  4W6I A;  1BF5 A;  1KFX L;  2KFG A;  1UHN A;  4NDB A;  3W1C A;  2KAX A;  5D69 A;  5KTY A;  1Y1A A;  2PXS A;  4L13 A;  5BTT A;  5I2L A;  2LC5 A;  2Z1O A;  4HRH A;  4LW5 A;  2G16 B;  1F09 A;  4YRU A;  1IQ5 A;  3TS5 B;  4MN0 A;  3DPX A;  1KQV A;  1IKU A;  3ST2 A;  4H3N A;  1G33 A;  5DU0 A;  4NQG A;  4YGB B;  1Q73 A;  2DDC A;  4BY4 A;  2WSO A;  1PVA A;  1CDP A;  1DJI A;  4J88 A;  2ZKM X;  2O60 A;  2EMO A;  1EMC A;  5EB6 A;  2PAS A;  2MLE C;  5DQM A;  4USL A;  4ANJ A;  1KSO A;  1JBY A;  2LP3 A;  4QJ3 B;  3DQ1 A;  3NSK A;  4OKH A;  1JC1 A;  3DQ6 A;  3ZUL A;  1GGW A;  2OS8 B;  4KF5 C;  3KO0 A;  2CTN A;  1A4P A;  1OXE A;  4XYN A;  2HGD A;  3SVN A;  3PAL A;  3P28 A;  1YRT B;  2M29 A;  3EK7 A;  2YFP A;  3DQ3 A;  3PLF B;  4YI9 A;  4KEX A;  2ARL A;  3BUW B;  4W6H A;  3QRX A;  3I5F B;  1UIS A;  2A4J A;  4M2Q A;  2ISD A;  4PE7 A;  4J89 A;  3SSP A;  3U8A A;  1MF8 B;  3GOF A;  5DKN A;  1BT6 A;  5FYX A;  5LTR A;  1W7S A;  3AKA A;  3JTD C;  2A54 B;  4H47 A;  3NSL A;  2WUR A;  1KYS A;  2OTB A;  2GGM A;  2Z6Z A;  1A2X A;  3ZWH A;  2AHA A;  4B5Y A;  4UPG A;  1CFD A;  1KFX S;  3NXA A;  3VRP A;  4NWS A;  4PAL A;  3DQI A;  2JOJ A;  1F4Q A;  1BR4 B;  1Z1Q A;  2CBL A;  1PUL A;  1ZAC A;  1F0B A;  1YUS A;  1WLZ A;  1IGV A;  1BR1 B;  1XFZ O;  4PHN A;  4MRY A;  2K2F A;  1TN4 A;  4Q7R A;  1A75 B;  3DQ2 A;  2NCO A;  3U0K A;  3CR2 A;  5AAN A;  1GQM A;  3JTD B;  1J55 A;  4P76 A;  1RRO A;  5DKR A;  3TMT A;  4KGF A;  2H61 C;  2JT8 A;  5CPV A;  2K2A A;  2AUC A;  1U5I B;  5DTY A;  3FS7 A;  2E6W A;  2M3W A;  1B1G A;  1KP5 A;  4IK1 A;  2VAD A;  2K7B A;  4OVN F;  3M24 A;  1XSS A;  4ZF5 A;  3DVJ A;  3EK4 A;  1TCF A;  3EK8 A;  1S6Z A;  2G6X A;  2COL B;  1NX1 A;  4Q04 A;  2MA2 A;  1EH2 A;  3U8C A;  4M2O A;  3LCP C;  2EMN A;  1EG3 A;  5G08 A;  2DUG A;  1K95 A;  4HQ9 A;  1S26 D;  2EGD A;  1JBA A;  3VK1 A;  3M22 A;  2JTT A;  3NEZ A;  3SRY A;  1K9U A;  1NX2 A;  2VVJ A;  5DPJ A;  4IK5 A;  1RMP A;  1MXL C;  4EUL A;  2NZ0 A;  5HYD A;  2QZ0 A;  2M9G A;  2V4E B;  3LS3 A;  1ZGP A;  1AP4 A;  4EN1 A;  3AKO A;  4PE4 A;  1K2H A;  4A4B A;  3IR8 A;  1QAS A;  4DIR A;  3EKJ A;  1UHH A;  3AAJ A;  1QX2 A;  2EMD A;  1XK4 C;  4NDD A;  4Z4K A;  1AJ4 A;  3OX6 A;  4OJ0 A;  1EMG A;  1GGZ A;  2KAV A;  2M97 A;  5IBW A;  2JU0 A;  2M1K B;  5DRF A;  2LAP A;  2A47 A;  4JGE A;  2QLI A;  4ZB1 A;  1H4B A;  1UUS A;  1M46 A;  1OMD A;  1XFU O;  1CFF A;  1SK6 D;  2BE6 A;  2K7O A;  4JWQ A;  4ZIN A;  4HRE E;  1GJY A;  2FZU A;  2LAN A;  1CKK A;  3M0W A;  4PHK A;  5HBD A;  4W74 A;  2WOR A;  1NWD A;  5HZS A;  1SCM B;  1G4Y R;  1KK8 B;  2RGI A;  4OV2 A;  1RK9 A;  1CNP A;  2D8N A;  4AR7 A;  1IJ6 A;  3HX4 A;  1CB1 A;  4AQJ A;  1TTX A;  4W7E A;  1YVH A;  1G7K A;  4OR9 B;  2L4I A;  3AI5 A;  1C7V A;  1WY9 A;  3EVU A;  3DQU A;  4ZCV A;  3BOW B;  4FQO A;  5HGE A;  4L9M A;  2AWJ A;  3GB3 A;  1YHH A;  4OHS A;  2JPT A;  4AOM A;  1XVJ A;  1YUR A;  1QY3 A;  4CFQ A;  4HVF A;  1NPQ A;  2MJW B;  1CM4 A;  1ZOT B;  1NIW A;  2ZNE A;  2MBX A;  3GJ2 A;  1XO5 A;  1X02 A;  1JSA A;  4HQ8 A;  1NX0 A;  5HZU A;  1DJY A;  1R6P A;  2OJK A;  2KQ6 A;  2JZI A;  5AXI A;  3SSL A;  1A03 A;  5B8I B;  2O29 A;  5DPI A;  5BPJ A;  3A4U B;  3SSK A;  1SKT A;  3KEV A;  4PHJ A;  3H1R A;  2ZO7 A;  3SVO A;  5FVF A;  1YJ2 A;  1N2D A;  1JF0 A;  3CFH A;  2H2K A;  1Q4B A;  3LL8 B;  3EVV A;  4GOB A;  4C0J A;  1RM9 A;  1KCY A;  1EL4 A;  2MRD A;  3AI4 A;  3SSY A;  1UP5 A;  2H5R A;  2KBI A;  5DPH A;  1IG5 A;  2QU1 A;  2PXW A;  4TNC A;  2WHU A;  3SIB A;  3PN7 B;  2FCD A;  2G5Z B;  4XVP A;  4M2P A;  1OE9 B;  2VVH A;  1LIN A;  2KYF A;  1LA0 A;  1JC2 A;  4LJD A;  1DGV A;  4IK9 A;  2KI4 C;  3OP0 A;  1SL8 A;  1F54 A;  1QX5 B;  4TZA A;  4EMQ A;  1FI5 A;  4DXO A;  2LLT A;  4IK3 A;  2WCF A;  1B47 A;  1L2O C;  1RWY A;  4MEW A;  1OOJ A;  4Q7T A;  4LQU A;  5CSN A;  1HT9 A;  5DTZ A;  4W6N A;  3LVD A;  1SL7 A;  4Z4M A;  1TCO B;  3RM1 A;  1GGX A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  3NT3 A;  1K8U A;  1ZUX A;  1BLQ A;  3KCT A;  2ZO6 A;  2JTZ A;  1MQ1 A;  2KI6 D;  1F4O A;  1CMG A;  4W72 A;  1Y0V H;  4PCW A;  4BY5 A;  2DDD A;  2LM5 A;  1UHK A;  2OPO A;  1CDN A;  1TNW A;  1PSR A;  3IP2 A;  3DQ4 A;  2WCB A;  4AQI A;  1FPW A;  1J7R A;  3I5H B;  2HGY A;  4W6S A;  1JUO A;  3BUN B;  2JT0 A;  2A56 B;  1CFP A;  4WRI A;  3I19 A;  4H3M A;  2DOQ A;  3DQC A;  5EHU A;  3I5G B;  2QAC A;  2KHN A;  3PJB A;  1LVC D;  3CB9 A;  1SPY A;  5DY6 A;  2ZN9 A;  4L1I A;  3ZUJ A;  1PRW A;  1IJ5 A;  4PE1 A;  5J3X A;  2BE4 A;  1QIW A;  2H5O A;  2DD7 A;  3O78 A;  1OSA A;  4R6B A;  1BG1 A;  1WDC C;  5HZO A;  4NDC A;  3O6B A;  1QYO A;  5TNC A;  2B3Q A;  1DJZ A;  1OZO A;  4MRX A;  1E8A A;  1J7Q A;  3WLC A;  2WND A;  3E5V A;  4F0Z B;  4UTS A;  1NCZ A;  2H5Q A;  3CTN A;  4RTC A;  2QLH A;  1MWN A;  4N5X A;  3SVE A;  3ADF A;  2WHT A;  4IZN A;  2QLE A;  1BOC A;  1K96 A;  1JFK A;  3DQ8 A;  3PIB A;  1TNP A;  2BL0 B;  3TZ1 A;  3VHT B;  1ZFS A;  4DS7 A;  2L2E A;  3OSR A;  4I2Y A;  3SS0 A;  2K7D A;  3GJ1 A;  2Q6P A;  4W7D A;  3BXC A;  2NCP A;  1EG4 A;  5HKY A;  1CFC A;  3DQE A;  4W6K A;  1C7W A;  1DGU A;  3DVE A;  5EXC I;  1GL4 A;  2VRG A;  4ETO A;  3LF3 A;  4YGA A;  2Q4U A;  3PSR A;  4H3L A;  2H9W A;  4MZL A;  3CGL A;  1QX7 A;  4P2Y B;  4KPI A;  4W6G A;  4W77 A;  4LJD C;  1JBZ A;  2HQZ A;  3ST3 A;  1ZUZ A;  1XA5 A;  3OB2 B;  1CLM A;  1SY9 A;  4GGN A;  1W7U A;  3TUY B;  1GFL A;  4PPK A;  3V3D A;  1S6J A;  4HRG A;  2A52 B;  1LA3 A;  2QLG A;  4OGS A;  5AQB B;  3U0L A;  1Q4A A;  4LJC A;  4W6F A;  3DD4 A;  4CID A;  4D1E A;  3CBE A;  3ST0 A;  4PHM A;  1YTZ C;  5LTQ A;  4BDU A;  4GF6 B;  1A29 A;  1SCV A;  2Y0G A;  3DPZ A;  2LE9 B;  2OTG C;  3A8S A;  1WRK A;  3SIA A;  3WNX B;  3OGO A;  4I5L B;  2KAY A;  2K61 A;  4XJK B;  2YDZ A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  4MSP A;  3OX5 A;  3SG5 A;  4XOW A;  2JNF A;  2G2B A;  1FW4 A;  3WXA A;  1MUX A;  5CSJ A;  2VVI A;  4W75 A;  3SG4 A;  3I5G C;  1SYM A;  2MHH A;  2A48 A;  2DD9 A;  1F70 A;  4XL5 A;  2LMU A;  1SMG A;  4MBE A;  3FWC A;  2HF5 A;  3EKH A;  4J8A A;  3AKB A;  1NUB A;  2G3O A;  3TMR A;  1OQP A;  4GAO A;  3BYA A;  4KF5 A;  4IK4 A;  2IE2 A;  1S5G Z;  2I7A A;  4HE4 A;  4RYW A;  4Q9W A;  1Q4E A;  1MHO A;  1MOV A;  4I5J A;  1M31 A;  3H4S E;  2OTE A;  1RFJ A;  2DUH A;  4KAG A;  3I5I C;  1ZGO A;  1N0Y A;  5DKQ A;  2HET A;  1UWO A;  2KBM A;  2YE1 A;  5ER4 X;  5HKZ A;  3TUY C;  1DMO A;  3E5T A;  4OY4 A;  1RRX A;  3U0N A;  2WC8 A;  2JWW A;  2M1U A;  2KFH A;  1XA9 A;  3PN7 C;  1J1E A;  3SG6 A;  4ZF3 A;  1J7O A;  3SVS A;  2FCE A;  5EJU A;  3TDI A;  3W1D A;  2QLG B;  1DTL A;  1Y1X A;  1TIZ A;  2OTG B;  3A8R A;  1H4U A;  1BU3 A;  2RH7 A;  2ICR A;  2ZN8 A;  4PFE A;  3DPW A;  2LNK A;  5DRG A;  3GK1 A;  2G3D B;  1XMZ A;  5JJG A;  3ED8 A;  2HPW A;  4JF9 A;  4XGY A;  3RWT A;  3SG2 A;  3LVA A;  3PJ5 A;  1OXD A;  4KW8 A;  2JT3 A;  2BL0 C;  4XJK A;  2KI6 C;  4YGC B;  1MYW A;  4GGF C;  2Y5I A;  3VIC A;  1QLS A;  2L51 A;  2FWQ A;  3DF0 B;  1MOU A;  2M8U A;  4ORA B;  1EMK A;  3DQD A;  1TRF A;  3PM8 A;  2M49 B;  1EMB A;  3PJ7 A;  3BUO B;  2F3Z A;  1RJV A;  1REC A;  1WRZ A;  5J2O A;  3TDZ A;  2Z6X A;  1AHR A;  3GK2 A;  2K0J A;  1IH0 A;  2LUX A;  1WRL A;  1H6R A;  4YGD B;  5CSF A;  5EBJ A;  2A46 A;  2M7N A;  4DXI A;  4QJ5 B;  4OCI A;  2MLF C;  3BUM B;  2I94 A;  4GUK A;  3TS5 C;  1Y6W A;  1B9A A;  5AEQ A;  3IF7 A;  1G8I A;  2BKH B;  2H6V A;  4LQT A;  1QLK A;  2E30 A;  2P6B B;  4WQ3 A;  2JXC A;  2ZRS A;  1ALV A;  1N65 A;  1M63 B;  1Z1P A;  2LLU A;  3I5F C;  4EDS A;  1EJ3 A;  2KQY A;  3DQK A;  4DUQ A;  1XFW O;  3GL4 A;  5FVG A;  2EC6 B;  3VRO A;  1KK8 C;  2ZMW A;  1W7T A;  1XFX O;  2B1U A;  2BBN A;  1QIV A;  1RTP 1;  4W69 A;  5H89 A;  3FWB A;  4EDO A;  1FF1 A;  3VHT A;  2O24 A;  2BTJ A;  1KQM C;  3KPX A;  3O2P A;  1XQM A;  3BOW A;  2LLS A;  5LTP A;  2AH8 A;  1KQM B;  5BQL A;  1KK7 Z;  3LK0 A;  2KNE A;  2AWL A;  1SR6 B;  2WIS A;  4FTG A;  4U2V A;  2OKY A;  2HRS A;  1F71 A;  1M45 A;  1W7J B;  2BEC A;  2LV7 A;  5I8N A;  3CFF A;  2L50 A;  1CTR A;  5DTX A;  5H87 A;  1SCM C;  5F6T A;  4DXN A;  3H1O A;  3BQ3 A;  3NSI A;  4N1G A;  3VRR A;  5BTT B;  1KFU L;  3BXB A;  2Q91 A;  2QPT A;  4IL1 A;  2F2P A;  1CLB A;  2WIQ A;  2GGZ A;  3DVM A;  3ICB A;  1YHI A;  1V1F A;  4JEO A;  1B8R A;  3CS1 A;  1SNL A;  1SBJ A;  4JQ0 D;  3IQQ A;  1NCY A;  4N3D A;  1YUU A;  2V53 A;  3SV5 A;  1K9P A;  1KYR A;  2IS9 A;  4W7C A;  1UUR A;  4DXP A;  2WHS A;  3CFA A;  2PSR A;  2ZFD A;  5D7F A;  3DQO A;  4W6D A;  1IWQ A;  1S3P A;  3MGF A;  3EVR A;  3JVT B;  4ORC B;  1TOP A;  2A53 B;  1B9C A;  1YFP A;  1M39 A;  3AAK A;  3CGA A;  3VGO A;  2IOV A;  1EMA A;  4C0K A;  3EVP A;  4DRW A;  4KW4 A;  2Z6Y A;  4U8D A;  1C07 A;  2IB5 A;  2LMT A;  3VRQ A;  3SVR A;  1EMM A;  4IK8 A;  5DPG A;  2LMV A;  4E68 A;  1ZGQ A;  3P8U A;  1D1O A;  2EHB A;  3SVC A;  1PK0 D;  4KW9 A;  5F9G A;  1B8L A;  4MVF A;  1DJW A;  4W6M A;  1TNX A;  3O77 A;  2L0P A;  4GFT A;  2B3P A;  2F3Y A;  1AVS A;  2F8P A;  4W6C A;  3DQA A;  3TDU A;  3NF0 A;  3RLZ A;  2HPS A;  1OZS A;  3JVT C;  2FOT A;  2L98 A;  4ZF4 A;  3LA1 A;  4WQ2 A;  1KYP A;  1FI6 A;  4W7X A;  1QV0 A;  3DQF A;  1C4F A;  4W6O A;  3BXK A;  2Y4Q A;  3GK4 X;  2F2O A;  4MLW A;  2KDH A;  1YZW A;  1EXR A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3DQL A;  3ST4 A;  1EME A;  2ZRT A;  2HFC A;  2HCG A;  4TZG A;  2I18 A;  4PPJ A;  2POX A;  2A50 B;  2LHL A;  1WLM A;  1HUY A;  1DJG A;  1S1E A;  2CXJ A;  3LF4 B;  2KGR A;  1XFY O;  3SSV A;  1WDC B;  4JFG A;  3HCM A;  2HQ8 A;  1FBV A;  3DQN A;  2HQK A;  3UG0 A;  3NED A;  1AJ5 A;  1QVI Y;  3F45 A;  4JPZ B;  4DKM A;  4W6A A;  1EMF A;  4YBH B;  2L5X B;  4H48 A;  5HLO A;  2JAD A;  1YUT A;  2O5G A;  4W76 A;  2GW4 B;  2BCX A;  5AFP A;  1SW8 A;  1XYD A;  2LP2 A;  3FIA A;  2V4E A;  1PAL A;  1QV1 A;  2H61 A;  2HJO A;  4GBA A;  4KA9 A;  1YHG A;  4CPV A;  3C1V A;  2H8Q A;  3U8P A;  2G2S B;  2V4E C;  1DJH A;  2CNP A;  2Y1M A;  4PPL A;  3CD1 A;  1BFP A;  2M0R A;  1QAT A;  4R6D A;  1K93 D;  1ZMZ A;  2SCP A;  3SG7 A;  2WOS A;  2SAS A;  1QYQ A;  1A75 A;  2JNX A;  4HSZ A;  3BXA A;  2LVI A;  3WHT B;  2FL1 A;  3K1K A;  3CZT X;  3NSO A;  4W7A A;  3WCK A;  1Q80 A;  2O2B A;  3E3R A;  4GNK B;  1R2U A;  4JRB A;  4W6P A;  3DQM A;  5CSI A;  1L7Z A;  3WHU B;  1IRJ A;  2LUC A;  2JXL A;  1K9K A;  2JUL A;  2DUE A;  3LLE A;  4GGF A;  4XOV A; 
#chains in the Genus database with same CATH topology
 1DQE A;  2WCM A;  2KI4 B;  3VRN A;  2BAP A;  1B4C A;  1KWO C;  1NYA A;  1DJX A;  1EML A;  3I5H C;  4W6B A;  1J7P A;  1QVI Z;  1ALW A;  5KTG A;  4INW A;  2QT2 A;  3D0Y A;  1U5I A;  4DCK A;  3RWA A;  2LVJ A;  5I2O A;  1ORG A;  4JC2 A;  2KOT A;  2WCL A;  2VAE A;  5DQB A;  1DVI A;  2CCM A;  1QWV A;  1HCJ A;  2TN4 A;  1S6C A;  5H88 A;  2KFF A;  1SR6 C;  1NP8 A;  3DF0 A;  2KGB C;  1YX7 A;  1NSH A;  2EC6 C;  4W6R A;  2HQW A;  1IIO A;  1XAE A;  3BUX B;  1QTX A;  1SRA A;  2P71 A;  2GW3 A;  4B30 A;  2KLD A;  3SSH A;  5BT0 A;  5I2Q A;  1Q4C A;  4W73 A;  3SST A;  1MR8 A;  2OGR A;  4LJB A;  4W7F A;  5GQQ C;  4KGE A;  3DQH A;  3LSA A;  1OMV A;  5FHV A;  2BCB A;  4ZCU A;  3DQJ A;  5HLV A;  1L2O B;  3OB1 B;  1KFU S;  4DXM A;  2PVB A;  5K89 A;  1CLL A;  1JF2 A;  1JFJ A;  4DKN A;  1DT7 B;  3NHT A;  1JC0 A;  1XK4 A;  4KF4 A;  3MSE B;  1YR5 A;  1B8C A;  2QRF A;  1S5G Y;  2IB6 A;  2WCE A;  2YE0 A;  1YJF A;  5T3I A;  4JD9 A;  4ICB A;  1CDL A;  2LCP A;  4ZIO A;  3LVC A;  3O4Y A;  3SVD A;  1QXP A;  2GX0 A;  1V1G A;  4QJ4 B;  4W6L A;  2G6E A;  1YX8 A;  1J1D A;  4MZJ A;  4ORB B;  2M7L A;  1KK7 Y;  3SG3 A;  1KSM A;  1BMO A;  1BOD A;  3PFV A;  1Y1U A;  1UHJ A;  1YRU B;  1BJF A;  1QJT A;  2WSN A;  1ODB A;  3ZNI A;  5DTL A;  2JQ6 A;  5EXU A;  1CMF A;  3S05 A;  3CLN A;  4YI8 A;  3SVB A;  1CDM A;  3WLD A;  3R1P A;  2F33 A;  3OHM B;  1GM0 A;  3UFZ A;  5HW9 A;  4W6J A;  4B30 B;  2AAO A;  3DQ9 A;  2ZMU A;  2AWK A;  3DQ5 A;  3SVU A;  3S0A A;  5LK4 A;  3NT9 A;  1K90 D;  3D0Y B;  2G6Y A;  1MXE A;  4W6U A;  3KHE A;  1JWD A;  4P1Q A;  2OKW A;  3GEX A;  2Y1N A;  2H5P A;  2GV5 A;  1IQ3 A;  2BCA A;  4PE0 A;  1S36 A;  4CFR A;  5FVI A;  1DF0 A;  1QYF A;  3E5W A;  2K7C A;  1F8H A;  1RMM A;  1DF0 B;  2JRF A;  1TNQ A;  3CD9 A;  5FI6 A;  2P4M A;  2PAL A;  4I5N B;  1XFV O;  1NX3 A;  2KYC A;  1S6I A;  2AMI A;  4P5O E;  1OXF A;  4ZFS A;  5HZT A;  2R2I A;  2JC2 A;  1NCX A;  1Q4D A;  1PSB A;  3KF9 A;  3OSQ A;  2L4H A;  4N1F A;  3G9A A;  2KSP A;  4Q7U A;  1DEK A;  4I5K A;  4OQW A;  4C0L A;  4ORN A;  4A4C A;  3ZTF A;  2Q57 A;  2BBM A;  3IQO A;  2YGU A;  3ZUF A;  4OZD A;  4YGE B;  1SL9 A;  5EXB A;  3K21 A;  5ER5 A;  4Q9X A;  2LHI A;  2OS8 C;  1CV7 A;  3DQ7 A;  2AWM A;  2CT9 A;  3CWG A;  1PVB A;  3KCS A;  1VRK A;  3CR4 X;  2ZND A;  4ZBL A;  1HQV A;  3SJS A;  3I5I B;  1W7I B;  2PRU A;  1QS7 A;  4RYS A;  4DXQ A;  2MAZ A;  5HKW A;  5AER A;  3L4A A;  2LVV A;  1B7T Y;  2VZX A;  2WC6 A;  2NLN A;  5EB7 A;  5PAL A;  2GX2 A;  5KU1 A;  3CR5 X;  3LK1 A;  1RMO A;  1QXT A;  4AS8 A;  3PAT A;  2C9J A;  2FJU B;  3UO9 A;  2BKI B;  4L12 A;  4HQC A;  1YVL A;  2DUI A;  3BX9 A;  4GES B;  2C9I A;  2LVK A;  3DVK A;  5JOL A;  1OMR A;  1F55 A;  4W7R A;  3S0B A;  4W6T A;  4PDZ A;  1H8B A;  1LXF C;  2DUF A;  1CM1 A;  3D10 A;  2NXQ A;  1UHI A;  5KSZ A;  3U0M A;  1K94 A;  1AK8 A;  4W6I A;  1BF5 A;  1KFX L;  2KFG A;  1UHN A;  4NDB A;  3W1C A;  2KAX A;  5D69 A;  5KTY A;  3D73 A;  1Y1A A;  2PXS A;  4L13 A;  5BTT A;  5I2L A;  2LC5 A;  2Z1O A;  4HRH A;  4LW5 A;  2WC5 A;  2G16 B;  1F09 A;  4YRU A;  1IQ5 A;  3TS5 B;  4MN0 A;  3DPX A;  1KQV A;  1IKU A;  3ST2 A;  4H3N A;  1G33 A;  5DU0 A;  4NQG A;  4YGB B;  1Q73 A;  2DDC A;  4BY4 A;  2WSO A;  1PVA A;  1CDP A;  1DJI A;  3NHI A;  4J88 A;  2ZKM X;  2O60 A;  2EMO A;  1EMC A;  5EB6 A;  2PAS A;  2MLE C;  5DQM A;  4USL A;  4ANJ A;  1KSO A;  1JBY A;  2LP3 A;  4QJ3 B;  3DQ1 A;  3NSK A;  5I94 A;  4OKH A;  1JC1 A;  3DQ6 A;  3B7A A;  3D76 A;  3ZUL A;  1GGW A;  2OS8 B;  4KF5 C;  3KO0 A;  2CTN A;  1A4P A;  1OXE A;  4XYN A;  2HGD A;  3SVN A;  3BFH A;  3PAL A;  3P28 A;  1YRT B;  2M29 A;  3EK7 A;  2YFP A;  3DQ3 A;  3PLF B;  4JKT A;  4YI9 A;  4KEX A;  2ARL A;  3BUW B;  4W6H A;  3QRX A;  3I5F B;  1UIS A;  2A4J A;  4M2Q A;  2ISD A;  4PE7 A;  4J89 A;  3SSP A;  3U8A A;  1MF8 B;  3GOF A;  5DKN A;  1BT6 A;  5FYX A;  5LTR A;  1W7S A;  3AKA A;  3JTD C;  2A54 B;  4H47 A;  3NSL A;  2WUR A;  1KYS A;  2OTB A;  2GGM A;  2Z6Z A;  1A2X A;  3ZWH A;  2AHA A;  1C3Z A;  4B5Y A;  4UPG A;  1CFD A;  1KFX S;  3NXA A;  3VRP A;  4NWS A;  4PAL A;  3DQI A;  2JOJ A;  1F4Q A;  3FE9 A;  1DEL A;  1BR4 B;  1Z1Q A;  2CBL A;  3D75 A;  1PUL A;  1ZAC A;  1F0B A;  1YUS A;  1WLZ A;  1IGV A;  1BR1 B;  1XFZ O;  4PHN A;  4MRY A;  2K2F A;  1TN4 A;  4Q7R A;  1A75 B;  3DQ2 A;  2NCO A;  3U0K A;  3CR2 A;  5AAN A;  1GQM A;  3CAB A;  5HL1 A;  3JTD B;  1J55 A;  2K60 A;  4P76 A;  1RRO A;  5DKR A;  3TMT A;  4KGF A;  1T14 A;  2H61 C;  2JT8 A;  3R72 A;  5CPV A;  2KPH A;  2K2A A;  2AUC A;  1U5I B;  5DTY A;  3FS7 A;  2E6W A;  3S0E A;  2M3W A;  1B1G A;  1KP5 A;  4IK1 A;  2VAD A;  2K7B A;  4OVN F;  3M24 A;  1XSS A;  4ZF5 A;  3DVJ A;  3EK4 A;  1TCF A;  3EK8 A;  1S6Z A;  2G6X A;  2COL B;  1NX1 A;  4Q04 A;  2MA2 A;  1EH2 A;  2H8V A;  3U8C A;  3B86 A;  4KYN A;  4M2O A;  3LCP C;  2EMN A;  1EG3 A;  5G08 A;  2DUG A;  1K95 A;  4HQ9 A;  3UNW A;  1S26 D;  2EGD A;  1JBA A;  3BJH A;  3VK1 A;  3M22 A;  2JTT A;  3NEZ A;  3SRY A;  1K9U A;  1NX2 A;  2VVJ A;  5DPJ A;  4IK5 A;  1RMP A;  1MXL C;  4EUL A;  3DXL A;  2NZ0 A;  5HYD A;  2QZ0 A;  2M9G A;  2V4E B;  3S0F A;  3LS3 A;  1ZGP A;  1AP4 A;  4EN1 A;  3S0G A;  3AKO A;  3OBV A;  4PE4 A;  1K2H A;  4A4B A;  3IR8 A;  1QAS A;  4DIR A;  3EKJ A;  1UHH A;  3AAJ A;  1QX2 A;  2EMD A;  1XK4 C;  4NDD A;  4Z4K A;  1AJ4 A;  3OX6 A;  4OJ0 A;  1EMG A;  1GGZ A;  2KAV A;  2M97 A;  5IBW A;  2JU0 A;  2M1K B;  5DRF A;  2LAP A;  2A47 A;  4JGE A;  2QLI A;  4ZB1 A;  1TUJ A;  1H4B A;  1UUS A;  1M46 A;  1OMD A;  1XFU O;  1CFF A;  1SK6 D;  2BE6 A;  2K7O A;  4JWQ A;  4ZIN A;  4HRE E;  1GJY A;  2FZU A;  2LAN A;  1CKK A;  3M0W A;  5FI7 A;  4PHK A;  5HBD A;  4W74 A;  2WOR A;  1NWD A;  5HZS A;  1SCM B;  1G4Y R;  1KK8 B;  2RGI A;  4OV2 A;  1RK9 A;  1CNP A;  2D8N A;  3K1E A;  5EL2 A;  4AR7 A;  1IJ6 A;  3HX4 A;  1CB1 A;  4AQJ A;  1TTX A;  3D77 A;  4W7E A;  1YVH A;  3O4X A;  1G7K A;  4OR9 B;  2L4I A;  3AI5 A;  1C7V A;  1WY9 A;  3EVU A;  3OGN A;  2PQL A;  3DQU A;  4ZCV A;  3BOW B;  4FQO A;  4L9M A;  5HGE A;  2AWJ A;  3GB3 A;  1YHH A;  4OHS A;  2JPT A;  4AOM A;  1XVJ A;  1YUR A;  2WCK A;  5FI2 A;  2QEB A;  1QY3 A;  4CFQ A;  4HVF A;  1NPQ A;  2MJW B;  3DZT A;  1CM4 A;  1ZOT B;  3N7H A;  3FE8 A;  1NIW A;  2ZNE A;  2MBX A;  3GJ2 A;  1XO5 A;  1X02 A;  1JSA A;  4HQ8 A;  1OOF A;  1NX0 A;  2WCH A;  5HZU A;  1DJY A;  1R6P A;  2OJK A;  2KQ6 A;  2JZI A;  5AXI A;  3SSL A;  1A03 A;  5B8I B;  2O29 A;  5DPI A;  5BPJ A;  3A4U B;  3SSK A;  1SKT A;  3KEV A;  4PHJ A;  3H1R A;  2ZO7 A;  3SVO A;  1TWO A;  5FVF A;  1YJ2 A;  1N2D A;  1JF0 A;  3CFH A;  2H2K A;  1Q4B A;  3LL8 B;  3EVV A;  4GOB A;  4C0J A;  1RM9 A;  2L2C A;  1EL4 A;  1KCY A;  3AI4 A;  2MRD A;  3SSY A;  1UP5 A;  2H5R A;  2KBI A;  5DPH A;  1IG5 A;  2QU1 A;  2PXW A;  4TNC A;  2WHU A;  3SIB A;  3PN7 B;  2FCD A;  2G5Z B;  4XVP A;  4M2P A;  1OE9 B;  2VVH A;  1LIN A;  2KYF A;  1LA0 A;  1JC2 A;  4LJD A;  1DGV A;  4IK9 A;  2KI4 C;  3OP0 A;  1SL8 A;  1F54 A;  1QX5 B;  4TZA A;  4EMQ A;  1FI5 A;  4DXO A;  2LLT A;  4IK3 A;  2WCF A;  1B47 A;  1L2O C;  1RWY A;  4MEW A;  1OOJ A;  3QME A;  4Q7T A;  4LQU A;  5CSN A;  1HT9 A;  5DTZ A;  4W6N A;  2BNX A;  3LVD A;  1SL7 A;  4Z4M A;  1TCO B;  3RM1 A;  1GGX A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  3NT3 A;  1K8U A;  1ZUX A;  1BLQ A;  3KCT A;  2ZO6 A;  2JTZ A;  1OW4 A;  1MQ1 A;  2KI6 D;  1F4O A;  1CMG A;  1TUZ A;  1Z2C B;  4W72 A;  1Y0V H;  4PCW A;  4BY5 A;  2DDD A;  2LM5 A;  1UHK A;  2OPO A;  1CDN A;  1TNW A;  1PSR A;  3IP2 A;  2QEO A;  3DQ4 A;  2WCB A;  4AQI A;  1FPW A;  1J7R A;  3I5H B;  2HGY A;  4W6S A;  1JUO A;  3SS3 A;  3BUN B;  2JT0 A;  2A56 B;  2PYQ A;  1CFP A;  4WRI A;  3I19 A;  4H3M A;  2DOQ A;  3DQC A;  5EHU A;  3I5G B;  2QAC A;  2KHN A;  3PJB A;  1LVC D;  3CB9 A;  1SPY A;  5DY6 A;  2ZN9 A;  4L1I A;  3ZUJ A;  1PRW A;  1LS8 A;  1IJ5 A;  4PE1 A;  5J3X A;  2BE4 A;  1QIW A;  2H5O A;  3EG5 B;  2DD7 A;  3O78 A;  1OSA A;  4R6B A;  1BG1 A;  1WDC C;  5HZO A;  4F7F A;  4NDC A;  3O6B A;  1QYO A;  5TNC A;  2B3Q A;  1DJZ A;  1OZO A;  4MRX A;  1E8A A;  1J7Q A;  3WLC A;  2WND A;  3E5V A;  4F0Z B;  4UTS A;  1NCZ A;  2H5Q A;  3CTN A;  4RTC A;  2QLH A;  1MWN A;  4N5X A;  3SVE A;  1OOI X;  3ADF A;  2KLE A;  2WHT A;  4IZN A;  2QLE A;  1BOC A;  1K96 A;  1JFK A;  3DQ8 A;  3PIB A;  1TNP A;  2BL0 B;  1DC1 A;  3TZ1 A;  3VHT B;  1ZFS A;  4DS7 A;  2L2E A;  3OSR A;  4I2Y A;  3D74 A;  3SS0 A;  2K7D A;  3GJ1 A;  2Q6P A;  4W7D A;  3BXC A;  2NCP A;  1EG4 A;  5HKY A;  1CFC A;  3DQE A;  4W6K A;  1C7W A;  1DGU A;  3DVE A;  5EXC I;  1GL4 A;  2VRG A;  3B87 A;  4ETO A;  3LF3 A;  4YGA A;  2Q4U A;  3PSR A;  4H3L A;  2H9W A;  4MZL A;  3CGL A;  3SS5 A;  1QX7 A;  3CYZ A;  4P2Y B;  4KPI A;  4W6G A;  4W77 A;  4LJD C;  1JBZ A;  2HQZ A;  3ST3 A;  1ZUZ A;  1XA5 A;  3OB2 B;  1CLM A;  1SY9 A;  4GGN A;  1W7U A;  4PPK A;  3TUY B;  1GFL A;  3V3D A;  1S6J A;  4HRG A;  2A52 B;  1LA3 A;  2QLG A;  4OGS A;  5AQB B;  3U0L A;  1Q4A A;  4LJC A;  4W6F A;  3DD4 A;  4CID A;  4D1E A;  3CBE A;  3ST0 A;  4PHM A;  1YTZ C;  5LTQ A;  4BDU A;  4GF6 B;  1A29 A;  1SCV A;  3BFB A;  2Y0G A;  3DPZ A;  2LE9 B;  2OTG C;  3A8S A;  1WRK A;  3DYE A;  3SIA A;  3WNX B;  3OGO A;  4I5L B;  2KAY A;  2K61 A;  4XJK B;  2L5Y A;  2YDZ A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  4MSP A;  3OX5 A;  3SG5 A;  4XOW A;  2JNF A;  2G2B A;  1FW4 A;  3WXA A;  3CDN A;  1MUX A;  2QDI A;  5CSJ A;  3RZS A;  2VVI A;  4W75 A;  3SG4 A;  4IJ7 A;  3I5G C;  1SYM A;  2MHH A;  2A48 A;  3B6X A;  2DD9 A;  1F70 A;  4XL5 A;  2LMU A;  2FJY A;  3CZ0 A;  1SMG A;  4MBE A;  3B88 A;  3FWC A;  2HF5 A;  3EKH A;  4J8A A;  1W9Z A;  3AKB A;  1NUB A;  2G3O A;  3TMR A;  1OQP A;  4GAO A;  3BYA A;  4KF5 A;  4IK4 A;  2IE2 A;  1S5G Z;  2I7A A;  4HE4 A;  3PJI A;  4RYW A;  4Q9W A;  1Q4E A;  1MHO A;  1MOV A;  4I5J A;  1M31 A;  3H4S E;  2OTE A;  1RFJ A;  2DUH A;  4KAG A;  3I5I C;  1ZGO A;  1N0Y A;  5DKQ A;  2HET A;  4FQT A;  1UWO A;  2KBM A;  2YE1 A;  5ER4 X;  5HKZ A;  3TUY C;  1DMO A;  3E5T A;  4OY4 A;  1RRX A;  3U0N A;  2WC8 A;  2JWW A;  2M1U A;  2KFH A;  1XA9 A;  3PN7 C;  3R1O A;  1J1E A;  3SG6 A;  4ZF3 A;  1J7O A;  3SVS A;  2FCE A;  5EJU A;  3TDI A;  2QLG B;  1DTL A;  1Y1X A;  3W1D A;  1TIZ A;  1OOG A;  2OTG B;  3A8R A;  1H4U A;  1XFR A;  1BU3 A;  2RH7 A;  2ICR A;  2ZN8 A;  4PFE A;  3L4L A;  3DPW A;  2LNK A;  3GK1 A;  5DRG A;  2G3D B;  3VB1 A;  1XMZ A;  5JJG A;  3ED8 A;  2HPW A;  4JF9 A;  4XGY A;  3RWT A;  3SG2 A;  2QEV A;  3LVA A;  3PJ5 A;  1OXD A;  4KW8 A;  2JT3 A;  2BL0 C;  4XJK A;  2KI6 C;  4YGC B;  1MYW A;  4GGF C;  2Y5I A;  3VIC A;  1QLS A;  2L51 A;  2FWQ A;  3DF0 B;  1MOU A;  2M8U A;  4ORA B;  1EMK A;  3DQD A;  1TRF A;  3PM8 A;  2M49 B;  1EMB A;  3PJ7 A;  3BUO B;  2F3Z A;  1RJV A;  1REC A;  1WRZ A;  5J2O A;  3TDZ A;  2Z6X A;  1AHR A;  3GK2 A;  2K0J A;  1IH0 A;  2LUX A;  1WRL A;  1H6R A;  4YGD B;  5CSF A;  5EBJ A;  2A46 A;  2M7N A;  4DXI A;  4QJ5 B;  4OCI A;  2MLF C;  3BUM B;  3FE6 A;  2I94 A;  3V2L A;  4GUK A;  3TS5 C;  1Y6W A;  1B9A A;  5AEQ A;  3IF7 A;  1G8I A;  2BKH B;  2H6V A;  4LQT A;  1QLK A;  2E30 A;  2P6B B;  4WQ3 A;  2JXC A;  2ZRS A;  1ALV A;  1N65 A;  1M63 B;  1Z1P A;  2LLU A;  3I5F C;  4EDS A;  1EJ3 A;  2KQY A;  3DQK A;  4DUQ A;  1XFW O;  3GL4 A;  5FVG A;  2EC6 B;  3VRO A;  1KK8 C;  2ZMW A;  3CZ2 A;  1W7T A;  1XFX O;  2B1U A;  2BBN A;  1QIV A;  1RTP 1;  4W69 A;  5H89 A;  3FWB A;  4EDO A;  1FF1 A;  3VHT A;  2O24 A;  2BTJ A;  1KQM C;  3KPX A;  3O2P A;  1XQM A;  3BOW A;  2LLS A;  5LTP A;  2AH8 A;  1KQM B;  5BQL A;  1KK7 Z;  3LK0 A;  2KNE A;  2AWL A;  1SR6 B;  2WIS A;  4FTG A;  4U2V A;  2OKY A;  2HRS A;  1F71 A;  1M45 A;  1W7J B;  2BEC A;  2LV7 A;  5I8N A;  3CFF A;  2L50 A;  1CTR A;  5DTX A;  2P70 A;  5D3O A;  5H87 A;  1SCM C;  5F6T A;  4DXN A;  3H1O A;  3BQ3 A;  3NSI A;  4N1G A;  3VRR A;  5BTT B;  1KFU L;  3BXB A;  2Q91 A;  2QPT A;  4IL1 A;  2F2P A;  1CLB A;  2WIQ A;  2GGZ A;  3DVM A;  3ICB A;  1YHI A;  3IVT A;  1OOH A;  3DY9 A;  1V1F A;  4JEO A;  1B8R A;  3CS1 A;  3BFA A;  1SNL A;  1SBJ A;  4JQ0 D;  3IQQ A;  3Q8I A;  1NCY A;  4N3D A;  1YUU A;  2V53 A;  3SV5 A;  1K9P A;  1KYR A;  2IS9 A;  4W7C A;  1UUR A;  4DXP A;  2WHS A;  3CFA A;  2PSR A;  2ZFD A;  5D7F A;  3DQO A;  4W6D A;  1IWQ A;  1S3P A;  3MGF A;  3EVR A;  3JVT B;  4ORC B;  1TOP A;  2A53 B;  1B9C A;  1YFP A;  1M39 A;  3AAK A;  1Z4H A;  3CGA A;  3VGO A;  2IOV A;  1EMA A;  4C0K A;  3EVP A;  4DRW A;  4KW4 A;  2Z6Y A;  4U8D A;  1C07 A;  2IB5 A;  2LMT A;  3L47 A;  3VRQ A;  3SVR A;  1EMM A;  4IK8 A;  5DPG A;  3PM2 A;  2LMV A;  4E68 A;  1ZGQ A;  5DIC A;  3P8U A;  1D1O A;  2EHB A;  3SVC A;  3CZ1 A;  1PK0 D;  4KW9 A;  5F9G A;  1B8L A;  2ERB A;  4MVF A;  1DJW A;  4W6M A;  1TNX A;  3O77 A;  2L0P A;  4GFT A;  2B3P A;  2F3Y A;  1AVS A;  2F8P A;  4W6C A;  3DQA A;  3TDU A;  3NF0 A;  3NGV A;  3RLZ A;  2HPS A;  1OZS A;  3JVT C;  2FOT A;  2L98 A;  3LA1 A;  4ZF4 A;  4WQ2 A;  1KYP A;  1FI6 A;  4W7X A;  3S0D A;  1QV0 A;  3DQF A;  1C4F A;  4W6O A;  3BXK A;  2Y4Q A;  3GK4 X;  2F2O A;  4MLW A;  2KDH A;  1YZW A;  1EXR A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3DQL A;  3ST4 A;  1EME A;  2ZRT A;  2HFC A;  2HCG A;  4TZG A;  2I18 A;  4PT1 A;  4PPJ A;  2POX A;  2A50 B;  2LHL A;  1WLM A;  3D78 A;  1HUY A;  1DJG A;  1S1E A;  1C3Y A;  2CXJ A;  3LF4 B;  2KGR A;  1XFY O;  3SSV A;  1WDC B;  4JFG A;  3HCM A;  2HQ8 A;  2GTE A;  1FBV A;  3DQN A;  2HQK A;  3UG0 A;  3NED A;  1AJ5 A;  1QVI Y;  3F45 A;  4JPZ B;  4DKM A;  4W6A A;  1EMF A;  2WCJ A;  4INX A;  4YBH B;  2L5X B;  4H48 A;  5HLO A;  2JAD A;  1YUT A;  2O5G A;  4W76 A;  2GW4 B;  2BCX A;  5AFP A;  1SW8 A;  1XYD A;  2LP2 A;  3FIA A;  2V4E A;  1PAL A;  1QV1 A;  2H61 A;  2HJO A;  4GBA A;  4KA9 A;  1YHG A;  4CPV A;  3C1V A;  1SSE B;  2H8Q A;  3U8P A;  2G2S B;  2QEH A;  2V4E C;  1DJH A;  2CNP A;  2Y1M A;  4PPL A;  3CD1 A;  1BFP A;  2M0R A;  1QAT A;  4R6D A;  1K93 D;  3SS4 A;  1ZMZ A;  2SCP A;  1P28 A;  3SG7 A;  2WOS A;  2SAS A;  1QYQ A;  1A75 A;  2JNX A;  4HSZ A;  3BXA A;  2LVI A;  3WHT B;  2FL1 A;  3K1K A;  3CZT X;  3NSO A;  3R1V A;  4W7A A;  3WCK A;  1Q80 A;  2O2B A;  3E3R A;  4GNK B;  1R2U A;  4JRB A;  2JPO A;  4W6P A;  3DQM A;  5CSI A;  1L7Z A;  3WHU B;  1IRJ A;  2LUC A;  2JXL A;  1K9K A;  2JUL A;  2DUE A;  3LLE A;  4GGF A;  4XOV A; 
#chains in the Genus database with same CATH homology
 2KI4 B;  3VRN A;  1B4C A;  1KWO C;  1NYA A;  1DJX A;  1EML A;  3I5H C;  4W6B A;  1J7P A;  1QVI Z;  1ALW A;  5KTG A;  2QT2 A;  3D0Y A;  1U5I A;  4DCK A;  3RWA A;  2LVJ A;  5I2O A;  4JC2 A;  2KOT A;  2VAE A;  5DQB A;  1DVI A;  2CCM A;  1HCJ A;  2TN4 A;  1S6C A;  5H88 A;  2KFF A;  1SR6 C;  1NP8 A;  3DF0 A;  2KGB C;  1YX7 A;  1NSH A;  2EC6 C;  4W6R A;  2HQW A;  1XAE A;  3BUX B;  1QTX A;  1SRA A;  2GW3 A;  4B30 A;  3SSH A;  5BT0 A;  5I2Q A;  1Q4C A;  4W73 A;  3SST A;  1MR8 A;  2OGR A;  4LJB A;  4W7F A;  5GQQ C;  4KGE A;  3DQH A;  3LSA A;  1OMV A;  5FHV A;  2BCB A;  4ZCU A;  3DQJ A;  5HLV A;  1L2O B;  3OB1 B;  1KFU S;  4DXM A;  2PVB A;  5K89 A;  1CLL A;  1JF2 A;  1JFJ A;  4DKN A;  1DT7 B;  1JC0 A;  1XK4 A;  4KF4 A;  3MSE B;  1YR5 A;  1B8C A;  2QRF A;  1S5G Y;  2IB6 A;  2WCE A;  2YE0 A;  1YJF A;  5T3I A;  4ICB A;  1CDL A;  2LCP A;  4ZIO A;  3LVC A;  3SVD A;  3O4Y A;  1QXP A;  2GX0 A;  1V1G A;  4QJ4 B;  4W6L A;  2G6E A;  1YX8 A;  1J1D A;  4MZJ A;  4ORB B;  2M7L A;  1KK7 Y;  3SG3 A;  1KSM A;  1BMO A;  1BOD A;  3PFV A;  1Y1U A;  1UHJ A;  1YRU B;  1BJF A;  1QJT A;  2WSN A;  1ODB A;  3ZNI A;  5DTL A;  2JQ6 A;  5EXU A;  1CMF A;  3S05 A;  3CLN A;  4YI8 A;  3SVB A;  1CDM A;  3WLD A;  2F33 A;  3OHM B;  3UFZ A;  5HW9 A;  4W6J A;  4B30 B;  2AAO A;  3DQ9 A;  2ZMU A;  2AWK A;  3DQ5 A;  3SVU A;  5LK4 A;  3NT9 A;  1K90 D;  3D0Y B;  2G6Y A;  1MXE A;  4W6U A;  3KHE A;  1JWD A;  4P1Q A;  2OKW A;  3GEX A;  2Y1N A;  2H5P A;  2GV5 A;  1IQ3 A;  2BCA A;  4PE0 A;  1S36 A;  4CFR A;  5FVI A;  1DF0 A;  1QYF A;  3E5W A;  2K7C A;  1F8H A;  1RMM A;  1DF0 B;  2JRF A;  1TNQ A;  3CD9 A;  2P4M A;  2PAL A;  4I5N B;  1XFV O;  1NX3 A;  2KYC A;  1S6I A;  2AMI A;  4P5O E;  4ZFS A;  1OXF A;  5HZT A;  2R2I A;  2JC2 A;  1NCX A;  1Q4D A;  1PSB A;  3KF9 A;  3OSQ A;  2L4H A;  4N1F A;  3G9A A;  2KSP A;  4Q7U A;  4I5K A;  4OQW A;  4C0L A;  4ORN A;  4A4C A;  3ZTF A;  2Q57 A;  2BBM A;  3IQO A;  3ZUF A;  4YGE B;  1SL9 A;  5EXB A;  3K21 A;  5ER5 A;  4Q9X A;  2LHI A;  2OS8 C;  1CV7 A;  3DQ7 A;  2AWM A;  2CT9 A;  3CWG A;  1PVB A;  3KCS A;  1VRK A;  3CR4 X;  2ZND A;  4ZBL A;  1HQV A;  3SJS A;  3I5I B;  1W7I B;  2PRU A;  1QS7 A;  4DXQ A;  4RYS A;  2MAZ A;  5HKW A;  5AER A;  2LVV A;  1B7T Y;  2VZX A;  2NLN A;  5EB7 A;  5PAL A;  2GX2 A;  5KU1 A;  3CR5 X;  3LK1 A;  1RMO A;  1QXT A;  4AS8 A;  3PAT A;  2C9J A;  2FJU B;  2BKI B;  4L12 A;  4HQC A;  1YVL A;  2DUI A;  3BX9 A;  4GES B;  2C9I A;  2LVK A;  3DVK A;  5JOL A;  1OMR A;  1F55 A;  4W7R A;  4W6T A;  4PDZ A;  1H8B A;  1LXF C;  2DUF A;  1CM1 A;  3D10 A;  2NXQ A;  1UHI A;  5KSZ A;  3U0M A;  1K94 A;  1AK8 A;  4W6I A;  1BF5 A;  1KFX L;  2KFG A;  1UHN A;  4NDB A;  3W1C A;  2KAX A;  5D69 A;  5KTY A;  1Y1A A;  2PXS A;  4L13 A;  5BTT A;  5I2L A;  2LC5 A;  2Z1O A;  4HRH A;  4LW5 A;  2G16 B;  1F09 A;  4YRU A;  1IQ5 A;  3TS5 B;  4MN0 A;  3DPX A;  1KQV A;  1IKU A;  3ST2 A;  4H3N A;  1G33 A;  5DU0 A;  4NQG A;  4YGB B;  1Q73 A;  2DDC A;  4BY4 A;  2WSO A;  1PVA A;  1CDP A;  1DJI A;  4J88 A;  2ZKM X;  2O60 A;  2EMO A;  1EMC A;  5EB6 A;  2PAS A;  2MLE C;  5DQM A;  4USL A;  4ANJ A;  1KSO A;  1JBY A;  2LP3 A;  4QJ3 B;  3DQ1 A;  3NSK A;  4OKH A;  1JC1 A;  3DQ6 A;  3ZUL A;  1GGW A;  2OS8 B;  4KF5 C;  3KO0 A;  2CTN A;  1A4P A;  1OXE A;  4XYN A;  2HGD A;  3SVN A;  3PAL A;  3P28 A;  1YRT B;  2M29 A;  3EK7 A;  2YFP A;  3DQ3 A;  3PLF B;  4YI9 A;  4KEX A;  2ARL A;  3BUW B;  4W6H A;  3QRX A;  3I5F B;  1UIS A;  2A4J A;  4M2Q A;  2ISD A;  4PE7 A;  4J89 A;  3SSP A;  3U8A A;  1MF8 B;  3GOF A;  5DKN A;  1BT6 A;  5FYX A;  5LTR A;  1W7S A;  3AKA A;  3JTD C;  2A54 B;  4H47 A;  3NSL A;  2WUR A;  1KYS A;  2OTB A;  2GGM A;  2Z6Z A;  1A2X A;  3ZWH A;  2AHA A;  4B5Y A;  4UPG A;  1CFD A;  1KFX S;  3NXA A;  3VRP A;  4NWS A;  4PAL A;  3DQI A;  2JOJ A;  1F4Q A;  1BR4 B;  1Z1Q A;  2CBL A;  1PUL A;  1ZAC A;  1F0B A;  1YUS A;  1WLZ A;  1IGV A;  1BR1 B;  1XFZ O;  4PHN A;  4MRY A;  2K2F A;  1TN4 A;  4Q7R A;  1A75 B;  3DQ2 A;  2NCO A;  3U0K A;  3CR2 A;  5AAN A;  1GQM A;  3JTD B;  1J55 A;  4P76 A;  1RRO A;  5DKR A;  3TMT A;  4KGF A;  2H61 C;  2JT8 A;  5CPV A;  2K2A A;  2AUC A;  1U5I B;  5DTY A;  3FS7 A;  2E6W A;  2M3W A;  1B1G A;  1KP5 A;  4IK1 A;  2VAD A;  2K7B A;  4OVN F;  3M24 A;  1XSS A;  4ZF5 A;  3DVJ A;  3EK4 A;  1TCF A;  3EK8 A;  1S6Z A;  2G6X A;  2COL B;  1NX1 A;  4Q04 A;  2MA2 A;  1EH2 A;  3U8C A;  4M2O A;  3LCP C;  2EMN A;  1EG3 A;  5G08 A;  2DUG A;  1K95 A;  4HQ9 A;  1S26 D;  2EGD A;  1JBA A;  3VK1 A;  3M22 A;  2JTT A;  3NEZ A;  3SRY A;  1K9U A;  1NX2 A;  2VVJ A;  5DPJ A;  4IK5 A;  1RMP A;  1MXL C;  4EUL A;  2NZ0 A;  5HYD A;  2QZ0 A;  2M9G A;  2V4E B;  3LS3 A;  1ZGP A;  1AP4 A;  4EN1 A;  3AKO A;  4PE4 A;  1K2H A;  4A4B A;  3IR8 A;  1QAS A;  4DIR A;  3EKJ A;  1UHH A;  3AAJ A;  1QX2 A;  2EMD A;  1XK4 C;  4NDD A;  4Z4K A;  1AJ4 A;  3OX6 A;  4OJ0 A;  1EMG A;  1GGZ A;  2KAV A;  2M97 A;  5IBW A;  2JU0 A;  2M1K B;  5DRF A;  2LAP A;  2A47 A;  4JGE A;  2QLI A;  4ZB1 A;  1H4B A;  1UUS A;  1M46 A;  1OMD A;  1XFU O;  1CFF A;  1SK6 D;  2BE6 A;  2K7O A;  4JWQ A;  4ZIN A;  4HRE E;  1GJY A;  2FZU A;  2LAN A;  1CKK A;  3M0W A;  4PHK A;  5HBD A;  4W74 A;  2WOR A;  1NWD A;  5HZS A;  1SCM B;  1G4Y R;  1KK8 B;  2RGI A;  4OV2 A;  1RK9 A;  1CNP A;  2D8N A;  4AR7 A;  1IJ6 A;  3HX4 A;  1CB1 A;  4AQJ A;  1TTX A;  4W7E A;  1YVH A;  1G7K A;  4OR9 B;  2L4I A;  3AI5 A;  1C7V A;  1WY9 A;  3EVU A;  3DQU A;  4ZCV A;  3BOW B;  4FQO A;  5HGE A;  4L9M A;  2AWJ A;  3GB3 A;  1YHH A;  4OHS A;  2JPT A;  4AOM A;  1XVJ A;  1YUR A;  1QY3 A;  4CFQ A;  4HVF A;  1NPQ A;  2MJW B;  1CM4 A;  1ZOT B;  1NIW A;  2ZNE A;  2MBX A;  3GJ2 A;  1XO5 A;  1X02 A;  1JSA A;  4HQ8 A;  1NX0 A;  5HZU A;  1DJY A;  1R6P A;  2OJK A;  2KQ6 A;  2JZI A;  5AXI A;  3SSL A;  1A03 A;  5B8I B;  2O29 A;  5DPI A;  5BPJ A;  3A4U B;  3SSK A;  1SKT A;  3KEV A;  4PHJ A;  3H1R A;  2ZO7 A;  3SVO A;  5FVF A;  1YJ2 A;  1N2D A;  1JF0 A;  3CFH A;  2H2K A;  1Q4B A;  3LL8 B;  3EVV A;  4GOB A;  4C0J A;  1RM9 A;  1KCY A;  1EL4 A;  2MRD A;  3AI4 A;  3SSY A;  1UP5 A;  2H5R A;  2KBI A;  5DPH A;  1IG5 A;  2QU1 A;  2PXW A;  4TNC A;  2WHU A;  3SIB A;  3PN7 B;  2FCD A;  2G5Z B;  4XVP A;  4M2P A;  1OE9 B;  2VVH A;  1LIN A;  2KYF A;  1LA0 A;  1JC2 A;  4LJD A;  1DGV A;  4IK9 A;  2KI4 C;  3OP0 A;  1SL8 A;  1F54 A;  1QX5 B;  4TZA A;  4EMQ A;  1FI5 A;  4DXO A;  2LLT A;  4IK3 A;  2WCF A;  1B47 A;  1L2O C;  1RWY A;  4MEW A;  1OOJ A;  4Q7T A;  4LQU A;  5CSN A;  1HT9 A;  5DTZ A;  4W6N A;  3LVD A;  1SL7 A;  4Z4M A;  1TCO B;  3RM1 A;  1GGX A;  2K8M B;  4MZK A;  4R1E A;  4CLN A;  3NT3 A;  1K8U A;  1ZUX A;  1BLQ A;  3KCT A;  2ZO6 A;  2JTZ A;  1MQ1 A;  2KI6 D;  1F4O A;  1CMG A;  4W72 A;  1Y0V H;  4PCW A;  4BY5 A;  2DDD A;  2LM5 A;  1UHK A;  2OPO A;  1CDN A;  1TNW A;  1PSR A;  3IP2 A;  3DQ4 A;  2WCB A;  4AQI A;  1FPW A;  1J7R A;  3I5H B;  2HGY A;  4W6S A;  1JUO A;  3BUN B;  2JT0 A;  2A56 B;  1CFP A;  4WRI A;  3I19 A;  4H3M A;  2DOQ A;  3DQC A;  5EHU A;  3I5G B;  2QAC A;  2KHN A;  3PJB A;  1LVC D;  3CB9 A;  1SPY A;  5DY6 A;  2ZN9 A;  4L1I A;  3ZUJ A;  1PRW A;  1IJ5 A;  4PE1 A;  5J3X A;  2BE4 A;  1QIW A;  2H5O A;  2DD7 A;  3O78 A;  1OSA A;  4R6B A;  1BG1 A;  1WDC C;  5HZO A;  4NDC A;  3O6B A;  1QYO A;  5TNC A;  2B3Q A;  1DJZ A;  1OZO A;  4MRX A;  1E8A A;  1J7Q A;  3WLC A;  2WND A;  3E5V A;  4F0Z B;  4UTS A;  1NCZ A;  2H5Q A;  3CTN A;  4RTC A;  2QLH A;  1MWN A;  4N5X A;  3SVE A;  3ADF A;  2WHT A;  4IZN A;  2QLE A;  1BOC A;  1K96 A;  1JFK A;  3DQ8 A;  3PIB A;  1TNP A;  2BL0 B;  3TZ1 A;  3VHT B;  1ZFS A;  4DS7 A;  2L2E A;  3OSR A;  4I2Y A;  3SS0 A;  2K7D A;  3GJ1 A;  2Q6P A;  4W7D A;  3BXC A;  2NCP A;  1EG4 A;  5HKY A;  1CFC A;  3DQE A;  4W6K A;  1C7W A;  1DGU A;  3DVE A;  5EXC I;  1GL4 A;  2VRG A;  4ETO A;  3LF3 A;  4YGA A;  2Q4U A;  3PSR A;  4H3L A;  2H9W A;  4MZL A;  3CGL A;  1QX7 A;  4P2Y B;  4KPI A;  4W6G A;  4W77 A;  4LJD C;  1JBZ A;  2HQZ A;  3ST3 A;  1ZUZ A;  1XA5 A;  3OB2 B;  1CLM A;  1SY9 A;  4GGN A;  1W7U A;  3TUY B;  1GFL A;  4PPK A;  3V3D A;  1S6J A;  4HRG A;  2A52 B;  1LA3 A;  2QLG A;  4OGS A;  5AQB B;  3U0L A;  1Q4A A;  4LJC A;  4W6F A;  3DD4 A;  4CID A;  4D1E A;  3CBE A;  3ST0 A;  4PHM A;  1YTZ C;  5LTQ A;  4BDU A;  4GF6 B;  1A29 A;  1SCV A;  2Y0G A;  3DPZ A;  2LE9 B;  2OTG C;  3A8S A;  1WRK A;  3SIA A;  3WNX B;  3OGO A;  4I5L B;  2KAY A;  2K61 A;  4XJK B;  2YDZ A;  4GPL B;  1KWO B;  2PMY A;  2G9B A;  4MSP A;  3OX5 A;  3SG5 A;  4XOW A;  2JNF A;  2G2B A;  1FW4 A;  3WXA A;  1MUX A;  5CSJ A;  2VVI A;  4W75 A;  3SG4 A;  3I5G C;  1SYM A;  2MHH A;  2A48 A;  2DD9 A;  1F70 A;  4XL5 A;  2LMU A;  1SMG A;  4MBE A;  3FWC A;  2HF5 A;  3EKH A;  4J8A A;  3AKB A;  1NUB A;  2G3O A;  3TMR A;  1OQP A;  4GAO A;  3BYA A;  4KF5 A;  4IK4 A;  2IE2 A;  1S5G Z;  2I7A A;  4HE4 A;  4RYW A;  4Q9W A;  1Q4E A;  1MHO A;  1MOV A;  4I5J A;  1M31 A;  3H4S E;  2OTE A;  1RFJ A;  2DUH A;  4KAG A;  3I5I C;  1ZGO A;  1N0Y A;  5DKQ A;  2HET A;  1UWO A;  2KBM A;  2YE1 A;  5ER4 X;  5HKZ A;  3TUY C;  1DMO A;  3E5T A;  4OY4 A;  1RRX A;  3U0N A;  2WC8 A;  2JWW A;  2M1U A;  2KFH A;  1XA9 A;  3PN7 C;  1J1E A;  3SG6 A;  4ZF3 A;  1J7O A;  3SVS A;  2FCE A;  5EJU A;  3TDI A;  3W1D A;  2QLG B;  1DTL A;  1Y1X A;  1TIZ A;  2OTG B;  3A8R A;  1H4U A;  1BU3 A;  2RH7 A;  2ICR A;  2ZN8 A;  4PFE A;  3DPW A;  2LNK A;  5DRG A;  3GK1 A;  2G3D B;  1XMZ A;  5JJG A;  3ED8 A;  2HPW A;  4JF9 A;  4XGY A;  3RWT A;  3SG2 A;  3LVA A;  3PJ5 A;  1OXD A;  4KW8 A;  2JT3 A;  2BL0 C;  4XJK A;  2KI6 C;  4YGC B;  1MYW A;  4GGF C;  2Y5I A;  3VIC A;  1QLS A;  2L51 A;  2FWQ A;  3DF0 B;  1MOU A;  2M8U A;  4ORA B;  1EMK A;  3DQD A;  1TRF A;  3PM8 A;  2M49 B;  1EMB A;  3PJ7 A;  3BUO B;  2F3Z A;  1RJV A;  1REC A;  1WRZ A;  5J2O A;  3TDZ A;  2Z6X A;  1AHR A;  3GK2 A;  2K0J A;  1IH0 A;  2LUX A;  1WRL A;  1H6R A;  4YGD B;  5CSF A;  5EBJ A;  2A46 A;  2M7N A;  4DXI A;  4QJ5 B;  4OCI A;  2MLF C;  3BUM B;  2I94 A;  4GUK A;  3TS5 C;  1Y6W A;  1B9A A;  5AEQ A;  3IF7 A;  1G8I A;  2BKH B;  2H6V A;  4LQT A;  1QLK A;  2E30 A;  2P6B B;  4WQ3 A;  2JXC A;  2ZRS A;  1ALV A;  1N65 A;  1M63 B;  1Z1P A;  2LLU A;  3I5F C;  4EDS A;  1EJ3 A;  2KQY A;  3DQK A;  4DUQ A;  1XFW O;  3GL4 A;  5FVG A;  2EC6 B;  3VRO A;  1KK8 C;  2ZMW A;  1W7T A;  1XFX O;  2B1U A;  2BBN A;  1QIV A;  1RTP 1;  4W69 A;  5H89 A;  3FWB A;  4EDO A;  1FF1 A;  3VHT A;  2O24 A;  2BTJ A;  1KQM C;  3KPX A;  3O2P A;  1XQM A;  3BOW A;  2LLS A;  5LTP A;  2AH8 A;  1KQM B;  5BQL A;  1KK7 Z;  3LK0 A;  2KNE A;  2AWL A;  1SR6 B;  2WIS A;  4FTG A;  4U2V A;  2OKY A;  2HRS A;  1F71 A;  1M45 A;  1W7J B;  2BEC A;  2LV7 A;  5I8N A;  3CFF A;  2L50 A;  1CTR A;  5DTX A;  5H87 A;  1SCM C;  5F6T A;  4DXN A;  3H1O A;  3BQ3 A;  3NSI A;  4N1G A;  3VRR A;  5BTT B;  1KFU L;  3BXB A;  2Q91 A;  2QPT A;  4IL1 A;  2F2P A;  1CLB A;  2WIQ A;  2GGZ A;  3DVM A;  3ICB A;  1YHI A;  1V1F A;  4JEO A;  1B8R A;  3CS1 A;  1SNL A;  1SBJ A;  4JQ0 D;  3IQQ A;  1NCY A;  4N3D A;  1YUU A;  2V53 A;  3SV5 A;  1K9P A;  1KYR A;  2IS9 A;  4W7C A;  1UUR A;  4DXP A;  2WHS A;  3CFA A;  2PSR A;  2ZFD A;  5D7F A;  3DQO A;  4W6D A;  1IWQ A;  1S3P A;  3MGF A;  3EVR A;  3JVT B;  4ORC B;  1TOP A;  2A53 B;  1B9C A;  1YFP A;  1M39 A;  3AAK A;  3CGA A;  3VGO A;  2IOV A;  1EMA A;  4C0K A;  3EVP A;  4DRW A;  4KW4 A;  2Z6Y A;  4U8D A;  1C07 A;  2IB5 A;  2LMT A;  3VRQ A;  3SVR A;  1EMM A;  4IK8 A;  5DPG A;  2LMV A;  4E68 A;  1ZGQ A;  3P8U A;  1D1O A;  2EHB A;  3SVC A;  1PK0 D;  4KW9 A;  5F9G A;  1B8L A;  4MVF A;  1DJW A;  4W6M A;  1TNX A;  3O77 A;  2L0P A;  4GFT A;  2B3P A;  2F3Y A;  1AVS A;  2F8P A;  4W6C A;  3DQA A;  3TDU A;  3NF0 A;  3RLZ A;  2HPS A;  1OZS A;  3JVT C;  2FOT A;  2L98 A;  4ZF4 A;  3LA1 A;  4WQ2 A;  1KYP A;  1FI6 A;  4W7X A;  1QV0 A;  3DQF A;  1C4F A;  4W6O A;  3BXK A;  2Y4Q A;  3GK4 X;  2F2O A;  4MLW A;  2KDH A;  1YZW A;  1EXR A;  1B7T Z;  1LKJ A;  2I2R E;  1AUI B;  3DQL A;  3ST4 A;  1EME A;  2ZRT A;  2HFC A;  2HCG A;  4TZG A;  2I18 A;  4PPJ A;  2POX A;  2A50 B;  2LHL A;  1WLM A;  1HUY A;  1DJG A;  1S1E A;  2CXJ A;  3LF4 B;  2KGR A;  1XFY O;  3SSV A;  1WDC B;  4JFG A;  3HCM A;  2HQ8 A;  1FBV A;  3DQN A;  2HQK A;  3UG0 A;  3NED A;  1AJ5 A;  1QVI Y;  3F45 A;  4JPZ B;  4DKM A;  4W6A A;  1EMF A;  4YBH B;  2L5X B;  4H48 A;  5HLO A;  2JAD A;  1YUT A;  2O5G A;  4W76 A;  2GW4 B;  2BCX A;  5AFP A;  1SW8 A;  1XYD A;  2LP2 A;  3FIA A;  2V4E A;  1PAL A;  1QV1 A;  2H61 A;  2HJO A;  4GBA A;  4KA9 A;  1YHG A;  4CPV A;  3C1V A;  2H8Q A;  3U8P A;  2G2S B;  2V4E C;  1DJH A;  2CNP A;  2Y1M A;  4PPL A;  3CD1 A;  1BFP A;  2M0R A;  1QAT A;  4R6D A;  1K93 D;  1ZMZ A;  2SCP A;  3SG7 A;  2WOS A;  2SAS A;  1QYQ A;  1A75 A;  2JNX A;  4HSZ A;  3BXA A;  2LVI A;  3WHT B;  2FL1 A;  3K1K A;  3CZT X;  3NSO A;  4W7A A;  3WCK A;  1Q80 A;  2O2B A;  3E3R A;  4GNK B;  1R2U A;  4JRB A;  4W6P A;  3DQM A;  5CSI A;  1L7Z A;  3WHU B;  1IRJ A;  2LUC A;  2JXL A;  1K9K A;  2JUL A;  2DUE A;  3LLE A;  4GGF A;  4XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...