3SG5A

Crystal structure of dimeric gcamp3-d380y, qp(linker 1), lp(linker 2)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
409
structure length
387
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSQPNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMADSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 124
structure length 387
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg5A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg5A01
1CTRA 1YTZC 1PULA 1KK7Y 1M46A 2BTJA 3DVMA 1EMKA 1DJIA 4N3DA 1K90D 1YUSA 2M97A 1JWDA 2KGRA 3GOFA 1Y1AA 4Q7RA 1A2XA 5G08A 4MZJA 3KHEA 4W6KA 1QTXA 4KEXA 2K8MB 1XMZA 2KDHA 2PVBA 1NCYA 3U8PA 1G33A 5HZUA 1YHGA 3PN7B 2HQ8A 2A4JA 4YBHB 2DUHA 3BX9A 2NLNA 4L9MA 2M29A 1FPWA 1OMVA 1NX2A 5AEQA 1U5IA 4W6BA 3OHMB 2GX2A 4LQTA 2G6XA 1MXEA 1JSAA 4PHKA 1J1EA 1YVLA 2ICRA 3CFFA 4W74A 1IQ5A 1LKJA 1XFUO 4E68A 4H3MA 5H88A 1KSOA 3K1KA 5DPIA 4NQGA 3M0WA 1K9KA 1EXRA 2NCPA 2AWKA 5CPVA 4MN0A 5DKNA 2OTGB 5BT0A 1OZOA 2ISDA 1R2UA 1HUYA 3PJ7A 5K89A 3JVTC 3TS5B 3SG5A 1A4PA 1DTLA 4JQ0D 4W6SA 1QX7A 1UP5A 4JC2A 2KOTA 5LTPA 3MSEB 2WORA 1MR8A 2M1KB 1F8HA 1YHIA 1DGUA 3CFAA 1MHOA 2ZN9A 1EMGA 1ZGQA 1W7SA 2H5OA 2IE2A 1M45A 4H47A 4ORCB 1SL7A 1ZUXA 2KI6D 2EMNA 4Z4MA 1NX3A 2HPSA 3DQFA 3LL8B 2LVKA 3C1VA 1EMLA 4OCIA 1JUOA 5B8IB 3IR8A 1DVIA 3AKAA 2KI6C 3W1CA 5HBDA 4GUKA 5DU0A 5DY6A 3SS0A 4W7AA 3P8UA 5EXUA 3WNXB 2LMTA 2Y1NA 3EKJA 1WDCC 3BUMB 5F9GA 1DJYA 4AR7A 3AI4A 4W6DA 2JOJA 3O6BA 1FI5A 2PXWA 2KGBC 4B30B 5CSIA 3CD1A 3OSQA 3BXAA 5BPJA 2KQ6A 4I5NB 2CNPA 1Y1UA 3SIBA 4LJBA 1UURA 5EXBA 3SIAA 1GL4A 3P28A 4IK3A 3E5VA 2JT8A 1GGZA 1RECA 1MOVA 2HQZA 1AUIB 1WLZA 5DTLA 5HZTA 2LLTA 4NWSA 4CPVA 1WLMA 3TDZA 1SCMB 1Y1XA 3NT9A 3I5IC 1W7IB 3U0MA 3PM8A 1J1DA 2B3PA 2YDZA 1N2DA 3NF0A 1ODBA 3OB2B 3DQ4A 3VGOA 1B8CA 4J89A 3I5HC 1XK4A 4KPIA 4AQIA 2WHSA 2AMIA 3W1DA 2ZRSA 2WHTA 2BKHB 1YX7A 3IQQA 1UHKA 4J88A 4HQ8A 2K2FA 2MLFC 3AKOA 3CB9A 1SRAA 5AQBB 3O2PA 1QX2A 3GK1A 4W69A 4HVFA 2AAOA 1A29A 4D1EA 1BR1B 2JADA 4DXOA 1SK6D 1MOUA 2H8QA 1SKTA 1VRKA 5KTGA 1F4QA 1QV1A 3CLNA 3VRRA 2K7DA 2AWJA 1B8RA 5HKWA 5FYXA 4W7FA 1S1EA 1BODA 3DQAA 2K7OA 5DKQA 3ZUFA 2Z6ZA 3NEZA 5AANA 2LLSA 1SY9A 4Q9WA 1K95A 4DXIA 1XFZO 1YHHA 2PRUA 3WLDA 2A54B 2SCPA 3BQ3A 2Q4UA 3ST2A 3HX4A 3NSLA 4ORAB 4HQ9A 4QJ5B 1SPYA 3DQDA 1Q80A 5T3IA 1RTP1 4FTGA 1AHRA 4I5LB 4B30A 2QLIA 3DF0B 4CFQA 3U0NA 1M63B 1XA5A 3VRPA 2OGRA 1B1GA 1AJ5A 4OY4A 3SSLA 1DF0A 5HLOA 2VVHA 3ZULA 4RYWA 3SVOA 2JU0A 2LUXA 3I5GB 1BF5A 2ZN8A 1NCXA 5JOLA 2MBXA 2JT3A 3DPXA 1QATA 2ZO6A 5DRGA 3CD9A 5HZOA 5LTRA 3BYAA 4W6IA 1CMFA 4GGFA 1LINA 1WRZA 4A4BA 1OSAA 2G2BA 1OMDA 2DUIA 1KP5A 4YGCB 1JF2A 3AKBA 1R6PA 3WLCA 1XFVO 3SVRA 2DUFA 5BQLA 2P4MA 4AQJA 4M2QA 3ZWHA 2WCEA 1NP8A 2M7LA 4W6MA 3DQ1A 2QRFA 1K94A 1QVIZ 4IK9A 5EHUA 4GESB 4W6RA 4YI9A 3NEDA 2KBMA 3PLFB 2YE1A 3CBEA 4DXQA 2WNDA 1K93D 2M49B 4XGYA 4PE7A 3OGOA 2M1UA 4PPKA 2H5QA 4PPLA 1L7ZA 1GGXA 1KCYA 1QXPA 1BOCA 1CKKA 5EB7A 3BUXB 1Q4EA 1CFDA 3KO0A 3M22A 4PALA 1QYFA 4IK1A 4CIDA 2IS9A 1EH2A 1CNPA 4ZF5A 1N0YA 1MQ1A 2V4EA 4DIRA 2M7NA 2QT2A 4W6NA 4OR9B 2F3YA 3D0YB 4DCKA 1S6JA 2OTBA 2JRFA 4PHNA 2LHLA 2NZ0A 4PE0A 4AS8A 1XYDA 1NCZA 3MGFA 3D10A 1DJHA 2PASA 2BCXA 4HQCA 3BXBA 1L2OB 3DF0A 2ZNDA 1KFXL 4PHMA 3GEXA 1MYWA 3U0LA 1EL4A 4HE4A 3I5FB 4XVPA 4EDOA 1AK8A 2IOVA 1V1FA 2YE0A 3LVAA 2CCMA 3PN7C 2B3QA 1JC1A 2POXA 2JULA 3OSRA 2LVIA 2JTTA 2I2RE 2TN4A 4HSZA 2WIQA 1JFJA 4MEWA 4C0LA 1MXLC 1KQMB 4YRUA 2H5PA 2JXCA 4GAOA 4R6DA 4ZCVA 2JT0A 2DOQA 3SSVA 5ER4X 1DJZA 4Q04A 3NXAA 3DQ8A 5EB6A 1JC0A 2E6WA 1S36A 1ZACA 2HETA 3DPZA 4RYSA 4W75A 1XK4C 2OTGC 1QLSA 4N5XA 5J3XA 4NDDA 4KF5A 3TS5C 1PK0D 1BU3A 4XYNA 3EKHA 2OKYA 1M31A 3OX6A 4M2PA 4LW5A 1FBVA 1F4OA 5FHVA 3DQLA 1FF1A 1G7KA 2KAVA 1FI6A 1CV7A 3OP0A 1BG1A 2HPWA 1K9PA 3BOWB 3VROA 1KFUS 4TNCA 4PE1A 3A4UB 2MLEC 3LF4B 5HGEA 3DQOA 1UHNA 2G6EA 3ADFA 2AWLA 2CXJA 2KYFA 1YJ2A 2DUGA 1WRLA 3D0YA 4EDSA 1S5GZ 1IJ6A 1BJFA 1UUSA 1CDNA 2F33A 1DJGA 2GGMA 3DQHA 1SL8A 1RROA 1DJXA 2L4HA 1TNXA 1K8UA 1J7QA 4JPZB 3RWAA 1RMPA 4ZBLA 4DUQA 4W7CA 2Q57A 2NXQA 4A4CA 3AAJA 2H6VA 2R2IA 1KWOB 2P6BB 1PSRA 1CDLA 1OQPA 3TZ1A 2FCEA 1KFXS 1RWYA 1SBJA 3SSHA 1QX5B 3SVDA 3VK1A 2WHUA 2I18A 3GJ1A 4XL5A 5J2OA 2O29A 2LV7A 3GK2A 2MAZA 2GV5A 1NPQA 1Q4DA 4GGFC 4C0JA 1SCMC 2CTNA 2SASA 1S6IA 2O60A 2KBIA 1BT6A 1YUTA 3H1RA 4YGAA 4MRXA 3JTDB 4W6FA 2LMVA 4U2VA 5DTZA 1BR4B 2BE4A 4KAGA 4KA9A 4LJCA 3SG3A 5DRFA 3LF3A 2VVIA 1NYAA 2AH8A 3IQOA 3DQ5A 2EHBA 3ST3A 1IGVA 4GOBA 1FW4A 3VRNA 3DD4A 1EMAA 2QLGB 1C7VA 1Y0VH 1RJVA 2M9GA 3KF9A 2LVVA 5HKZA 5CSJA 1DF0B 3BOWA 2H2KA 2ZRTA 3SSKA 2G16B 2F2PA 1NX0A 1YX8A 4ZIOA 2Z1OA 3AAKA 1A75B 4W7XA 2OPOA 3SG4A 3ST0A 1B9AA 1XO5A 3HCMA 3GJ2A 4TZGA 1TN4A 2NCOA 1TCFA 1IH0A 4W6PA 1J7PA 2VADA 4ANJA 3SG6A 5HLVA 4P1QA 2MRDA 2H5RA 1KYSA 4Q7TA 2G2SB 5DPHA 5H89A 2HQWA 3EVUA 4H48A 2V4EC 3TMRA 1DGVA 3CS1A 1ALWA 5EJUA 2ZFDA 1MF8B 2FZUA 1TRFA 4FQOA 1B7TZ 1RFJA 2EMDA 2ZNEA 4XJKB 4I2YA 5D69A 1DT7B 2G6YA 1ZMZA 3O78A 4I5JA 2L4IA 4H3NA 3KEVA 3VHTB 3BUWB 2AWMA 4W6UA 1DMOA 3I5GC 2KFFA 4L1IA 3DPWA 4W6OA 2KFHA 2LUCA 1ZOTB 1TCOB 2LAPA 2VVJA 1SR6B 2FJUB 1TNWA 3CTNA 5I2OA 3GK4X 2QU1A 4BY5A 3LSAA 2PMYA 1Z1PA 1CB1A 2V4EB 3E5TA 1RMMA 2HF5A 2GW4B 2LMUA 2IB5A 3SVSA 2GGZA 3PJ5A 2G9BA 4KGEA 4P2YB 1LVCD 1W7UA 2G3OA 1S6ZA 4PHJA 3ED8A 2JWWA 1S26D 4YI8A 2QLGA 3DQ3A 3SSYA 2BL0B 4KF5C 1HCJA 4IL1A 2YFPA 1OMRA 3LA1A 3DQUA 5BTTB 3NSKA 1NX1A 1Q73A 1AJ4A 1RK9A 1EMBA 1A75A 3H4SE 3G9AA 3CGLA 2F2OA 4W76A 3PATA 3SVBA 1SW8A 1XVJA 3LLEA 4HRGA 2WSNA 1OE9B 2JNXA 4OVNF 3WXAA 2JZIA 2KQYA 4IZNA 1B47A 2QLEA 1LA3A 3EVPA 4GF6B 4ZINA 4XOVA 2D8NA 1YRUB 2VRGA 1XQMA 1RMOA 3SVUA 4PCWA 1XA9A 2JPTA 4L12A 4KW8A 1DJWA 1S3PA 4UPGA 3RLZA 4BDUA 5CSFA 1CLBA 1CLLA 1A03A 2A47A 1UISA 1HT9A 4XJKA 2QACA 1RRXA 1QLKA 2EC6B 1L2OC 5HKYA 1C7WA 2HJOA 3VHTA 3TUYB 2F3ZA 1KK7Z 2A48A 2FWQA 4JWQA 2DDDA 2O24A 3E3RA 3RM1A 3I5FC 1TTXA 3CGAA 5LTQA 3DQIA 4ZF3A 2BECA 4DKMA 3EK4A 1KQMC 4DKNA 2DUEA 5AXIA 3DQ2A 4EMQA 3KPXA 1YVHA 2LANA 4OV2A 1TIZA 5KU1A 4DS7A 1YR5A 3CFHA 5ER5A 1XFXO 4OKHA 2MJWB 2ZKMX 2KAXA 1GQMA 1SMGA 3H1OA 3LVDA 1G8IA 4ORBB 1J55A 3ZNIA 1ALVA 1WRKA 1H6RA 5BTTA 2BKIB 2C9IA 2LVJA 3BUNB 4C0KA 1IKUA 1NSHA 1ZUZA 3PJBA 1OOJA 2LE9B 3TDIA 5IBWA 4ZCUA 4U8DA 1NWDA 1PSBA 2F8PA 4NDCA 1UHJA 2L0PA 3BXCA 2Y1MA 4W7RA 5DPGA 1QY3A 1N65A 4LJDA 2LHIA 3PFVA 5FVFA 1AVSA 4MBEA 1BLQA 4W77A 3PALA 2ZMWA 1QVIY 3VRQA 1E8AA 4EULA 4USLA 2A56B 4WRIA 1S6CA 2KI4C 1YURA 1C4FA 5DPJA 1EMMA 1YJFA 5AFPA 1QASA 1YRTB 2C9JA 1XFWO 3AI5A 3DVJA 1ZGOA 5D7FA 2Q91A 1KWOC 4MRYA 4WQ3A 1OXFA 3KCSA 2ZO7A 1QYOA 4W6CA 4KF4A 2EGDA 1GJYA 4KW9A 3U8AA 2WISA 1GFLA 1CDPA 4OQWA 1KK8B 2L50A 2QLHA 3NSOA 1PVBA 1GGWA 1JF0A 3OX5A 2WCFA 1J7OA 2Z6YA 2HRSA 4KW4A 3CR5X 2QPTA 1WY9A 2K0JA 2OS8B 1KYPA 2VZXA 1V1GA 2L2EA 4MLWA 4W72A 4F0ZB 3RWTA 2E30A 4P5OE 1YZWA 3U0KA 1G4YR 1RM9A 3JTDC 4W6LA 4CLNA 2KI4B 5HZSA 4R1EA 3SJSA 3NT3A 4PE4A 2BBMA 2KAYA 2A52B 3O4YA 2RGIA 1EJ3A 1EG3A 1IQ3A 4GNKB 4J8AA 2Z6XA 1IG5A 3DQ9A 4W6GA 3FIAA 3DQ6A 5HYDA 5AERA 4I5KA 2ZMUA 2M0RA 2H61A 4MZKA 4GFTA 2EMOA 3DQCA 3E5WA 4B5YA 2Y5IA 3A8SA 1CDMA 4N1GA 2COLB 1F55A 2MHHA 3SVEA 4ORNA 2QZ0A 3EK8A 2K61A 2B1UA 4MZLA 4W73A 1OXEA 5FVIA 4AOMA 1EMFA 2FL1A 4W7DA 1F54A 1IRJA 1EG4A 3V3DA 4LQUA 4W6HA 4Q9XA 1YFPA 1AP4A 2I7AA 3CWGA 1SL9A 4GGNA 1QXTA 1KYRA 2JQ6A 4YGEB 2KFGA 1CFCA 4ZFSA 4W6AA 2DDCA 3GL4A 1CM4A 3CR4X 3JVTB 1Q4CA 3K21A 4PPJA 3ZUJA 4W6JA 3TMTA 1H4BA 4PDZA 2DD7A 2WC8A 1TOPA 1KQVA 3S05A 1QIWA 1W7TA 2WCBA 3FS7A 5TNCA 3DQJA 2IB6A 3LCPC 2HCGA 3PSRA 3DQ7A 4KGFA 4Z4KA 1SNLA 3CZTX 2HGDA 1SR6C 1S5GY 2A50B 1LA0A 1UHHA 1JBZA 2CT9A 2KHNA 4IK8A 4DXPA 2L5XB 4GPLB 1XSSA 2DD9A 2M3WA 4TZAA 5DQMA 1CFFA 2Y0GA 1XAEA 4N1FA 1QIVA 3UG0A 3DQNA 2CBLA 1H8BA 5LK4A 5PALA 1CM1A 3SVCA 1OXDA 1HQVA 2LC5A 1LXFC 2JTZA 2O5GA 4EN1A 2BL0C 1WDCB 3I19A 1K9UA 2MA2A 2LCPA 2O2BA 1IJ5A 2LP3A 4IK4A 3GB3A 4CFRA 1NIWA 2BCAA 5HW9A 2Y4QA 1CFPA 1UWOA 4IK5A 3BXKA 1QS7A 4JRBA 2BE6A 3A8RA 3FWBA 4QJ4B 1QV0A 3IF7A 5GQQC 1H4UA 4LJDC 1PRWA 2OKWA 3I5IB 3FWCA 1TNPA 3I5HB 1EMEA 2OTEA 4W6TA 2LNKA 3WHUB 3SV5A 2PXSA 4ETOA 4OHSA 4JGEA 3EVRA 2EC6C 4YGDB 4HREE 2L51A 3KCTA 2KSPA 3TUYC 4JF9A 4ZF4A 2V53A 1OZSA 4WQ2A 1JBAA 5F6TA 1UHIA 3DQMA 3TDUA 2G3DB 1K96A 5JJGA 4HRHA 4DRWA 2RH7A 4XOWA 2LM5A 3NSIA 1ZGPA 4R6BA 2JNFA 1Q4AA 4BY4A 1F70A 2AUCA 2WURA 1BMOA 1M39A 2OJKA 3U8CA 3SVNA 1D1OA 2K7BA 2GX0A 4OJ0A 3LK0A 3UFZA 1JFKA 1MUXA 1B7TY 2K2AA 2GW3A 3WCKA 2KYCA 4DXNA 1W7JB 3ICBA 4MVFA 5EBJA 3EVVA 1F71A 4ZB1A 4DXMA 1Z1QA 2Q6PA 4OGSA 4UTSA 3SG2A 2AHAA 2LLUA 1EMCA 5KSZA 3DQEA 2HGYA 3SRYA 2I94A 1X02A 2L98A 1KSMA 1ZFSA 3DQKA 4GBAA 1TNQA 1JC2A 3WHTB 3EK7A 2HQKA 4L13A 1JBYA 3F45A 3QRXA 4H3LA 5DTYA 2H9WA 2H61C 2FCDA 3DVEA 3IP2A 1KFUL 1Q4BA 5CSNA 2BCBA 2KNEA 3SSTA 1NUBA 4JEOA 1C07A 1MWNA 4PFEA 1SCVA 5H87A 4JFGA 4P76A 3SSPA 4ICBA 1F09A 2JXLA 1CLMA 5FVGA 1XFYO 2ARLA 1U5IB 4W7EA 1B4CA 2WOSA 3CR2A 3LVCA 1SYMA 1PVAA 5KTYA 1B8LA 5I2QA 1Y6WA 2FOTA 3ZTFA 4YGBB 5EXCI 4QJ3B 2WSOA 3PIBA 3DVKA 4Q7UA 1QYQA 2BBNA 4M2OA 3O77A 1B9CA 2G5ZB 5DTXA 2PSRA 2A53B 3M24A 2M8UA 2VAEA 1KK8C 5I8NA 1F0BA 1IWQA 1QJTA 1K2HA 3LS3A 3SG7A 3OB1B 2JC2A 1J7RA 2OS8C 5I2LA 5DQBA 2LP2A 2A46A 1CMGA 1YUUA 3LK1A 4NDBA 2HFCA 1PALA 2K7CA 2PALA 3ST4A 5DKRA 3BUOB 1BFPA 4MSPA 4RTCA 3VICA
chains in the Genus database with same CATH superfamily
1CTRA 1YTZC 1PULA 1KK7Y 1M46A 2BTJA 3DVMA 1EMKA 1DJIA 4N3DA 1K90D 1YUSA 2M97A 1JWDA 2KGRA 3GOFA 1Y1AA 2WCLA 3NHIA 4Q7RA 1A2XA 5G08A 4MZJA 3KHEA 4W6KA 1QTXA 4KEXA 2K8MB 1XMZA 2KDHA 2PVBA 3S0DA 1NCYA 3U8PA 1G33A 5HZUA 1YHGA 3PN7B 2HQ8A 2A4JA 4YBHB 3D73A 2DUHA 3BX9A 1T14A 2NLNA 4L9MA 2M29A 1FPWA 1OMVA 1NX2A 5AEQA 1U5IA 4W6BA 3OHMB 2GX2A 4LQTA 2G6XA 1MXEA 1JSAA 4PHKA 3S0GA 1J1EA 5I94A 1YVLA 2ICRA 3CFFA 4W74A 1IQ5A 1LKJA 1XFUO 4E68A 4H3MA 5H88A 1KSOA 3K1KA 5DPIA 4NQGA 3M0WA 1K9KA 1EXRA 2NCPA 2AWKA 5CPVA 4MN0A 5DKNA 1DEKA 2OTGB 5BT0A 1OZOA 2ISDA 1R2UA 1HUYA 3PJ7A 5K89A 3JVTC 3TS5B 3SG5A 1A4PA 1DTLA 4JQ0D 1Z2CB 4W6SA 1QX7A 1UP5A 4JC2A 2KOTA 5LTPA 3MSEB 2WORA 1MR8A 2M1KB 1F8HA 1YHIA 1DGUA 3CFAA 1MHOA 1GM0A 2ZN9A 3UO9A 1EMGA 1ZGQA 1W7SA 2H5OA 2IE2A 1M45A 4H47A 4ORCB 1SL7A 1ZUXA 2KI6D 4JKTA 2EMNA 4Z4MA 1NX3A 2HPSA 3DQFA 3LL8B 2LVKA 3C1VA 1EMLA 4OCIA 1JUOA 5B8IB 3IR8A 1DVIA 3AKAA 2KI6C 3W1CA 5HBDA 4GUKA 5DU0A 5DY6A 3SS0A 4W7AA 3P8UA 2KLDA 5EXUA 3WNXB 2LMTA 2Y1NA 3O4XA 2QEOA 3EKJA 1WDCC 3BUMB 5F9GA 1DJYA 4AR7A 3B88A 5FI2A 3AI4A 4W6DA 2JOJA 3O6BA 1FI5A 2PXWA 2KGBC 4B30B 5CSIA 3CD1A 3OSQA 3BXAA 1OOIX 5BPJA 2BNXA 2KQ6A 4I5NB 2CNPA 1Y1UA 3SIBA 4LJBA 1UURA 2WCMA 5EXBA 3SIAA 1GL4A 3P28A 4IK3A 3E5VA 2JT8A 1GGZA 1RECA 1MOVA 2HQZA 1AUIB 1WLZA 5DTLA 5HZTA 2LLTA 4NWSA 4CPVA 1WLMA 3TDZA 1SCMB 3NHTA 1Y1XA 3NT9A 3I5IC 1W7IB 3U0MA 3PM8A 1J1DA 2B3PA 2YDZA 1N2DA 3NF0A 1ODBA 3OB2B 3DQ4A 3VGOA 1B8CA 3I5HC 4J89A 1XK4A 4KPIA 3BFHA 4AQIA 5FI7A 2WHSA 2AMIA 3W1DA 2ZRSA 2WHTA 2BKHB 1YX7A 3IQQA 1UHKA 3NGVA 4J88A 4HQ8A 2K2FA 2MLFC 3AKOA 3CB9A 1SRAA 5AQBB 3BFBA 3O2PA 1QX2A 2WC5A 3GK1A 4W69A 3CABA 4HVFA 2AAOA 1A29A 4D1EA 1BR1B 2JADA 5D3OA 4DXOA 1SK6D 1MOUA 2H8QA 1SKTA 1VRKA 5KTGA 1F4QA 1QV1A 3CLNA 3DZTA 3VRRA 2K7DA 4INWA 2AWJA 1B8RA 5HKWA 5FYXA 4W7FA 1S1EA 3D75A 1BODA 3DQAA 2K7OA 5DKQA 3ZUFA 3SS4A 2Z6ZA 3NEZA 5AANA 2LLSA 1SY9A 4Q9WA 1K95A 4DXIA 1XFZO 1YHHA 2PRUA 3WLDA 2A54B 2SCPA 3BQ3A 3PJIA 2Q4UA 3ST2A 3HX4A 3NSLA 4ORAB 4HQ9A 4QJ5B 1SPYA 3DQDA 1Q80A 3DY9A 5T3IA 3R1PA 1RTP1 4FTGA 1W9ZA 1AHRA 4I5LB 4B30A 2QLIA 3DF0B 4CFQA 3U0NA 1M63B 1XA5A 3VRPA 2OGRA 1B1GA 1AJ5A 4OY4A 3SSLA 1DF0A 2WC6A 5HLOA 2VVHA 3ZULA 4RYWA 3SVOA 3S0AA 2JU0A 2LUXA 3I5GB 1BF5A 2ZN8A 1NCXA 5JOLA 2MBXA 2JT3A 3DPXA 1QATA 2ZO6A 5DRGA 3CD9A 5HZOA 5LTRA 3BYAA 1CMFA 4W6IA 4GGFA 1LINA 1WRZA 2QDIA 4A4BA 1OSAA 2G2BA 1OMDA 2DUIA 1KP5A 4YGCB 1JF2A 3AKBA 1R6PA 3WLCA 1XFVO 3SVRA 2DUFA 5BQLA 2P4MA 4AQJA 4M2QA 3ZWHA 1P28A 2WCEA 1NP8A 2M7LA 4W6MA 3DQ1A 2QRFA 1K94A 1QVIZ 4IK9A 5EHUA 4GESB 4W6RA 4YI9A 1TUJA 3NEDA 2KBMA 2P71A 3PLFB 2YE1A 3CBEA 4DXQA 2WNDA 1K93D 2M49B 4XGYA 4PE7A 3OGOA 2M1UA 4PPKA 3CZ1A 2WCKA 2H5QA 4PPLA 1L7ZA 1GGXA 1KCYA 3D77A 1QXPA 1BOCA 1CKKA 5EB7A 3BUXB 1Q4EA 1CFDA 3KO0A 3DYEA 3M22A 4PALA 1QYFA 1QWVA 4IK1A 4CIDA 3B7AA 2IS9A 1EH2A 3S0FA 1CNPA 4ZF5A 1N0YA 1MQ1A 2V4EA 4DIRA 2M7NA 2QT2A 4W6NA 4OR9B 2F3YA 3D0YB 4DCKA 1S6JA 2OTBA 2JRFA 4PHNA 3CZ2A 2LHLA 2NZ0A 4PE0A 4AS8A 1XYDA 1NCZA 3MGFA 3D10A 1DJHA 2PASA 2BCXA 4HQCA 3BXBA 1L2OB 3DF0A 2ZNDA 1KFXL 4PHMA 3GEXA 3OBVA 1MYWA 3U0LA 1EL4A 4HE4A 3I5FB 4XVPA 4EDOA 1AK8A 2IOVA 1V1FA 2YE0A 3LVAA 2CCMA 3PN7C 2B3QA 1JC1A 2POXA 2JULA 3OSRA 2LVIA 2JTTA 2I2RE 2TN4A 4HSZA 2WIQA 1JFJA 4MEWA 4C0LA 1MXLC 1KQMB 4YRUA 2H5PA 2JXCA 4GAOA 4R6DA 4ZCVA 2JT0A 2DOQA 3SSVA 5ER4X 1DJZA 4Q04A 2K60A 3NXAA 3DQ8A 5EB6A 1JC0A 2E6WA 1XFRA 1S36A 1ZACA 2HETA 3DPZA 4RYSA 4W75A 1XK4C 2OTGC 1QLSA 4N5XA 5J3XA 4NDDA 4KF5A 3TS5C 1PK0D 1BU3A 4XYNA 2QEBA 3EKHA 2OKYA 1M31A 3OX6A 4M2PA 4LW5A 1FBVA 2WCHA 1F4OA 5FI6A 5FHVA 3DQLA 1FF1A 1G7KA 2KAVA 1FI6A 1CV7A 3OP0A 1BG1A 2HPWA 1K9PA 3BOWB 3VROA 1KFUS 4TNCA 4PE1A 3A4UB 2MLEC 3LF4B 5HGEA 3DQOA 3S0EA 1UHNA 4PT1A 2G6EA 3ADFA 2AWLA 2CXJA 2KYFA 1YJ2A 2DUGA 1OW4A 1WRLA 3BJHA 3S0BA 3D0YA 4EDSA 1S5GZ 1IJ6A 1BJFA 1UUSA 1CDNA 2F33A 1DJGA 2GGMA 3CDNA 3DQHA 1SL8A 1RROA 1DJXA 2L4HA 1TNXA 1K8UA 1J7QA 4JPZB 3RWAA 1RMPA 4ZBLA 4DUQA 4W7CA 2Q57A 2NXQA 3RZSA 2L5YA 3AAJA 4A4CA 2H6VA 2R2IA 1KWOB 2P6BB 1PSRA 1CDLA 1OOFA 1OQPA 3TZ1A 2FCEA 1KFXS 1RWYA 1C3ZA 1SBJA 3SSHA 1QX5B 3SVDA 3VK1A 2WHUA 2I18A 3GJ1A 4XL5A 5J2OA 2O29A 1OOGA 3R72A 2LV7A 3GK2A 2MAZA 2GV5A 1NPQA 1Q4DA 4GGFC 4C0JA 1SCMC 2CTNA 2SASA 3OGNA 1S6IA 2O60A 2KBIA 1BT6A 1YUTA 3H1RA 4YGAA 4MRXA 3JTDB 3BFAA 2LMVA 4U2VA 4W6FA 5DTZA 1BR4B 2BE4A 4KAGA 4KA9A 4LJCA 3SG3A 5DRFA 3LF3A 2VVIA 1NYAA 2AH8A 3IQOA 3DQ5A 3R1OA 2EHBA 3ST3A 1IGVA 4GOBA 2KPHA 1FW4A 3VRNA 3DD4A 1EMAA 2QLGB 1C7VA 1Y0VH 1RJVA 2M9GA 3KF9A 2LVVA 5HKZA 5CSJA 1DF0B 3BOWA 2H2KA 2ZRTA 3SSKA 2G16B 2F2PA 1NX0A 1YX8A 4ZIOA 2Z1OA 3AAKA 1A75B 4W7XA 2OPOA 3SG4A 3ST0A 1B9AA 1XO5A 3HCMA 3GJ2A 4TZGA 1TN4A 2NCOA 1TCFA 1IH0A 4W6PA 1J7PA 2VADA 4ANJA 3SG6A 5HLVA 4P1QA 2MRDA 2H5RA 1KYSA 4Q7TA 2G2SB 5DPHA 3K1EA 5H89A 2HQWA 3EVUA 4H48A 2V4EC 4IJ7A 3TMRA 1DGVA 3CS1A 1ALWA 5EJUA 2ZFDA 1MF8B 2FZUA 1TRFA 4FQOA 1B7TZ 1RFJA 2EMDA 2ZNEA 4XJKB 4I2YA 5D69A 1DT7B 2G6YA 1ZMZA 3O78A 4I5JA 2L4IA 4H3NA 3KEVA 3VHTB 3BUWB 2AWMA 4W6UA 1DMOA 3I5GC 2KFFA 4L1IA 3DPWA 4W6OA 2KFHA 2LUCA 1ZOTB 1TCOB 2LAPA 2VVJA 1SR6B 2FJUB 1TNWA 3CTNA 5I2OA 3GK4X 2QU1A 4BY5A 3LSAA 2PMYA 1Z1PA 1CB1A 2V4EB 3E5TA 1RMMA 2HF5A 2GW4B 2LMUA 2IB5A 3SVSA 2GGZA 3PJ5A 2G9BA 4KGEA 4P2YB 1LVCD 1W7UA 2G3OA 1S6ZA 3CYZA 4PHJA 3ED8A 2JWWA 1S26D 3Q8IA 4YI8A 2QLGA 3DQ3A 3SSYA 2BL0B 4KF5C 1OOHA 1HCJA 4IL1A 2YFPA 1OMRA 3QMEA 3LA1A 3DQUA 5BTTB 3NSKA 1NX1A 1Q73A 1AJ4A 1RK9A 1EMBA 1A75A 3H4SE 3G9AA 3CGLA 2F2OA 4W76A 3PATA 3SVBA 3V2LA 1SW8A 1XVJA 3LLEA 4HRGA 2WSNA 1OE9B 2JNXA 4OVNF 3WXAA 2JZIA 2KQYA 4IZNA 1B47A 2QLEA 1LA3A 3EVPA 4GF6B 4ZINA 4XOVA 2D8NA 3SS3A 1YRUB 2VRGA 1XQMA 1RMOA 3SVUA 4FQTA 4PCWA 1XA9A 4KYNA 2JPTA 4L12A 1DJWA 4UPGA 1S3PA 4KW8A 3RLZA 1SSEB 4BDUA 5CSFA 1CLBA 1CLLA 1A03A 2A47A 1UISA 1HT9A 4XJKA 2QACA 1RRXA 1QLKA 2EC6B 1L2OC 5HKYA 1C7WA 2HJOA 3VHTA 3TUYB 2F3ZA 1KK7Z 2A48A 2FWQA 4JWQA 2DDDA 2O24A 2QEHA 3E3RA 3RM1A 3I5FC 1TTXA 3CGAA 5LTQA 3DQIA 4ZF3A 2BECA 4DKMA 3EK4A 1KQMC 4DKNA 2DUEA 5AXIA 3DQ2A 4EMQA 3KPXA 1YVHA 3VB1A 2LANA 4OV2A 1TIZA 3L47A 3UNWA 5KU1A 1ORGA 4DS7A 1YR5A 3CFHA 5ER5A 1LS8A 1XFXO 4OKHA 2MJWB 2ZKMX 2KAXA 1GQMA 1SMGA 3H1OA 3LVDA 1G8IA 4ORBB 1J55A 3ZNIA 1ALVA 1WRKA 1H6RA 5BTTA 2BKIB 2C9IA 2LVJA 3BUNB 4C0KA 1IKUA 4F7FA 1NSHA 1ZUZA 3PJBA 1OOJA 2LE9B 3TDIA 1DELA 1Z4HA 5IBWA 4ZCUA 4U8DA 1NWDA 1PSBA 2F8PA 4NDCA 1UHJA 2L0PA 4INXA 3BXCA 2Y1MA 4W7RA 5DPGA 1QY3A 1N65A 4LJDA 2LHIA 3B86A 3PFVA 3B87A 5FVFA 1AVSA 4MBEA 1BLQA 4JD9A 4W77A 3PALA 2ZMWA 1QVIY 3VRQA 1E8AA 4EULA 4USLA 2A56B 4WRIA 1S6CA 2KI4C 1YURA 1C4FA 5DPJA 1EMMA 1YJFA 5AFPA 1QASA 1YRTB 2C9JA 1XFWO 3AI5A 3DVJA 1ZGOA 5D7FA 2Q91A 1KWOC 4MRYA 4WQ3A 1OXFA 3KCSA 2ZO7A 1QYOA 4W6CA 4KF4A 2EGDA 1GJYA 4KW9A 3U8AA 2KLEA 2WISA 1GFLA 1CDPA 4OQWA 1KK8B 2L50A 5EL2A 2QLHA 3NSOA 1PVBA 1GGWA 1JF0A 3OX5A 2WCFA 1J7OA 2Z6YA 2HRSA 4KW4A 3CR5X 3EG5B 2QPTA 1WY9A 2K0JA 2OS8B 1KYPA 2VZXA 1V1GA 2L2EA 4MLWA 4W72A 4F0ZB 3RWTA 2E30A 1TUZA 4P5OE 1YZWA 3B6XA 3U0KA 1G4YR 1RM9A 3JTDC 4W6LA 4CLNA 2KI4B 5HZSA 4R1EA 3SJSA 3NT3A 4PE4A 3FE9A 2BBMA 2KAYA 1TWOA 3D78A 2A52B 3O4YA 2RGIA 1EJ3A 1EG3A 1IQ3A 4GNKB 4J8AA 2Z6XA 1IG5A 3DQ9A 4W6GA 3FIAA 3D76A 3DQ6A 5HYDA 5AERA 4I5KA 2ZMUA 2M0RA 2H61A 4MZKA 4GFTA 2EMOA 3DQCA 3E5WA 4B5YA 3L4AA 2Y5IA 3A8SA 1CDMA 4N1GA 2COLB 1F55A 5HL1A 2MHHA 3SVEA 4ORNA 2QZ0A 3EK8A 2K61A 2B1UA 4MZLA 4W73A 1OXEA 5FVIA 4AOMA 1EMFA 2FL1A 4W7DA 1F54A 1IRJA 1EG4A 3V3DA 2BAPA 4LQUA 4Q9XA 1YFPA 4W6HA 1AP4A 3R1VA 2I7AA 5DICA 3CWGA 1SL9A 4GGNA 1QXTA 1KYRA 2JQ6A 4YGEB 2KFGA 1CFCA 4ZFSA 4W6AA 2DDCA 3GL4A 1CM4A 3CR4X 2H8VA 3JVTB 1Q4CA 3K21A 4PPJA 3ZUJA 4W6JA 3TMTA 1H4BA 4PDZA 2DD7A 2WC8A 1TOPA 1KQVA 3S05A 1QIWA 1W7TA 2WCBA 3FS7A 2QEVA 5TNCA 3DQJA 2IB6A 3LCPC 2HCGA 3PSRA 3DQ7A 4KGFA 2FJYA 4Z4KA 1SNLA 3CZTX 2HGDA 1SR6C 1S5GY 2A50B 1LA0A 1UHHA 1JBZA 2CT9A 2KHNA 4IK8A 4DXPA 2L5XB 4GPLB 1XSSA 2DD9A 2M3WA 4TZAA 5DQMA 1CFFA 2Y0GA 1XAEA 4N1FA 1QIVA 3UG0A 3DQNA 2CBLA 1H8BA 5LK4A 5PALA 1CM1A 3SVCA 1OXDA 1HQVA 2LC5A 1LXFC 2JTZA 2O5GA 4EN1A 2BL0C 1WDCB 3I19A 1K9UA 2MA2A 2LCPA 2O2BA 1IJ5A 2LP3A 4IK4A 3GB3A 4CFRA 1NIWA 2BCAA 5HW9A 2Y4QA 1CFPA 1UWOA 4IK5A 3BXKA 1QS7A 4JRBA 2BE6A 3A8RA 3FWBA 2ERBA 3FE6A 4QJ4B 1QV0A 3IF7A 5GQQC 1H4UA 4LJDC 1PRWA 2JPOA 2OKWA 3I5IB 3FWCA 1TNPA 3FE8A 3I5HB 1EMEA 2OTEA 4W6TA 2LNKA 2YGUA 3WHUB 3SV5A 2PXSA 4ETOA 1C3YA 4OHSA 4JGEA 3CZ0A 3EVRA 2EC6C 4YGDB 3SS5A 4HREE 2L51A 3KCTA 2KSPA 3TUYC 4JF9A 4ZF4A 1DC1A 2V53A 1OZSA 4WQ2A 1JBAA 5F6TA 3DXLA 4OZDA 2WCJA 1UHIA 3DQMA 3TDUA 2G3DB 1K96A 5JJGA 4HRHA 4DRWA 2RH7A 4XOWA 2LM5A 2L2CA 3NSIA 1ZGPA 4R6BA 2JNFA 1Q4AA 4BY4A 1F70A 2AUCA 2WURA 1BMOA 3IVTA 1M39A 2OJKA 3U8CA 3D74A 3SVNA 1D1OA 2K7BA 2GX0A 4OJ0A 3LK0A 3UFZA 1JFKA 1MUXA 1B7TY 2K2AA 2GW3A 3WCKA 2KYCA 4DXNA 1W7JB 3ICBA 4MVFA 5EBJA 3EVVA 1F71A 4ZB1A 4DXMA 1Z1QA 2Q6PA 4OGSA 4UTSA 3SG2A 2AHAA 2LLUA 1EMCA 5KSZA 3DQEA 2HGYA 3SRYA 2I94A 1X02A 2L98A 1KSMA 1ZFSA 3DQKA 4GBAA 1TNQA 1JC2A 3WHTB 3EK7A 2HQKA 4L13A 1JBYA 3F45A 3QRXA 3PM2A 4H3LA 5DTYA 2H9WA 2H61C 2FCDA 3DVEA 3IP2A 1KFUL 1Q4BA 5CSNA 2BCBA 2KNEA 3SSTA 1NUBA 4JEOA 1C07A 1MWNA 4PFEA 1SCVA 5H87A 2P70A 4JFGA 4P76A 3SSPA 4ICBA 1F09A 2JXLA 1CLMA 5FVGA 1XFYO 2ARLA 2PYQA 1U5IB 4W7EA 1B4CA 2WOSA 3CR2A 3LVCA 2GTEA 1SYMA 1PVAA 5KTYA 2PQLA 1B8LA 5I2QA 1Y6WA 2FOTA 3ZTFA 4YGBB 5EXCI 4QJ3B 2WSOA 3PIBA 3DVKA 4Q7UA 1QYQA 2BBNA 4M2OA 3O77A 1B9CA 2G5ZB 5DTXA 2PSRA 2A53B 3M24A 1IIOA 2M8UA 2VAEA 1KK8C 5I8NA 1F0BA 1IWQA 3L4LA 1QJTA 1K2HA 3N7HA 3LS3A 3SG7A 3OB1B 2JC2A 1J7RA 2OS8C 5I2LA 5DQBA 2LP2A 2A46A 1CMGA 1YUUA 3LK1A 4NDBA 2HFCA 1PALA 2K7CA 2PALA 3ST4A 5DKRA 3BUOB 1BFPA 4MSPA 4RTCA 3VICA 1DQEA
chains in the Genus database with same CATH topology
1CTRA 1YTZC 1PULA 1KK7Y 1M46A 2BTJA 3DVMA 1EMKA 1DJIA 4N3DA 1K90D 1YUSA 2M97A 1JWDA 2KGRA 3GOFA 1Y1AA 4Q7RA 1A2XA 5G08A 4MZJA 3KHEA 4W6KA 1QTXA 4KEXA 2K8MB 1XMZA 2KDHA 2PVBA 1NCYA 3U8PA 1G33A 5HZUA 1YHGA 3PN7B 2HQ8A 2A4JA 4YBHB 2DUHA 3BX9A 2NLNA 4L9MA 2M29A 1FPWA 1OMVA 1NX2A 5AEQA 1U5IA 4W6BA 3OHMB 2GX2A 4LQTA 2G6XA 1MXEA 1JSAA 4PHKA 1J1EA 1YVLA 2ICRA 3CFFA 4W74A 1IQ5A 1LKJA 1XFUO 4E68A 4H3MA 5H88A 1KSOA 3K1KA 5DPIA 4NQGA 3M0WA 1K9KA 1EXRA 2NCPA 2AWKA 5CPVA 4MN0A 5DKNA 2OTGB 5BT0A 1OZOA 2ISDA 1R2UA 1HUYA 3PJ7A 5K89A 3JVTC 3TS5B 3SG5A 1A4PA 1DTLA 4JQ0D 4W6SA 1QX7A 1UP5A 4JC2A 2KOTA 5LTPA 3MSEB 2WORA 1MR8A 2M1KB 1F8HA 1YHIA 1DGUA 3CFAA 1MHOA 2ZN9A 1EMGA 1ZGQA 1W7SA 2H5OA 2IE2A 1M45A 4H47A 4ORCB 1SL7A 1ZUXA 2KI6D 2EMNA 4Z4MA 1NX3A 2HPSA 3DQFA 3LL8B 2LVKA 3C1VA 1EMLA 4OCIA 1JUOA 5B8IB 3IR8A 1DVIA 3AKAA 2KI6C 3W1CA 5HBDA 4GUKA 5DU0A 5DY6A 3SS0A 4W7AA 3P8UA 5EXUA 3WNXB 2LMTA 2Y1NA 3EKJA 1WDCC 3BUMB 5F9GA 1DJYA 4AR7A 3AI4A 4W6DA 2JOJA 3O6BA 1FI5A 2PXWA 2KGBC 4B30B 5CSIA 3CD1A 3OSQA 3BXAA 5BPJA 2KQ6A 4I5NB 2CNPA 1Y1UA 3SIBA 4LJBA 1UURA 5EXBA 3SIAA 1GL4A 3P28A 4IK3A 3E5VA 2JT8A 1GGZA 1RECA 1MOVA 2HQZA 1AUIB 1WLZA 5DTLA 5HZTA 2LLTA 4NWSA 4CPVA 1WLMA 3TDZA 1SCMB 1Y1XA 3NT9A 3I5IC 1W7IB 3U0MA 3PM8A 1J1DA 2B3PA 2YDZA 1N2DA 3NF0A 1ODBA 3OB2B 3DQ4A 3VGOA 1B8CA 4J89A 3I5HC 1XK4A 4KPIA 4AQIA 2WHSA 2AMIA 3W1DA 2ZRSA 2WHTA 2BKHB 1YX7A 3IQQA 1UHKA 4J88A 4HQ8A 2K2FA 2MLFC 3AKOA 3CB9A 1SRAA 5AQBB 3O2PA 1QX2A 3GK1A 4W69A 4HVFA 2AAOA 1A29A 4D1EA 1BR1B 2JADA 4DXOA 1SK6D 1MOUA 2H8QA 1SKTA 1VRKA 5KTGA 1F4QA 1QV1A 3CLNA 3VRRA 2K7DA 2AWJA 1B8RA 5HKWA 5FYXA 4W7FA 1S1EA 1BODA 3DQAA 2K7OA 5DKQA 3ZUFA 2Z6ZA 3NEZA 5AANA 2LLSA 1SY9A 4Q9WA 1K95A 4DXIA 1XFZO 1YHHA 2PRUA 3WLDA 2A54B 2SCPA 3BQ3A 2Q4UA 3ST2A 3HX4A 3NSLA 4ORAB 4HQ9A 4QJ5B 1SPYA 3DQDA 1Q80A 5T3IA 1RTP1 4FTGA 1AHRA 4I5LB 4B30A 2QLIA 3DF0B 4CFQA 3U0NA 1M63B 1XA5A 3VRPA 2OGRA 1B1GA 1AJ5A 4OY4A 3SSLA 1DF0A 5HLOA 2VVHA 3ZULA 4RYWA 3SVOA 2JU0A 2LUXA 3I5GB 1BF5A 2ZN8A 1NCXA 5JOLA 2MBXA 2JT3A 3DPXA 1QATA 2ZO6A 5DRGA 3CD9A 5HZOA 5LTRA 3BYAA 4W6IA 1CMFA 4GGFA 1LINA 1WRZA 4A4BA 1OSAA 2G2BA 1OMDA 2DUIA 1KP5A 4YGCB 1JF2A 3AKBA 1R6PA 3WLCA 1XFVO 3SVRA 2DUFA 5BQLA 2P4MA 4AQJA 4M2QA 3ZWHA 2WCEA 1NP8A 2M7LA 4W6MA 3DQ1A 2QRFA 1K94A 1QVIZ 4IK9A 5EHUA 4GESB 4W6RA 4YI9A 3NEDA 2KBMA 3PLFB 2YE1A 3CBEA 4DXQA 2WNDA 1K93D 2M49B 4XGYA 4PE7A 3OGOA 2M1UA 4PPKA 2H5QA 4PPLA 1L7ZA 1GGXA 1KCYA 1QXPA 1BOCA 1CKKA 5EB7A 3BUXB 1Q4EA 1CFDA 3KO0A 3M22A 4PALA 1QYFA 4IK1A 4CIDA 2IS9A 1EH2A 1CNPA 4ZF5A 1N0YA 1MQ1A 2V4EA 4DIRA 2M7NA 2QT2A 4W6NA 4OR9B 2F3YA 3D0YB 4DCKA 1S6JA 2OTBA 2JRFA 4PHNA 2LHLA 2NZ0A 4PE0A 4AS8A 1XYDA 1NCZA 3MGFA 3D10A 1DJHA 2PASA 2BCXA 4HQCA 3BXBA 1L2OB 3DF0A 2ZNDA 1KFXL 4PHMA 3GEXA 1MYWA 3U0LA 1EL4A 4HE4A 3I5FB 4XVPA 4EDOA 1AK8A 2IOVA 1V1FA 2YE0A 3LVAA 2CCMA 3PN7C 2B3QA 1JC1A 2POXA 2JULA 3OSRA 2LVIA 2JTTA 2I2RE 2TN4A 4HSZA 2WIQA 1JFJA 4MEWA 4C0LA 1MXLC 1KQMB 4YRUA 2H5PA 2JXCA 4GAOA 4R6DA 4ZCVA 2JT0A 2DOQA 3SSVA 5ER4X 1DJZA 4Q04A 3NXAA 3DQ8A 5EB6A 1JC0A 2E6WA 1S36A 1ZACA 2HETA 3DPZA 4RYSA 4W75A 1XK4C 2OTGC 1QLSA 4N5XA 5J3XA 4NDDA 4KF5A 3TS5C 1PK0D 1BU3A 4XYNA 3EKHA 2OKYA 1M31A 3OX6A 4M2PA 4LW5A 1FBVA 1F4OA 5FHVA 3DQLA 1FF1A 1G7KA 2KAVA 1FI6A 1CV7A 3OP0A 1BG1A 2HPWA 1K9PA 3BOWB 3VROA 1KFUS 4TNCA 4PE1A 3A4UB 2MLEC 3LF4B 5HGEA 3DQOA 1UHNA 2G6EA 3ADFA 2AWLA 2CXJA 2KYFA 1YJ2A 2DUGA 1WRLA 3D0YA 4EDSA 1S5GZ 1IJ6A 1BJFA 1UUSA 1CDNA 2F33A 1DJGA 2GGMA 3DQHA 1SL8A 1RROA 1DJXA 2L4HA 1TNXA 1K8UA 1J7QA 4JPZB 3RWAA 1RMPA 4ZBLA 4DUQA 4W7CA 2Q57A 2NXQA 4A4CA 3AAJA 2H6VA 2R2IA 1KWOB 2P6BB 1PSRA 1CDLA 1OQPA 3TZ1A 2FCEA 1KFXS 1RWYA 1SBJA 3SSHA 1QX5B 3SVDA 3VK1A 2WHUA 2I18A 3GJ1A 4XL5A 5J2OA 2O29A 2LV7A 3GK2A 2MAZA 2GV5A 1NPQA 1Q4DA 4GGFC 4C0JA 1SCMC 2CTNA 2SASA 1S6IA 2O60A 2KBIA 1BT6A 1YUTA 3H1RA 4YGAA 4MRXA 3JTDB 4W6FA 2LMVA 4U2VA 5DTZA 1BR4B 2BE4A 4KAGA 4KA9A 4LJCA 3SG3A 5DRFA 3LF3A 2VVIA 1NYAA 2AH8A 3IQOA 3DQ5A 2EHBA 3ST3A 1IGVA 4GOBA 1FW4A 3VRNA 3DD4A 1EMAA 2QLGB 1C7VA 1Y0VH 1RJVA 2M9GA 3KF9A 2LVVA 5HKZA 5CSJA 1DF0B 3BOWA 2H2KA 2ZRTA 3SSKA 2G16B 2F2PA 1NX0A 1YX8A 4ZIOA 2Z1OA 3AAKA 1A75B 4W7XA 2OPOA 3SG4A 3ST0A 1B9AA 1XO5A 3HCMA 3GJ2A 4TZGA 1TN4A 2NCOA 1TCFA 1IH0A 4W6PA 1J7PA 2VADA 4ANJA 3SG6A 5HLVA 4P1QA 2MRDA 2H5RA 1KYSA 4Q7TA 2G2SB 5DPHA 5H89A 2HQWA 3EVUA 4H48A 2V4EC 3TMRA 1DGVA 3CS1A 1ALWA 5EJUA 2ZFDA 1MF8B 2FZUA 1TRFA 4FQOA 1B7TZ 1RFJA 2EMDA 2ZNEA 4XJKB 4I2YA 5D69A 1DT7B 2G6YA 1ZMZA 3O78A 4I5JA 2L4IA 4H3NA 3KEVA 3VHTB 3BUWB 2AWMA 4W6UA 1DMOA 3I5GC 2KFFA 4L1IA 3DPWA 4W6OA 2KFHA 2LUCA 1ZOTB 1TCOB 2LAPA 2VVJA 1SR6B 2FJUB 1TNWA 3CTNA 5I2OA 3GK4X 2QU1A 4BY5A 3LSAA 2PMYA 1Z1PA 1CB1A 2V4EB 3E5TA 1RMMA 2HF5A 2GW4B 2LMUA 2IB5A 3SVSA 2GGZA 3PJ5A 2G9BA 4KGEA 4P2YB 1LVCD 1W7UA 2G3OA 1S6ZA 4PHJA 3ED8A 2JWWA 1S26D 4YI8A 2QLGA 3DQ3A 3SSYA 2BL0B 4KF5C 1HCJA 4IL1A 2YFPA 1OMRA 3LA1A 3DQUA 5BTTB 3NSKA 1NX1A 1Q73A 1AJ4A 1RK9A 1EMBA 1A75A 3H4SE 3G9AA 3CGLA 2F2OA 4W76A 3PATA 3SVBA 1SW8A 1XVJA 3LLEA 4HRGA 2WSNA 1OE9B 2JNXA 4OVNF 3WXAA 2JZIA 2KQYA 4IZNA 1B47A 2QLEA 1LA3A 3EVPA 4GF6B 4ZINA 4XOVA 2D8NA 1YRUB 2VRGA 1XQMA 1RMOA 3SVUA 4PCWA 1XA9A 2JPTA 4L12A 4KW8A 1DJWA 1S3PA 4UPGA 3RLZA 4BDUA 5CSFA 1CLBA 1CLLA 1A03A 2A47A 1UISA 1HT9A 4XJKA 2QACA 1RRXA 1QLKA 2EC6B 1L2OC 5HKYA 1C7WA 2HJOA 3VHTA 3TUYB 2F3ZA 1KK7Z 2A48A 2FWQA 4JWQA 2DDDA 2O24A 3E3RA 3RM1A 3I5FC 1TTXA 3CGAA 5LTQA 3DQIA 4ZF3A 2BECA 4DKMA 3EK4A 1KQMC 4DKNA 2DUEA 5AXIA 3DQ2A 4EMQA 3KPXA 1YVHA 2LANA 4OV2A 1TIZA 5KU1A 4DS7A 1YR5A 3CFHA 5ER5A 1XFXO 4OKHA 2MJWB 2ZKMX 2KAXA 1GQMA 1SMGA 3H1OA 3LVDA 1G8IA 4ORBB 1J55A 3ZNIA 1ALVA 1WRKA 1H6RA 5BTTA 2BKIB 2C9IA 2LVJA 3BUNB 4C0KA 1IKUA 1NSHA 1ZUZA 3PJBA 1OOJA 2LE9B 3TDIA 5IBWA 4ZCUA 4U8DA 1NWDA 1PSBA 2F8PA 4NDCA 1UHJA 2L0PA 3BXCA 2Y1MA 4W7RA 5DPGA 1QY3A 1N65A 4LJDA 2LHIA 3PFVA 5FVFA 1AVSA 4MBEA 1BLQA 4W77A 3PALA 2ZMWA 1QVIY 3VRQA 1E8AA 4EULA 4USLA 2A56B 4WRIA 1S6CA 2KI4C 1YURA 1C4FA 5DPJA 1EMMA 1YJFA 5AFPA 1QASA 1YRTB 2C9JA 1XFWO 3AI5A 3DVJA 1ZGOA 5D7FA 2Q91A 1KWOC 4MRYA 4WQ3A 1OXFA 3KCSA 2ZO7A 1QYOA 4W6CA 4KF4A 2EGDA 1GJYA 4KW9A 3U8AA 2WISA 1GFLA 1CDPA 4OQWA 1KK8B 2L50A 2QLHA 3NSOA 1PVBA 1GGWA 1JF0A 3OX5A 2WCFA 1J7OA 2Z6YA 2HRSA 4KW4A 3CR5X 2QPTA 1WY9A 2K0JA 2OS8B 1KYPA 2VZXA 1V1GA 2L2EA 4MLWA 4W72A 4F0ZB 3RWTA 2E30A 4P5OE 1YZWA 3U0KA 1G4YR 1RM9A 3JTDC 4W6LA 4CLNA 2KI4B 5HZSA 4R1EA 3SJSA 3NT3A 4PE4A 2BBMA 2KAYA 2A52B 3O4YA 2RGIA 1EJ3A 1EG3A 1IQ3A 4GNKB 4J8AA 2Z6XA 1IG5A 3DQ9A 4W6GA 3FIAA 3DQ6A 5HYDA 5AERA 4I5KA 2ZMUA 2M0RA 2H61A 4MZKA 4GFTA 2EMOA 3DQCA 3E5WA 4B5YA 2Y5IA 3A8SA 1CDMA 4N1GA 2COLB 1F55A 2MHHA 3SVEA 4ORNA 2QZ0A 3EK8A 2K61A 2B1UA 4MZLA 4W73A 1OXEA 5FVIA 4AOMA 1EMFA 2FL1A 4W7DA 1F54A 1IRJA 1EG4A 3V3DA 4LQUA 4W6HA 4Q9XA 1YFPA 1AP4A 2I7AA 3CWGA 1SL9A 4GGNA 1QXTA 1KYRA 2JQ6A 4YGEB 2KFGA 1CFCA 4ZFSA 4W6AA 2DDCA 3GL4A 1CM4A 3CR4X 3JVTB 1Q4CA 3K21A 4PPJA 3ZUJA 4W6JA 3TMTA 1H4BA 4PDZA 2DD7A 2WC8A 1TOPA 1KQVA 3S05A 1QIWA 1W7TA 2WCBA 3FS7A 5TNCA 3DQJA 2IB6A 3LCPC 2HCGA 3PSRA 3DQ7A 4KGFA 4Z4KA 1SNLA 3CZTX 2HGDA 1SR6C 1S5GY 2A50B 1LA0A 1UHHA 1JBZA 2CT9A 2KHNA 4IK8A 4DXPA 2L5XB 4GPLB 1XSSA 2DD9A 2M3WA 4TZAA 5DQMA 1CFFA 2Y0GA 1XAEA 4N1FA 1QIVA 3UG0A 3DQNA 2CBLA 1H8BA 5LK4A 5PALA 1CM1A 3SVCA 1OXDA 1HQVA 2LC5A 1LXFC 2JTZA 2O5GA 4EN1A 2BL0C 1WDCB 3I19A 1K9UA 2MA2A 2LCPA 2O2BA 1IJ5A 2LP3A 4IK4A 3GB3A 4CFRA 1NIWA 2BCAA 5HW9A 2Y4QA 1CFPA 1UWOA 4IK5A 3BXKA 1QS7A 4JRBA 2BE6A 3A8RA 3FWBA 4QJ4B 1QV0A 3IF7A 5GQQC 1H4UA 4LJDC 1PRWA 2OKWA 3I5IB 3FWCA 1TNPA 3I5HB 1EMEA 2OTEA 4W6TA 2LNKA 3WHUB 3SV5A 2PXSA 4ETOA 4OHSA 4JGEA 3EVRA 2EC6C 4YGDB 4HREE 2L51A 3KCTA 2KSPA 3TUYC 4JF9A 4ZF4A 2V53A 1OZSA 4WQ2A 1JBAA 5F6TA 1UHIA 3DQMA 3TDUA 2G3DB 1K96A 5JJGA 4HRHA 4DRWA 2RH7A 4XOWA 2LM5A 3NSIA 1ZGPA 4R6BA 2JNFA 1Q4AA 4BY4A 1F70A 2AUCA 2WURA 1BMOA 1M39A 2OJKA 3U8CA 3SVNA 1D1OA 2K7BA 2GX0A 4OJ0A 3LK0A 3UFZA 1JFKA 1MUXA 1B7TY 2K2AA 2GW3A 3WCKA 2KYCA 4DXNA 1W7JB 3ICBA 4MVFA 5EBJA 3EVVA 1F71A 4ZB1A 4DXMA 1Z1QA 2Q6PA 4OGSA 4UTSA 3SG2A 2AHAA 2LLUA 1EMCA 5KSZA 3DQEA 2HGYA 3SRYA 2I94A 1X02A 2L98A 1KSMA 1ZFSA 3DQKA 4GBAA 1TNQA 1JC2A 3WHTB 3EK7A 2HQKA 4L13A 1JBYA 3F45A 3QRXA 4H3LA 5DTYA 2H9WA 2H61C 2FCDA 3DVEA 3IP2A 1KFUL 1Q4BA 5CSNA 2BCBA 2KNEA 3SSTA 1NUBA 4JEOA 1C07A 1MWNA 4PFEA 1SCVA 5H87A 4JFGA 4P76A 3SSPA 4ICBA 1F09A 2JXLA 1CLMA 5FVGA 1XFYO 2ARLA 1U5IB 4W7EA 1B4CA 2WOSA 3CR2A 3LVCA 1SYMA 1PVAA 5KTYA 1B8LA 5I2QA 1Y6WA 2FOTA 3ZTFA 4YGBB 5EXCI 4QJ3B 2WSOA 3PIBA 3DVKA 4Q7UA 1QYQA 2BBNA 4M2OA 3O77A 1B9CA 2G5ZB 5DTXA 2PSRA 2A53B 3M24A 2M8UA 2VAEA 1KK8C 5I8NA 1F0BA 1IWQA 1QJTA 1K2HA 3LS3A 3SG7A 3OB1B 2JC2A 1J7RA 2OS8C 5I2LA 5DQBA 2LP2A 2A46A 1CMGA 1YUUA 3LK1A 4NDBA 2HFCA 1PALA 2K7CA 2PALA 3ST4A 5DKRA 3BUOB 1BFPA 4MSPA 4RTCA 3VICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTR A;  1YTZ C;  1PUL A;  1KK7 Y;  1M46 A;  2BTJ A;  3DVM A;  1EMK A;  1DJI A;  4N3D A;  1K90 D;  1YUS A;  2M97 A;  1JWD A;  2KGR A;  3GOF A;  1Y1A A;  4Q7R A;  1A2X A;  5G08 A;  4MZJ A;  3KHE A;  4W6K A;  1QTX A;  4KEX A;  2K8M B;  1XMZ A;  2KDH A;  2PVB A;  1NCY A;  3U8P A;  1G33 A;  5HZU A;  1YHG A;  3PN7 B;  2HQ8 A;  2A4J A;  4YBH B;  2DUH A;  3BX9 A;  2NLN A;  4L9M A;  2M29 A;  1FPW A;  1OMV A;  1NX2 A;  5AEQ A;  1U5I A;  4W6B A;  3OHM B;  2GX2 A;  4LQT A;  2G6X A;  1MXE A;  1JSA A;  4PHK A;  1J1E A;  1YVL A;  2ICR A;  3CFF A;  4W74 A;  1IQ5 A;  1LKJ A;  1XFU O;  4E68 A;  4H3M A;  5H88 A;  1KSO A;  3K1K A;  5DPI A;  4NQG A;  3M0W A;  1K9K A;  1EXR A;  2NCP A;  2AWK A;  5CPV A;  4MN0 A;  5DKN A;  2OTG B;  5BT0 A;  1OZO A;  2ISD A;  1R2U A;  1HUY A;  3PJ7 A;  5K89 A;  3JVT C;  3TS5 B;  3SG5 A;  1A4P A;  1DTL A;  4JQ0 D;  4W6S A;  1QX7 A;  1UP5 A;  4JC2 A;  2KOT A;  5LTP A;  3MSE B;  2WOR A;  1MR8 A;  2M1K B;  1F8H A;  1YHI A;  1DGU A;  3CFA A;  1MHO A;  2ZN9 A;  1EMG A;  1ZGQ A;  1W7S A;  2H5O A;  2IE2 A;  1M45 A;  4H47 A;  4ORC B;  1SL7 A;  1ZUX A;  2KI6 D;  2EMN A;  4Z4M A;  1NX3 A;  2HPS A;  3DQF A;  3LL8 B;  2LVK A;  3C1V A;  1EML A;  4OCI A;  1JUO A;  5B8I B;  3IR8 A;  1DVI A;  3AKA A;  2KI6 C;  3W1C A;  5HBD A;  4GUK A;  5DU0 A;  5DY6 A;  3SS0 A;  4W7A A;  3P8U A;  5EXU A;  3WNX B;  2LMT A;  2Y1N A;  3EKJ A;  1WDC C;  3BUM B;  5F9G A;  1DJY A;  4AR7 A;  3AI4 A;  4W6D A;  2JOJ A;  3O6B A;  1FI5 A;  2PXW A;  2KGB C;  4B30 B;  5CSI A;  3CD1 A;  3OSQ A;  3BXA A;  5BPJ A;  2KQ6 A;  4I5N B;  2CNP A;  1Y1U A;  3SIB A;  4LJB A;  1UUR A;  5EXB A;  3SIA A;  1GL4 A;  3P28 A;  4IK3 A;  3E5V A;  2JT8 A;  1GGZ A;  1REC A;  1MOV A;  2HQZ A;  1AUI B;  1WLZ A;  5DTL A;  5HZT A;  2LLT A;  4NWS A;  4CPV A;  1WLM A;  3TDZ A;  1SCM B;  1Y1X A;  3NT9 A;  3I5I C;  1W7I B;  3U0M A;  3PM8 A;  1J1D A;  2B3P A;  2YDZ A;  1N2D A;  3NF0 A;  1ODB A;  3OB2 B;  3DQ4 A;  3VGO A;  1B8C A;  4J89 A;  3I5H C;  1XK4 A;  4KPI A;  4AQI A;  2WHS A;  2AMI A;  3W1D A;  2ZRS A;  2WHT A;  2BKH B;  1YX7 A;  3IQQ A;  1UHK A;  4J88 A;  4HQ8 A;  2K2F A;  2MLF C;  3AKO A;  3CB9 A;  1SRA A;  5AQB B;  3O2P A;  1QX2 A;  3GK1 A;  4W69 A;  4HVF A;  2AAO A;  1A29 A;  4D1E A;  1BR1 B;  2JAD A;  4DXO A;  1SK6 D;  1MOU A;  2H8Q A;  1SKT A;  1VRK A;  5KTG A;  1F4Q A;  1QV1 A;  3CLN A;  3VRR A;  2K7D A;  2AWJ A;  1B8R A;  5HKW A;  5FYX A;  4W7F A;  1S1E A;  1BOD A;  3DQA A;  2K7O A;  5DKQ A;  3ZUF A;  2Z6Z A;  3NEZ A;  5AAN A;  2LLS A;  1SY9 A;  4Q9W A;  1K95 A;  4DXI A;  1XFZ O;  1YHH A;  2PRU A;  3WLD A;  2A54 B;  2SCP A;  3BQ3 A;  2Q4U A;  3ST2 A;  3HX4 A;  3NSL A;  4ORA B;  4HQ9 A;  4QJ5 B;  1SPY A;  3DQD A;  1Q80 A;  5T3I A;  1RTP 1;  4FTG A;  1AHR A;  4I5L B;  4B30 A;  2QLI A;  3DF0 B;  4CFQ A;  3U0N A;  1M63 B;  1XA5 A;  3VRP A;  2OGR A;  1B1G A;  1AJ5 A;  4OY4 A;  3SSL A;  1DF0 A;  5HLO A;  2VVH A;  3ZUL A;  4RYW A;  3SVO A;  2JU0 A;  2LUX A;  3I5G B;  1BF5 A;  2ZN8 A;  1NCX A;  5JOL A;  2MBX A;  2JT3 A;  3DPX A;  1QAT A;  2ZO6 A;  5DRG A;  3CD9 A;  5HZO A;  5LTR A;  3BYA A;  4W6I A;  1CMF A;  4GGF A;  1LIN A;  1WRZ A;  4A4B A;  1OSA A;  2G2B A;  1OMD A;  2DUI A;  1KP5 A;  4YGC B;  1JF2 A;  3AKB A;  1R6P A;  3WLC A;  1XFV O;  3SVR A;  2DUF A;  5BQL A;  2P4M A;  4AQJ A;  4M2Q A;  3ZWH A;  2WCE A;  1NP8 A;  2M7L A;  4W6M A;  3DQ1 A;  2QRF A;  1K94 A;  1QVI Z;  4IK9 A;  5EHU A;  4GES B;  4W6R A;  4YI9 A;  3NED A;  2KBM A;  3PLF B;  2YE1 A;  3CBE A;  4DXQ A;  2WND A;  1K93 D;  2M49 B;  4XGY A;  4PE7 A;  3OGO A;  2M1U A;  4PPK A;  2H5Q A;  4PPL A;  1L7Z A;  1GGX A;  1KCY A;  1QXP A;  1BOC A;  1CKK A;  5EB7 A;  3BUX B;  1Q4E A;  1CFD A;  3KO0 A;  3M22 A;  4PAL A;  1QYF A;  4IK1 A;  4CID A;  2IS9 A;  1EH2 A;  1CNP A;  4ZF5 A;  1N0Y A;  1MQ1 A;  2V4E A;  4DIR A;  2M7N A;  2QT2 A;  4W6N A;  4OR9 B;  2F3Y A;  3D0Y B;  4DCK A;  1S6J A;  2OTB A;  2JRF A;  4PHN A;  2LHL A;  2NZ0 A;  4PE0 A;  4AS8 A;  1XYD A;  1NCZ A;  3MGF A;  3D10 A;  1DJH A;  2PAS A;  2BCX A;  4HQC A;  3BXB A;  1L2O B;  3DF0 A;  2ZND A;  1KFX L;  4PHM A;  3GEX A;  1MYW A;  3U0L A;  1EL4 A;  4HE4 A;  3I5F B;  4XVP A;  4EDO A;  1AK8 A;  2IOV A;  1V1F A;  2YE0 A;  3LVA A;  2CCM A;  3PN7 C;  2B3Q A;  1JC1 A;  2POX A;  2JUL A;  3OSR A;  2LVI A;  2JTT A;  2I2R E;  2TN4 A;  4HSZ A;  2WIQ A;  1JFJ A;  4MEW A;  4C0L A;  1MXL C;  1KQM B;  4YRU A;  2H5P A;  2JXC A;  4GAO A;  4R6D A;  4ZCV A;  2JT0 A;  2DOQ A;  3SSV A;  5ER4 X;  1DJZ A;  4Q04 A;  3NXA A;  3DQ8 A;  5EB6 A;  1JC0 A;  2E6W A;  1S36 A;  1ZAC A;  2HET A;  3DPZ A;  4RYS A;  4W75 A;  1XK4 C;  2OTG C;  1QLS A;  4N5X A;  5J3X A;  4NDD A;  4KF5 A;  3TS5 C;  1PK0 D;  1BU3 A;  4XYN A;  3EKH A;  2OKY A;  1M31 A;  3OX6 A;  4M2P A;  4LW5 A;  1FBV A;  1F4O A;  5FHV A;  3DQL A;  1FF1 A;  1G7K A;  2KAV A;  1FI6 A;  1CV7 A;  3OP0 A;  1BG1 A;  2HPW A;  1K9P A;  3BOW B;  3VRO A;  1KFU S;  4TNC A;  4PE1 A;  3A4U B;  2MLE C;  3LF4 B;  5HGE A;  3DQO A;  1UHN A;  2G6E A;  3ADF A;  2AWL A;  2CXJ A;  2KYF A;  1YJ2 A;  2DUG A;  1WRL A;  3D0Y A;  4EDS A;  1S5G Z;  1IJ6 A;  1BJF A;  1UUS A;  1CDN A;  2F33 A;  1DJG A;  2GGM A;  3DQH A;  1SL8 A;  1RRO A;  1DJX A;  2L4H A;  1TNX A;  1K8U A;  1J7Q A;  4JPZ B;  3RWA A;  1RMP A;  4ZBL A;  4DUQ A;  4W7C A;  2Q57 A;  2NXQ A;  4A4C A;  3AAJ A;  2H6V A;  2R2I A;  1KWO B;  2P6B B;  1PSR A;  1CDL A;  1OQP A;  3TZ1 A;  2FCE A;  1KFX S;  1RWY A;  1SBJ A;  3SSH A;  1QX5 B;  3SVD A;  3VK1 A;  2WHU A;  2I18 A;  3GJ1 A;  4XL5 A;  5J2O A;  2O29 A;  2LV7 A;  3GK2 A;  2MAZ A;  2GV5 A;  1NPQ A;  1Q4D A;  4GGF C;  4C0J A;  1SCM C;  2CTN A;  2SAS A;  1S6I A;  2O60 A;  2KBI A;  1BT6 A;  1YUT A;  3H1R A;  4YGA A;  4MRX A;  3JTD B;  4W6F A;  2LMV A;  4U2V A;  5DTZ A;  1BR4 B;  2BE4 A;  4KAG A;  4KA9 A;  4LJC A;  3SG3 A;  5DRF A;  3LF3 A;  2VVI A;  1NYA A;  2AH8 A;  3IQO A;  3DQ5 A;  2EHB A;  3ST3 A;  1IGV A;  4GOB A;  1FW4 A;  3VRN A;  3DD4 A;  1EMA A;  2QLG B;  1C7V A;  1Y0V H;  1RJV A;  2M9G A;  3KF9 A;  2LVV A;  5HKZ A;  5CSJ A;  1DF0 B;  3BOW A;  2H2K A;  2ZRT A;  3SSK A;  2G16 B;  2F2P A;  1NX0 A;  1YX8 A;  4ZIO A;  2Z1O A;  3AAK A;  1A75 B;  4W7X A;  2OPO A;  3SG4 A;  3ST0 A;  1B9A A;  1XO5 A;  3HCM A;  3GJ2 A;  4TZG A;  1TN4 A;  2NCO A;  1TCF A;  1IH0 A;  4W6P A;  1J7P A;  2VAD A;  4ANJ A;  3SG6 A;  5HLV A;  4P1Q A;  2MRD A;  2H5R A;  1KYS A;  4Q7T A;  2G2S B;  5DPH A;  5H89 A;  2HQW A;  3EVU A;  4H48 A;  2V4E C;  3TMR A;  1DGV A;  3CS1 A;  1ALW A;  5EJU A;  2ZFD A;  1MF8 B;  2FZU A;  1TRF A;  4FQO A;  1B7T Z;  1RFJ A;  2EMD A;  2ZNE A;  4XJK B;  4I2Y A;  5D69 A;  1DT7 B;  2G6Y A;  1ZMZ A;  3O78 A;  4I5J A;  2L4I A;  4H3N A;  3KEV A;  3VHT B;  3BUW B;  2AWM A;  4W6U A;  1DMO A;  3I5G C;  2KFF A;  4L1I A;  3DPW A;  4W6O A;  2KFH A;  2LUC A;  1ZOT B;  1TCO B;  2LAP A;  2VVJ A;  1SR6 B;  2FJU B;  1TNW A;  3CTN A;  5I2O A;  3GK4 X;  2QU1 A;  4BY5 A;  3LSA A;  2PMY A;  1Z1P A;  1CB1 A;  2V4E B;  3E5T A;  1RMM A;  2HF5 A;  2GW4 B;  2LMU A;  2IB5 A;  3SVS A;  2GGZ A;  3PJ5 A;  2G9B A;  4KGE A;  4P2Y B;  1LVC D;  1W7U A;  2G3O A;  1S6Z A;  4PHJ A;  3ED8 A;  2JWW A;  1S26 D;  4YI8 A;  2QLG A;  3DQ3 A;  3SSY A;  2BL0 B;  4KF5 C;  1HCJ A;  4IL1 A;  2YFP A;  1OMR A;  3LA1 A;  3DQU A;  5BTT B;  3NSK A;  1NX1 A;  1Q73 A;  1AJ4 A;  1RK9 A;  1EMB A;  1A75 A;  3H4S E;  3G9A A;  3CGL A;  2F2O A;  4W76 A;  3PAT A;  3SVB A;  1SW8 A;  1XVJ A;  3LLE A;  4HRG A;  2WSN A;  1OE9 B;  2JNX A;  4OVN F;  3WXA A;  2JZI A;  2KQY A;  4IZN A;  1B47 A;  2QLE A;  1LA3 A;  3EVP A;  4GF6 B;  4ZIN A;  4XOV A;  2D8N A;  1YRU B;  2VRG A;  1XQM A;  1RMO A;  3SVU A;  4PCW A;  1XA9 A;  2JPT A;  4L12 A;  4KW8 A;  1DJW A;  1S3P A;  4UPG A;  3RLZ A;  4BDU A;  5CSF A;  1CLB A;  1CLL A;  1A03 A;  2A47 A;  1UIS A;  1HT9 A;  4XJK A;  2QAC A;  1RRX A;  1QLK A;  2EC6 B;  1L2O C;  5HKY A;  1C7W A;  2HJO A;  3VHT A;  3TUY B;  2F3Z A;  1KK7 Z;  2A48 A;  2FWQ A;  4JWQ A;  2DDD A;  2O24 A;  3E3R A;  3RM1 A;  3I5F C;  1TTX A;  3CGA A;  5LTQ A;  3DQI A;  4ZF3 A;  2BEC A;  4DKM A;  3EK4 A;  1KQM C;  4DKN A;  2DUE A;  5AXI A;  3DQ2 A;  4EMQ A;  3KPX A;  1YVH A;  2LAN A;  4OV2 A;  1TIZ A;  5KU1 A;  4DS7 A;  1YR5 A;  3CFH A;  5ER5 A;  1XFX O;  4OKH A;  2MJW B;  2ZKM X;  2KAX A;  1GQM A;  1SMG A;  3H1O A;  3LVD A;  1G8I A;  4ORB B;  1J55 A;  3ZNI A;  1ALV A;  1WRK A;  1H6R A;  5BTT A;  2BKI B;  2C9I A;  2LVJ A;  3BUN B;  4C0K A;  1IKU A;  1NSH A;  1ZUZ A;  3PJB A;  1OOJ A;  2LE9 B;  3TDI A;  5IBW A;  4ZCU A;  4U8D A;  1NWD A;  1PSB A;  2F8P A;  4NDC A;  1UHJ A;  2L0P A;  3BXC A;  2Y1M A;  4W7R A;  5DPG A;  1QY3 A;  1N65 A;  4LJD A;  2LHI A;  3PFV A;  5FVF A;  1AVS A;  4MBE A;  1BLQ A;  4W77 A;  3PAL A;  2ZMW A;  1QVI Y;  3VRQ A;  1E8A A;  4EUL A;  4USL A;  2A56 B;  4WRI A;  1S6C A;  2KI4 C;  1YUR A;  1C4F A;  5DPJ A;  1EMM A;  1YJF A;  5AFP A;  1QAS A;  1YRT B;  2C9J A;  1XFW O;  3AI5 A;  3DVJ A;  1ZGO A;  5D7F A;  2Q91 A;  1KWO C;  4MRY A;  4WQ3 A;  1OXF A;  3KCS A;  2ZO7 A;  1QYO A;  4W6C A;  4KF4 A;  2EGD A;  1GJY A;  4KW9 A;  3U8A A;  2WIS A;  1GFL A;  1CDP A;  4OQW A;  1KK8 B;  2L50 A;  2QLH A;  3NSO A;  1PVB A;  1GGW A;  1JF0 A;  3OX5 A;  2WCF A;  1J7O A;  2Z6Y A;  2HRS A;  4KW4 A;  3CR5 X;  2QPT A;  1WY9 A;  2K0J A;  2OS8 B;  1KYP A;  2VZX A;  1V1G A;  2L2E A;  4MLW A;  4W72 A;  4F0Z B;  3RWT A;  2E30 A;  4P5O E;  1YZW A;  3U0K A;  1G4Y R;  1RM9 A;  3JTD C;  4W6L A;  4CLN A;  2KI4 B;  5HZS A;  4R1E A;  3SJS A;  3NT3 A;  4PE4 A;  2BBM A;  2KAY A;  2A52 B;  3O4Y A;  2RGI A;  1EJ3 A;  1EG3 A;  1IQ3 A;  4GNK B;  4J8A A;  2Z6X A;  1IG5 A;  3DQ9 A;  4W6G A;  3FIA A;  3DQ6 A;  5HYD A;  5AER A;  4I5K A;  2ZMU A;  2M0R A;  2H61 A;  4MZK A;  4GFT A;  2EMO A;  3DQC A;  3E5W A;  4B5Y A;  2Y5I A;  3A8S A;  1CDM A;  4N1G A;  2COL B;  1F55 A;  2MHH A;  3SVE A;  4ORN A;  2QZ0 A;  3EK8 A;  2K61 A;  2B1U A;  4MZL A;  4W73 A;  1OXE A;  5FVI A;  4AOM A;  1EMF A;  2FL1 A;  4W7D A;  1F54 A;  1IRJ A;  1EG4 A;  3V3D A;  4LQU A;  4W6H A;  4Q9X A;  1YFP A;  1AP4 A;  2I7A A;  3CWG A;  1SL9 A;  4GGN A;  1QXT A;  1KYR A;  2JQ6 A;  4YGE B;  2KFG A;  1CFC A;  4ZFS A;  4W6A A;  2DDC A;  3GL4 A;  1CM4 A;  3CR4 X;  3JVT B;  1Q4C A;  3K21 A;  4PPJ A;  3ZUJ A;  4W6J A;  3TMT A;  1H4B A;  4PDZ A;  2DD7 A;  2WC8 A;  1TOP A;  1KQV A;  3S05 A;  1QIW A;  1W7T A;  2WCB A;  3FS7 A;  5TNC A;  3DQJ A;  2IB6 A;  3LCP C;  2HCG A;  3PSR A;  3DQ7 A;  4KGF A;  4Z4K A;  1SNL A;  3CZT X;  2HGD A;  1SR6 C;  1S5G Y;  2A50 B;  1LA0 A;  1UHH A;  1JBZ A;  2CT9 A;  2KHN A;  4IK8 A;  4DXP A;  2L5X B;  4GPL B;  1XSS A;  2DD9 A;  2M3W A;  4TZA A;  5DQM A;  1CFF A;  2Y0G A;  1XAE A;  4N1F A;  1QIV A;  3UG0 A;  3DQN A;  2CBL A;  1H8B A;  5LK4 A;  5PAL A;  1CM1 A;  3SVC A;  1OXD A;  1HQV A;  2LC5 A;  1LXF C;  2JTZ A;  2O5G A;  4EN1 A;  2BL0 C;  1WDC B;  3I19 A;  1K9U A;  2MA2 A;  2LCP A;  2O2B A;  1IJ5 A;  2LP3 A;  4IK4 A;  3GB3 A;  4CFR A;  1NIW A;  2BCA A;  5HW9 A;  2Y4Q A;  1CFP A;  1UWO A;  4IK5 A;  3BXK A;  1QS7 A;  4JRB A;  2BE6 A;  3A8R A;  3FWB A;  4QJ4 B;  1QV0 A;  3IF7 A;  5GQQ C;  1H4U A;  4LJD C;  1PRW A;  2OKW A;  3I5I B;  3FWC A;  1TNP A;  3I5H B;  1EME A;  2OTE A;  4W6T A;  2LNK A;  3WHU B;  3SV5 A;  2PXS A;  4ETO A;  4OHS A;  4JGE A;  3EVR A;  2EC6 C;  4YGD B;  4HRE E;  2L51 A;  3KCT A;  2KSP A;  3TUY C;  4JF9 A;  4ZF4 A;  2V53 A;  1OZS A;  4WQ2 A;  1JBA A;  5F6T A;  1UHI A;  3DQM A;  3TDU A;  2G3D B;  1K96 A;  5JJG A;  4HRH A;  4DRW A;  2RH7 A;  4XOW A;  2LM5 A;  3NSI A;  1ZGP A;  4R6B A;  2JNF A;  1Q4A A;  4BY4 A;  1F70 A;  2AUC A;  2WUR A;  1BMO A;  1M39 A;  2OJK A;  3U8C A;  3SVN A;  1D1O A;  2K7B A;  2GX0 A;  4OJ0 A;  3LK0 A;  3UFZ A;  1JFK A;  1MUX A;  1B7T Y;  2K2A A;  2GW3 A;  3WCK A;  2KYC A;  4DXN A;  1W7J B;  3ICB A;  4MVF A;  5EBJ A;  3EVV A;  1F71 A;  4ZB1 A;  4DXM A;  1Z1Q A;  2Q6P A;  4OGS A;  4UTS A;  3SG2 A;  2AHA A;  2LLU A;  1EMC A;  5KSZ A;  3DQE A;  2HGY A;  3SRY A;  2I94 A;  1X02 A;  2L98 A;  1KSM A;  1ZFS A;  3DQK A;  4GBA A;  1TNQ A;  1JC2 A;  3WHT B;  3EK7 A;  2HQK A;  4L13 A;  1JBY A;  3F45 A;  3QRX A;  4H3L A;  5DTY A;  2H9W A;  2H61 C;  2FCD A;  3DVE A;  3IP2 A;  1KFU L;  1Q4B A;  5CSN A;  2BCB A;  2KNE A;  3SST A;  1NUB A;  4JEO A;  1C07 A;  1MWN A;  4PFE A;  1SCV A;  5H87 A;  4JFG A;  4P76 A;  3SSP A;  4ICB A;  1F09 A;  2JXL A;  1CLM A;  5FVG A;  1XFY O;  2ARL A;  1U5I B;  4W7E A;  1B4C A;  2WOS A;  3CR2 A;  3LVC A;  1SYM A;  1PVA A;  5KTY A;  1B8L A;  5I2Q A;  1Y6W A;  2FOT A;  3ZTF A;  4YGB B;  5EXC I;  4QJ3 B;  2WSO A;  3PIB A;  3DVK A;  4Q7U A;  1QYQ A;  2BBN A;  4M2O A;  3O77 A;  1B9C A;  2G5Z B;  5DTX A;  2PSR A;  2A53 B;  3M24 A;  2M8U A;  2VAE A;  1KK8 C;  5I8N A;  1F0B A;  1IWQ A;  1QJT A;  1K2H A;  3LS3 A;  3SG7 A;  3OB1 B;  2JC2 A;  1J7R A;  2OS8 C;  5I2L A;  5DQB A;  2LP2 A;  2A46 A;  1CMG A;  1YUU A;  3LK1 A;  4NDB A;  2HFC A;  1PAL A;  2K7C A;  2PAL A;  3ST4 A;  5DKR A;  3BUO B;  1BFP A;  4MSP A;  4RTC A;  3VIC A; 
#chains in the Genus database with same CATH topology
 1CTR A;  1YTZ C;  1PUL A;  1KK7 Y;  1M46 A;  2BTJ A;  3DVM A;  1EMK A;  1DJI A;  4N3D A;  1K90 D;  1YUS A;  2M97 A;  1JWD A;  2KGR A;  3GOF A;  1Y1A A;  2WCL A;  3NHI A;  4Q7R A;  1A2X A;  5G08 A;  4MZJ A;  3KHE A;  4W6K A;  1QTX A;  4KEX A;  2K8M B;  1XMZ A;  2KDH A;  2PVB A;  3S0D A;  1NCY A;  3U8P A;  1G33 A;  5HZU A;  1YHG A;  3PN7 B;  2HQ8 A;  2A4J A;  4YBH B;  3D73 A;  2DUH A;  3BX9 A;  1T14 A;  2NLN A;  4L9M A;  2M29 A;  1FPW A;  1OMV A;  1NX2 A;  5AEQ A;  1U5I A;  4W6B A;  3OHM B;  2GX2 A;  4LQT A;  2G6X A;  1MXE A;  1JSA A;  4PHK A;  3S0G A;  1J1E A;  5I94 A;  1YVL A;  2ICR A;  3CFF A;  4W74 A;  1IQ5 A;  1LKJ A;  1XFU O;  4E68 A;  4H3M A;  5H88 A;  1KSO A;  3K1K A;  5DPI A;  4NQG A;  3M0W A;  1K9K A;  1EXR A;  2NCP A;  2AWK A;  5CPV A;  4MN0 A;  5DKN A;  1DEK A;  2OTG B;  5BT0 A;  1OZO A;  2ISD A;  1R2U A;  1HUY A;  3PJ7 A;  5K89 A;  3JVT C;  3TS5 B;  3SG5 A;  1A4P A;  1DTL A;  4JQ0 D;  1Z2C B;  4W6S A;  1QX7 A;  1UP5 A;  4JC2 A;  2KOT A;  5LTP A;  3MSE B;  2WOR A;  1MR8 A;  2M1K B;  1F8H A;  1YHI A;  1DGU A;  3CFA A;  1MHO A;  1GM0 A;  2ZN9 A;  3UO9 A;  1EMG A;  1ZGQ A;  1W7S A;  2H5O A;  2IE2 A;  1M45 A;  4H47 A;  4ORC B;  1SL7 A;  1ZUX A;  2KI6 D;  4JKT A;  2EMN A;  4Z4M A;  1NX3 A;  2HPS A;  3DQF A;  3LL8 B;  2LVK A;  3C1V A;  1EML A;  4OCI A;  1JUO A;  5B8I B;  3IR8 A;  1DVI A;  3AKA A;  2KI6 C;  3W1C A;  5HBD A;  4GUK A;  5DU0 A;  5DY6 A;  3SS0 A;  4W7A A;  3P8U A;  2KLD A;  5EXU A;  3WNX B;  2LMT A;  2Y1N A;  3O4X A;  2QEO A;  3EKJ A;  1WDC C;  3BUM B;  5F9G A;  1DJY A;  4AR7 A;  3B88 A;  5FI2 A;  3AI4 A;  4W6D A;  2JOJ A;  3O6B A;  1FI5 A;  2PXW A;  2KGB C;  4B30 B;  5CSI A;  3CD1 A;  3OSQ A;  3BXA A;  1OOI X;  5BPJ A;  2BNX A;  2KQ6 A;  4I5N B;  2CNP A;  1Y1U A;  3SIB A;  4LJB A;  1UUR A;  2WCM A;  5EXB A;  3SIA A;  1GL4 A;  3P28 A;  4IK3 A;  3E5V A;  2JT8 A;  1GGZ A;  1REC A;  1MOV A;  2HQZ A;  1AUI B;  1WLZ A;  5DTL A;  5HZT A;  2LLT A;  4NWS A;  4CPV A;  1WLM A;  3TDZ A;  1SCM B;  3NHT A;  1Y1X A;  3NT9 A;  3I5I C;  1W7I B;  3U0M A;  3PM8 A;  1J1D A;  2B3P A;  2YDZ A;  1N2D A;  3NF0 A;  1ODB A;  3OB2 B;  3DQ4 A;  3VGO A;  1B8C A;  3I5H C;  4J89 A;  1XK4 A;  4KPI A;  3BFH A;  4AQI A;  5FI7 A;  2WHS A;  2AMI A;  3W1D A;  2ZRS A;  2WHT A;  2BKH B;  1YX7 A;  3IQQ A;  1UHK A;  3NGV A;  4J88 A;  4HQ8 A;  2K2F A;  2MLF C;  3AKO A;  3CB9 A;  1SRA A;  5AQB B;  3BFB A;  3O2P A;  1QX2 A;  2WC5 A;  3GK1 A;  4W69 A;  3CAB A;  4HVF A;  2AAO A;  1A29 A;  4D1E A;  1BR1 B;  2JAD A;  5D3O A;  4DXO A;  1SK6 D;  1MOU A;  2H8Q A;  1SKT A;  1VRK A;  5KTG A;  1F4Q A;  1QV1 A;  3CLN A;  3DZT A;  3VRR A;  2K7D A;  4INW A;  2AWJ A;  1B8R A;  5HKW A;  5FYX A;  4W7F A;  1S1E A;  3D75 A;  1BOD A;  3DQA A;  2K7O A;  5DKQ A;  3ZUF A;  3SS4 A;  2Z6Z A;  3NEZ A;  5AAN A;  2LLS A;  1SY9 A;  4Q9W A;  1K95 A;  4DXI A;  1XFZ O;  1YHH A;  2PRU A;  3WLD A;  2A54 B;  2SCP A;  3BQ3 A;  3PJI A;  2Q4U A;  3ST2 A;  3HX4 A;  3NSL A;  4ORA B;  4HQ9 A;  4QJ5 B;  1SPY A;  3DQD A;  1Q80 A;  3DY9 A;  5T3I A;  3R1P A;  1RTP 1;  4FTG A;  1W9Z A;  1AHR A;  4I5L B;  4B30 A;  2QLI A;  3DF0 B;  4CFQ A;  3U0N A;  1M63 B;  1XA5 A;  3VRP A;  2OGR A;  1B1G A;  1AJ5 A;  4OY4 A;  3SSL A;  1DF0 A;  2WC6 A;  5HLO A;  2VVH A;  3ZUL A;  4RYW A;  3SVO A;  3S0A A;  2JU0 A;  2LUX A;  3I5G B;  1BF5 A;  2ZN8 A;  1NCX A;  5JOL A;  2MBX A;  2JT3 A;  3DPX A;  1QAT A;  2ZO6 A;  5DRG A;  3CD9 A;  5HZO A;  5LTR A;  3BYA A;  1CMF A;  4W6I A;  4GGF A;  1LIN A;  1WRZ A;  2QDI A;  4A4B A;  1OSA A;  2G2B A;  1OMD A;  2DUI A;  1KP5 A;  4YGC B;  1JF2 A;  3AKB A;  1R6P A;  3WLC A;  1XFV O;  3SVR A;  2DUF A;  5BQL A;  2P4M A;  4AQJ A;  4M2Q A;  3ZWH A;  1P28 A;  2WCE A;  1NP8 A;  2M7L A;  4W6M A;  3DQ1 A;  2QRF A;  1K94 A;  1QVI Z;  4IK9 A;  5EHU A;  4GES B;  4W6R A;  4YI9 A;  1TUJ A;  3NED A;  2KBM A;  2P71 A;  3PLF B;  2YE1 A;  3CBE A;  4DXQ A;  2WND A;  1K93 D;  2M49 B;  4XGY A;  4PE7 A;  3OGO A;  2M1U A;  4PPK A;  3CZ1 A;  2WCK A;  2H5Q A;  4PPL A;  1L7Z A;  1GGX A;  1KCY A;  3D77 A;  1QXP A;  1BOC A;  1CKK A;  5EB7 A;  3BUX B;  1Q4E A;  1CFD A;  3KO0 A;  3DYE A;  3M22 A;  4PAL A;  1QYF A;  1QWV A;  4IK1 A;  4CID A;  3B7A A;  2IS9 A;  1EH2 A;  3S0F A;  1CNP A;  4ZF5 A;  1N0Y A;  1MQ1 A;  2V4E A;  4DIR A;  2M7N A;  2QT2 A;  4W6N A;  4OR9 B;  2F3Y A;  3D0Y B;  4DCK A;  1S6J A;  2OTB A;  2JRF A;  4PHN A;  3CZ2 A;  2LHL A;  2NZ0 A;  4PE0 A;  4AS8 A;  1XYD A;  1NCZ A;  3MGF A;  3D10 A;  1DJH A;  2PAS A;  2BCX A;  4HQC A;  3BXB A;  1L2O B;  3DF0 A;  2ZND A;  1KFX L;  4PHM A;  3GEX A;  3OBV A;  1MYW A;  3U0L A;  1EL4 A;  4HE4 A;  3I5F B;  4XVP A;  4EDO A;  1AK8 A;  2IOV A;  1V1F A;  2YE0 A;  3LVA A;  2CCM A;  3PN7 C;  2B3Q A;  1JC1 A;  2POX A;  2JUL A;  3OSR A;  2LVI A;  2JTT A;  2I2R E;  2TN4 A;  4HSZ A;  2WIQ A;  1JFJ A;  4MEW A;  4C0L A;  1MXL C;  1KQM B;  4YRU A;  2H5P A;  2JXC A;  4GAO A;  4R6D A;  4ZCV A;  2JT0 A;  2DOQ A;  3SSV A;  5ER4 X;  1DJZ A;  4Q04 A;  2K60 A;  3NXA A;  3DQ8 A;  5EB6 A;  1JC0 A;  2E6W A;  1XFR A;  1S36 A;  1ZAC A;  2HET A;  3DPZ A;  4RYS A;  4W75 A;  1XK4 C;  2OTG C;  1QLS A;  4N5X A;  5J3X A;  4NDD A;  4KF5 A;  3TS5 C;  1PK0 D;  1BU3 A;  4XYN A;  2QEB A;  3EKH A;  2OKY A;  1M31 A;  3OX6 A;  4M2P A;  4LW5 A;  1FBV A;  2WCH A;  1F4O A;  5FI6 A;  5FHV A;  3DQL A;  1FF1 A;  1G7K A;  2KAV A;  1FI6 A;  1CV7 A;  3OP0 A;  1BG1 A;  2HPW A;  1K9P A;  3BOW B;  3VRO A;  1KFU S;  4TNC A;  4PE1 A;  3A4U B;  2MLE C;  3LF4 B;  5HGE A;  3DQO A;  3S0E A;  1UHN A;  4PT1 A;  2G6E A;  3ADF A;  2AWL A;  2CXJ A;  2KYF A;  1YJ2 A;  2DUG A;  1OW4 A;  1WRL A;  3BJH A;  3S0B A;  3D0Y A;  4EDS A;  1S5G Z;  1IJ6 A;  1BJF A;  1UUS A;  1CDN A;  2F33 A;  1DJG A;  2GGM A;  3CDN A;  3DQH A;  1SL8 A;  1RRO A;  1DJX A;  2L4H A;  1TNX A;  1K8U A;  1J7Q A;  4JPZ B;  3RWA A;  1RMP A;  4ZBL A;  4DUQ A;  4W7C A;  2Q57 A;  2NXQ A;  3RZS A;  2L5Y A;  3AAJ A;  4A4C A;  2H6V A;  2R2I A;  1KWO B;  2P6B B;  1PSR A;  1CDL A;  1OOF A;  1OQP A;  3TZ1 A;  2FCE A;  1KFX S;  1RWY A;  1C3Z A;  1SBJ A;  3SSH A;  1QX5 B;  3SVD A;  3VK1 A;  2WHU A;  2I18 A;  3GJ1 A;  4XL5 A;  5J2O A;  2O29 A;  1OOG A;  3R72 A;  2LV7 A;  3GK2 A;  2MAZ A;  2GV5 A;  1NPQ A;  1Q4D A;  4GGF C;  4C0J A;  1SCM C;  2CTN A;  2SAS A;  3OGN A;  1S6I A;  2O60 A;  2KBI A;  1BT6 A;  1YUT A;  3H1R A;  4YGA A;  4MRX A;  3JTD B;  3BFA A;  2LMV A;  4U2V A;  4W6F A;  5DTZ A;  1BR4 B;  2BE4 A;  4KAG A;  4KA9 A;  4LJC A;  3SG3 A;  5DRF A;  3LF3 A;  2VVI A;  1NYA A;  2AH8 A;  3IQO A;  3DQ5 A;  3R1O A;  2EHB A;  3ST3 A;  1IGV A;  4GOB A;  2KPH A;  1FW4 A;  3VRN A;  3DD4 A;  1EMA A;  2QLG B;  1C7V A;  1Y0V H;  1RJV A;  2M9G A;  3KF9 A;  2LVV A;  5HKZ A;  5CSJ A;  1DF0 B;  3BOW A;  2H2K A;  2ZRT A;  3SSK A;  2G16 B;  2F2P A;  1NX0 A;  1YX8 A;  4ZIO A;  2Z1O A;  3AAK A;  1A75 B;  4W7X A;  2OPO A;  3SG4 A;  3ST0 A;  1B9A A;  1XO5 A;  3HCM A;  3GJ2 A;  4TZG A;  1TN4 A;  2NCO A;  1TCF A;  1IH0 A;  4W6P A;  1J7P A;  2VAD A;  4ANJ A;  3SG6 A;  5HLV A;  4P1Q A;  2MRD A;  2H5R A;  1KYS A;  4Q7T A;  2G2S B;  5DPH A;  3K1E A;  5H89 A;  2HQW A;  3EVU A;  4H48 A;  2V4E C;  4IJ7 A;  3TMR A;  1DGV A;  3CS1 A;  1ALW A;  5EJU A;  2ZFD A;  1MF8 B;  2FZU A;  1TRF A;  4FQO A;  1B7T Z;  1RFJ A;  2EMD A;  2ZNE A;  4XJK B;  4I2Y A;  5D69 A;  1DT7 B;  2G6Y A;  1ZMZ A;  3O78 A;  4I5J A;  2L4I A;  4H3N A;  3KEV A;  3VHT B;  3BUW B;  2AWM A;  4W6U A;  1DMO A;  3I5G C;  2KFF A;  4L1I A;  3DPW A;  4W6O A;  2KFH A;  2LUC A;  1ZOT B;  1TCO B;  2LAP A;  2VVJ A;  1SR6 B;  2FJU B;  1TNW A;  3CTN A;  5I2O A;  3GK4 X;  2QU1 A;  4BY5 A;  3LSA A;  2PMY A;  1Z1P A;  1CB1 A;  2V4E B;  3E5T A;  1RMM A;  2HF5 A;  2GW4 B;  2LMU A;  2IB5 A;  3SVS A;  2GGZ A;  3PJ5 A;  2G9B A;  4KGE A;  4P2Y B;  1LVC D;  1W7U A;  2G3O A;  1S6Z A;  3CYZ A;  4PHJ A;  3ED8 A;  2JWW A;  1S26 D;  3Q8I A;  4YI8 A;  2QLG A;  3DQ3 A;  3SSY A;  2BL0 B;  4KF5 C;  1OOH A;  1HCJ A;  4IL1 A;  2YFP A;  1OMR A;  3QME A;  3LA1 A;  3DQU A;  5BTT B;  3NSK A;  1NX1 A;  1Q73 A;  1AJ4 A;  1RK9 A;  1EMB A;  1A75 A;  3H4S E;  3G9A A;  3CGL A;  2F2O A;  4W76 A;  3PAT A;  3SVB A;  3V2L A;  1SW8 A;  1XVJ A;  3LLE A;  4HRG A;  2WSN A;  1OE9 B;  2JNX A;  4OVN F;  3WXA A;  2JZI A;  2KQY A;  4IZN A;  1B47 A;  2QLE A;  1LA3 A;  3EVP A;  4GF6 B;  4ZIN A;  4XOV A;  2D8N A;  3SS3 A;  1YRU B;  2VRG A;  1XQM A;  1RMO A;  3SVU A;  4FQT A;  4PCW A;  1XA9 A;  4KYN A;  2JPT A;  4L12 A;  1DJW A;  4UPG A;  1S3P A;  4KW8 A;  3RLZ A;  1SSE B;  4BDU A;  5CSF A;  1CLB A;  1CLL A;  1A03 A;  2A47 A;  1UIS A;  1HT9 A;  4XJK A;  2QAC A;  1RRX A;  1QLK A;  2EC6 B;  1L2O C;  5HKY A;  1C7W A;  2HJO A;  3VHT A;  3TUY B;  2F3Z A;  1KK7 Z;  2A48 A;  2FWQ A;  4JWQ A;  2DDD A;  2O24 A;  2QEH A;  3E3R A;  3RM1 A;  3I5F C;  1TTX A;  3CGA A;  5LTQ A;  3DQI A;  4ZF3 A;  2BEC A;  4DKM A;  3EK4 A;  1KQM C;  4DKN A;  2DUE A;  5AXI A;  3DQ2 A;  4EMQ A;  3KPX A;  1YVH A;  3VB1 A;  2LAN A;  4OV2 A;  1TIZ A;  3L47 A;  3UNW A;  5KU1 A;  1ORG A;  4DS7 A;  1YR5 A;  3CFH A;  5ER5 A;  1LS8 A;  1XFX O;  4OKH A;  2MJW B;  2ZKM X;  2KAX A;  1GQM A;  1SMG A;  3H1O A;  3LVD A;  1G8I A;  4ORB B;  1J55 A;  3ZNI A;  1ALV A;  1WRK A;  1H6R A;  5BTT A;  2BKI B;  2C9I A;  2LVJ A;  3BUN B;  4C0K A;  1IKU A;  4F7F A;  1NSH A;  1ZUZ A;  3PJB A;  1OOJ A;  2LE9 B;  3TDI A;  1DEL A;  1Z4H A;  5IBW A;  4ZCU A;  4U8D A;  1NWD A;  1PSB A;  2F8P A;  4NDC A;  1UHJ A;  2L0P A;  4INX A;  3BXC A;  2Y1M A;  4W7R A;  5DPG A;  1QY3 A;  1N65 A;  4LJD A;  2LHI A;  3B86 A;  3PFV A;  3B87 A;  5FVF A;  1AVS A;  4MBE A;  1BLQ A;  4JD9 A;  4W77 A;  3PAL A;  2ZMW A;  1QVI Y;  3VRQ A;  1E8A A;  4EUL A;  4USL A;  2A56 B;  4WRI A;  1S6C A;  2KI4 C;  1YUR A;  1C4F A;  5DPJ A;  1EMM A;  1YJF A;  5AFP A;  1QAS A;  1YRT B;  2C9J A;  1XFW O;  3AI5 A;  3DVJ A;  1ZGO A;  5D7F A;  2Q91 A;  1KWO C;  4MRY A;  4WQ3 A;  1OXF A;  3KCS A;  2ZO7 A;  1QYO A;  4W6C A;  4KF4 A;  2EGD A;  1GJY A;  4KW9 A;  3U8A A;  2KLE A;  2WIS A;  1GFL A;  1CDP A;  4OQW A;  1KK8 B;  2L50 A;  5EL2 A;  2QLH A;  3NSO A;  1PVB A;  1GGW A;  1JF0 A;  3OX5 A;  2WCF A;  1J7O A;  2Z6Y A;  2HRS A;  4KW4 A;  3CR5 X;  3EG5 B;  2QPT A;  1WY9 A;  2K0J A;  2OS8 B;  1KYP A;  2VZX A;  1V1G A;  2L2E A;  4MLW A;  4W72 A;  4F0Z B;  3RWT A;  2E30 A;  1TUZ A;  4P5O E;  1YZW A;  3B6X A;  3U0K A;  1G4Y R;  1RM9 A;  3JTD C;  4W6L A;  4CLN A;  2KI4 B;  5HZS A;  4R1E A;  3SJS A;  3NT3 A;  4PE4 A;  3FE9 A;  2BBM A;  2KAY A;  1TWO A;  3D78 A;  2A52 B;  3O4Y A;  2RGI A;  1EJ3 A;  1EG3 A;  1IQ3 A;  4GNK B;  4J8A A;  2Z6X A;  1IG5 A;  3DQ9 A;  4W6G A;  3FIA A;  3D76 A;  3DQ6 A;  5HYD A;  5AER A;  4I5K A;  2ZMU A;  2M0R A;  2H61 A;  4MZK A;  4GFT A;  2EMO A;  3DQC A;  3E5W A;  4B5Y A;  3L4A A;  2Y5I A;  3A8S A;  1CDM A;  4N1G A;  2COL B;  1F55 A;  5HL1 A;  2MHH A;  3SVE A;  4ORN A;  2QZ0 A;  3EK8 A;  2K61 A;  2B1U A;  4MZL A;  4W73 A;  1OXE A;  5FVI A;  4AOM A;  1EMF A;  2FL1 A;  4W7D A;  1F54 A;  1IRJ A;  1EG4 A;  3V3D A;  2BAP A;  4LQU A;  4Q9X A;  1YFP A;  4W6H A;  1AP4 A;  3R1V A;  2I7A A;  5DIC A;  3CWG A;  1SL9 A;  4GGN A;  1QXT A;  1KYR A;  2JQ6 A;  4YGE B;  2KFG A;  1CFC A;  4ZFS A;  4W6A A;  2DDC A;  3GL4 A;  1CM4 A;  3CR4 X;  2H8V A;  3JVT B;  1Q4C A;  3K21 A;  4PPJ A;  3ZUJ A;  4W6J A;  3TMT A;  1H4B A;  4PDZ A;  2DD7 A;  2WC8 A;  1TOP A;  1KQV A;  3S05 A;  1QIW A;  1W7T A;  2WCB A;  3FS7 A;  2QEV A;  5TNC A;  3DQJ A;  2IB6 A;  3LCP C;  2HCG A;  3PSR A;  3DQ7 A;  4KGF A;  2FJY A;  4Z4K A;  1SNL A;  3CZT X;  2HGD A;  1SR6 C;  1S5G Y;  2A50 B;  1LA0 A;  1UHH A;  1JBZ A;  2CT9 A;  2KHN A;  4IK8 A;  4DXP A;  2L5X B;  4GPL B;  1XSS A;  2DD9 A;  2M3W A;  4TZA A;  5DQM A;  1CFF A;  2Y0G A;  1XAE A;  4N1F A;  1QIV A;  3UG0 A;  3DQN A;  2CBL A;  1H8B A;  5LK4 A;  5PAL A;  1CM1 A;  3SVC A;  1OXD A;  1HQV A;  2LC5 A;  1LXF C;  2JTZ A;  2O5G A;  4EN1 A;  2BL0 C;  1WDC B;  3I19 A;  1K9U A;  2MA2 A;  2LCP A;  2O2B A;  1IJ5 A;  2LP3 A;  4IK4 A;  3GB3 A;  4CFR A;  1NIW A;  2BCA A;  5HW9 A;  2Y4Q A;  1CFP A;  1UWO A;  4IK5 A;  3BXK A;  1QS7 A;  4JRB A;  2BE6 A;  3A8R A;  3FWB A;  2ERB A;  3FE6 A;  4QJ4 B;  1QV0 A;  3IF7 A;  5GQQ C;  1H4U A;  4LJD C;  1PRW A;  2JPO A;  2OKW A;  3I5I B;  3FWC A;  1TNP A;  3FE8 A;  3I5H B;  1EME A;  2OTE A;  4W6T A;  2LNK A;  2YGU A;  3WHU B;  3SV5 A;  2PXS A;  4ETO A;  1C3Y A;  4OHS A;  4JGE A;  3CZ0 A;  3EVR A;  2EC6 C;  4YGD B;  3SS5 A;  4HRE E;  2L51 A;  3KCT A;  2KSP A;  3TUY C;  4JF9 A;  4ZF4 A;  1DC1 A;  2V53 A;  1OZS A;  4WQ2 A;  1JBA A;  5F6T A;  3DXL A;  4OZD A;  2WCJ A;  1UHI A;  3DQM A;  3TDU A;  2G3D B;  1K96 A;  5JJG A;  4HRH A;  4DRW A;  2RH7 A;  4XOW A;  2LM5 A;  2L2C A;  3NSI A;  1ZGP A;  4R6B A;  2JNF A;  1Q4A A;  4BY4 A;  1F70 A;  2AUC A;  2WUR A;  1BMO A;  3IVT A;  1M39 A;  2OJK A;  3U8C A;  3D74 A;  3SVN A;  1D1O A;  2K7B A;  2GX0 A;  4OJ0 A;  3LK0 A;  3UFZ A;  1JFK A;  1MUX A;  1B7T Y;  2K2A A;  2GW3 A;  3WCK A;  2KYC A;  4DXN A;  1W7J B;  3ICB A;  4MVF A;  5EBJ A;  3EVV A;  1F71 A;  4ZB1 A;  4DXM A;  1Z1Q A;  2Q6P A;  4OGS A;  4UTS A;  3SG2 A;  2AHA A;  2LLU A;  1EMC A;  5KSZ A;  3DQE A;  2HGY A;  3SRY A;  2I94 A;  1X02 A;  2L98 A;  1KSM A;  1ZFS A;  3DQK A;  4GBA A;  1TNQ A;  1JC2 A;  3WHT B;  3EK7 A;  2HQK A;  4L13 A;  1JBY A;  3F45 A;  3QRX A;  3PM2 A;  4H3L A;  5DTY A;  2H9W A;  2H61 C;  2FCD A;  3DVE A;  3IP2 A;  1KFU L;  1Q4B A;  5CSN A;  2BCB A;  2KNE A;  3SST A;  1NUB A;  4JEO A;  1C07 A;  1MWN A;  4PFE A;  1SCV A;  5H87 A;  2P70 A;  4JFG A;  4P76 A;  3SSP A;  4ICB A;  1F09 A;  2JXL A;  1CLM A;  5FVG A;  1XFY O;  2ARL A;  2PYQ A;  1U5I B;  4W7E A;  1B4C A;  2WOS A;  3CR2 A;  3LVC A;  2GTE A;  1SYM A;  1PVA A;  5KTY A;  2PQL A;  1B8L A;  5I2Q A;  1Y6W A;  2FOT A;  3ZTF A;  4YGB B;  5EXC I;  4QJ3 B;  2WSO A;  3PIB A;  3DVK A;  4Q7U A;  1QYQ A;  2BBN A;  4M2O A;  3O77 A;  1B9C A;  2G5Z B;  5DTX A;  2PSR A;  2A53 B;  3M24 A;  1IIO A;  2M8U A;  2VAE A;  1KK8 C;  5I8N A;  1F0B A;  1IWQ A;  3L4L A;  1QJT A;  1K2H A;  3N7H A;  3LS3 A;  3SG7 A;  3OB1 B;  2JC2 A;  1J7R A;  2OS8 C;  5I2L A;  5DQB A;  2LP2 A;  2A46 A;  1CMG A;  1YUU A;  3LK1 A;  4NDB A;  2HFC A;  1PAL A;  2K7C A;  2PAL A;  3ST4 A;  5DKR A;  3BUO B;  1BFP A;  4MSP A;  4RTC A;  3VIC A;  1DQE A; 
#chains in the Genus database with same CATH homology
 1CTR A;  1YTZ C;  1PUL A;  1KK7 Y;  1M46 A;  2BTJ A;  3DVM A;  1EMK A;  1DJI A;  4N3D A;  1K90 D;  1YUS A;  2M97 A;  1JWD A;  2KGR A;  3GOF A;  1Y1A A;  4Q7R A;  1A2X A;  5G08 A;  4MZJ A;  3KHE A;  4W6K A;  1QTX A;  4KEX A;  2K8M B;  1XMZ A;  2KDH A;  2PVB A;  1NCY A;  3U8P A;  1G33 A;  5HZU A;  1YHG A;  3PN7 B;  2HQ8 A;  2A4J A;  4YBH B;  2DUH A;  3BX9 A;  2NLN A;  4L9M A;  2M29 A;  1FPW A;  1OMV A;  1NX2 A;  5AEQ A;  1U5I A;  4W6B A;  3OHM B;  2GX2 A;  4LQT A;  2G6X A;  1MXE A;  1JSA A;  4PHK A;  1J1E A;  1YVL A;  2ICR A;  3CFF A;  4W74 A;  1IQ5 A;  1LKJ A;  1XFU O;  4E68 A;  4H3M A;  5H88 A;  1KSO A;  3K1K A;  5DPI A;  4NQG A;  3M0W A;  1K9K A;  1EXR A;  2NCP A;  2AWK A;  5CPV A;  4MN0 A;  5DKN A;  2OTG B;  5BT0 A;  1OZO A;  2ISD A;  1R2U A;  1HUY A;  3PJ7 A;  5K89 A;  3JVT C;  3TS5 B;  3SG5 A;  1A4P A;  1DTL A;  4JQ0 D;  4W6S A;  1QX7 A;  1UP5 A;  4JC2 A;  2KOT A;  5LTP A;  3MSE B;  2WOR A;  1MR8 A;  2M1K B;  1F8H A;  1YHI A;  1DGU A;  3CFA A;  1MHO A;  2ZN9 A;  1EMG A;  1ZGQ A;  1W7S A;  2H5O A;  2IE2 A;  1M45 A;  4H47 A;  4ORC B;  1SL7 A;  1ZUX A;  2KI6 D;  2EMN A;  4Z4M A;  1NX3 A;  2HPS A;  3DQF A;  3LL8 B;  2LVK A;  3C1V A;  1EML A;  4OCI A;  1JUO A;  5B8I B;  3IR8 A;  1DVI A;  3AKA A;  2KI6 C;  3W1C A;  5HBD A;  4GUK A;  5DU0 A;  5DY6 A;  3SS0 A;  4W7A A;  3P8U A;  5EXU A;  3WNX B;  2LMT A;  2Y1N A;  3EKJ A;  1WDC C;  3BUM B;  5F9G A;  1DJY A;  4AR7 A;  3AI4 A;  4W6D A;  2JOJ A;  3O6B A;  1FI5 A;  2PXW A;  2KGB C;  4B30 B;  5CSI A;  3CD1 A;  3OSQ A;  3BXA A;  5BPJ A;  2KQ6 A;  4I5N B;  2CNP A;  1Y1U A;  3SIB A;  4LJB A;  1UUR A;  5EXB A;  3SIA A;  1GL4 A;  3P28 A;  4IK3 A;  3E5V A;  2JT8 A;  1GGZ A;  1REC A;  1MOV A;  2HQZ A;  1AUI B;  1WLZ A;  5DTL A;  5HZT A;  2LLT A;  4NWS A;  4CPV A;  1WLM A;  3TDZ A;  1SCM B;  1Y1X A;  3NT9 A;  3I5I C;  1W7I B;  3U0M A;  3PM8 A;  1J1D A;  2B3P A;  2YDZ A;  1N2D A;  3NF0 A;  1ODB A;  3OB2 B;  3DQ4 A;  3VGO A;  1B8C A;  4J89 A;  3I5H C;  1XK4 A;  4KPI A;  4AQI A;  2WHS A;  2AMI A;  3W1D A;  2ZRS A;  2WHT A;  2BKH B;  1YX7 A;  3IQQ A;  1UHK A;  4J88 A;  4HQ8 A;  2K2F A;  2MLF C;  3AKO A;  3CB9 A;  1SRA A;  5AQB B;  3O2P A;  1QX2 A;  3GK1 A;  4W69 A;  4HVF A;  2AAO A;  1A29 A;  4D1E A;  1BR1 B;  2JAD A;  4DXO A;  1SK6 D;  1MOU A;  2H8Q A;  1SKT A;  1VRK A;  5KTG A;  1F4Q A;  1QV1 A;  3CLN A;  3VRR A;  2K7D A;  2AWJ A;  1B8R A;  5HKW A;  5FYX A;  4W7F A;  1S1E A;  1BOD A;  3DQA A;  2K7O A;  5DKQ A;  3ZUF A;  2Z6Z A;  3NEZ A;  5AAN A;  2LLS A;  1SY9 A;  4Q9W A;  1K95 A;  4DXI A;  1XFZ O;  1YHH A;  2PRU A;  3WLD A;  2A54 B;  2SCP A;  3BQ3 A;  2Q4U A;  3ST2 A;  3HX4 A;  3NSL A;  4ORA B;  4HQ9 A;  4QJ5 B;  1SPY A;  3DQD A;  1Q80 A;  5T3I A;  1RTP 1;  4FTG A;  1AHR A;  4I5L B;  4B30 A;  2QLI A;  3DF0 B;  4CFQ A;  3U0N A;  1M63 B;  1XA5 A;  3VRP A;  2OGR A;  1B1G A;  1AJ5 A;  4OY4 A;  3SSL A;  1DF0 A;  5HLO A;  2VVH A;  3ZUL A;  4RYW A;  3SVO A;  2JU0 A;  2LUX A;  3I5G B;  1BF5 A;  2ZN8 A;  1NCX A;  5JOL A;  2MBX A;  2JT3 A;  3DPX A;  1QAT A;  2ZO6 A;  5DRG A;  3CD9 A;  5HZO A;  5LTR A;  3BYA A;  4W6I A;  1CMF A;  4GGF A;  1LIN A;  1WRZ A;  4A4B A;  1OSA A;  2G2B A;  1OMD A;  2DUI A;  1KP5 A;  4YGC B;  1JF2 A;  3AKB A;  1R6P A;  3WLC A;  1XFV O;  3SVR A;  2DUF A;  5BQL A;  2P4M A;  4AQJ A;  4M2Q A;  3ZWH A;  2WCE A;  1NP8 A;  2M7L A;  4W6M A;  3DQ1 A;  2QRF A;  1K94 A;  1QVI Z;  4IK9 A;  5EHU A;  4GES B;  4W6R A;  4YI9 A;  3NED A;  2KBM A;  3PLF B;  2YE1 A;  3CBE A;  4DXQ A;  2WND A;  1K93 D;  2M49 B;  4XGY A;  4PE7 A;  3OGO A;  2M1U A;  4PPK A;  2H5Q A;  4PPL A;  1L7Z A;  1GGX A;  1KCY A;  1QXP A;  1BOC A;  1CKK A;  5EB7 A;  3BUX B;  1Q4E A;  1CFD A;  3KO0 A;  3M22 A;  4PAL A;  1QYF A;  4IK1 A;  4CID A;  2IS9 A;  1EH2 A;  1CNP A;  4ZF5 A;  1N0Y A;  1MQ1 A;  2V4E A;  4DIR A;  2M7N A;  2QT2 A;  4W6N A;  4OR9 B;  2F3Y A;  3D0Y B;  4DCK A;  1S6J A;  2OTB A;  2JRF A;  4PHN A;  2LHL A;  2NZ0 A;  4PE0 A;  4AS8 A;  1XYD A;  1NCZ A;  3MGF A;  3D10 A;  1DJH A;  2PAS A;  2BCX A;  4HQC A;  3BXB A;  1L2O B;  3DF0 A;  2ZND A;  1KFX L;  4PHM A;  3GEX A;  1MYW A;  3U0L A;  1EL4 A;  4HE4 A;  3I5F B;  4XVP A;  4EDO A;  1AK8 A;  2IOV A;  1V1F A;  2YE0 A;  3LVA A;  2CCM A;  3PN7 C;  2B3Q A;  1JC1 A;  2POX A;  2JUL A;  3OSR A;  2LVI A;  2JTT A;  2I2R E;  2TN4 A;  4HSZ A;  2WIQ A;  1JFJ A;  4MEW A;  4C0L A;  1MXL C;  1KQM B;  4YRU A;  2H5P A;  2JXC A;  4GAO A;  4R6D A;  4ZCV A;  2JT0 A;  2DOQ A;  3SSV A;  5ER4 X;  1DJZ A;  4Q04 A;  3NXA A;  3DQ8 A;  5EB6 A;  1JC0 A;  2E6W A;  1S36 A;  1ZAC A;  2HET A;  3DPZ A;  4RYS A;  4W75 A;  1XK4 C;  2OTG C;  1QLS A;  4N5X A;  5J3X A;  4NDD A;  4KF5 A;  3TS5 C;  1PK0 D;  1BU3 A;  4XYN A;  3EKH A;  2OKY A;  1M31 A;  3OX6 A;  4M2P A;  4LW5 A;  1FBV A;  1F4O A;  5FHV A;  3DQL A;  1FF1 A;  1G7K A;  2KAV A;  1FI6 A;  1CV7 A;  3OP0 A;  1BG1 A;  2HPW A;  1K9P A;  3BOW B;  3VRO A;  1KFU S;  4TNC A;  4PE1 A;  3A4U B;  2MLE C;  3LF4 B;  5HGE A;  3DQO A;  1UHN A;  2G6E A;  3ADF A;  2AWL A;  2CXJ A;  2KYF A;  1YJ2 A;  2DUG A;  1WRL A;  3D0Y A;  4EDS A;  1S5G Z;  1IJ6 A;  1BJF A;  1UUS A;  1CDN A;  2F33 A;  1DJG A;  2GGM A;  3DQH A;  1SL8 A;  1RRO A;  1DJX A;  2L4H A;  1TNX A;  1K8U A;  1J7Q A;  4JPZ B;  3RWA A;  1RMP A;  4ZBL A;  4DUQ A;  4W7C A;  2Q57 A;  2NXQ A;  4A4C A;  3AAJ A;  2H6V A;  2R2I A;  1KWO B;  2P6B B;  1PSR A;  1CDL A;  1OQP A;  3TZ1 A;  2FCE A;  1KFX S;  1RWY A;  1SBJ A;  3SSH A;  1QX5 B;  3SVD A;  3VK1 A;  2WHU A;  2I18 A;  3GJ1 A;  4XL5 A;  5J2O A;  2O29 A;  2LV7 A;  3GK2 A;  2MAZ A;  2GV5 A;  1NPQ A;  1Q4D A;  4GGF C;  4C0J A;  1SCM C;  2CTN A;  2SAS A;  1S6I A;  2O60 A;  2KBI A;  1BT6 A;  1YUT A;  3H1R A;  4YGA A;  4MRX A;  3JTD B;  4W6F A;  2LMV A;  4U2V A;  5DTZ A;  1BR4 B;  2BE4 A;  4KAG A;  4KA9 A;  4LJC A;  3SG3 A;  5DRF A;  3LF3 A;  2VVI A;  1NYA A;  2AH8 A;  3IQO A;  3DQ5 A;  2EHB A;  3ST3 A;  1IGV A;  4GOB A;  1FW4 A;  3VRN A;  3DD4 A;  1EMA A;  2QLG B;  1C7V A;  1Y0V H;  1RJV A;  2M9G A;  3KF9 A;  2LVV A;  5HKZ A;  5CSJ A;  1DF0 B;  3BOW A;  2H2K A;  2ZRT A;  3SSK A;  2G16 B;  2F2P A;  1NX0 A;  1YX8 A;  4ZIO A;  2Z1O A;  3AAK A;  1A75 B;  4W7X A;  2OPO A;  3SG4 A;  3ST0 A;  1B9A A;  1XO5 A;  3HCM A;  3GJ2 A;  4TZG A;  1TN4 A;  2NCO A;  1TCF A;  1IH0 A;  4W6P A;  1J7P A;  2VAD A;  4ANJ A;  3SG6 A;  5HLV A;  4P1Q A;  2MRD A;  2H5R A;  1KYS A;  4Q7T A;  2G2S B;  5DPH A;  5H89 A;  2HQW A;  3EVU A;  4H48 A;  2V4E C;  3TMR A;  1DGV A;  3CS1 A;  1ALW A;  5EJU A;  2ZFD A;  1MF8 B;  2FZU A;  1TRF A;  4FQO A;  1B7T Z;  1RFJ A;  2EMD A;  2ZNE A;  4XJK B;  4I2Y A;  5D69 A;  1DT7 B;  2G6Y A;  1ZMZ A;  3O78 A;  4I5J A;  2L4I A;  4H3N A;  3KEV A;  3VHT B;  3BUW B;  2AWM A;  4W6U A;  1DMO A;  3I5G C;  2KFF A;  4L1I A;  3DPW A;  4W6O A;  2KFH A;  2LUC A;  1ZOT B;  1TCO B;  2LAP A;  2VVJ A;  1SR6 B;  2FJU B;  1TNW A;  3CTN A;  5I2O A;  3GK4 X;  2QU1 A;  4BY5 A;  3LSA A;  2PMY A;  1Z1P A;  1CB1 A;  2V4E B;  3E5T A;  1RMM A;  2HF5 A;  2GW4 B;  2LMU A;  2IB5 A;  3SVS A;  2GGZ A;  3PJ5 A;  2G9B A;  4KGE A;  4P2Y B;  1LVC D;  1W7U A;  2G3O A;  1S6Z A;  4PHJ A;  3ED8 A;  2JWW A;  1S26 D;  4YI8 A;  2QLG A;  3DQ3 A;  3SSY A;  2BL0 B;  4KF5 C;  1HCJ A;  4IL1 A;  2YFP A;  1OMR A;  3LA1 A;  3DQU A;  5BTT B;  3NSK A;  1NX1 A;  1Q73 A;  1AJ4 A;  1RK9 A;  1EMB A;  1A75 A;  3H4S E;  3G9A A;  3CGL A;  2F2O A;  4W76 A;  3PAT A;  3SVB A;  1SW8 A;  1XVJ A;  3LLE A;  4HRG A;  2WSN A;  1OE9 B;  2JNX A;  4OVN F;  3WXA A;  2JZI A;  2KQY A;  4IZN A;  1B47 A;  2QLE A;  1LA3 A;  3EVP A;  4GF6 B;  4ZIN A;  4XOV A;  2D8N A;  1YRU B;  2VRG A;  1XQM A;  1RMO A;  3SVU A;  4PCW A;  1XA9 A;  2JPT A;  4L12 A;  4KW8 A;  1DJW A;  1S3P A;  4UPG A;  3RLZ A;  4BDU A;  5CSF A;  1CLB A;  1CLL A;  1A03 A;  2A47 A;  1UIS A;  1HT9 A;  4XJK A;  2QAC A;  1RRX A;  1QLK A;  2EC6 B;  1L2O C;  5HKY A;  1C7W A;  2HJO A;  3VHT A;  3TUY B;  2F3Z A;  1KK7 Z;  2A48 A;  2FWQ A;  4JWQ A;  2DDD A;  2O24 A;  3E3R A;  3RM1 A;  3I5F C;  1TTX A;  3CGA A;  5LTQ A;  3DQI A;  4ZF3 A;  2BEC A;  4DKM A;  3EK4 A;  1KQM C;  4DKN A;  2DUE A;  5AXI A;  3DQ2 A;  4EMQ A;  3KPX A;  1YVH A;  2LAN A;  4OV2 A;  1TIZ A;  5KU1 A;  4DS7 A;  1YR5 A;  3CFH A;  5ER5 A;  1XFX O;  4OKH A;  2MJW B;  2ZKM X;  2KAX A;  1GQM A;  1SMG A;  3H1O A;  3LVD A;  1G8I A;  4ORB B;  1J55 A;  3ZNI A;  1ALV A;  1WRK A;  1H6R A;  5BTT A;  2BKI B;  2C9I A;  2LVJ A;  3BUN B;  4C0K A;  1IKU A;  1NSH A;  1ZUZ A;  3PJB A;  1OOJ A;  2LE9 B;  3TDI A;  5IBW A;  4ZCU A;  4U8D A;  1NWD A;  1PSB A;  2F8P A;  4NDC A;  1UHJ A;  2L0P A;  3BXC A;  2Y1M A;  4W7R A;  5DPG A;  1QY3 A;  1N65 A;  4LJD A;  2LHI A;  3PFV A;  5FVF A;  1AVS A;  4MBE A;  1BLQ A;  4W77 A;  3PAL A;  2ZMW A;  1QVI Y;  3VRQ A;  1E8A A;  4EUL A;  4USL A;  2A56 B;  4WRI A;  1S6C A;  2KI4 C;  1YUR A;  1C4F A;  5DPJ A;  1EMM A;  1YJF A;  5AFP A;  1QAS A;  1YRT B;  2C9J A;  1XFW O;  3AI5 A;  3DVJ A;  1ZGO A;  5D7F A;  2Q91 A;  1KWO C;  4MRY A;  4WQ3 A;  1OXF A;  3KCS A;  2ZO7 A;  1QYO A;  4W6C A;  4KF4 A;  2EGD A;  1GJY A;  4KW9 A;  3U8A A;  2WIS A;  1GFL A;  1CDP A;  4OQW A;  1KK8 B;  2L50 A;  2QLH A;  3NSO A;  1PVB A;  1GGW A;  1JF0 A;  3OX5 A;  2WCF A;  1J7O A;  2Z6Y A;  2HRS A;  4KW4 A;  3CR5 X;  2QPT A;  1WY9 A;  2K0J A;  2OS8 B;  1KYP A;  2VZX A;  1V1G A;  2L2E A;  4MLW A;  4W72 A;  4F0Z B;  3RWT A;  2E30 A;  4P5O E;  1YZW A;  3U0K A;  1G4Y R;  1RM9 A;  3JTD C;  4W6L A;  4CLN A;  2KI4 B;  5HZS A;  4R1E A;  3SJS A;  3NT3 A;  4PE4 A;  2BBM A;  2KAY A;  2A52 B;  3O4Y A;  2RGI A;  1EJ3 A;  1EG3 A;  1IQ3 A;  4GNK B;  4J8A A;  2Z6X A;  1IG5 A;  3DQ9 A;  4W6G A;  3FIA A;  3DQ6 A;  5HYD A;  5AER A;  4I5K A;  2ZMU A;  2M0R A;  2H61 A;  4MZK A;  4GFT A;  2EMO A;  3DQC A;  3E5W A;  4B5Y A;  2Y5I A;  3A8S A;  1CDM A;  4N1G A;  2COL B;  1F55 A;  2MHH A;  3SVE A;  4ORN A;  2QZ0 A;  3EK8 A;  2K61 A;  2B1U A;  4MZL A;  4W73 A;  1OXE A;  5FVI A;  4AOM A;  1EMF A;  2FL1 A;  4W7D A;  1F54 A;  1IRJ A;  1EG4 A;  3V3D A;  4LQU A;  4W6H A;  4Q9X A;  1YFP A;  1AP4 A;  2I7A A;  3CWG A;  1SL9 A;  4GGN A;  1QXT A;  1KYR A;  2JQ6 A;  4YGE B;  2KFG A;  1CFC A;  4ZFS A;  4W6A A;  2DDC A;  3GL4 A;  1CM4 A;  3CR4 X;  3JVT B;  1Q4C A;  3K21 A;  4PPJ A;  3ZUJ A;  4W6J A;  3TMT A;  1H4B A;  4PDZ A;  2DD7 A;  2WC8 A;  1TOP A;  1KQV A;  3S05 A;  1QIW A;  1W7T A;  2WCB A;  3FS7 A;  5TNC A;  3DQJ A;  2IB6 A;  3LCP C;  2HCG A;  3PSR A;  3DQ7 A;  4KGF A;  4Z4K A;  1SNL A;  3CZT X;  2HGD A;  1SR6 C;  1S5G Y;  2A50 B;  1LA0 A;  1UHH A;  1JBZ A;  2CT9 A;  2KHN A;  4IK8 A;  4DXP A;  2L5X B;  4GPL B;  1XSS A;  2DD9 A;  2M3W A;  4TZA A;  5DQM A;  1CFF A;  2Y0G A;  1XAE A;  4N1F A;  1QIV A;  3UG0 A;  3DQN A;  2CBL A;  1H8B A;  5LK4 A;  5PAL A;  1CM1 A;  3SVC A;  1OXD A;  1HQV A;  2LC5 A;  1LXF C;  2JTZ A;  2O5G A;  4EN1 A;  2BL0 C;  1WDC B;  3I19 A;  1K9U A;  2MA2 A;  2LCP A;  2O2B A;  1IJ5 A;  2LP3 A;  4IK4 A;  3GB3 A;  4CFR A;  1NIW A;  2BCA A;  5HW9 A;  2Y4Q A;  1CFP A;  1UWO A;  4IK5 A;  3BXK A;  1QS7 A;  4JRB A;  2BE6 A;  3A8R A;  3FWB A;  4QJ4 B;  1QV0 A;  3IF7 A;  5GQQ C;  1H4U A;  4LJD C;  1PRW A;  2OKW A;  3I5I B;  3FWC A;  1TNP A;  3I5H B;  1EME A;  2OTE A;  4W6T A;  2LNK A;  3WHU B;  3SV5 A;  2PXS A;  4ETO A;  4OHS A;  4JGE A;  3EVR A;  2EC6 C;  4YGD B;  4HRE E;  2L51 A;  3KCT A;  2KSP A;  3TUY C;  4JF9 A;  4ZF4 A;  2V53 A;  1OZS A;  4WQ2 A;  1JBA A;  5F6T A;  1UHI A;  3DQM A;  3TDU A;  2G3D B;  1K96 A;  5JJG A;  4HRH A;  4DRW A;  2RH7 A;  4XOW A;  2LM5 A;  3NSI A;  1ZGP A;  4R6B A;  2JNF A;  1Q4A A;  4BY4 A;  1F70 A;  2AUC A;  2WUR A;  1BMO A;  1M39 A;  2OJK A;  3U8C A;  3SVN A;  1D1O A;  2K7B A;  2GX0 A;  4OJ0 A;  3LK0 A;  3UFZ A;  1JFK A;  1MUX A;  1B7T Y;  2K2A A;  2GW3 A;  3WCK A;  2KYC A;  4DXN A;  1W7J B;  3ICB A;  4MVF A;  5EBJ A;  3EVV A;  1F71 A;  4ZB1 A;  4DXM A;  1Z1Q A;  2Q6P A;  4OGS A;  4UTS A;  3SG2 A;  2AHA A;  2LLU A;  1EMC A;  5KSZ A;  3DQE A;  2HGY A;  3SRY A;  2I94 A;  1X02 A;  2L98 A;  1KSM A;  1ZFS A;  3DQK A;  4GBA A;  1TNQ A;  1JC2 A;  3WHT B;  3EK7 A;  2HQK A;  4L13 A;  1JBY A;  3F45 A;  3QRX A;  4H3L A;  5DTY A;  2H9W A;  2H61 C;  2FCD A;  3DVE A;  3IP2 A;  1KFU L;  1Q4B A;  5CSN A;  2BCB A;  2KNE A;  3SST A;  1NUB A;  4JEO A;  1C07 A;  1MWN A;  4PFE A;  1SCV A;  5H87 A;  4JFG A;  4P76 A;  3SSP A;  4ICB A;  1F09 A;  2JXL A;  1CLM A;  5FVG A;  1XFY O;  2ARL A;  1U5I B;  4W7E A;  1B4C A;  2WOS A;  3CR2 A;  3LVC A;  1SYM A;  1PVA A;  5KTY A;  1B8L A;  5I2Q A;  1Y6W A;  2FOT A;  3ZTF A;  4YGB B;  5EXC I;  4QJ3 B;  2WSO A;  3PIB A;  3DVK A;  4Q7U A;  1QYQ A;  2BBN A;  4M2O A;  3O77 A;  1B9C A;  2G5Z B;  5DTX A;  2PSR A;  2A53 B;  3M24 A;  2M8U A;  2VAE A;  1KK8 C;  5I8N A;  1F0B A;  1IWQ A;  1QJT A;  1K2H A;  3LS3 A;  3SG7 A;  3OB1 B;  2JC2 A;  1J7R A;  2OS8 C;  5I2L A;  5DQB A;  2LP2 A;  2A46 A;  1CMG A;  1YUU A;  3LK1 A;  4NDB A;  2HFC A;  1PAL A;  2K7C A;  2PAL A;  3ST4 A;  5DKR A;  3BUO B;  1BFP A;  4MSP A;  4RTC A;  3VIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...