3SG5A

Crystal structure of dimeric gcamp3-d380y, qp(linker 1), lp(linker 2)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
409
structure length
387
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSQPNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMADSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 124
structure length 387
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg5A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg5A01
4JC2A 2ZRSA 4AQIA 2TN4A 2K2AA 3SG4A 4BY4A 2BE4A 3CD9A 1B8RA 4ORNA 1XFVO 4PFEA 4JRBA 2HQWA 1NX3A 1OXDA 2M9GA 1UHHA 2I18A 2A4JA 5D7FA 1K2HA 1XVJA 3DQEA 1QJTA 3LLEA 2ZFDA 2ZO6A 4R1EA 4PHMA 4J88A 2OGRA 3ST0A 1S5GY 1Z1PA 3BUWB 3D0YB 1DGUA 1NYAA 2OKYA 2GV5A 4W6UA 3DQFA 3EVPA 2KAVA 4MN0A 1YRUB 2PVBA 2AWJA 1UUSA 2V53A 2GX2A 3U0LA 2HGDA 3CS1A 3KO0A 2Y4QA 3I5GB 2I7AA 1SW8A 4HVFA 2VVHA 1Z1QA 4B5YA 3A8SA 3BXCA 2B1UA 5EJUA 3OSRA 5LTQA 1SR6B 4MZJA 4LJBA 2F3YA 1F8HA 1B9CA 2HGYA 4JGEA 3H4SE 4DS7A 4W6FA 1XFYO 1ZOTB 3ZNIA 3E5WA 1K93D 1Q4CA 4YI8A 2GGZA 4U8DA 3O6BA 1Q4DA 2Q91A 2A52B 1WDCC 1S6IA 1OZSA 3PIBA 2KFHA 1PSRA 2VZXA 3DVKA 1W7JB 2RH7A 3SIBA 1L7ZA 2G9BA 4HE4A 1SCMC 1J55A 1KQVA 2DOQA 4W6MA 5DPHA 1CDLA 2FCDA 1XFZO 3LS3A 1YURA 2WHUA 1CDNA 2A54B 3SSHA 3I5HB 2NZ0A 2GW4B 1ZACA 1GFLA 1QASA 4Q9XA 2G3OA 2JXCA 2PMYA 1W7IB 3U0MA 2LMVA 3EK4A 3DQOA 1L2OC 1QV1A 1IQ3A 3BXBA 4TZGA 5BQLA 3SVNA 2QLHA 1IJ6A 4EDOA 1QX5B 5DPJA 2EGDA 3NT9A 1GL4A 1M31A 1BJFA 1K94A 2M7LA 2OTBA 4MZLA 2WISA 5DKQA 4P5OE 4ORCB 3CWGA 3NT3A 4W6KA 1EMAA 1J7OA 2QZ0A 2JQ6A 1S1EA 1UHJA 1EMLA 3VRNA 2BL0B 1EMMA 1GGWA 2DUGA 1YVHA 4JFGA 3O4YA 3DF0B 1EL4A 1OE9B 2QLEA 4HRGA 1DTLA 1V1GA 1NPQA 1DJXA 4UPGA 4ZF4A 4KGFA 2HQ8A 2SCPA 4W6SA 4RYWA 4CFQA 3PJ5A 3AKBA 2IB5A 4KAGA 4B30B 1Q4BA 3OHMB 2H8QA 5G08A 2WCEA 3U8PA 2QPTA 2K7BA 1SL7A 1XFUO 2I2RE 4C0LA 1G8IA 3EKHA 2F8PA 3DQAA 2BKHB 3SSLA 1UWOA 4Q9WA 1TNQA 2ZO7A 3IF7A 3CFFA 2KGBC 4N1GA 5T3IA 2CXJA 2KQ6A 4AQJA 3PJBA 4GPLB 2JT8A 4PHNA 3GJ1A 1YR5A 3CTNA 1Y0VH 4W6RA 1QVIZ 1CKKA 4P1QA 2O24A 2COLB 2DUFA 3NSKA 2M29A 4CIDA 3VK1A 5DTZA 2HCGA 3DQ4A 3P28A 3LSAA 3IQQA 4XJKB 1CM4A 1NCZA 2HQKA 4GESB 3QRXA 1XA9A 2F2OA 4XOWA 4MBEA 2H6VA 3AAKA 3DQ2A 2FJUB 3W1CA 5B8IB 2ARLA 3E3RA 2KYFA 2A56B 2HETA 1CLMA 4WQ2A 2Y1MA 1OMVA 2JXLA 2JT3A 1MHOA 2WIQA 1WRLA 3E5VA 1K96A 4ZB1A 3U0NA 2AWKA 2VAEA 4R6DA 3BX9A 1B9AA 2BCAA 3ICBA 2LC5A 4CPVA 3DPWA 1MOUA 4M2QA 1Q4EA 3ED8A 1B47A 2BCBA 4W7DA 1EMCA 2LHIA 3W1DA 3OX6A 3GEXA 4LW5A 1F09A 2EMNA 4C0KA 2WSNA 3WHUB 1FPWA 5CPVA 2KI6C 1MYWA 1DJHA 1KCYA 2G6EA 3MSEB 1OOJA 2L50A 4TZAA 3LK1A 2V4EC 1H4UA 1BU3A 4DXOA 5LTPA 1ZUXA 1AHRA 1NUBA 1SCMB 1CMFA 2DDDA 2G5ZB 3SIAA 5AEQA 4EULA 2AWLA 2ZMWA 3H1RA 1QV0A 2VADA 1H4BA 4H3MA 4HQ9A 1ZFSA 1TRFA 4D1EA 2KSPA 1XO5A 1XK4C 5ER4X 5KSZA 4U2VA 3DQDA 3KCTA 4H3NA 1ODBA 1L2OB 3DQ1A 3AAJA 1WLZA 1DGVA 1IWQA 3FS7A 1LA0A 2ZNDA 4PE1A 2LE9B 1A4PA 4N5XA 1JC0A 2H5OA 2HJOA 3I5IB 1XFXO 3CR4X 1A75A 4DIRA 2Y0GA 1JF0A 1SCVA 1CMGA 2QRFA 4XGYA 3CFAA 3K21A 4W6TA 5PALA 3DQUA 4EDSA 3SRYA 3SG5A 4DXMA 2MJWB 2PASA 2O5GA 4LQUA 1K9PA 1QATA 1B1GA 2KDHA 3WLCA 2KI4C 2JWWA 3G9AA 1J1DA 3ST3A 3PATA 2M97A 3CR2A 4Q04A 1B4CA 2LUXA 1FBVA 1KWOC 4GGFC 4W75A 3EVVA 5HYDA 4L1IA 2F33A 3SVRA 2LANA 3JVTC 1AVSA 2WOSA 2G3DB 4CLNA 4DXNA 3E5TA 3PJ7A 4RYSA 1C07A 2WCBA 4IK4A 1EXRA 4MRXA 4NDBA 1KFXL 2IS9A 1C4FA 2CBLA 2PALA 1UHIA 1YUSA 2OS8C 1H6RA 1QYFA 3CR5X 3UFZA 1OMRA 1QX7A 1RJVA 2A48A 1CFCA 3VRPA 1S6ZA 4NDDA 2Q57A 1JFJA 2AUCA 2G6YA 2GW3A 4W72A 4W6BA 1PK0D 3RWTA 2POXA 2LUCA 1DJIA 1KSMA 1VRKA 1Y6WA 2JNXA 1QY3A 1GQMA 1UHNA 4W73A 2JTTA 2CCMA 2GX0A 3KEVA 4I2YA 4W74A 4ZINA 2E6WA 3IQOA 4JF9A 1YX8A 3GB3A 3F45A 2HPWA 4H47A 1XYDA 1S3PA 2BBNA 1LVCD 2MLEC 1DJWA 4ZIOA 3PN7C 4OV2A 3LF4B 3VRRA 1IG5A 4ZCUA 4YRUA 3VICA 4NDCA 1CFDA 2K61A 3HCMA 5HZSA 1ALWA 4GBAA 4W6AA 1WY9A 3SVDA 1AJ4A 1N2DA 3C1VA 5EXCI 3DQKA 2QLGB 2KQYA 2ZN8A 4PDZA 4GAOA 2NLNA 2IB6A 5BTTB 4I5JA 3SSKA 1FI5A 2JOJA 1QS7A 4OJ0A 5BPJA 4Q7TA 1HCJA 2LAPA 2NCOA 1W7TA 3S05A 5J2OA 4KW8A 1E8AA 2WORA 2AH8A 1BR1B 2OPOA 4LJDC 2BKIB 2M8UA 4PPKA 3SVEA 4OHSA 4OKHA 1PVAA 1JFKA 2HPSA 2LP2A 1PVBA 1D1OA 2FOTA 2WCFA 4XOVA 5I8NA 1KYPA 5H87A 1F55A 1W7UA 3BUNB 2K0JA 2V4EB 4OVNF 4PCWA 4ZCVA 4OQWA 3AI5A 2C9IA 1CB1A 2LLUA 3DQLA 3BOWA 4W6HA 4FTGA 3DPXA 1NX2A 2M7NA 4PPLA 4WQ3A 1BOCA 4N3DA 2KOTA 4W6IA 2GGMA 2KBMA 5TNCA 5F9GA 3I5IC 4W6LA 3JTDC 4EMQA 2YFPA 1PALA 2MBXA 1CTRA 1C7VA 1BG1A 1MUXA 3VGOA 1Q80A 4RTCA 3VHTA 4MLWA 1JBYA 2JRFA 1YHGA 1CDMA 2HRSA 1QTXA 3TS5C 5JJGA 1S5GZ 1SPYA 1NCYA 3UG0A 3SSVA 5KTYA 1DF0B 3AKAA 3TMRA 1OSAA 5HBDA 1MWNA 1B7TY 1RMPA 3SV5A 2BBMA 2JULA 4WRIA 4ANJA 5DKRA 2I94A 3FWBA 2KI4B 5JOLA 2A47A 4YGEB 1M45A 1KWOB 4YGCB 3A4UB 4GF6B 1N65A 4XVPA 4DKMA 1RWYA 3BUMB 3OGOA 2H61A 4M2PA 3JVTB 2B3PA 5FYXA 1RK9A 4KA9A 2LV7A 2K7CA 1N0YA 2A46A 3GK4X 2NXQA 3A8RA 2IOVA 4IK5A 1QLKA 2OS8B 3VRQA 1S6JA 5ER5A 3ZUFA 4A4CA 2ZN9A 2L5XB 4HREE 4KEXA 3CGAA 1MXEA 2Z1OA 3DVJA 4OY4A 5HKZA 2LCPA 3OB2B 2OKWA 1TCOB 3D10A 1YZWA 3GK2A 1K95A 2K8MB 1OQPA 2QU1A 5F6TA 3SVCA 5AQBB 5I2OA 3ST4A 4ZF3A 1EG4A 2OTGC 3BXAA 4AR7A 1TTXA 2VRGA 1GJYA 1SNLA 1ZMZA 3D0YA 5HKWA 2ZRTA 1WLMA 2FL1A 5AXIA 2G2BA 2CTNA 4ZFSA 1SL8A 4AOMA 4W7CA 2Z6ZA 3PN7B 1YHIA 3CB9A 3NEZA 1RROA 1U5IA 1J7QA 5DRGA 4W6PA 1Y1UA 1EMEA 4KF4A 4MRYA 3EVUA 1BFPA 3H1OA 4QJ5B 4W6CA 5AERA 1NWDA 3OP0A 5IBWA 1SYMA 4W69A 5DQMA 5HZTA 1B8CA 2O60A 1QYQA 4ZF5A 4XYNA 3CGLA 1PSBA 1SBJA 5H89A 2A50B 2LP3A 4MSPA 4ETOA 3EVRA 2Z6XA 3M22A 5DPGA 5CSFA 4IZNA 1BLQA 1K9KA 4KPIA 1TN4A 2YDZA 5LTRA 3CFHA 3DQNA 5EB7A 1UP5A 4I5LB 1WRKA 2QACA 4DRWA 4JPZB 1EG3A 1MQ1A 1JBZA 2HQZA 2P4MA 4YGDB 4PALA 1TNXA 2FWQA 4HQ8A 4R6BA 1DMOA 5DY6A 1QX2A 1XAEA 3BOWB 3DQ7A 3NEDA 5J3XA 1SK6D 1DJYA 3PFVA 1KK8C 2EMOA 2RGIA 4W76A 3ADFA 3JTDB 5HW9A 2QT2A 3HX4A 2AMIA 5I2QA 2JADA 4M2OA 3PSRA 2BECA 4F0ZB 2WNDA 3WXAA 2VVIA 1R6PA 3IR8A 1CNPA 1F70A 1UHKA 3KF9A 1AP4A 3DF0A 3TS5B 4H3LA 1TCFA 2M49B 3MGFA 4NQGA 3DQ6A 3CD1A 3O2PA 1EMGA 2LMUA 2Q6PA 4IK8A 1A29A 1YJFA 3DD4A 1TNPA 2AHAA 4W6OA 4B30A 4W6GA 1W7SA 5DTYA 1DJZA 1KP5A 2EMDA 1FI6A 5DU0A 2KFGA 4GGFA 2DDCA 1JWDA 4CFRA 2M0RA 1OXFA 3VROA 3IP2A 1Q73A 3DVEA 3ST2A 1TNWA 1DJGA 4KF5A 1NIWA 2PXSA 1NCXA 3I5FC 2L0PA 4W7XA 1EMKA 1CM1A 1EJ3A 2HF5A 1XSSA 4PPJA 4QJ4B 3DQ5A 3WNXB 4YBHB 3GK1A 2D8NA 3LF3A 3DQJA 1KFUS 1RMOA 3LCPC 4BDUA 5BT0A 1KYRA 5I2LA 1JC2A 2FCEA 1IQ5A 1WRZA 1EMBA 1XA5A 4W6JA 1R2UA 3DVMA 4HRHA 5DKNA 3AI4A 3O77A 3U0KA 2KFFA 1NSHA 1M46A 4XJKA 1CV7A 2P6BB 1FW4A 2AAOA 1IKUA 2E30A 2OTGB 1M39A 1LINA 2PRUA 1RM9A 4USLA 2BCXA 2QLIA 3DQIA 4XL5A 5FVIA 3SVBA 5FVGA 5DPIA 1IH0A 1ALVA 1CFPA 2G6XA 4W7AA 1UISA 1IRJA 4W7FA 5EXUA 4DCKA 3DQMA 2MLFC 1OMDA 1V1FA 3K1KA 5HZOA 4JWQA 1RTP1 3NF0A 2HFCA 1KFUL 2WURA 3SVSA 1QIVA 1U5IB 3CZTX 4GGNA 1AJ5A 1AK8A 2M1KB 4PE0A 3DQ8A 1ZGPA 5CSNA 1MOVA 1J7PA 2JZIA 3U8AA 2IE2A 5D69A 5HGEA 1S6CA 2G2SB 3EKJA 3SG2A 4LJDA 2L98A 4DXPA 2KNEA 4W6NA 1KQMC 1SL9A 4IK9A 1XFWO 3OSQA 2DUHA 4W7EA 5CSJA 4KW9A 3SSTA 4YGBB 2LNKA 2CT9A 3DQHA 1EMFA 3GL4A 4FQOA 1MF8B 2LVKA 2H5QA 4OR9B 2KAXA 1NX1A 4H48A 1QVIY 1MR8A 3LVAA 3O78A 3EK7A 5FVFA 3RWAA 2F3ZA 4W7RA 2Q4UA 5HLVA 3M24A 2MAZA 4I5KA 3OB1B 1K90D 1C7WA 4DXIA 1F4QA 1XQMA 3DQ9A 1OZOA 3ZTFA 4KW4A 1Q4AA 4IK3A 4J89A 3TUYB 4AS8A 1QYOA 2EC6C 1EH2A 1K9UA 1KK8B 2H5RA 3OX5A 1QLSA 4A4BA 3SVUA 3AKOA 2KHNA 4J8AA 5EHUA 2MHHA 5HLOA 1F54A 2LLTA 2BE6A 3DQCA 1A75B 4PE4A 2JT0A 2L4HA 1B8LA 1Y1AA 1ZUZA 2PXWA 4LJCA 4PHJA 1SRAA 2L51A 2ISDA 4DKNA 1KSOA 3BQ3A 3LA1A 3TDUA 1XMZA 4OGSA 4ZBLA 2K7OA 4ORBB 4YI9A 4YGAA 2L2EA 3DPZA 2JTZA 3LVDA 1A2XA 4W6DA 2H5PA 5KU1A 3NXAA 3BUXB 1RMMA 1JF2A 4GFTA 2EHBA 1ZGOA 2JC2A 3GJ2A 1QIWA 2FZUA 1BODA 1G7KA 4IL1A 2B3QA 3LL8B 2NCPA 1J7RA 2DUIA 1YJ2A 2H61C 1UURA 4W77A 4KGEA 2AWMA 1NP8A 3I5FB 3SSYA 2VVJA 2LVIA 3ZULA 3PALA 1QXPA 5H88A 2DD9A 3TMTA 1SY9A 4PE7A 3FWCA 1LA3A 4PHKA 1CDPA 4JQ0D 2YE0A 4GUKA 2ZKMX 4DXQA 1K8UA 2A53B 2MRDA 1BF5A 3BXKA 3KPXA 2SASA 4OCIA 4P2YB 3PLFB 2M3WA 4Z4KA 4LQTA 1MXLC 3NSOA 1CFFA 3TZ1A 5CSIA 1YX7A 1NX0A 2DD7A 2MA2A 3CBEA 5DTXA 1JUOA 4Q7UA 2WC8A 2C9JA 2QLGA 2KAYA 2O2BA 2G16B 1IJ5A 2H2KA 5BTTA 1GGXA 1YUTA 3RM1A 3I5GC 5AFPA 5DQBA 4C0JA 5HZUA 1B7TZ 4MVFA 1JSAA 2JNFA 2L4IA 2R2IA 1KK7Y 3SVOA 1HT9A 1F71A 1SR6C 3U8CA 2KGRA 3WHTB 1BT6A 1LXFC 4ICBA 1PULA 4MZKA 2Y1NA 5DTLA 1M63B 4Q7RA 1KYSA 5HKYA 5K89A 5DRFA 1Y1XA 4L12A 3SG7A 5AANA 2LMTA 1KQMB 1YRTB 4E68A 2F2PA 2V4EA 3DQ3A 1RECA 1JC1A 3WLDA 5EB6A 1YTZC 1WDCB 4IK1A 1HQVA 3BUOB 4TNCA 3FIAA 2JU0A 1BMOA 1BR4B 1IGVA 2WHTA 3SJSA 4JEOA 1A03A 3LK0A 2DUEA 3I5HC 2M1UA 1XK4A 5LK4A 5GQQC 2YE1A 1DT7B 1F0BA 4L13A 1S26D 3P8UA 3TUYC 1TIZA 3CLNA 1GGZA 4L9MA 5KTGA 4GNKB 3M0WA 4DUQA 1PRWA 2Z6YA 1YVLA 2CNPA 3KHEA 4I5NB 1FF1A 1DVIA 1KFXS 2LHLA 2K7DA 2EC6B 2LVVA 4Z4MA 2WHSA 1S36A 3SSPA 1SMGA 3SG6A 1DF0A 1CLLA 1X02A 1AUIB 1YHHA 3BYAA 3GOFA 4UTSA 3NSIA 1F4OA 1YFPA 2WSOA 4EN1A 1RRXA 2KYCA 3VHTB 4MEWA 2BL0C 2H9WA 4P76A 3KCSA 3SG3A 1SKTA 2OJKA 2O29A 4BY5A 2PSRA 3LVCA 4HQCA 2JPTA 1LKJA 2LM5A 4GOBA 3SS0A 1G33A 2KI6D 3ZUJA 2ZMUA 4HSZA 1ZGQA 2K2FA 4QJ3B 1KK7Z 2ZNEA 2ICRA 3EK8A 2BTJA 2LVJA 1JBAA 1YUUA 5EBJA 3RLZA 5FHVA 2KBIA 4ORAB 1CLBA 1TOPA 3TDIA 1OXEA 3V3DA 4KF5C 3I19A 1RFJA 1HUYA 3WCKA 3ZWHA 1G4YR 2OTEA 4NWSA 3TDZA 3NSLA 5EXBA 2Y5IA 1H8BA 3PM8A 1J1EA 1QXTA 4N1FA 2LLSA
chains in the Genus database with same CATH superfamily
4JC2A 2ZRSA 4AQIA 2TN4A 2K2AA 3SG4A 4BY4A 2BE4A 3CD9A 1B8RA 4ORNA 1XFVO 4PFEA 4JRBA 2HQWA 4IJ7A 1NX3A 1OXDA 2M9GA 1UHHA 2I18A 2A4JA 3EG5B 5D7FA 1K2HA 1XVJA 3DQEA 2K60A 1QJTA 3LLEA 2ZFDA 2ZO6A 4R1EA 4PHMA 4J88A 2OGRA 3ST0A 1S5GY 1Z1PA 3BUWB 3D0YB 1DGUA 1NYAA 2OKYA 2GV5A 4W6UA 3DQFA 3EVPA 1IIOA 2KAVA 4MN0A 1YRUB 2PVBA 2AWJA 1UUSA 2V53A 2GX2A 3U0LA 2HGDA 3CDNA 3CS1A 3KO0A 2Y4QA 2ERBA 1W9ZA 3I5GB 2I7AA 1SW8A 4HVFA 2VVHA 2KLDA 1Z1QA 4B5YA 3A8SA 3BXCA 2B1UA 5EJUA 3OSRA 2WCKA 5LTQA 1SR6B 4MZJA 4LJBA 2F3YA 1F8HA 1B9CA 2HGYA 4JGEA 3H4SE 4DS7A 4W6FA 1XFYO 1ZOTB 3ZNIA 3E5WA 1K93D 1Q4CA 3UNWA 4YI8A 2GGZA 4U8DA 3O6BA 1Q4DA 2Q91A 2A52B 1WDCC 1S6IA 1OZSA 3PIBA 2KFHA 1PSRA 2VZXA 3DVKA 1W7JB 2RH7A 3SIBA 1L7ZA 2G9BA 3BFHA 3CZ1A 4HE4A 1SCMC 1J55A 1KQVA 2DOQA 4W6MA 5DPHA 1CDLA 2FCDA 1XFZO 3LS3A 1YURA 2WHUA 1CDNA 2A54B 3SSHA 3I5HB 2NZ0A 2GW4B 1ZACA 1GFLA 1QASA 4Q9XA 2G3OA 2JXCA 2PMYA 1W7IB 3U0MA 2LMVA 3EK4A 3DQOA 2L5YA 1L2OC 1QV1A 3QMEA 1IQ3A 3BXBA 4TZGA 5BQLA 3SVNA 2QLHA 1IJ6A 4EDOA 1QX5B 5DPJA 2EGDA 3OBVA 3NT9A 1GL4A 1M31A 1BJFA 1K94A 2M7LA 2OTBA 4MZLA 2WISA 5DKQA 4P5OE 4ORCB 3CWGA 4JD9A 3NT3A 1EMAA 4W6KA 1J7OA 2QZ0A 4JKTA 2JQ6A 1S1EA 3S0GA 1UHJA 1EMLA 3VRNA 2BL0B 1EMMA 1GGWA 2DUGA 1YVHA 4JFGA 3O4YA 3DF0B 1EL4A 1OE9B 2QLEA 2QDIA 4HRGA 1DTLA 1V1GA 1NPQA 1LS8A 1DJXA 4UPGA 4ZF4A 4KGFA 2HQ8A 2SCPA 3FE8A 4KYNA 4RYWA 4W6SA 4CFQA 3PJ5A 3AKBA 2IB5A 4KAGA 4B30B 1Q4BA 3UO9A 3OHMB 3R1OA 2H8QA 5G08A 2WCEA 5D3OA 3U8PA 2QPTA 3BFBA 2K7BA 1SL7A 1XFUO 1C3YA 2I2RE 4C0LA 1G8IA 3EKHA 2F8PA 3DQAA 2KPHA 2BKHB 3DYEA 3SSLA 1UWOA 4Q9WA 1TNQA 2ZO7A 3IF7A 3CFFA 2KGBC 4N1GA 5T3IA 1TUZA 2CXJA 2KQ6A 4AQJA 3PJBA 4GPLB 2JT8A 4PHNA 3GJ1A 1YR5A 3CTNA 1XFRA 1Y0VH 4W6RA 1QVIZ 1CKKA 4P1QA 2O24A 2COLB 2DUFA 3NSKA 2M29A 4CIDA 3V2LA 3VK1A 5DTZA 1OOFA 2HCGA 1ORGA 3DQ4A 3P28A 3LSAA 3IQQA 4XJKB 1DEKA 1CM4A 1NCZA 2HQKA 4GESB 3QRXA 1XA9A 2F2OA 4XOWA 4MBEA 2H6VA 3AAKA 3DQ2A 2WCJA 2FJUB 3S0EA 3W1CA 1DQEA 5B8IB 2ARLA 3E3RA 2KYFA 2A56B 2HETA 3VB1A 1CLMA 4WQ2A 2Y1MA 1OMVA 1OW4A 2JXLA 2JT3A 1MHOA 2WIQA 1WRLA 3E5VA 1K96A 4ZB1A 1OOGA 3U0NA 2AWKA 2PYQA 2VAEA 4R6DA 3BX9A 1B9AA 2BCAA 3ICBA 2LC5A 4CPVA 3DPWA 1MOUA 4M2QA 1Q4EA 3ED8A 1B47A 2BCBA 4W7DA 1EMCA 2LHIA 3W1DA 2KLEA 3OX6A 3GEXA 4LW5A 1F09A 2EMNA 4C0KA 2WSNA 3WHUB 1FPWA 5CPVA 2KI6C 4FQTA 1MYWA 1DJHA 1KCYA 2G6EA 3MSEB 1OOJA 2L50A 4TZAA 3LK1A 2V4EC 1H4UA 1BU3A 3D78A 4DXOA 5LTPA 1ZUXA 1AHRA 1NUBA 1SCMB 1CMFA 2DDDA 2G5ZB 3SIAA 5AEQA 4EULA 2AWLA 2ZMWA 3H1RA 1QV0A 2VADA 1H4BA 4H3MA 4HQ9A 1ZFSA 1TRFA 4D1EA 2KSPA 1XO5A 1XK4C 5ER4X 5KSZA 4U2VA 3DQDA 3KCTA 4H3NA 1ODBA 1L2OB 3B86A 3DQ1A 3AAJA 1WLZA 1DGVA 1IWQA 3FS7A 1LA0A 2ZNDA 4PE1A 2LE9B 1A4PA 4N5XA 1JC0A 2H5OA 2HJOA 3I5IB 1XFXO 3CR4X 1A75A 4DIRA 2Y0GA 1JF0A 1SCVA 1CMGA 2QRFA 1QWVA 4XGYA 3CFAA 3K21A 4W6TA 3D74A 5PALA 3DQUA 4EDSA 1TWOA 3SRYA 3SG5A 4DXMA 2MJWB 2PASA 2O5GA 4LQUA 1K9PA 1QATA 1B1GA 1OOHA 2KDHA 3WLCA 3B7AA 2KI4C 2JWWA 3G9AA 1J1DA 3ST3A 2QEOA 3PATA 2M97A 3CR2A 4Q04A 1B4CA 2LUXA 1FBVA 1KWOC 4GGFC 4W75A 3EVVA 5HYDA 4L1IA 2F33A 3SVRA 2LANA 3JVTC 1AVSA 2WOSA 2G3DB 4CLNA 4DXNA 3E5TA 3PJ7A 4RYSA 1C07A 2WCBA 4IK4A 1EXRA 4MRXA 4NDBA 1KFXL 2IS9A 1C4FA 2CBLA 2PALA 1UHIA 1YUSA 2OS8C 1H6RA 1QYFA 3R72A 3CR5X 3UFZA 1OMRA 1QX7A 1RJVA 2A48A 1CFCA 3VRPA 1S6ZA 4NDDA 2Q57A 1JFJA 2AUCA 2G6YA 2GW3A 4W72A 4W6BA 1PK0D 3RWTA 2POXA 2LUCA 1DJIA 1KSMA 1VRKA 1Y6WA 2JNXA 1QY3A 1GQMA 1UHNA 4W73A 2JTTA 2CCMA 2GX0A 3KEVA 4I2YA 4W74A 4ZINA 2E6WA 3IQOA 4JF9A 1YX8A 3GB3A 3D77A 3F45A 2HPWA 4H47A 1XYDA 1S3PA 2BBNA 1LVCD 2MLEC 2FJYA 1DJWA 4ZIOA 3PN7C 4OV2A 3LF4B 3VRRA 1IG5A 4ZCUA 4YRUA 3VICA 4NDCA 1CFDA 2K61A 3HCMA 5HZSA 1ALWA 4GBAA 4W6AA 1WY9A 3SVDA 1AJ4A 3CYZA 1N2DA 3C1VA 5EXCI 3DQKA 2QLGB 2KQYA 2ZN8A 4PDZA 4GAOA 2NLNA 2IB6A 5BTTB 2QEVA 4I5JA 3SSKA 1FI5A 3SS5A 2JOJA 1QS7A 4OJ0A 5BPJA 4Q7TA 1HCJA 2LAPA 2NCOA 1W7TA 3S05A 5J2OA 4KW8A 1E8AA 2WORA 2AH8A 1BR1B 2OPOA 4LJDC 3S0FA 2BKIB 2M8UA 4PPKA 3SVEA 4OHSA 3K1EA 3L47A 4OKHA 1PVAA 1JFKA 2HPSA 3PJIA 2LP2A 1PVBA 1D1OA 3FE6A 2FOTA 2WCFA 4XOVA 5I8NA 1KYPA 5H87A 1F55A 1W7UA 3BUNB 2K0JA 2V4EB 4OVNF 4PCWA 4ZCVA 4OQWA 3AI5A 2C9IA 1CB1A 2LLUA 3DQLA 3BOWA 4W6HA 4FTGA 3DPXA 1NX2A 2M7NA 4PPLA 4WQ3A 1BOCA 4N3DA 2KOTA 2GTEA 4W6IA 2GGMA 3O4XA 2KBMA 5TNCA 5F9GA 3I5IC 1C3ZA 4W6LA 3JTDC 4EMQA 2YFPA 1PALA 2MBXA 1CTRA 1C7VA 1BG1A 1MUXA 3VGOA 1Q80A 4RTCA 3VHTA 4MLWA 1JBYA 2JRFA 1YHGA 2BNXA 1CDMA 2HRSA 1QTXA 3TS5C 5JJGA 1S5GZ 1SPYA 1NCYA 3UG0A 3SSVA 5KTYA 1DF0B 3AKAA 3TMRA 1OSAA 5HBDA 1MWNA 3R1PA 1B7TY 1RMPA 3SV5A 2BBMA 1OOIX 3L4LA 2JULA 4WRIA 4ANJA 5DKRA 2I94A 3FWBA 2KI4B 5JOLA 2A47A 4YGEB 1M45A 1KWOB 4YGCB 3A4UB 4GF6B 1N65A 4XVPA 4DKMA 1RWYA 3BUMB 3OGOA 2H61A 4M2PA 3JVTB 2B3PA 5FYXA 1RK9A 4KA9A 2LV7A 2K7CA 1N0YA 2A46A 2WCHA 3GK4X 2NXQA 3A8RA 2IOVA 4IK5A 1QLKA 2OS8B 3VRQA 1S6JA 5ER5A 3ZUFA 4A4CA 2ZN9A 2L5XB 4HREE 2Z1OA 3CGAA 1MXEA 4KEXA 3DVJA 4OY4A 5HKZA 2LCPA 3OB2B 2OKWA 1TCOB 3D10A 1YZWA 3GK2A 1K95A 2K8MB 1OQPA 2QU1A 5F6TA 3SVCA 1T14A 5AQBB 4INWA 5I2OA 3ST4A 4ZF3A 1EG4A 2OTGC 3NGVA 3BXAA 4AR7A 2WC6A 1TTXA 2VRGA 1GJYA 1SNLA 1ZMZA 3D0YA 5HKWA 2BAPA 2ZRTA 1WLMA 2FL1A 5AXIA 2G2BA 2CTNA 4ZFSA 1SL8A 4AOMA 4W7CA 3IVTA 2Z6ZA 3PN7B 1YHIA 3CB9A 3NEZA 1RROA 1U5IA 3D73A 1J7QA 5DRGA 4W6PA 1Y1UA 1EMEA 4KF4A 4MRYA 3EVUA 1BFPA 3H1OA 4QJ5B 4W6CA 4PT1A 5AERA 1NWDA 3OP0A 5IBWA 1SYMA 4W69A 5DQMA 5HZTA 1B8CA 1TUJA 2O60A 1QYQA 4ZF5A 4XYNA 3CGLA 1PSBA 1SBJA 5H89A 3CZ0A 2A50B 2LP3A 4MSPA 3CABA 4ETOA 3EVRA 2Z6XA 3M22A 5DPGA 5CSFA 4IZNA 4F7FA 1BLQA 1K9KA 4KPIA 1TN4A 2YDZA 5LTRA 3CFHA 3DQNA 5EB7A 3NHIA 1UP5A 4I5LB 1WRKA 2QACA 4DRWA 4JPZB 1EG3A 1MQ1A 1JBZA 1DELA 2HQZA 2P4MA 4YGDB 4PALA 1TNXA 2FWQA 4HQ8A 4R6BA 1DMOA 5DY6A 1QX2A 1XAEA 3BOWB 3DQ7A 3NEDA 5J3XA 1SK6D 1DJYA 3PFVA 1KK8C 2EMOA 2RGIA 4W76A 3ADFA 3JTDB 5HW9A 2QT2A 3HX4A 2AMIA 5I2QA 2JADA 3CZ2A 4M2OA 3PSRA 2BECA 4F0ZB 2WNDA 3WXAA 2VVIA 1R6PA 5FI6A 3IR8A 1CNPA 1F70A 1UHKA 3KF9A 1AP4A 3DF0A 3TS5B 4H3LA 1TCFA 2M49B 1P28A 3MGFA 4NQGA 3DQ6A 3CD1A 3O2PA 1EMGA 3DY9A 2LMUA 3B88A 2Q6PA 4IK8A 1A29A 1YJFA 3DD4A 1TNPA 2AHAA 4W6OA 4B30A 4W6GA 1W7SA 5DTYA 1DJZA 1KP5A 2H8VA 2EMDA 1FI6A 5DU0A 2KFGA 4GGFA 3S0AA 2DDCA 1JWDA 4CFRA 2M0RA 1OXFA 3VROA 3IP2A 1Q73A 2WCMA 3DVEA 3ST2A 2QEHA 1TNWA 1DJGA 4KF5A 1NIWA 2PXSA 3D75A 1NCXA 3I5FC 2L0PA 4W7XA 1EMKA 1CM1A 1EJ3A 2HF5A 1XSSA 4PPJA 4QJ4B 3DQ5A 3WNXB 4YBHB 3GK1A 2D8NA 3LF3A 3DQJA 1KFUS 1RMOA 3LCPC 4BDUA 5BT0A 3BFAA 1KYRA 5I2LA 1JC2A 2FCEA 1IQ5A 1WRZA 1EMBA 3B87A 1XA5A 4W6JA 1R2UA 3L4AA 3DVMA 5EL2A 4HRHA 5DKNA 3AI4A 3O77A 3U0KA 2KFFA 1NSHA 1M46A 4XJKA 1CV7A 2P6BB 5FI2A 1FW4A 2AAOA 1IKUA 2E30A 2OTGB 1M39A 1LINA 2PRUA 1RM9A 4USLA 2BCXA 2QLIA 3DQIA 5HL1A 4XL5A 5FVIA 3SVBA 5FVGA 5DPIA 1IH0A 1ALVA 1CFPA 2G6XA 4W7AA 1UISA 1IRJA 4W7FA 5EXUA 4DCKA 3DQMA 2MLFC 1OMDA 3DZTA 1V1FA 3K1KA 5HZOA 4JWQA 1RTP1 3NF0A 2HFCA 1KFUL 2WURA 3SVSA 1QIVA 1U5IB 3CZTX 4GGNA 1AJ5A 1AK8A 2M1KB 4PE0A 3Q8IA 5I94A 3DQ8A 3R1VA 5CSNA 1ZGPA 1MOVA 1J7PA 2JZIA 3U8AA 2IE2A 5D69A 5HGEA 1S6CA 2G2SB 3EKJA 3SG2A 4LJDA 2QEBA 2L98A 4DXPA 2KNEA 4W6NA 1KQMC 1SL9A 4IK9A 1XFWO 3OSQA 5FI7A 2DUHA 4W7EA 5CSJA 4KW9A 3SSTA 4YGBB 2LNKA 2CT9A 3DQHA 1EMFA 3GL4A 4FQOA 1MF8B 2LVKA 2H5QA 4OR9B 2KAXA 1NX1A 4H48A 1QVIY 1MR8A 3NHTA 3LVAA 3O78A 2L2CA 3EK7A 5FVFA 3RWAA 2F3ZA 4W7RA 2Q4UA 5HLVA 3M24A 2MAZA 4I5KA 3OB1B 1K90D 1C7WA 4DXIA 1F4QA 1XQMA 3DQ9A 1OZOA 3ZTFA 4KW4A 1Q4AA 4IK3A 4J89A 3TUYB 4AS8A 1QYOA 2EC6C 1EH2A 1K9UA 1KK8B 2H5RA 3OX5A 1QLSA 4A4BA 3SVUA 3AKOA 2KHNA 4J8AA 5EHUA 2MHHA 5HLOA 1F54A 2LLTA 2BE6A 3DQCA 1A75B 4PE4A 2JT0A 2L4HA 1B8LA 1Y1AA 1ZUZA 2PXWA 2WCLA 4LJCA 4PHJA 1SRAA 2L51A 2ISDA 4DKNA 1KSOA 3BQ3A 3LA1A 3TDUA 1XMZA 4OGSA 4ZBLA 1DC1A 2K7OA 4ORBB 4YI9A 4YGAA 2L2EA 3OGNA 3DPZA 2JTZA 3LVDA 1A2XA 4W6DA 2H5PA 5KU1A 3NXAA 3BUXB 1RMMA 1JF2A 4OZDA 4GFTA 2EHBA 1ZGOA 2JC2A 3N7HA 3GJ2A 1QIWA 2FZUA 1BODA 1G7KA 4IL1A 2B3QA 3LL8B 2NCPA 1J7RA 2DUIA 1YJ2A 2H61C 1UURA 4W77A 4KGEA 2AWMA 1NP8A 3I5FB 3SSYA 1Z4HA 2VVJA 2LVIA 3ZULA 3S0BA 3PALA 1QXPA 5H88A 2DD9A 3TMTA 1SY9A 4PE7A 3S0DA 3FWCA 1LA3A 4PHKA 1CDPA 4JQ0D 2YE0A 4GUKA 2ZKMX 4DXQA 1K8UA 2A53B 2MRDA 3B6XA 3D76A 1BF5A 3BXKA 3KPXA 2SASA 4OCIA 4P2YB 3PLFB 2M3WA 4Z4KA 4LQTA 1MXLC 3NSOA 1CFFA 3TZ1A 5CSIA 1YX7A 1NX0A 2DD7A 2MA2A 3CBEA 5DTXA 1JUOA 4Q7UA 2WC8A 2C9JA 2PQLA 3DXLA 2QLGA 2KAYA 2O2BA 2G16B 1IJ5A 2H2KA 5BTTA 1GGXA 1YUTA 3SS3A 3RM1A 3I5GC 5AFPA 5DQBA 4C0JA 5HZUA 1B7TZ 4MVFA 1JSAA 2JNFA 2L4IA 2R2IA 1KK7Y 3SVOA 1HT9A 1F71A 1SSEB 1SR6C 3U8CA 2KGRA 3WHTB 1BT6A 1LXFC 4ICBA 1PULA 4MZKA 2Y1NA 5DTLA 1M63B 4Q7RA 1KYSA 5HKYA 5K89A 5DRFA 1Y1XA 4L12A 3SG7A 2P71A 5AANA 2LMTA 1KQMB 1YRTB 4E68A 2F2PA 2V4EA 3DQ3A 1Z2CB 1RECA 2YGUA 1JC1A 3WLDA 5EB6A 1YTZC 1WDCB 3FE9A 4IK1A 1HQVA 3BUOB 4TNCA 3FIAA 2JU0A 1BMOA 1BR4B 1IGVA 1GM0A 2WHTA 3SJSA 4JEOA 1A03A 2WC5A 3LK0A 2DUEA 3I5HC 2P70A 2M1UA 1XK4A 5LK4A 5GQQC 2YE1A 1DT7B 1F0BA 4L13A 1S26D 3P8UA 3TUYC 1TIZA 3CLNA 1GGZA 4L9MA 5KTGA 4GNKB 3M0WA 4DUQA 1PRWA 2Z6YA 1YVLA 2CNPA 3KHEA 4I5NB 1FF1A 3RZSA 1DVIA 1KFXS 2LHLA 2K7DA 4INXA 2EC6B 2LVVA 4Z4MA 2WHSA 1S36A 3SSPA 1SMGA 3SG6A 1DF0A 1CLLA 1X02A 1AUIB 1YHHA 3BYAA 3GOFA 4UTSA 3NSIA 1F4OA 1YFPA 2WSOA 4EN1A 1RRXA 2KYCA 3VHTB 4MEWA 2BL0C 2H9WA 4P76A 3BJHA 3KCSA 3PM2A 1SKTA 3SG3A 2OJKA 2O29A 4BY5A 2PSRA 3LVCA 4HQCA 2JPTA 1LKJA 2LM5A 4GOBA 3SS0A 1G33A 2KI6D 3ZUJA 2ZMUA 2JPOA 4HSZA 1ZGQA 2K2FA 4QJ3B 1KK7Z 2ZNEA 2ICRA 3EK8A 2BTJA 2LVJA 1JBAA 1YUUA 5EBJA 3RLZA 5FHVA 2KBIA 4ORAB 1CLBA 1TOPA 3TDIA 1OXEA 3V3DA 4KF5C 3I19A 1RFJA 1HUYA 3WCKA 3ZWHA 1G4YR 2OTEA 5DICA 4NWSA 3TDZA 3NSLA 5EXBA 2Y5IA 1H8BA 3PM8A 1J1EA 1QXTA 3SS4A 4N1FA 2LLSA
chains in the Genus database with same CATH topology
4JC2A 2ZRSA 4AQIA 2TN4A 2K2AA 3SG4A 4BY4A 2BE4A 3CD9A 1B8RA 4ORNA 1XFVO 4PFEA 4JRBA 2HQWA 1NX3A 1OXDA 2M9GA 1UHHA 2I18A 2A4JA 5D7FA 1K2HA 1XVJA 3DQEA 1QJTA 3LLEA 2ZFDA 2ZO6A 4R1EA 4PHMA 4J88A 2OGRA 3ST0A 1S5GY 1Z1PA 3BUWB 3D0YB 1DGUA 1NYAA 2OKYA 2GV5A 4W6UA 3DQFA 3EVPA 2KAVA 4MN0A 1YRUB 2PVBA 2AWJA 1UUSA 2V53A 2GX2A 3U0LA 2HGDA 3CS1A 3KO0A 2Y4QA 3I5GB 2I7AA 1SW8A 4HVFA 2VVHA 1Z1QA 4B5YA 3A8SA 3BXCA 2B1UA 5EJUA 3OSRA 5LTQA 1SR6B 4MZJA 4LJBA 2F3YA 1F8HA 1B9CA 2HGYA 4JGEA 3H4SE 4DS7A 4W6FA 1XFYO 1ZOTB 3ZNIA 3E5WA 1K93D 1Q4CA 4YI8A 2GGZA 4U8DA 3O6BA 1Q4DA 2Q91A 2A52B 1WDCC 1S6IA 1OZSA 3PIBA 2KFHA 1PSRA 2VZXA 3DVKA 1W7JB 2RH7A 3SIBA 1L7ZA 2G9BA 4HE4A 1SCMC 1J55A 1KQVA 2DOQA 4W6MA 5DPHA 1CDLA 2FCDA 1XFZO 3LS3A 1YURA 2WHUA 1CDNA 2A54B 3SSHA 3I5HB 2NZ0A 2GW4B 1ZACA 1GFLA 1QASA 4Q9XA 2G3OA 2JXCA 2PMYA 1W7IB 3U0MA 2LMVA 3EK4A 3DQOA 1L2OC 1QV1A 1IQ3A 3BXBA 4TZGA 5BQLA 3SVNA 2QLHA 1IJ6A 4EDOA 1QX5B 5DPJA 2EGDA 3NT9A 1GL4A 1M31A 1BJFA 1K94A 2M7LA 2OTBA 4MZLA 2WISA 5DKQA 4P5OE 4ORCB 3CWGA 3NT3A 4W6KA 1EMAA 1J7OA 2QZ0A 2JQ6A 1S1EA 1UHJA 1EMLA 3VRNA 2BL0B 1EMMA 1GGWA 2DUGA 1YVHA 4JFGA 3O4YA 3DF0B 1EL4A 1OE9B 2QLEA 4HRGA 1DTLA 1V1GA 1NPQA 1DJXA 4UPGA 4ZF4A 4KGFA 2HQ8A 2SCPA 4W6SA 4RYWA 4CFQA 3PJ5A 3AKBA 2IB5A 4KAGA 4B30B 1Q4BA 3OHMB 2H8QA 5G08A 2WCEA 3U8PA 2QPTA 2K7BA 1SL7A 1XFUO 2I2RE 4C0LA 1G8IA 3EKHA 2F8PA 3DQAA 2BKHB 3SSLA 1UWOA 4Q9WA 1TNQA 2ZO7A 3IF7A 3CFFA 2KGBC 4N1GA 5T3IA 2CXJA 2KQ6A 4AQJA 3PJBA 4GPLB 2JT8A 4PHNA 3GJ1A 1YR5A 3CTNA 1Y0VH 4W6RA 1QVIZ 1CKKA 4P1QA 2O24A 2COLB 2DUFA 3NSKA 2M29A 4CIDA 3VK1A 5DTZA 2HCGA 3DQ4A 3P28A 3LSAA 3IQQA 4XJKB 1CM4A 1NCZA 2HQKA 4GESB 3QRXA 1XA9A 2F2OA 4XOWA 4MBEA 2H6VA 3AAKA 3DQ2A 2FJUB 3W1CA 5B8IB 2ARLA 3E3RA 2KYFA 2A56B 2HETA 1CLMA 4WQ2A 2Y1MA 1OMVA 2JXLA 2JT3A 1MHOA 2WIQA 1WRLA 3E5VA 1K96A 4ZB1A 3U0NA 2AWKA 2VAEA 4R6DA 3BX9A 1B9AA 2BCAA 3ICBA 2LC5A 4CPVA 3DPWA 1MOUA 4M2QA 1Q4EA 3ED8A 1B47A 2BCBA 4W7DA 1EMCA 2LHIA 3W1DA 3OX6A 3GEXA 4LW5A 1F09A 2EMNA 4C0KA 2WSNA 3WHUB 1FPWA 5CPVA 2KI6C 1MYWA 1DJHA 1KCYA 2G6EA 3MSEB 1OOJA 2L50A 4TZAA 3LK1A 2V4EC 1H4UA 1BU3A 4DXOA 5LTPA 1ZUXA 1AHRA 1NUBA 1SCMB 1CMFA 2DDDA 2G5ZB 3SIAA 5AEQA 4EULA 2AWLA 2ZMWA 3H1RA 1QV0A 2VADA 1H4BA 4H3MA 4HQ9A 1ZFSA 1TRFA 4D1EA 2KSPA 1XO5A 1XK4C 5ER4X 5KSZA 4U2VA 3DQDA 3KCTA 4H3NA 1ODBA 1L2OB 3DQ1A 3AAJA 1WLZA 1DGVA 1IWQA 3FS7A 1LA0A 2ZNDA 4PE1A 2LE9B 1A4PA 4N5XA 1JC0A 2H5OA 2HJOA 3I5IB 1XFXO 3CR4X 1A75A 4DIRA 2Y0GA 1JF0A 1SCVA 1CMGA 2QRFA 4XGYA 3CFAA 3K21A 4W6TA 5PALA 3DQUA 4EDSA 3SRYA 3SG5A 4DXMA 2MJWB 2PASA 2O5GA 4LQUA 1K9PA 1QATA 1B1GA 2KDHA 3WLCA 2KI4C 2JWWA 3G9AA 1J1DA 3ST3A 3PATA 2M97A 3CR2A 4Q04A 1B4CA 2LUXA 1FBVA 1KWOC 4GGFC 4W75A 3EVVA 5HYDA 4L1IA 2F33A 3SVRA 2LANA 3JVTC 1AVSA 2WOSA 2G3DB 4CLNA 4DXNA 3E5TA 3PJ7A 4RYSA 1C07A 2WCBA 4IK4A 1EXRA 4MRXA 4NDBA 1KFXL 2IS9A 1C4FA 2CBLA 2PALA 1UHIA 1YUSA 2OS8C 1H6RA 1QYFA 3CR5X 3UFZA 1OMRA 1QX7A 1RJVA 2A48A 1CFCA 3VRPA 1S6ZA 4NDDA 2Q57A 1JFJA 2AUCA 2G6YA 2GW3A 4W72A 4W6BA 1PK0D 3RWTA 2POXA 2LUCA 1DJIA 1KSMA 1VRKA 1Y6WA 2JNXA 1QY3A 1GQMA 1UHNA 4W73A 2JTTA 2CCMA 2GX0A 3KEVA 4I2YA 4W74A 4ZINA 2E6WA 3IQOA 4JF9A 1YX8A 3GB3A 3F45A 2HPWA 4H47A 1XYDA 1S3PA 2BBNA 1LVCD 2MLEC 1DJWA 4ZIOA 3PN7C 4OV2A 3LF4B 3VRRA 1IG5A 4ZCUA 4YRUA 3VICA 4NDCA 1CFDA 2K61A 3HCMA 5HZSA 1ALWA 4GBAA 4W6AA 1WY9A 3SVDA 1AJ4A 1N2DA 3C1VA 5EXCI 3DQKA 2QLGB 2KQYA 2ZN8A 4PDZA 4GAOA 2NLNA 2IB6A 5BTTB 4I5JA 3SSKA 1FI5A 2JOJA 1QS7A 4OJ0A 5BPJA 4Q7TA 1HCJA 2LAPA 2NCOA 1W7TA 3S05A 5J2OA 4KW8A 1E8AA 2WORA 2AH8A 1BR1B 2OPOA 4LJDC 2BKIB 2M8UA 4PPKA 3SVEA 4OHSA 4OKHA 1PVAA 1JFKA 2HPSA 2LP2A 1PVBA 1D1OA 2FOTA 2WCFA 4XOVA 5I8NA 1KYPA 5H87A 1F55A 1W7UA 3BUNB 2K0JA 2V4EB 4OVNF 4PCWA 4ZCVA 4OQWA 3AI5A 2C9IA 1CB1A 2LLUA 3DQLA 3BOWA 4W6HA 4FTGA 3DPXA 1NX2A 2M7NA 4PPLA 4WQ3A 1BOCA 4N3DA 2KOTA 4W6IA 2GGMA 2KBMA 5TNCA 5F9GA 3I5IC 4W6LA 3JTDC 4EMQA 2YFPA 1PALA 2MBXA 1CTRA 1C7VA 1BG1A 1MUXA 3VGOA 1Q80A 4RTCA 3VHTA 4MLWA 1JBYA 2JRFA 1YHGA 1CDMA 2HRSA 1QTXA 3TS5C 5JJGA 1S5GZ 1SPYA 1NCYA 3UG0A 3SSVA 5KTYA 1DF0B 3AKAA 3TMRA 1OSAA 5HBDA 1MWNA 1B7TY 1RMPA 3SV5A 2BBMA 2JULA 4WRIA 4ANJA 5DKRA 2I94A 3FWBA 2KI4B 5JOLA 2A47A 4YGEB 1M45A 1KWOB 4YGCB 3A4UB 4GF6B 1N65A 4XVPA 4DKMA 1RWYA 3BUMB 3OGOA 2H61A 4M2PA 3JVTB 2B3PA 5FYXA 1RK9A 4KA9A 2LV7A 2K7CA 1N0YA 2A46A 3GK4X 2NXQA 3A8RA 2IOVA 4IK5A 1QLKA 2OS8B 3VRQA 1S6JA 5ER5A 3ZUFA 4A4CA 2ZN9A 2L5XB 4HREE 4KEXA 3CGAA 1MXEA 2Z1OA 3DVJA 4OY4A 5HKZA 2LCPA 3OB2B 2OKWA 1TCOB 3D10A 1YZWA 3GK2A 1K95A 2K8MB 1OQPA 2QU1A 5F6TA 3SVCA 5AQBB 5I2OA 3ST4A 4ZF3A 1EG4A 2OTGC 3BXAA 4AR7A 1TTXA 2VRGA 1GJYA 1SNLA 1ZMZA 3D0YA 5HKWA 2ZRTA 1WLMA 2FL1A 5AXIA 2G2BA 2CTNA 4ZFSA 1SL8A 4AOMA 4W7CA 2Z6ZA 3PN7B 1YHIA 3CB9A 3NEZA 1RROA 1U5IA 1J7QA 5DRGA 4W6PA 1Y1UA 1EMEA 4KF4A 4MRYA 3EVUA 1BFPA 3H1OA 4QJ5B 4W6CA 5AERA 1NWDA 3OP0A 5IBWA 1SYMA 4W69A 5DQMA 5HZTA 1B8CA 2O60A 1QYQA 4ZF5A 4XYNA 3CGLA 1PSBA 1SBJA 5H89A 2A50B 2LP3A 4MSPA 4ETOA 3EVRA 2Z6XA 3M22A 5DPGA 5CSFA 4IZNA 1BLQA 1K9KA 4KPIA 1TN4A 2YDZA 5LTRA 3CFHA 3DQNA 5EB7A 1UP5A 4I5LB 1WRKA 2QACA 4DRWA 4JPZB 1EG3A 1MQ1A 1JBZA 2HQZA 2P4MA 4YGDB 4PALA 1TNXA 2FWQA 4HQ8A 4R6BA 1DMOA 5DY6A 1QX2A 1XAEA 3BOWB 3DQ7A 3NEDA 5J3XA 1SK6D 1DJYA 3PFVA 1KK8C 2EMOA 2RGIA 4W76A 3ADFA 3JTDB 5HW9A 2QT2A 3HX4A 2AMIA 5I2QA 2JADA 4M2OA 3PSRA 2BECA 4F0ZB 2WNDA 3WXAA 2VVIA 1R6PA 3IR8A 1CNPA 1F70A 1UHKA 3KF9A 1AP4A 3DF0A 3TS5B 4H3LA 1TCFA 2M49B 3MGFA 4NQGA 3DQ6A 3CD1A 3O2PA 1EMGA 2LMUA 2Q6PA 4IK8A 1A29A 1YJFA 3DD4A 1TNPA 2AHAA 4W6OA 4B30A 4W6GA 1W7SA 5DTYA 1DJZA 1KP5A 2EMDA 1FI6A 5DU0A 2KFGA 4GGFA 2DDCA 1JWDA 4CFRA 2M0RA 1OXFA 3VROA 3IP2A 1Q73A 3DVEA 3ST2A 1TNWA 1DJGA 4KF5A 1NIWA 2PXSA 1NCXA 3I5FC 2L0PA 4W7XA 1EMKA 1CM1A 1EJ3A 2HF5A 1XSSA 4PPJA 4QJ4B 3DQ5A 3WNXB 4YBHB 3GK1A 2D8NA 3LF3A 3DQJA 1KFUS 1RMOA 3LCPC 4BDUA 5BT0A 1KYRA 5I2LA 1JC2A 2FCEA 1IQ5A 1WRZA 1EMBA 1XA5A 4W6JA 1R2UA 3DVMA 4HRHA 5DKNA 3AI4A 3O77A 3U0KA 2KFFA 1NSHA 1M46A 4XJKA 1CV7A 2P6BB 1FW4A 2AAOA 1IKUA 2E30A 2OTGB 1M39A 1LINA 2PRUA 1RM9A 4USLA 2BCXA 2QLIA 3DQIA 4XL5A 5FVIA 3SVBA 5FVGA 5DPIA 1IH0A 1ALVA 1CFPA 2G6XA 4W7AA 1UISA 1IRJA 4W7FA 5EXUA 4DCKA 3DQMA 2MLFC 1OMDA 1V1FA 3K1KA 5HZOA 4JWQA 1RTP1 3NF0A 2HFCA 1KFUL 2WURA 3SVSA 1QIVA 1U5IB 3CZTX 4GGNA 1AJ5A 1AK8A 2M1KB 4PE0A 3DQ8A 1ZGPA 5CSNA 1MOVA 1J7PA 2JZIA 3U8AA 2IE2A 5D69A 5HGEA 1S6CA 2G2SB 3EKJA 3SG2A 4LJDA 2L98A 4DXPA 2KNEA 4W6NA 1KQMC 1SL9A 4IK9A 1XFWO 3OSQA 2DUHA 4W7EA 5CSJA 4KW9A 3SSTA 4YGBB 2LNKA 2CT9A 3DQHA 1EMFA 3GL4A 4FQOA 1MF8B 2LVKA 2H5QA 4OR9B 2KAXA 1NX1A 4H48A 1QVIY 1MR8A 3LVAA 3O78A 3EK7A 5FVFA 3RWAA 2F3ZA 4W7RA 2Q4UA 5HLVA 3M24A 2MAZA 4I5KA 3OB1B 1K90D 1C7WA 4DXIA 1F4QA 1XQMA 3DQ9A 1OZOA 3ZTFA 4KW4A 1Q4AA 4IK3A 4J89A 3TUYB 4AS8A 1QYOA 2EC6C 1EH2A 1K9UA 1KK8B 2H5RA 3OX5A 1QLSA 4A4BA 3SVUA 3AKOA 2KHNA 4J8AA 5EHUA 2MHHA 5HLOA 1F54A 2LLTA 2BE6A 3DQCA 1A75B 4PE4A 2JT0A 2L4HA 1B8LA 1Y1AA 1ZUZA 2PXWA 4LJCA 4PHJA 1SRAA 2L51A 2ISDA 4DKNA 1KSOA 3BQ3A 3LA1A 3TDUA 1XMZA 4OGSA 4ZBLA 2K7OA 4ORBB 4YI9A 4YGAA 2L2EA 3DPZA 2JTZA 3LVDA 1A2XA 4W6DA 2H5PA 5KU1A 3NXAA 3BUXB 1RMMA 1JF2A 4GFTA 2EHBA 1ZGOA 2JC2A 3GJ2A 1QIWA 2FZUA 1BODA 1G7KA 4IL1A 2B3QA 3LL8B 2NCPA 1J7RA 2DUIA 1YJ2A 2H61C 1UURA 4W77A 4KGEA 2AWMA 1NP8A 3I5FB 3SSYA 2VVJA 2LVIA 3ZULA 3PALA 1QXPA 5H88A 2DD9A 3TMTA 1SY9A 4PE7A 3FWCA 1LA3A 4PHKA 1CDPA 4JQ0D 2YE0A 4GUKA 2ZKMX 4DXQA 1K8UA 2A53B 2MRDA 1BF5A 3BXKA 3KPXA 2SASA 4OCIA 4P2YB 3PLFB 2M3WA 4Z4KA 4LQTA 1MXLC 3NSOA 1CFFA 3TZ1A 5CSIA 1YX7A 1NX0A 2DD7A 2MA2A 3CBEA 5DTXA 1JUOA 4Q7UA 2WC8A 2C9JA 2QLGA 2KAYA 2O2BA 2G16B 1IJ5A 2H2KA 5BTTA 1GGXA 1YUTA 3RM1A 3I5GC 5AFPA 5DQBA 4C0JA 5HZUA 1B7TZ 4MVFA 1JSAA 2JNFA 2L4IA 2R2IA 1KK7Y 3SVOA 1HT9A 1F71A 1SR6C 3U8CA 2KGRA 3WHTB 1BT6A 1LXFC 4ICBA 1PULA 4MZKA 2Y1NA 5DTLA 1M63B 4Q7RA 1KYSA 5HKYA 5K89A 5DRFA 1Y1XA 4L12A 3SG7A 5AANA 2LMTA 1KQMB 1YRTB 4E68A 2F2PA 2V4EA 3DQ3A 1RECA 1JC1A 3WLDA 5EB6A 1YTZC 1WDCB 4IK1A 1HQVA 3BUOB 4TNCA 3FIAA 2JU0A 1BMOA 1BR4B 1IGVA 2WHTA 3SJSA 4JEOA 1A03A 3LK0A 2DUEA 3I5HC 2M1UA 1XK4A 5LK4A 5GQQC 2YE1A 1DT7B 1F0BA 4L13A 1S26D 3P8UA 3TUYC 1TIZA 3CLNA 1GGZA 4L9MA 5KTGA 4GNKB 3M0WA 4DUQA 1PRWA 2Z6YA 1YVLA 2CNPA 3KHEA 4I5NB 1FF1A 1DVIA 1KFXS 2LHLA 2K7DA 2EC6B 2LVVA 4Z4MA 2WHSA 1S36A 3SSPA 1SMGA 3SG6A 1DF0A 1CLLA 1X02A 1AUIB 1YHHA 3BYAA 3GOFA 4UTSA 3NSIA 1F4OA 1YFPA 2WSOA 4EN1A 1RRXA 2KYCA 3VHTB 4MEWA 2BL0C 2H9WA 4P76A 3KCSA 3SG3A 1SKTA 2OJKA 2O29A 4BY5A 2PSRA 3LVCA 4HQCA 2JPTA 1LKJA 2LM5A 4GOBA 3SS0A 1G33A 2KI6D 3ZUJA 2ZMUA 4HSZA 1ZGQA 2K2FA 4QJ3B 1KK7Z 2ZNEA 2ICRA 3EK8A 2BTJA 2LVJA 1JBAA 1YUUA 5EBJA 3RLZA 5FHVA 2KBIA 4ORAB 1CLBA 1TOPA 3TDIA 1OXEA 3V3DA 4KF5C 3I19A 1RFJA 1HUYA 3WCKA 3ZWHA 1G4YR 2OTEA 4NWSA 3TDZA 3NSLA 5EXBA 2Y5IA 1H8BA 3PM8A 1J1EA 1QXTA 4N1FA 2LLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JC2 A;  2ZRS A;  4AQI A;  2TN4 A;  2K2A A;  3SG4 A;  4BY4 A;  2BE4 A;  3CD9 A;  1B8R A;  4ORN A;  1XFV O;  4PFE A;  4JRB A;  2HQW A;  1NX3 A;  1OXD A;  2M9G A;  1UHH A;  2I18 A;  2A4J A;  5D7F A;  1K2H A;  1XVJ A;  3DQE A;  1QJT A;  3LLE A;  2ZFD A;  2ZO6 A;  4R1E A;  4PHM A;  4J88 A;  2OGR A;  3ST0 A;  1S5G Y;  1Z1P A;  3BUW B;  3D0Y B;  1DGU A;  1NYA A;  2OKY A;  2GV5 A;  4W6U A;  3DQF A;  3EVP A;  2KAV A;  4MN0 A;  1YRU B;  2PVB A;  2AWJ A;  1UUS A;  2V53 A;  2GX2 A;  3U0L A;  2HGD A;  3CS1 A;  3KO0 A;  2Y4Q A;  3I5G B;  2I7A A;  1SW8 A;  4HVF A;  2VVH A;  1Z1Q A;  4B5Y A;  3A8S A;  3BXC A;  2B1U A;  5EJU A;  3OSR A;  5LTQ A;  1SR6 B;  4MZJ A;  4LJB A;  2F3Y A;  1F8H A;  1B9C A;  2HGY A;  4JGE A;  3H4S E;  4DS7 A;  4W6F A;  1XFY O;  1ZOT B;  3ZNI A;  3E5W A;  1K93 D;  1Q4C A;  4YI8 A;  2GGZ A;  4U8D A;  3O6B A;  1Q4D A;  2Q91 A;  2A52 B;  1WDC C;  1S6I A;  1OZS A;  3PIB A;  2KFH A;  1PSR A;  2VZX A;  3DVK A;  1W7J B;  2RH7 A;  3SIB A;  1L7Z A;  2G9B A;  4HE4 A;  1SCM C;  1J55 A;  1KQV A;  2DOQ A;  4W6M A;  5DPH A;  1CDL A;  2FCD A;  1XFZ O;  3LS3 A;  1YUR A;  2WHU A;  1CDN A;  2A54 B;  3SSH A;  3I5H B;  2NZ0 A;  2GW4 B;  1ZAC A;  1GFL A;  1QAS A;  4Q9X A;  2G3O A;  2JXC A;  2PMY A;  1W7I B;  3U0M A;  2LMV A;  3EK4 A;  3DQO A;  1L2O C;  1QV1 A;  1IQ3 A;  3BXB A;  4TZG A;  5BQL A;  3SVN A;  2QLH A;  1IJ6 A;  4EDO A;  1QX5 B;  5DPJ A;  2EGD A;  3NT9 A;  1GL4 A;  1M31 A;  1BJF A;  1K94 A;  2M7L A;  2OTB A;  4MZL A;  2WIS A;  5DKQ A;  4P5O E;  4ORC B;  3CWG A;  3NT3 A;  4W6K A;  1EMA A;  1J7O A;  2QZ0 A;  2JQ6 A;  1S1E A;  1UHJ A;  1EML A;  3VRN A;  2BL0 B;  1EMM A;  1GGW A;  2DUG A;  1YVH A;  4JFG A;  3O4Y A;  3DF0 B;  1EL4 A;  1OE9 B;  2QLE A;  4HRG A;  1DTL A;  1V1G A;  1NPQ A;  1DJX A;  4UPG A;  4ZF4 A;  4KGF A;  2HQ8 A;  2SCP A;  4W6S A;  4RYW A;  4CFQ A;  3PJ5 A;  3AKB A;  2IB5 A;  4KAG A;  4B30 B;  1Q4B A;  3OHM B;  2H8Q A;  5G08 A;  2WCE A;  3U8P A;  2QPT A;  2K7B A;  1SL7 A;  1XFU O;  2I2R E;  4C0L A;  1G8I A;  3EKH A;  2F8P A;  3DQA A;  2BKH B;  3SSL A;  1UWO A;  4Q9W A;  1TNQ A;  2ZO7 A;  3IF7 A;  3CFF A;  2KGB C;  4N1G A;  5T3I A;  2CXJ A;  2KQ6 A;  4AQJ A;  3PJB A;  4GPL B;  2JT8 A;  4PHN A;  3GJ1 A;  1YR5 A;  3CTN A;  1Y0V H;  4W6R A;  1QVI Z;  1CKK A;  4P1Q A;  2O24 A;  2COL B;  2DUF A;  3NSK A;  2M29 A;  4CID A;  3VK1 A;  5DTZ A;  2HCG A;  3DQ4 A;  3P28 A;  3LSA A;  3IQQ A;  4XJK B;  1CM4 A;  1NCZ A;  2HQK A;  4GES B;  3QRX A;  1XA9 A;  2F2O A;  4XOW A;  4MBE A;  2H6V A;  3AAK A;  3DQ2 A;  2FJU B;  3W1C A;  5B8I B;  2ARL A;  3E3R A;  2KYF A;  2A56 B;  2HET A;  1CLM A;  4WQ2 A;  2Y1M A;  1OMV A;  2JXL A;  2JT3 A;  1MHO A;  2WIQ A;  1WRL A;  3E5V A;  1K96 A;  4ZB1 A;  3U0N A;  2AWK A;  2VAE A;  4R6D A;  3BX9 A;  1B9A A;  2BCA A;  3ICB A;  2LC5 A;  4CPV A;  3DPW A;  1MOU A;  4M2Q A;  1Q4E A;  3ED8 A;  1B47 A;  2BCB A;  4W7D A;  1EMC A;  2LHI A;  3W1D A;  3OX6 A;  3GEX A;  4LW5 A;  1F09 A;  2EMN A;  4C0K A;  2WSN A;  3WHU B;  1FPW A;  5CPV A;  2KI6 C;  1MYW A;  1DJH A;  1KCY A;  2G6E A;  3MSE B;  1OOJ A;  2L50 A;  4TZA A;  3LK1 A;  2V4E C;  1H4U A;  1BU3 A;  4DXO A;  5LTP A;  1ZUX A;  1AHR A;  1NUB A;  1SCM B;  1CMF A;  2DDD A;  2G5Z B;  3SIA A;  5AEQ A;  4EUL A;  2AWL A;  2ZMW A;  3H1R A;  1QV0 A;  2VAD A;  1H4B A;  4H3M A;  4HQ9 A;  1ZFS A;  1TRF A;  4D1E A;  2KSP A;  1XO5 A;  1XK4 C;  5ER4 X;  5KSZ A;  4U2V A;  3DQD A;  3KCT A;  4H3N A;  1ODB A;  1L2O B;  3DQ1 A;  3AAJ A;  1WLZ A;  1DGV A;  1IWQ A;  3FS7 A;  1LA0 A;  2ZND A;  4PE1 A;  2LE9 B;  1A4P A;  4N5X A;  1JC0 A;  2H5O A;  2HJO A;  3I5I B;  1XFX O;  3CR4 X;  1A75 A;  4DIR A;  2Y0G A;  1JF0 A;  1SCV A;  1CMG A;  2QRF A;  4XGY A;  3CFA A;  3K21 A;  4W6T A;  5PAL A;  3DQU A;  4EDS A;  3SRY A;  3SG5 A;  4DXM A;  2MJW B;  2PAS A;  2O5G A;  4LQU A;  1K9P A;  1QAT A;  1B1G A;  2KDH A;  3WLC A;  2KI4 C;  2JWW A;  3G9A A;  1J1D A;  3ST3 A;  3PAT A;  2M97 A;  3CR2 A;  4Q04 A;  1B4C A;  2LUX A;  1FBV A;  1KWO C;  4GGF C;  4W75 A;  3EVV A;  5HYD A;  4L1I A;  2F33 A;  3SVR A;  2LAN A;  3JVT C;  1AVS A;  2WOS A;  2G3D B;  4CLN A;  4DXN A;  3E5T A;  3PJ7 A;  4RYS A;  1C07 A;  2WCB A;  4IK4 A;  1EXR A;  4MRX A;  4NDB A;  1KFX L;  2IS9 A;  1C4F A;  2CBL A;  2PAL A;  1UHI A;  1YUS A;  2OS8 C;  1H6R A;  1QYF A;  3CR5 X;  3UFZ A;  1OMR A;  1QX7 A;  1RJV A;  2A48 A;  1CFC A;  3VRP A;  1S6Z A;  4NDD A;  2Q57 A;  1JFJ A;  2AUC A;  2G6Y A;  2GW3 A;  4W72 A;  4W6B A;  1PK0 D;  3RWT A;  2POX A;  2LUC A;  1DJI A;  1KSM A;  1VRK A;  1Y6W A;  2JNX A;  1QY3 A;  1GQM A;  1UHN A;  4W73 A;  2JTT A;  2CCM A;  2GX0 A;  3KEV A;  4I2Y A;  4W74 A;  4ZIN A;  2E6W A;  3IQO A;  4JF9 A;  1YX8 A;  3GB3 A;  3F45 A;  2HPW A;  4H47 A;  1XYD A;  1S3P A;  2BBN A;  1LVC D;  2MLE C;  1DJW A;  4ZIO A;  3PN7 C;  4OV2 A;  3LF4 B;  3VRR A;  1IG5 A;  4ZCU A;  4YRU A;  3VIC A;  4NDC A;  1CFD A;  2K61 A;  3HCM A;  5HZS A;  1ALW A;  4GBA A;  4W6A A;  1WY9 A;  3SVD A;  1AJ4 A;  1N2D A;  3C1V A;  5EXC I;  3DQK A;  2QLG B;  2KQY A;  2ZN8 A;  4PDZ A;  4GAO A;  2NLN A;  2IB6 A;  5BTT B;  4I5J A;  3SSK A;  1FI5 A;  2JOJ A;  1QS7 A;  4OJ0 A;  5BPJ A;  4Q7T A;  1HCJ A;  2LAP A;  2NCO A;  1W7T A;  3S05 A;  5J2O A;  4KW8 A;  1E8A A;  2WOR A;  2AH8 A;  1BR1 B;  2OPO A;  4LJD C;  2BKI B;  2M8U A;  4PPK A;  3SVE A;  4OHS A;  4OKH A;  1PVA A;  1JFK A;  2HPS A;  2LP2 A;  1PVB A;  1D1O A;  2FOT A;  2WCF A;  4XOV A;  5I8N A;  1KYP A;  5H87 A;  1F55 A;  1W7U A;  3BUN B;  2K0J A;  2V4E B;  4OVN F;  4PCW A;  4ZCV A;  4OQW A;  3AI5 A;  2C9I A;  1CB1 A;  2LLU A;  3DQL A;  3BOW A;  4W6H A;  4FTG A;  3DPX A;  1NX2 A;  2M7N A;  4PPL A;  4WQ3 A;  1BOC A;  4N3D A;  2KOT A;  4W6I A;  2GGM A;  2KBM A;  5TNC A;  5F9G A;  3I5I C;  4W6L A;  3JTD C;  4EMQ A;  2YFP A;  1PAL A;  2MBX A;  1CTR A;  1C7V A;  1BG1 A;  1MUX A;  3VGO A;  1Q80 A;  4RTC A;  3VHT A;  4MLW A;  1JBY A;  2JRF A;  1YHG A;  1CDM A;  2HRS A;  1QTX A;  3TS5 C;  5JJG A;  1S5G Z;  1SPY A;  1NCY A;  3UG0 A;  3SSV A;  5KTY A;  1DF0 B;  3AKA A;  3TMR A;  1OSA A;  5HBD A;  1MWN A;  1B7T Y;  1RMP A;  3SV5 A;  2BBM A;  2JUL A;  4WRI A;  4ANJ A;  5DKR A;  2I94 A;  3FWB A;  2KI4 B;  5JOL A;  2A47 A;  4YGE B;  1M45 A;  1KWO B;  4YGC B;  3A4U B;  4GF6 B;  1N65 A;  4XVP A;  4DKM A;  1RWY A;  3BUM B;  3OGO A;  2H61 A;  4M2P A;  3JVT B;  2B3P A;  5FYX A;  1RK9 A;  4KA9 A;  2LV7 A;  2K7C A;  1N0Y A;  2A46 A;  3GK4 X;  2NXQ A;  3A8R A;  2IOV A;  4IK5 A;  1QLK A;  2OS8 B;  3VRQ A;  1S6J A;  5ER5 A;  3ZUF A;  4A4C A;  2ZN9 A;  2L5X B;  4HRE E;  4KEX A;  3CGA A;  1MXE A;  2Z1O A;  3DVJ A;  4OY4 A;  5HKZ A;  2LCP A;  3OB2 B;  2OKW A;  1TCO B;  3D10 A;  1YZW A;  3GK2 A;  1K95 A;  2K8M B;  1OQP A;  2QU1 A;  5F6T A;  3SVC A;  5AQB B;  5I2O A;  3ST4 A;  4ZF3 A;  1EG4 A;  2OTG C;  3BXA A;  4AR7 A;  1TTX A;  2VRG A;  1GJY A;  1SNL A;  1ZMZ A;  3D0Y A;  5HKW A;  2ZRT A;  1WLM A;  2FL1 A;  5AXI A;  2G2B A;  2CTN A;  4ZFS A;  1SL8 A;  4AOM A;  4W7C A;  2Z6Z A;  3PN7 B;  1YHI A;  3CB9 A;  3NEZ A;  1RRO A;  1U5I A;  1J7Q A;  5DRG A;  4W6P A;  1Y1U A;  1EME A;  4KF4 A;  4MRY A;  3EVU A;  1BFP A;  3H1O A;  4QJ5 B;  4W6C A;  5AER A;  1NWD A;  3OP0 A;  5IBW A;  1SYM A;  4W69 A;  5DQM A;  5HZT A;  1B8C A;  2O60 A;  1QYQ A;  4ZF5 A;  4XYN A;  3CGL A;  1PSB A;  1SBJ A;  5H89 A;  2A50 B;  2LP3 A;  4MSP A;  4ETO A;  3EVR A;  2Z6X A;  3M22 A;  5DPG A;  5CSF A;  4IZN A;  1BLQ A;  1K9K A;  4KPI A;  1TN4 A;  2YDZ A;  5LTR A;  3CFH A;  3DQN A;  5EB7 A;  1UP5 A;  4I5L B;  1WRK A;  2QAC A;  4DRW A;  4JPZ B;  1EG3 A;  1MQ1 A;  1JBZ A;  2HQZ A;  2P4M A;  4YGD B;  4PAL A;  1TNX A;  2FWQ A;  4HQ8 A;  4R6B A;  1DMO A;  5DY6 A;  1QX2 A;  1XAE A;  3BOW B;  3DQ7 A;  3NED A;  5J3X A;  1SK6 D;  1DJY A;  3PFV A;  1KK8 C;  2EMO A;  2RGI A;  4W76 A;  3ADF A;  3JTD B;  5HW9 A;  2QT2 A;  3HX4 A;  2AMI A;  5I2Q A;  2JAD A;  4M2O A;  3PSR A;  2BEC A;  4F0Z B;  2WND A;  3WXA A;  2VVI A;  1R6P A;  3IR8 A;  1CNP A;  1F70 A;  1UHK A;  3KF9 A;  1AP4 A;  3DF0 A;  3TS5 B;  4H3L A;  1TCF A;  2M49 B;  3MGF A;  4NQG A;  3DQ6 A;  3CD1 A;  3O2P A;  1EMG A;  2LMU A;  2Q6P A;  4IK8 A;  1A29 A;  1YJF A;  3DD4 A;  1TNP A;  2AHA A;  4W6O A;  4B30 A;  4W6G A;  1W7S A;  5DTY A;  1DJZ A;  1KP5 A;  2EMD A;  1FI6 A;  5DU0 A;  2KFG A;  4GGF A;  2DDC A;  1JWD A;  4CFR A;  2M0R A;  1OXF A;  3VRO A;  3IP2 A;  1Q73 A;  3DVE A;  3ST2 A;  1TNW A;  1DJG A;  4KF5 A;  1NIW A;  2PXS A;  1NCX A;  3I5F C;  2L0P A;  4W7X A;  1EMK A;  1CM1 A;  1EJ3 A;  2HF5 A;  1XSS A;  4PPJ A;  4QJ4 B;  3DQ5 A;  3WNX B;  4YBH B;  3GK1 A;  2D8N A;  3LF3 A;  3DQJ A;  1KFU S;  1RMO A;  3LCP C;  4BDU A;  5BT0 A;  1KYR A;  5I2L A;  1JC2 A;  2FCE A;  1IQ5 A;  1WRZ A;  1EMB A;  1XA5 A;  4W6J A;  1R2U A;  3DVM A;  4HRH A;  5DKN A;  3AI4 A;  3O77 A;  3U0K A;  2KFF A;  1NSH A;  1M46 A;  4XJK A;  1CV7 A;  2P6B B;  1FW4 A;  2AAO A;  1IKU A;  2E30 A;  2OTG B;  1M39 A;  1LIN A;  2PRU A;  1RM9 A;  4USL A;  2BCX A;  2QLI A;  3DQI A;  4XL5 A;  5FVI A;  3SVB A;  5FVG A;  5DPI A;  1IH0 A;  1ALV A;  1CFP A;  2G6X A;  4W7A A;  1UIS A;  1IRJ A;  4W7F A;  5EXU A;  4DCK A;  3DQM A;  2MLF C;  1OMD A;  1V1F A;  3K1K A;  5HZO A;  4JWQ A;  1RTP 1;  3NF0 A;  2HFC A;  1KFU L;  2WUR A;  3SVS A;  1QIV A;  1U5I B;  3CZT X;  4GGN A;  1AJ5 A;  1AK8 A;  2M1K B;  4PE0 A;  3DQ8 A;  1ZGP A;  5CSN A;  1MOV A;  1J7P A;  2JZI A;  3U8A A;  2IE2 A;  5D69 A;  5HGE A;  1S6C A;  2G2S B;  3EKJ A;  3SG2 A;  4LJD A;  2L98 A;  4DXP A;  2KNE A;  4W6N A;  1KQM C;  1SL9 A;  4IK9 A;  1XFW O;  3OSQ A;  2DUH A;  4W7E A;  5CSJ A;  4KW9 A;  3SST A;  4YGB B;  2LNK A;  2CT9 A;  3DQH A;  1EMF A;  3GL4 A;  4FQO A;  1MF8 B;  2LVK A;  2H5Q A;  4OR9 B;  2KAX A;  1NX1 A;  4H48 A;  1QVI Y;  1MR8 A;  3LVA A;  3O78 A;  3EK7 A;  5FVF A;  3RWA A;  2F3Z A;  4W7R A;  2Q4U A;  5HLV A;  3M24 A;  2MAZ A;  4I5K A;  3OB1 B;  1K90 D;  1C7W A;  4DXI A;  1F4Q A;  1XQM A;  3DQ9 A;  1OZO A;  3ZTF A;  4KW4 A;  1Q4A A;  4IK3 A;  4J89 A;  3TUY B;  4AS8 A;  1QYO A;  2EC6 C;  1EH2 A;  1K9U A;  1KK8 B;  2H5R A;  3OX5 A;  1QLS A;  4A4B A;  3SVU A;  3AKO A;  2KHN A;  4J8A A;  5EHU A;  2MHH A;  5HLO A;  1F54 A;  2LLT A;  2BE6 A;  3DQC A;  1A75 B;  4PE4 A;  2JT0 A;  2L4H A;  1B8L A;  1Y1A A;  1ZUZ A;  2PXW A;  4LJC A;  4PHJ A;  1SRA A;  2L51 A;  2ISD A;  4DKN A;  1KSO A;  3BQ3 A;  3LA1 A;  3TDU A;  1XMZ A;  4OGS A;  4ZBL A;  2K7O A;  4ORB B;  4YI9 A;  4YGA A;  2L2E A;  3DPZ A;  2JTZ A;  3LVD A;  1A2X A;  4W6D A;  2H5P A;  5KU1 A;  3NXA A;  3BUX B;  1RMM A;  1JF2 A;  4GFT A;  2EHB A;  1ZGO A;  2JC2 A;  3GJ2 A;  1QIW A;  2FZU A;  1BOD A;  1G7K A;  4IL1 A;  2B3Q A;  3LL8 B;  2NCP A;  1J7R A;  2DUI A;  1YJ2 A;  2H61 C;  1UUR A;  4W77 A;  4KGE A;  2AWM A;  1NP8 A;  3I5F B;  3SSY A;  2VVJ A;  2LVI A;  3ZUL A;  3PAL A;  1QXP A;  5H88 A;  2DD9 A;  3TMT A;  1SY9 A;  4PE7 A;  3FWC A;  1LA3 A;  4PHK A;  1CDP A;  4JQ0 D;  2YE0 A;  4GUK A;  2ZKM X;  4DXQ A;  1K8U A;  2A53 B;  2MRD A;  1BF5 A;  3BXK A;  3KPX A;  2SAS A;  4OCI A;  4P2Y B;  3PLF B;  2M3W A;  4Z4K A;  4LQT A;  1MXL C;  3NSO A;  1CFF A;  3TZ1 A;  5CSI A;  1YX7 A;  1NX0 A;  2DD7 A;  2MA2 A;  3CBE A;  5DTX A;  1JUO A;  4Q7U A;  2WC8 A;  2C9J A;  2QLG A;  2KAY A;  2O2B A;  2G16 B;  1IJ5 A;  2H2K A;  5BTT A;  1GGX A;  1YUT A;  3RM1 A;  3I5G C;  5AFP A;  5DQB A;  4C0J A;  5HZU A;  1B7T Z;  4MVF A;  1JSA A;  2JNF A;  2L4I A;  2R2I A;  1KK7 Y;  3SVO A;  1HT9 A;  1F71 A;  1SR6 C;  3U8C A;  2KGR A;  3WHT B;  1BT6 A;  1LXF C;  4ICB A;  1PUL A;  4MZK A;  2Y1N A;  5DTL A;  1M63 B;  4Q7R A;  1KYS A;  5HKY A;  5K89 A;  5DRF A;  1Y1X A;  4L12 A;  3SG7 A;  5AAN A;  2LMT A;  1KQM B;  1YRT B;  4E68 A;  2F2P A;  2V4E A;  3DQ3 A;  1REC A;  1JC1 A;  3WLD A;  5EB6 A;  1YTZ C;  1WDC B;  4IK1 A;  1HQV A;  3BUO B;  4TNC A;  3FIA A;  2JU0 A;  1BMO A;  1BR4 B;  1IGV A;  2WHT A;  3SJS A;  4JEO A;  1A03 A;  3LK0 A;  2DUE A;  3I5H C;  2M1U A;  1XK4 A;  5LK4 A;  5GQQ C;  2YE1 A;  1DT7 B;  1F0B A;  4L13 A;  1S26 D;  3P8U A;  3TUY C;  1TIZ A;  3CLN A;  1GGZ A;  4L9M A;  5KTG A;  4GNK B;  3M0W A;  4DUQ A;  1PRW A;  2Z6Y A;  1YVL A;  2CNP A;  3KHE A;  4I5N B;  1FF1 A;  1DVI A;  1KFX S;  2LHL A;  2K7D A;  2EC6 B;  2LVV A;  4Z4M A;  2WHS A;  1S36 A;  3SSP A;  1SMG A;  3SG6 A;  1DF0 A;  1CLL A;  1X02 A;  1AUI B;  1YHH A;  3BYA A;  3GOF A;  4UTS A;  3NSI A;  1F4O A;  1YFP A;  2WSO A;  4EN1 A;  1RRX A;  2KYC A;  3VHT B;  4MEW A;  2BL0 C;  2H9W A;  4P76 A;  3KCS A;  3SG3 A;  1SKT A;  2OJK A;  2O29 A;  4BY5 A;  2PSR A;  3LVC A;  4HQC A;  2JPT A;  1LKJ A;  2LM5 A;  4GOB A;  3SS0 A;  1G33 A;  2KI6 D;  3ZUJ A;  2ZMU A;  4HSZ A;  1ZGQ A;  2K2F A;  4QJ3 B;  1KK7 Z;  2ZNE A;  2ICR A;  3EK8 A;  2BTJ A;  2LVJ A;  1JBA A;  1YUU A;  5EBJ A;  3RLZ A;  5FHV A;  2KBI A;  4ORA B;  1CLB A;  1TOP A;  3TDI A;  1OXE A;  3V3D A;  4KF5 C;  3I19 A;  1RFJ A;  1HUY A;  3WCK A;  3ZWH A;  1G4Y R;  2OTE A;  4NWS A;  3TDZ A;  3NSL A;  5EXB A;  2Y5I A;  1H8B A;  3PM8 A;  1J1E A;  1QXT A;  4N1F A;  2LLS A; 
#chains in the Genus database with same CATH topology
 4JC2 A;  2ZRS A;  4AQI A;  2TN4 A;  2K2A A;  3SG4 A;  4BY4 A;  2BE4 A;  3CD9 A;  1B8R A;  4ORN A;  1XFV O;  4PFE A;  4JRB A;  2HQW A;  4IJ7 A;  1NX3 A;  1OXD A;  2M9G A;  1UHH A;  2I18 A;  2A4J A;  3EG5 B;  5D7F A;  1K2H A;  1XVJ A;  3DQE A;  2K60 A;  1QJT A;  3LLE A;  2ZFD A;  2ZO6 A;  4R1E A;  4PHM A;  4J88 A;  2OGR A;  3ST0 A;  1S5G Y;  1Z1P A;  3BUW B;  3D0Y B;  1DGU A;  1NYA A;  2OKY A;  2GV5 A;  4W6U A;  3DQF A;  3EVP A;  1IIO A;  2KAV A;  4MN0 A;  1YRU B;  2PVB A;  2AWJ A;  1UUS A;  2V53 A;  2GX2 A;  3U0L A;  2HGD A;  3CDN A;  3CS1 A;  3KO0 A;  2Y4Q A;  2ERB A;  1W9Z A;  3I5G B;  2I7A A;  1SW8 A;  4HVF A;  2VVH A;  2KLD A;  1Z1Q A;  4B5Y A;  3A8S A;  3BXC A;  2B1U A;  5EJU A;  3OSR A;  2WCK A;  5LTQ A;  1SR6 B;  4MZJ A;  4LJB A;  2F3Y A;  1F8H A;  1B9C A;  2HGY A;  4JGE A;  3H4S E;  4DS7 A;  4W6F A;  1XFY O;  1ZOT B;  3ZNI A;  3E5W A;  1K93 D;  1Q4C A;  3UNW A;  4YI8 A;  2GGZ A;  4U8D A;  3O6B A;  1Q4D A;  2Q91 A;  2A52 B;  1WDC C;  1S6I A;  1OZS A;  3PIB A;  2KFH A;  1PSR A;  2VZX A;  3DVK A;  1W7J B;  2RH7 A;  3SIB A;  1L7Z A;  2G9B A;  3BFH A;  3CZ1 A;  4HE4 A;  1SCM C;  1J55 A;  1KQV A;  2DOQ A;  4W6M A;  5DPH A;  1CDL A;  2FCD A;  1XFZ O;  3LS3 A;  1YUR A;  2WHU A;  1CDN A;  2A54 B;  3SSH A;  3I5H B;  2NZ0 A;  2GW4 B;  1ZAC A;  1GFL A;  1QAS A;  4Q9X A;  2G3O A;  2JXC A;  2PMY A;  1W7I B;  3U0M A;  2LMV A;  3EK4 A;  3DQO A;  2L5Y A;  1L2O C;  1QV1 A;  3QME A;  1IQ3 A;  3BXB A;  4TZG A;  5BQL A;  3SVN A;  2QLH A;  1IJ6 A;  4EDO A;  1QX5 B;  5DPJ A;  2EGD A;  3OBV A;  3NT9 A;  1GL4 A;  1M31 A;  1BJF A;  1K94 A;  2M7L A;  2OTB A;  4MZL A;  2WIS A;  5DKQ A;  4P5O E;  4ORC B;  3CWG A;  4JD9 A;  3NT3 A;  1EMA A;  4W6K A;  1J7O A;  2QZ0 A;  4JKT A;  2JQ6 A;  1S1E A;  3S0G A;  1UHJ A;  1EML A;  3VRN A;  2BL0 B;  1EMM A;  1GGW A;  2DUG A;  1YVH A;  4JFG A;  3O4Y A;  3DF0 B;  1EL4 A;  1OE9 B;  2QLE A;  2QDI A;  4HRG A;  1DTL A;  1V1G A;  1NPQ A;  1LS8 A;  1DJX A;  4UPG A;  4ZF4 A;  4KGF A;  2HQ8 A;  2SCP A;  3FE8 A;  4KYN A;  4RYW A;  4W6S A;  4CFQ A;  3PJ5 A;  3AKB A;  2IB5 A;  4KAG A;  4B30 B;  1Q4B A;  3UO9 A;  3OHM B;  3R1O A;  2H8Q A;  5G08 A;  2WCE A;  5D3O A;  3U8P A;  2QPT A;  3BFB A;  2K7B A;  1SL7 A;  1XFU O;  1C3Y A;  2I2R E;  4C0L A;  1G8I A;  3EKH A;  2F8P A;  3DQA A;  2KPH A;  2BKH B;  3DYE A;  3SSL A;  1UWO A;  4Q9W A;  1TNQ A;  2ZO7 A;  3IF7 A;  3CFF A;  2KGB C;  4N1G A;  5T3I A;  1TUZ A;  2CXJ A;  2KQ6 A;  4AQJ A;  3PJB A;  4GPL B;  2JT8 A;  4PHN A;  3GJ1 A;  1YR5 A;  3CTN A;  1XFR A;  1Y0V H;  4W6R A;  1QVI Z;  1CKK A;  4P1Q A;  2O24 A;  2COL B;  2DUF A;  3NSK A;  2M29 A;  4CID A;  3V2L A;  3VK1 A;  5DTZ A;  1OOF A;  2HCG A;  1ORG A;  3DQ4 A;  3P28 A;  3LSA A;  3IQQ A;  4XJK B;  1DEK A;  1CM4 A;  1NCZ A;  2HQK A;  4GES B;  3QRX A;  1XA9 A;  2F2O A;  4XOW A;  4MBE A;  2H6V A;  3AAK A;  3DQ2 A;  2WCJ A;  2FJU B;  3S0E A;  3W1C A;  1DQE A;  5B8I B;  2ARL A;  3E3R A;  2KYF A;  2A56 B;  2HET A;  3VB1 A;  1CLM A;  4WQ2 A;  2Y1M A;  1OMV A;  1OW4 A;  2JXL A;  2JT3 A;  1MHO A;  2WIQ A;  1WRL A;  3E5V A;  1K96 A;  4ZB1 A;  1OOG A;  3U0N A;  2AWK A;  2PYQ A;  2VAE A;  4R6D A;  3BX9 A;  1B9A A;  2BCA A;  3ICB A;  2LC5 A;  4CPV A;  3DPW A;  1MOU A;  4M2Q A;  1Q4E A;  3ED8 A;  1B47 A;  2BCB A;  4W7D A;  1EMC A;  2LHI A;  3W1D A;  2KLE A;  3OX6 A;  3GEX A;  4LW5 A;  1F09 A;  2EMN A;  4C0K A;  2WSN A;  3WHU B;  1FPW A;  5CPV A;  2KI6 C;  4FQT A;  1MYW A;  1DJH A;  1KCY A;  2G6E A;  3MSE B;  1OOJ A;  2L50 A;  4TZA A;  3LK1 A;  2V4E C;  1H4U A;  1BU3 A;  3D78 A;  4DXO A;  5LTP A;  1ZUX A;  1AHR A;  1NUB A;  1SCM B;  1CMF A;  2DDD A;  2G5Z B;  3SIA A;  5AEQ A;  4EUL A;  2AWL A;  2ZMW A;  3H1R A;  1QV0 A;  2VAD A;  1H4B A;  4H3M A;  4HQ9 A;  1ZFS A;  1TRF A;  4D1E A;  2KSP A;  1XO5 A;  1XK4 C;  5ER4 X;  5KSZ A;  4U2V A;  3DQD A;  3KCT A;  4H3N A;  1ODB A;  1L2O B;  3B86 A;  3DQ1 A;  3AAJ A;  1WLZ A;  1DGV A;  1IWQ A;  3FS7 A;  1LA0 A;  2ZND A;  4PE1 A;  2LE9 B;  1A4P A;  4N5X A;  1JC0 A;  2H5O A;  2HJO A;  3I5I B;  1XFX O;  3CR4 X;  1A75 A;  4DIR A;  2Y0G A;  1JF0 A;  1SCV A;  1CMG A;  2QRF A;  1QWV A;  4XGY A;  3CFA A;  3K21 A;  4W6T A;  3D74 A;  5PAL A;  3DQU A;  4EDS A;  1TWO A;  3SRY A;  3SG5 A;  4DXM A;  2MJW B;  2PAS A;  2O5G A;  4LQU A;  1K9P A;  1QAT A;  1B1G A;  1OOH A;  2KDH A;  3WLC A;  3B7A A;  2KI4 C;  2JWW A;  3G9A A;  1J1D A;  3ST3 A;  2QEO A;  3PAT A;  2M97 A;  3CR2 A;  4Q04 A;  1B4C A;  2LUX A;  1FBV A;  1KWO C;  4GGF C;  4W75 A;  3EVV A;  5HYD A;  4L1I A;  2F33 A;  3SVR A;  2LAN A;  3JVT C;  1AVS A;  2WOS A;  2G3D B;  4CLN A;  4DXN A;  3E5T A;  3PJ7 A;  4RYS A;  1C07 A;  2WCB A;  4IK4 A;  1EXR A;  4MRX A;  4NDB A;  1KFX L;  2IS9 A;  1C4F A;  2CBL A;  2PAL A;  1UHI A;  1YUS A;  2OS8 C;  1H6R A;  1QYF A;  3R72 A;  3CR5 X;  3UFZ A;  1OMR A;  1QX7 A;  1RJV A;  2A48 A;  1CFC A;  3VRP A;  1S6Z A;  4NDD A;  2Q57 A;  1JFJ A;  2AUC A;  2G6Y A;  2GW3 A;  4W72 A;  4W6B A;  1PK0 D;  3RWT A;  2POX A;  2LUC A;  1DJI A;  1KSM A;  1VRK A;  1Y6W A;  2JNX A;  1QY3 A;  1GQM A;  1UHN A;  4W73 A;  2JTT A;  2CCM A;  2GX0 A;  3KEV A;  4I2Y A;  4W74 A;  4ZIN A;  2E6W A;  3IQO A;  4JF9 A;  1YX8 A;  3GB3 A;  3D77 A;  3F45 A;  2HPW A;  4H47 A;  1XYD A;  1S3P A;  2BBN A;  1LVC D;  2MLE C;  2FJY A;  1DJW A;  4ZIO A;  3PN7 C;  4OV2 A;  3LF4 B;  3VRR A;  1IG5 A;  4ZCU A;  4YRU A;  3VIC A;  4NDC A;  1CFD A;  2K61 A;  3HCM A;  5HZS A;  1ALW A;  4GBA A;  4W6A A;  1WY9 A;  3SVD A;  1AJ4 A;  3CYZ A;  1N2D A;  3C1V A;  5EXC I;  3DQK A;  2QLG B;  2KQY A;  2ZN8 A;  4PDZ A;  4GAO A;  2NLN A;  2IB6 A;  5BTT B;  2QEV A;  4I5J A;  3SSK A;  1FI5 A;  3SS5 A;  2JOJ A;  1QS7 A;  4OJ0 A;  5BPJ A;  4Q7T A;  1HCJ A;  2LAP A;  2NCO A;  1W7T A;  3S05 A;  5J2O A;  4KW8 A;  1E8A A;  2WOR A;  2AH8 A;  1BR1 B;  2OPO A;  4LJD C;  3S0F A;  2BKI B;  2M8U A;  4PPK A;  3SVE A;  4OHS A;  3K1E A;  3L47 A;  4OKH A;  1PVA A;  1JFK A;  2HPS A;  3PJI A;  2LP2 A;  1PVB A;  1D1O A;  3FE6 A;  2FOT A;  2WCF A;  4XOV A;  5I8N A;  1KYP A;  5H87 A;  1F55 A;  1W7U A;  3BUN B;  2K0J A;  2V4E B;  4OVN F;  4PCW A;  4ZCV A;  4OQW A;  3AI5 A;  2C9I A;  1CB1 A;  2LLU A;  3DQL A;  3BOW A;  4W6H A;  4FTG A;  3DPX A;  1NX2 A;  2M7N A;  4PPL A;  4WQ3 A;  1BOC A;  4N3D A;  2KOT A;  2GTE A;  4W6I A;  2GGM A;  3O4X A;  2KBM A;  5TNC A;  5F9G A;  3I5I C;  1C3Z A;  4W6L A;  3JTD C;  4EMQ A;  2YFP A;  1PAL A;  2MBX A;  1CTR A;  1C7V A;  1BG1 A;  1MUX A;  3VGO A;  1Q80 A;  4RTC A;  3VHT A;  4MLW A;  1JBY A;  2JRF A;  1YHG A;  2BNX A;  1CDM A;  2HRS A;  1QTX A;  3TS5 C;  5JJG A;  1S5G Z;  1SPY A;  1NCY A;  3UG0 A;  3SSV A;  5KTY A;  1DF0 B;  3AKA A;  3TMR A;  1OSA A;  5HBD A;  1MWN A;  3R1P A;  1B7T Y;  1RMP A;  3SV5 A;  2BBM A;  1OOI X;  3L4L A;  2JUL A;  4WRI A;  4ANJ A;  5DKR A;  2I94 A;  3FWB A;  2KI4 B;  5JOL A;  2A47 A;  4YGE B;  1M45 A;  1KWO B;  4YGC B;  3A4U B;  4GF6 B;  1N65 A;  4XVP A;  4DKM A;  1RWY A;  3BUM B;  3OGO A;  2H61 A;  4M2P A;  3JVT B;  2B3P A;  5FYX A;  1RK9 A;  4KA9 A;  2LV7 A;  2K7C A;  1N0Y A;  2A46 A;  2WCH A;  3GK4 X;  2NXQ A;  3A8R A;  2IOV A;  4IK5 A;  1QLK A;  2OS8 B;  3VRQ A;  1S6J A;  5ER5 A;  3ZUF A;  4A4C A;  2ZN9 A;  2L5X B;  4HRE E;  2Z1O A;  3CGA A;  1MXE A;  4KEX A;  3DVJ A;  4OY4 A;  5HKZ A;  2LCP A;  3OB2 B;  2OKW A;  1TCO B;  3D10 A;  1YZW A;  3GK2 A;  1K95 A;  2K8M B;  1OQP A;  2QU1 A;  5F6T A;  3SVC A;  1T14 A;  5AQB B;  4INW A;  5I2O A;  3ST4 A;  4ZF3 A;  1EG4 A;  2OTG C;  3NGV A;  3BXA A;  4AR7 A;  2WC6 A;  1TTX A;  2VRG A;  1GJY A;  1SNL A;  1ZMZ A;  3D0Y A;  5HKW A;  2BAP A;  2ZRT A;  1WLM A;  2FL1 A;  5AXI A;  2G2B A;  2CTN A;  4ZFS A;  1SL8 A;  4AOM A;  4W7C A;  3IVT A;  2Z6Z A;  3PN7 B;  1YHI A;  3CB9 A;  3NEZ A;  1RRO A;  1U5I A;  3D73 A;  1J7Q A;  5DRG A;  4W6P A;  1Y1U A;  1EME A;  4KF4 A;  4MRY A;  3EVU A;  1BFP A;  3H1O A;  4QJ5 B;  4W6C A;  4PT1 A;  5AER A;  1NWD A;  3OP0 A;  5IBW A;  1SYM A;  4W69 A;  5DQM A;  5HZT A;  1B8C A;  1TUJ A;  2O60 A;  1QYQ A;  4ZF5 A;  4XYN A;  3CGL A;  1PSB A;  1SBJ A;  5H89 A;  3CZ0 A;  2A50 B;  2LP3 A;  4MSP A;  3CAB A;  4ETO A;  3EVR A;  2Z6X A;  3M22 A;  5DPG A;  5CSF A;  4IZN A;  4F7F A;  1BLQ A;  1K9K A;  4KPI A;  1TN4 A;  2YDZ A;  5LTR A;  3CFH A;  3DQN A;  5EB7 A;  3NHI A;  1UP5 A;  4I5L B;  1WRK A;  2QAC A;  4DRW A;  4JPZ B;  1EG3 A;  1MQ1 A;  1JBZ A;  1DEL A;  2HQZ A;  2P4M A;  4YGD B;  4PAL A;  1TNX A;  2FWQ A;  4HQ8 A;  4R6B A;  1DMO A;  5DY6 A;  1QX2 A;  1XAE A;  3BOW B;  3DQ7 A;  3NED A;  5J3X A;  1SK6 D;  1DJY A;  3PFV A;  1KK8 C;  2EMO A;  2RGI A;  4W76 A;  3ADF A;  3JTD B;  5HW9 A;  2QT2 A;  3HX4 A;  2AMI A;  5I2Q A;  2JAD A;  3CZ2 A;  4M2O A;  3PSR A;  2BEC A;  4F0Z B;  2WND A;  3WXA A;  2VVI A;  1R6P A;  5FI6 A;  3IR8 A;  1CNP A;  1F70 A;  1UHK A;  3KF9 A;  1AP4 A;  3DF0 A;  3TS5 B;  4H3L A;  1TCF A;  2M49 B;  1P28 A;  3MGF A;  4NQG A;  3DQ6 A;  3CD1 A;  3O2P A;  1EMG A;  3DY9 A;  2LMU A;  3B88 A;  2Q6P A;  4IK8 A;  1A29 A;  1YJF A;  3DD4 A;  1TNP A;  2AHA A;  4W6O A;  4B30 A;  4W6G A;  1W7S A;  5DTY A;  1DJZ A;  1KP5 A;  2H8V A;  2EMD A;  1FI6 A;  5DU0 A;  2KFG A;  4GGF A;  3S0A A;  2DDC A;  1JWD A;  4CFR A;  2M0R A;  1OXF A;  3VRO A;  3IP2 A;  1Q73 A;  2WCM A;  3DVE A;  3ST2 A;  2QEH A;  1TNW A;  1DJG A;  4KF5 A;  1NIW A;  2PXS A;  3D75 A;  1NCX A;  3I5F C;  2L0P A;  4W7X A;  1EMK A;  1CM1 A;  1EJ3 A;  2HF5 A;  1XSS A;  4PPJ A;  4QJ4 B;  3DQ5 A;  3WNX B;  4YBH B;  3GK1 A;  2D8N A;  3LF3 A;  3DQJ A;  1KFU S;  1RMO A;  3LCP C;  4BDU A;  5BT0 A;  3BFA A;  1KYR A;  5I2L A;  1JC2 A;  2FCE A;  1IQ5 A;  1WRZ A;  1EMB A;  3B87 A;  1XA5 A;  4W6J A;  1R2U A;  3L4A A;  3DVM A;  5EL2 A;  4HRH A;  5DKN A;  3AI4 A;  3O77 A;  3U0K A;  2KFF A;  1NSH A;  1M46 A;  4XJK A;  1CV7 A;  2P6B B;  5FI2 A;  1FW4 A;  2AAO A;  1IKU A;  2E30 A;  2OTG B;  1M39 A;  1LIN A;  2PRU A;  1RM9 A;  4USL A;  2BCX A;  2QLI A;  3DQI A;  5HL1 A;  4XL5 A;  5FVI A;  3SVB A;  5FVG A;  5DPI A;  1IH0 A;  1ALV A;  1CFP A;  2G6X A;  4W7A A;  1UIS A;  1IRJ A;  4W7F A;  5EXU A;  4DCK A;  3DQM A;  2MLF C;  1OMD A;  3DZT A;  1V1F A;  3K1K A;  5HZO A;  4JWQ A;  1RTP 1;  3NF0 A;  2HFC A;  1KFU L;  2WUR A;  3SVS A;  1QIV A;  1U5I B;  3CZT X;  4GGN A;  1AJ5 A;  1AK8 A;  2M1K B;  4PE0 A;  3Q8I A;  5I94 A;  3DQ8 A;  3R1V A;  5CSN A;  1ZGP A;  1MOV A;  1J7P A;  2JZI A;  3U8A A;  2IE2 A;  5D69 A;  5HGE A;  1S6C A;  2G2S B;  3EKJ A;  3SG2 A;  4LJD A;  2QEB A;  2L98 A;  4DXP A;  2KNE A;  4W6N A;  1KQM C;  1SL9 A;  4IK9 A;  1XFW O;  3OSQ A;  5FI7 A;  2DUH A;  4W7E A;  5CSJ A;  4KW9 A;  3SST A;  4YGB B;  2LNK A;  2CT9 A;  3DQH A;  1EMF A;  3GL4 A;  4FQO A;  1MF8 B;  2LVK A;  2H5Q A;  4OR9 B;  2KAX A;  1NX1 A;  4H48 A;  1QVI Y;  1MR8 A;  3NHT A;  3LVA A;  3O78 A;  2L2C A;  3EK7 A;  5FVF A;  3RWA A;  2F3Z A;  4W7R A;  2Q4U A;  5HLV A;  3M24 A;  2MAZ A;  4I5K A;  3OB1 B;  1K90 D;  1C7W A;  4DXI A;  1F4Q A;  1XQM A;  3DQ9 A;  1OZO A;  3ZTF A;  4KW4 A;  1Q4A A;  4IK3 A;  4J89 A;  3TUY B;  4AS8 A;  1QYO A;  2EC6 C;  1EH2 A;  1K9U A;  1KK8 B;  2H5R A;  3OX5 A;  1QLS A;  4A4B A;  3SVU A;  3AKO A;  2KHN A;  4J8A A;  5EHU A;  2MHH A;  5HLO A;  1F54 A;  2LLT A;  2BE6 A;  3DQC A;  1A75 B;  4PE4 A;  2JT0 A;  2L4H A;  1B8L A;  1Y1A A;  1ZUZ A;  2PXW A;  2WCL A;  4LJC A;  4PHJ A;  1SRA A;  2L51 A;  2ISD A;  4DKN A;  1KSO A;  3BQ3 A;  3LA1 A;  3TDU A;  1XMZ A;  4OGS A;  4ZBL A;  1DC1 A;  2K7O A;  4ORB B;  4YI9 A;  4YGA A;  2L2E A;  3OGN A;  3DPZ A;  2JTZ A;  3LVD A;  1A2X A;  4W6D A;  2H5P A;  5KU1 A;  3NXA A;  3BUX B;  1RMM A;  1JF2 A;  4OZD A;  4GFT A;  2EHB A;  1ZGO A;  2JC2 A;  3N7H A;  3GJ2 A;  1QIW A;  2FZU A;  1BOD A;  1G7K A;  4IL1 A;  2B3Q A;  3LL8 B;  2NCP A;  1J7R A;  2DUI A;  1YJ2 A;  2H61 C;  1UUR A;  4W77 A;  4KGE A;  2AWM A;  1NP8 A;  3I5F B;  3SSY A;  1Z4H A;  2VVJ A;  2LVI A;  3ZUL A;  3S0B A;  3PAL A;  1QXP A;  5H88 A;  2DD9 A;  3TMT A;  1SY9 A;  4PE7 A;  3S0D A;  3FWC A;  1LA3 A;  4PHK A;  1CDP A;  4JQ0 D;  2YE0 A;  4GUK A;  2ZKM X;  4DXQ A;  1K8U A;  2A53 B;  2MRD A;  3B6X A;  3D76 A;  1BF5 A;  3BXK A;  3KPX A;  2SAS A;  4OCI A;  4P2Y B;  3PLF B;  2M3W A;  4Z4K A;  4LQT A;  1MXL C;  3NSO A;  1CFF A;  3TZ1 A;  5CSI A;  1YX7 A;  1NX0 A;  2DD7 A;  2MA2 A;  3CBE A;  5DTX A;  1JUO A;  4Q7U A;  2WC8 A;  2C9J A;  2PQL A;  3DXL A;  2QLG A;  2KAY A;  2O2B A;  2G16 B;  1IJ5 A;  2H2K A;  5BTT A;  1GGX A;  1YUT A;  3SS3 A;  3RM1 A;  3I5G C;  5AFP A;  5DQB A;  4C0J A;  5HZU A;  1B7T Z;  4MVF A;  1JSA A;  2JNF A;  2L4I A;  2R2I A;  1KK7 Y;  3SVO A;  1HT9 A;  1F71 A;  1SSE B;  1SR6 C;  3U8C A;  2KGR A;  3WHT B;  1BT6 A;  1LXF C;  4ICB A;  1PUL A;  4MZK A;  2Y1N A;  5DTL A;  1M63 B;  4Q7R A;  1KYS A;  5HKY A;  5K89 A;  5DRF A;  1Y1X A;  4L12 A;  3SG7 A;  2P71 A;  5AAN A;  2LMT A;  1KQM B;  1YRT B;  4E68 A;  2F2P A;  2V4E A;  3DQ3 A;  1Z2C B;  1REC A;  2YGU A;  1JC1 A;  3WLD A;  5EB6 A;  1YTZ C;  1WDC B;  3FE9 A;  4IK1 A;  1HQV A;  3BUO B;  4TNC A;  3FIA A;  2JU0 A;  1BMO A;  1BR4 B;  1IGV A;  1GM0 A;  2WHT A;  3SJS A;  4JEO A;  1A03 A;  2WC5 A;  3LK0 A;  2DUE A;  3I5H C;  2P70 A;  2M1U A;  1XK4 A;  5LK4 A;  5GQQ C;  2YE1 A;  1DT7 B;  1F0B A;  4L13 A;  1S26 D;  3P8U A;  3TUY C;  1TIZ A;  3CLN A;  1GGZ A;  4L9M A;  5KTG A;  4GNK B;  3M0W A;  4DUQ A;  1PRW A;  2Z6Y A;  1YVL A;  2CNP A;  3KHE A;  4I5N B;  1FF1 A;  3RZS A;  1DVI A;  1KFX S;  2LHL A;  2K7D A;  4INX A;  2EC6 B;  2LVV A;  4Z4M A;  2WHS A;  1S36 A;  3SSP A;  1SMG A;  3SG6 A;  1DF0 A;  1CLL A;  1X02 A;  1AUI B;  1YHH A;  3BYA A;  3GOF A;  4UTS A;  3NSI A;  1F4O A;  1YFP A;  2WSO A;  4EN1 A;  1RRX A;  2KYC A;  3VHT B;  4MEW A;  2BL0 C;  2H9W A;  4P76 A;  3BJH A;  3KCS A;  3PM2 A;  1SKT A;  3SG3 A;  2OJK A;  2O29 A;  4BY5 A;  2PSR A;  3LVC A;  4HQC A;  2JPT A;  1LKJ A;  2LM5 A;  4GOB A;  3SS0 A;  1G33 A;  2KI6 D;  3ZUJ A;  2ZMU A;  2JPO A;  4HSZ A;  1ZGQ A;  2K2F A;  4QJ3 B;  1KK7 Z;  2ZNE A;  2ICR A;  3EK8 A;  2BTJ A;  2LVJ A;  1JBA A;  1YUU A;  5EBJ A;  3RLZ A;  5FHV A;  2KBI A;  4ORA B;  1CLB A;  1TOP A;  3TDI A;  1OXE A;  3V3D A;  4KF5 C;  3I19 A;  1RFJ A;  1HUY A;  3WCK A;  3ZWH A;  1G4Y R;  2OTE A;  5DIC A;  4NWS A;  3TDZ A;  3NSL A;  5EXB A;  2Y5I A;  1H8B A;  3PM8 A;  1J1E A;  1QXT A;  3SS4 A;  4N1F A;  2LLS A; 
#chains in the Genus database with same CATH homology
 4JC2 A;  2ZRS A;  4AQI A;  2TN4 A;  2K2A A;  3SG4 A;  4BY4 A;  2BE4 A;  3CD9 A;  1B8R A;  4ORN A;  1XFV O;  4PFE A;  4JRB A;  2HQW A;  1NX3 A;  1OXD A;  2M9G A;  1UHH A;  2I18 A;  2A4J A;  5D7F A;  1K2H A;  1XVJ A;  3DQE A;  1QJT A;  3LLE A;  2ZFD A;  2ZO6 A;  4R1E A;  4PHM A;  4J88 A;  2OGR A;  3ST0 A;  1S5G Y;  1Z1P A;  3BUW B;  3D0Y B;  1DGU A;  1NYA A;  2OKY A;  2GV5 A;  4W6U A;  3DQF A;  3EVP A;  2KAV A;  4MN0 A;  1YRU B;  2PVB A;  2AWJ A;  1UUS A;  2V53 A;  2GX2 A;  3U0L A;  2HGD A;  3CS1 A;  3KO0 A;  2Y4Q A;  3I5G B;  2I7A A;  1SW8 A;  4HVF A;  2VVH A;  1Z1Q A;  4B5Y A;  3A8S A;  3BXC A;  2B1U A;  5EJU A;  3OSR A;  5LTQ A;  1SR6 B;  4MZJ A;  4LJB A;  2F3Y A;  1F8H A;  1B9C A;  2HGY A;  4JGE A;  3H4S E;  4DS7 A;  4W6F A;  1XFY O;  1ZOT B;  3ZNI A;  3E5W A;  1K93 D;  1Q4C A;  4YI8 A;  2GGZ A;  4U8D A;  3O6B A;  1Q4D A;  2Q91 A;  2A52 B;  1WDC C;  1S6I A;  1OZS A;  3PIB A;  2KFH A;  1PSR A;  2VZX A;  3DVK A;  1W7J B;  2RH7 A;  3SIB A;  1L7Z A;  2G9B A;  4HE4 A;  1SCM C;  1J55 A;  1KQV A;  2DOQ A;  4W6M A;  5DPH A;  1CDL A;  2FCD A;  1XFZ O;  3LS3 A;  1YUR A;  2WHU A;  1CDN A;  2A54 B;  3SSH A;  3I5H B;  2NZ0 A;  2GW4 B;  1ZAC A;  1GFL A;  1QAS A;  4Q9X A;  2G3O A;  2JXC A;  2PMY A;  1W7I B;  3U0M A;  2LMV A;  3EK4 A;  3DQO A;  1L2O C;  1QV1 A;  1IQ3 A;  3BXB A;  4TZG A;  5BQL A;  3SVN A;  2QLH A;  1IJ6 A;  4EDO A;  1QX5 B;  5DPJ A;  2EGD A;  3NT9 A;  1GL4 A;  1M31 A;  1BJF A;  1K94 A;  2M7L A;  2OTB A;  4MZL A;  2WIS A;  5DKQ A;  4P5O E;  4ORC B;  3CWG A;  3NT3 A;  4W6K A;  1EMA A;  1J7O A;  2QZ0 A;  2JQ6 A;  1S1E A;  1UHJ A;  1EML A;  3VRN A;  2BL0 B;  1EMM A;  1GGW A;  2DUG A;  1YVH A;  4JFG A;  3O4Y A;  3DF0 B;  1EL4 A;  1OE9 B;  2QLE A;  4HRG A;  1DTL A;  1V1G A;  1NPQ A;  1DJX A;  4UPG A;  4ZF4 A;  4KGF A;  2HQ8 A;  2SCP A;  4W6S A;  4RYW A;  4CFQ A;  3PJ5 A;  3AKB A;  2IB5 A;  4KAG A;  4B30 B;  1Q4B A;  3OHM B;  2H8Q A;  5G08 A;  2WCE A;  3U8P A;  2QPT A;  2K7B A;  1SL7 A;  1XFU O;  2I2R E;  4C0L A;  1G8I A;  3EKH A;  2F8P A;  3DQA A;  2BKH B;  3SSL A;  1UWO A;  4Q9W A;  1TNQ A;  2ZO7 A;  3IF7 A;  3CFF A;  2KGB C;  4N1G A;  5T3I A;  2CXJ A;  2KQ6 A;  4AQJ A;  3PJB A;  4GPL B;  2JT8 A;  4PHN A;  3GJ1 A;  1YR5 A;  3CTN A;  1Y0V H;  4W6R A;  1QVI Z;  1CKK A;  4P1Q A;  2O24 A;  2COL B;  2DUF A;  3NSK A;  2M29 A;  4CID A;  3VK1 A;  5DTZ A;  2HCG A;  3DQ4 A;  3P28 A;  3LSA A;  3IQQ A;  4XJK B;  1CM4 A;  1NCZ A;  2HQK A;  4GES B;  3QRX A;  1XA9 A;  2F2O A;  4XOW A;  4MBE A;  2H6V A;  3AAK A;  3DQ2 A;  2FJU B;  3W1C A;  5B8I B;  2ARL A;  3E3R A;  2KYF A;  2A56 B;  2HET A;  1CLM A;  4WQ2 A;  2Y1M A;  1OMV A;  2JXL A;  2JT3 A;  1MHO A;  2WIQ A;  1WRL A;  3E5V A;  1K96 A;  4ZB1 A;  3U0N A;  2AWK A;  2VAE A;  4R6D A;  3BX9 A;  1B9A A;  2BCA A;  3ICB A;  2LC5 A;  4CPV A;  3DPW A;  1MOU A;  4M2Q A;  1Q4E A;  3ED8 A;  1B47 A;  2BCB A;  4W7D A;  1EMC A;  2LHI A;  3W1D A;  3OX6 A;  3GEX A;  4LW5 A;  1F09 A;  2EMN A;  4C0K A;  2WSN A;  3WHU B;  1FPW A;  5CPV A;  2KI6 C;  1MYW A;  1DJH A;  1KCY A;  2G6E A;  3MSE B;  1OOJ A;  2L50 A;  4TZA A;  3LK1 A;  2V4E C;  1H4U A;  1BU3 A;  4DXO A;  5LTP A;  1ZUX A;  1AHR A;  1NUB A;  1SCM B;  1CMF A;  2DDD A;  2G5Z B;  3SIA A;  5AEQ A;  4EUL A;  2AWL A;  2ZMW A;  3H1R A;  1QV0 A;  2VAD A;  1H4B A;  4H3M A;  4HQ9 A;  1ZFS A;  1TRF A;  4D1E A;  2KSP A;  1XO5 A;  1XK4 C;  5ER4 X;  5KSZ A;  4U2V A;  3DQD A;  3KCT A;  4H3N A;  1ODB A;  1L2O B;  3DQ1 A;  3AAJ A;  1WLZ A;  1DGV A;  1IWQ A;  3FS7 A;  1LA0 A;  2ZND A;  4PE1 A;  2LE9 B;  1A4P A;  4N5X A;  1JC0 A;  2H5O A;  2HJO A;  3I5I B;  1XFX O;  3CR4 X;  1A75 A;  4DIR A;  2Y0G A;  1JF0 A;  1SCV A;  1CMG A;  2QRF A;  4XGY A;  3CFA A;  3K21 A;  4W6T A;  5PAL A;  3DQU A;  4EDS A;  3SRY A;  3SG5 A;  4DXM A;  2MJW B;  2PAS A;  2O5G A;  4LQU A;  1K9P A;  1QAT A;  1B1G A;  2KDH A;  3WLC A;  2KI4 C;  2JWW A;  3G9A A;  1J1D A;  3ST3 A;  3PAT A;  2M97 A;  3CR2 A;  4Q04 A;  1B4C A;  2LUX A;  1FBV A;  1KWO C;  4GGF C;  4W75 A;  3EVV A;  5HYD A;  4L1I A;  2F33 A;  3SVR A;  2LAN A;  3JVT C;  1AVS A;  2WOS A;  2G3D B;  4CLN A;  4DXN A;  3E5T A;  3PJ7 A;  4RYS A;  1C07 A;  2WCB A;  4IK4 A;  1EXR A;  4MRX A;  4NDB A;  1KFX L;  2IS9 A;  1C4F A;  2CBL A;  2PAL A;  1UHI A;  1YUS A;  2OS8 C;  1H6R A;  1QYF A;  3CR5 X;  3UFZ A;  1OMR A;  1QX7 A;  1RJV A;  2A48 A;  1CFC A;  3VRP A;  1S6Z A;  4NDD A;  2Q57 A;  1JFJ A;  2AUC A;  2G6Y A;  2GW3 A;  4W72 A;  4W6B A;  1PK0 D;  3RWT A;  2POX A;  2LUC A;  1DJI A;  1KSM A;  1VRK A;  1Y6W A;  2JNX A;  1QY3 A;  1GQM A;  1UHN A;  4W73 A;  2JTT A;  2CCM A;  2GX0 A;  3KEV A;  4I2Y A;  4W74 A;  4ZIN A;  2E6W A;  3IQO A;  4JF9 A;  1YX8 A;  3GB3 A;  3F45 A;  2HPW A;  4H47 A;  1XYD A;  1S3P A;  2BBN A;  1LVC D;  2MLE C;  1DJW A;  4ZIO A;  3PN7 C;  4OV2 A;  3LF4 B;  3VRR A;  1IG5 A;  4ZCU A;  4YRU A;  3VIC A;  4NDC A;  1CFD A;  2K61 A;  3HCM A;  5HZS A;  1ALW A;  4GBA A;  4W6A A;  1WY9 A;  3SVD A;  1AJ4 A;  1N2D A;  3C1V A;  5EXC I;  3DQK A;  2QLG B;  2KQY A;  2ZN8 A;  4PDZ A;  4GAO A;  2NLN A;  2IB6 A;  5BTT B;  4I5J A;  3SSK A;  1FI5 A;  2JOJ A;  1QS7 A;  4OJ0 A;  5BPJ A;  4Q7T A;  1HCJ A;  2LAP A;  2NCO A;  1W7T A;  3S05 A;  5J2O A;  4KW8 A;  1E8A A;  2WOR A;  2AH8 A;  1BR1 B;  2OPO A;  4LJD C;  2BKI B;  2M8U A;  4PPK A;  3SVE A;  4OHS A;  4OKH A;  1PVA A;  1JFK A;  2HPS A;  2LP2 A;  1PVB A;  1D1O A;  2FOT A;  2WCF A;  4XOV A;  5I8N A;  1KYP A;  5H87 A;  1F55 A;  1W7U A;  3BUN B;  2K0J A;  2V4E B;  4OVN F;  4PCW A;  4ZCV A;  4OQW A;  3AI5 A;  2C9I A;  1CB1 A;  2LLU A;  3DQL A;  3BOW A;  4W6H A;  4FTG A;  3DPX A;  1NX2 A;  2M7N A;  4PPL A;  4WQ3 A;  1BOC A;  4N3D A;  2KOT A;  4W6I A;  2GGM A;  2KBM A;  5TNC A;  5F9G A;  3I5I C;  4W6L A;  3JTD C;  4EMQ A;  2YFP A;  1PAL A;  2MBX A;  1CTR A;  1C7V A;  1BG1 A;  1MUX A;  3VGO A;  1Q80 A;  4RTC A;  3VHT A;  4MLW A;  1JBY A;  2JRF A;  1YHG A;  1CDM A;  2HRS A;  1QTX A;  3TS5 C;  5JJG A;  1S5G Z;  1SPY A;  1NCY A;  3UG0 A;  3SSV A;  5KTY A;  1DF0 B;  3AKA A;  3TMR A;  1OSA A;  5HBD A;  1MWN A;  1B7T Y;  1RMP A;  3SV5 A;  2BBM A;  2JUL A;  4WRI A;  4ANJ A;  5DKR A;  2I94 A;  3FWB A;  2KI4 B;  5JOL A;  2A47 A;  4YGE B;  1M45 A;  1KWO B;  4YGC B;  3A4U B;  4GF6 B;  1N65 A;  4XVP A;  4DKM A;  1RWY A;  3BUM B;  3OGO A;  2H61 A;  4M2P A;  3JVT B;  2B3P A;  5FYX A;  1RK9 A;  4KA9 A;  2LV7 A;  2K7C A;  1N0Y A;  2A46 A;  3GK4 X;  2NXQ A;  3A8R A;  2IOV A;  4IK5 A;  1QLK A;  2OS8 B;  3VRQ A;  1S6J A;  5ER5 A;  3ZUF A;  4A4C A;  2ZN9 A;  2L5X B;  4HRE E;  4KEX A;  3CGA A;  1MXE A;  2Z1O A;  3DVJ A;  4OY4 A;  5HKZ A;  2LCP A;  3OB2 B;  2OKW A;  1TCO B;  3D10 A;  1YZW A;  3GK2 A;  1K95 A;  2K8M B;  1OQP A;  2QU1 A;  5F6T A;  3SVC A;  5AQB B;  5I2O A;  3ST4 A;  4ZF3 A;  1EG4 A;  2OTG C;  3BXA A;  4AR7 A;  1TTX A;  2VRG A;  1GJY A;  1SNL A;  1ZMZ A;  3D0Y A;  5HKW A;  2ZRT A;  1WLM A;  2FL1 A;  5AXI A;  2G2B A;  2CTN A;  4ZFS A;  1SL8 A;  4AOM A;  4W7C A;  2Z6Z A;  3PN7 B;  1YHI A;  3CB9 A;  3NEZ A;  1RRO A;  1U5I A;  1J7Q A;  5DRG A;  4W6P A;  1Y1U A;  1EME A;  4KF4 A;  4MRY A;  3EVU A;  1BFP A;  3H1O A;  4QJ5 B;  4W6C A;  5AER A;  1NWD A;  3OP0 A;  5IBW A;  1SYM A;  4W69 A;  5DQM A;  5HZT A;  1B8C A;  2O60 A;  1QYQ A;  4ZF5 A;  4XYN A;  3CGL A;  1PSB A;  1SBJ A;  5H89 A;  2A50 B;  2LP3 A;  4MSP A;  4ETO A;  3EVR A;  2Z6X A;  3M22 A;  5DPG A;  5CSF A;  4IZN A;  1BLQ A;  1K9K A;  4KPI A;  1TN4 A;  2YDZ A;  5LTR A;  3CFH A;  3DQN A;  5EB7 A;  1UP5 A;  4I5L B;  1WRK A;  2QAC A;  4DRW A;  4JPZ B;  1EG3 A;  1MQ1 A;  1JBZ A;  2HQZ A;  2P4M A;  4YGD B;  4PAL A;  1TNX A;  2FWQ A;  4HQ8 A;  4R6B A;  1DMO A;  5DY6 A;  1QX2 A;  1XAE A;  3BOW B;  3DQ7 A;  3NED A;  5J3X A;  1SK6 D;  1DJY A;  3PFV A;  1KK8 C;  2EMO A;  2RGI A;  4W76 A;  3ADF A;  3JTD B;  5HW9 A;  2QT2 A;  3HX4 A;  2AMI A;  5I2Q A;  2JAD A;  4M2O A;  3PSR A;  2BEC A;  4F0Z B;  2WND A;  3WXA A;  2VVI A;  1R6P A;  3IR8 A;  1CNP A;  1F70 A;  1UHK A;  3KF9 A;  1AP4 A;  3DF0 A;  3TS5 B;  4H3L A;  1TCF A;  2M49 B;  3MGF A;  4NQG A;  3DQ6 A;  3CD1 A;  3O2P A;  1EMG A;  2LMU A;  2Q6P A;  4IK8 A;  1A29 A;  1YJF A;  3DD4 A;  1TNP A;  2AHA A;  4W6O A;  4B30 A;  4W6G A;  1W7S A;  5DTY A;  1DJZ A;  1KP5 A;  2EMD A;  1FI6 A;  5DU0 A;  2KFG A;  4GGF A;  2DDC A;  1JWD A;  4CFR A;  2M0R A;  1OXF A;  3VRO A;  3IP2 A;  1Q73 A;  3DVE A;  3ST2 A;  1TNW A;  1DJG A;  4KF5 A;  1NIW A;  2PXS A;  1NCX A;  3I5F C;  2L0P A;  4W7X A;  1EMK A;  1CM1 A;  1EJ3 A;  2HF5 A;  1XSS A;  4PPJ A;  4QJ4 B;  3DQ5 A;  3WNX B;  4YBH B;  3GK1 A;  2D8N A;  3LF3 A;  3DQJ A;  1KFU S;  1RMO A;  3LCP C;  4BDU A;  5BT0 A;  1KYR A;  5I2L A;  1JC2 A;  2FCE A;  1IQ5 A;  1WRZ A;  1EMB A;  1XA5 A;  4W6J A;  1R2U A;  3DVM A;  4HRH A;  5DKN A;  3AI4 A;  3O77 A;  3U0K A;  2KFF A;  1NSH A;  1M46 A;  4XJK A;  1CV7 A;  2P6B B;  1FW4 A;  2AAO A;  1IKU A;  2E30 A;  2OTG B;  1M39 A;  1LIN A;  2PRU A;  1RM9 A;  4USL A;  2BCX A;  2QLI A;  3DQI A;  4XL5 A;  5FVI A;  3SVB A;  5FVG A;  5DPI A;  1IH0 A;  1ALV A;  1CFP A;  2G6X A;  4W7A A;  1UIS A;  1IRJ A;  4W7F A;  5EXU A;  4DCK A;  3DQM A;  2MLF C;  1OMD A;  1V1F A;  3K1K A;  5HZO A;  4JWQ A;  1RTP 1;  3NF0 A;  2HFC A;  1KFU L;  2WUR A;  3SVS A;  1QIV A;  1U5I B;  3CZT X;  4GGN A;  1AJ5 A;  1AK8 A;  2M1K B;  4PE0 A;  3DQ8 A;  1ZGP A;  5CSN A;  1MOV A;  1J7P A;  2JZI A;  3U8A A;  2IE2 A;  5D69 A;  5HGE A;  1S6C A;  2G2S B;  3EKJ A;  3SG2 A;  4LJD A;  2L98 A;  4DXP A;  2KNE A;  4W6N A;  1KQM C;  1SL9 A;  4IK9 A;  1XFW O;  3OSQ A;  2DUH A;  4W7E A;  5CSJ A;  4KW9 A;  3SST A;  4YGB B;  2LNK A;  2CT9 A;  3DQH A;  1EMF A;  3GL4 A;  4FQO A;  1MF8 B;  2LVK A;  2H5Q A;  4OR9 B;  2KAX A;  1NX1 A;  4H48 A;  1QVI Y;  1MR8 A;  3LVA A;  3O78 A;  3EK7 A;  5FVF A;  3RWA A;  2F3Z A;  4W7R A;  2Q4U A;  5HLV A;  3M24 A;  2MAZ A;  4I5K A;  3OB1 B;  1K90 D;  1C7W A;  4DXI A;  1F4Q A;  1XQM A;  3DQ9 A;  1OZO A;  3ZTF A;  4KW4 A;  1Q4A A;  4IK3 A;  4J89 A;  3TUY B;  4AS8 A;  1QYO A;  2EC6 C;  1EH2 A;  1K9U A;  1KK8 B;  2H5R A;  3OX5 A;  1QLS A;  4A4B A;  3SVU A;  3AKO A;  2KHN A;  4J8A A;  5EHU A;  2MHH A;  5HLO A;  1F54 A;  2LLT A;  2BE6 A;  3DQC A;  1A75 B;  4PE4 A;  2JT0 A;  2L4H A;  1B8L A;  1Y1A A;  1ZUZ A;  2PXW A;  4LJC A;  4PHJ A;  1SRA A;  2L51 A;  2ISD A;  4DKN A;  1KSO A;  3BQ3 A;  3LA1 A;  3TDU A;  1XMZ A;  4OGS A;  4ZBL A;  2K7O A;  4ORB B;  4YI9 A;  4YGA A;  2L2E A;  3DPZ A;  2JTZ A;  3LVD A;  1A2X A;  4W6D A;  2H5P A;  5KU1 A;  3NXA A;  3BUX B;  1RMM A;  1JF2 A;  4GFT A;  2EHB A;  1ZGO A;  2JC2 A;  3GJ2 A;  1QIW A;  2FZU A;  1BOD A;  1G7K A;  4IL1 A;  2B3Q A;  3LL8 B;  2NCP A;  1J7R A;  2DUI A;  1YJ2 A;  2H61 C;  1UUR A;  4W77 A;  4KGE A;  2AWM A;  1NP8 A;  3I5F B;  3SSY A;  2VVJ A;  2LVI A;  3ZUL A;  3PAL A;  1QXP A;  5H88 A;  2DD9 A;  3TMT A;  1SY9 A;  4PE7 A;  3FWC A;  1LA3 A;  4PHK A;  1CDP A;  4JQ0 D;  2YE0 A;  4GUK A;  2ZKM X;  4DXQ A;  1K8U A;  2A53 B;  2MRD A;  1BF5 A;  3BXK A;  3KPX A;  2SAS A;  4OCI A;  4P2Y B;  3PLF B;  2M3W A;  4Z4K A;  4LQT A;  1MXL C;  3NSO A;  1CFF A;  3TZ1 A;  5CSI A;  1YX7 A;  1NX0 A;  2DD7 A;  2MA2 A;  3CBE A;  5DTX A;  1JUO A;  4Q7U A;  2WC8 A;  2C9J A;  2QLG A;  2KAY A;  2O2B A;  2G16 B;  1IJ5 A;  2H2K A;  5BTT A;  1GGX A;  1YUT A;  3RM1 A;  3I5G C;  5AFP A;  5DQB A;  4C0J A;  5HZU A;  1B7T Z;  4MVF A;  1JSA A;  2JNF A;  2L4I A;  2R2I A;  1KK7 Y;  3SVO A;  1HT9 A;  1F71 A;  1SR6 C;  3U8C A;  2KGR A;  3WHT B;  1BT6 A;  1LXF C;  4ICB A;  1PUL A;  4MZK A;  2Y1N A;  5DTL A;  1M63 B;  4Q7R A;  1KYS A;  5HKY A;  5K89 A;  5DRF A;  1Y1X A;  4L12 A;  3SG7 A;  5AAN A;  2LMT A;  1KQM B;  1YRT B;  4E68 A;  2F2P A;  2V4E A;  3DQ3 A;  1REC A;  1JC1 A;  3WLD A;  5EB6 A;  1YTZ C;  1WDC B;  4IK1 A;  1HQV A;  3BUO B;  4TNC A;  3FIA A;  2JU0 A;  1BMO A;  1BR4 B;  1IGV A;  2WHT A;  3SJS A;  4JEO A;  1A03 A;  3LK0 A;  2DUE A;  3I5H C;  2M1U A;  1XK4 A;  5LK4 A;  5GQQ C;  2YE1 A;  1DT7 B;  1F0B A;  4L13 A;  1S26 D;  3P8U A;  3TUY C;  1TIZ A;  3CLN A;  1GGZ A;  4L9M A;  5KTG A;  4GNK B;  3M0W A;  4DUQ A;  1PRW A;  2Z6Y A;  1YVL A;  2CNP A;  3KHE A;  4I5N B;  1FF1 A;  1DVI A;  1KFX S;  2LHL A;  2K7D A;  2EC6 B;  2LVV A;  4Z4M A;  2WHS A;  1S36 A;  3SSP A;  1SMG A;  3SG6 A;  1DF0 A;  1CLL A;  1X02 A;  1AUI B;  1YHH A;  3BYA A;  3GOF A;  4UTS A;  3NSI A;  1F4O A;  1YFP A;  2WSO A;  4EN1 A;  1RRX A;  2KYC A;  3VHT B;  4MEW A;  2BL0 C;  2H9W A;  4P76 A;  3KCS A;  3SG3 A;  1SKT A;  2OJK A;  2O29 A;  4BY5 A;  2PSR A;  3LVC A;  4HQC A;  2JPT A;  1LKJ A;  2LM5 A;  4GOB A;  3SS0 A;  1G33 A;  2KI6 D;  3ZUJ A;  2ZMU A;  4HSZ A;  1ZGQ A;  2K2F A;  4QJ3 B;  1KK7 Z;  2ZNE A;  2ICR A;  3EK8 A;  2BTJ A;  2LVJ A;  1JBA A;  1YUU A;  5EBJ A;  3RLZ A;  5FHV A;  2KBI A;  4ORA B;  1CLB A;  1TOP A;  3TDI A;  1OXE A;  3V3D A;  4KF5 C;  3I19 A;  1RFJ A;  1HUY A;  3WCK A;  3ZWH A;  1G4Y R;  2OTE A;  4NWS A;  3TDZ A;  3NSL A;  5EXB A;  2Y5I A;  1H8B A;  3PM8 A;  1J1E A;  1QXT A;  4N1F A;  2LLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...