3SG5A

Crystal structure of dimeric gcamp3-d380y, qp(linker 1), lp(linker 2)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
409
structure length
387
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSQPNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMADSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
total genus 124
structure length 387
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg5A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg5A01
2NCPA 4LQTA 3TS5C 1SL7A 5KSZA 3DQ6A 2KI4B 3DD4A 4W6AA 3ZWHA 1W7IB 1WRLA 2KHNA 3U8CA 4KGFA 2M1KB 1XVJA 5FVIA 1HQVA 2PSRA 4A4CA 2JT3A 2SCPA 4HRHA 1RTP1 2NZ0A 4W73A 5HLOA 3LF4B 3PSRA 2F8PA 3W1DA 4MVFA 5DKRA 3DQFA 2K2FA 4W74A 4ANJA 2LHLA 4W77A 1W7UA 1B8RA 3OX6A 4W6OA 1AVSA 3ST0A 2LUXA 2G3DB 1KWOB 5HW9A 1R6PA 2GW4B 5TNCA 2A48A 3QRXA 1F71A 1KFXS 3ZNIA 1KQMB 5AQBB 2JRFA 1OMDA 1EMAA 2BECA 4W6DA 4Z4KA 4I5KA 2O24A 1SY9A 5DTLA 4YI8A 2HQ8A 3SJSA 2ZN9A 2YFPA 4N1GA 2Z6YA 3SSHA 2GGMA 4JGEA 1XFUO 3DQNA 4USLA 3NSIA 3SVUA 3FWBA 1KK7Z 1WLMA 1OQPA 5FYXA 3SSVA 3DQCA 1XA9A 5DPJA 3NT9A 1TRFA 4WRIA 1YX7A 1BODA 5CSIA 2JNFA 2IOVA 3EKJA 1Q4CA 2LLSA 4GGNA 4GUKA 4NWSA 3O78A 3C1VA 2WSNA 3A4UB 4N5XA 1BLQA 3DVKA 2LVJA 2LVIA 1C07A 2B3QA 3V3DA 2Z6XA 1NWDA 4I2YA 1BT6A 4LQUA 1S6JA 2LVKA 2L4IA 4AOMA 2WOSA 2LV7A 4NDBA 4HE4A 4PPKA 2A54B 3TMRA 5D69A 1MWNA 1QXPA 1XMZA 1YX8A 3SV5A 4JPZB 4BY5A 1W7TA 1RMPA 5BTTB 2WCEA 3KHEA 5HKYA 3BYAA 2I18A 1ZUXA 2K61A 3D0YA 1H6RA 3P28A 4RYSA 2QU1A 3PATA 4DXMA 4W7EA 2FCDA 4RTCA 4E68A 2G2SB 4B30A 4ZF4A 2GV5A 1JC1A 1RMMA 5LK4A 1ZGOA 1W7JB 1QVIZ 3DQUA 4R6BA 5HZTA 1UHJA 2LCPA 4W6RA 2K2AA 4C0LA 1KFXL 4LJCA 2JZIA 3CFAA 4P2YB 1JSAA 4W7AA 4M2PA 2OPOA 4Z4MA 4CFRA 4IL1A 1CKKA 2HQZA 4MZJA 1KQVA 3GJ1A 3MSEB 2A4JA 1NCYA 3VRPA 4KW9A 3I5IC 3DQOA 3SVSA 3D0YB 2PVBA 1MXLC 4H47A 4IK1A 3BUNB 4H3LA 3VROA 2K7OA 3A8RA 2EC6C 2PASA 3DVMA 1KSOA 1LA0A 3PM8A 3SG6A 1CLLA 4W75A 3HCMA 3SVCA 2F2OA 2Y1MA 2B1UA 2HQWA 2M7LA 2KDHA 3FS7A 2DUEA 2E6WA 2BKHB 1QLSA 2HCGA 1M45A 1K94A 2L98A 1XFXO 1YJFA 4HQ8A 2BBNA 3A8SA 1AP4A 3VGOA 5LTQA 2VRGA 2JADA 2M1UA 2JOJA 2BL0C 3OB2B 3DQ1A 1B8CA 2KBMA 2GW3A 1IQ5A 1FPWA 1TNPA 1NX0A 1UURA 1WLZA 4PE4A 3UG0A 3EK4A 5DPHA 4L1IA 4IK9A 3H1RA 1YVLA 1WRZA 1Y6WA 2COLB 1RM9A 2DDCA 1Q73A 3O4YA 2BKIB 1S6IA 3KO0A 2M3WA 2G16B 2K0JA 3DPXA 2JPTA 3I5GC 1YVHA 4PPJA 4XOVA 2BE6A 3BOWA 1RECA 5T3IA 3ADFA 5BT0A 4GNKB 1C7WA 5DU0A 1C4FA 3ST3A 1BOCA 1SRAA 4PHKA 1NPQA 1XSSA 3PFVA 4JC2A 1J55A 5I2QA 2A53B 1G7KA 3H1OA 4M2OA 1X02A 3WHTB 5G08A 1GFLA 3CGLA 2HETA 4XGYA 2JC2A 2FZUA 3SIBA 1TNWA 4ORCB 3LVAA 1DJZA 1GGZA 3U0MA 3BXBA 5DRFA 1JFKA 3OB1B 4KPIA 3PJ5A 2H61C 1M31A 3I5GB 3DQ8A 4OVNF 2H61A 4C0KA 1IWQA 3CWGA 3WLCA 3DQ5A 5EXCI 2KGRA 3PJBA 1BF5A 3TDUA 1A2XA 1CDLA 3S05A 3U0NA 1FI6A 4W7CA 3RM1A 5DQBA 2KGBC 4L13A 3UFZA 1B4CA 2JTZA 1UP5A 5J3XA 1WY9A 3JVTC 3CB9A 4DKMA 4MRYA 3AAKA 5EBJA 1B7TY 2M0RA 4CFQA 3LLEA 2FCEA 2LHIA 1JWDA 4IZNA 2VVHA 1HUYA 3LK1A 4XJKA 3WCKA 2LP3A 1MOUA 2GGZA 4MLWA 2O29A 1QYFA 1QV1A 2BCAA 3PIBA 2DD9A 4H48A 4PE0A 1U5IA 4W6PA 1PALA 4DXIA 2OTEA 2QLIA 2CBLA 2OTGC 3E5VA 2EGDA 1CB1A 5EB7A 4W6LA 1F55A 1RWYA 5D7FA 1XO5A 2POXA 2KBIA 1IQ3A 1JBYA 2KQ6A 4HVFA 5AFPA 2R2IA 2IB6A 4NDDA 3SVDA 1G8IA 4W6MA 3SG7A 4XJKB 5DKNA 1CFCA 4KA9A 1GQMA 2CCMA 2NLNA 1UHKA 1DJHA 2L2EA 3CD9A 1CFPA 3SVRA 3LK0A 5DTYA 2AWLA 1J7RA 1RFJA 1N2DA 2Q91A 1CFDA 2H5RA 4BDUA 1S6CA 1XA5A 2G9BA 1NX1A 3ZULA 1NIWA 4XL5A 3TMTA 2E30A 2AUCA 1UHHA 3NF0A 3SVBA 4CIDA 4OR9B 2OTBA 4D1EA 2OTGB 3OSQA 5EHUA 1FI5A 1OMVA 3OSRA 2OS8C 3U0KA 2JNXA 2ZNDA 3PLFB 2JXLA 2QT2A 3ZTFA 1UISA 5DPGA 4DXOA 1CM1A 1LXFC 4PHNA 3EVRA 2KFFA 3RWAA 1K9UA 2VADA 3EVVA 1MUXA 1NCXA 2IB5A 1MF8B 1S3PA 3BX9A 3CR5X 4YGDB 3DQDA 1XFYO 3RLZA 4HSZA 1F70A 2KYFA 3TS5B 2PXSA 4ORAB 5BPJA 1FF1A 1NYAA 4Q7RA 1TCOB 2ZRSA 2M29A 2EMOA 1TIZA 3M24A 5PALA 2P4MA 3NEZA 5LTRA 1ODBA 1A75A 3O2PA 2Y4QA 1UWOA 2OS8B 1NUBA 3SG2A 1F8HA 4DUQA 2H9WA 2AH8A 2JT8A 4ZIOA 4XOWA 1R2UA 2L4HA 1DJWA 1RRXA 1YRUB 2H5QA 4MZKA 1EMKA 4UTSA 4GF6B 4KGEA 3VHTA 3JTDC 4Q04A 4CPVA 4TZAA 3E3RA 1J7QA 4ZCUA 4F0ZB 5AANA 1J1EA 2L0PA 2A52B 1OMRA 3F45A 4GAOA 3I5FC 1GGWA 4OGSA 1DJIA 2CT9A 1NCZA 5EXUA 4W6SA 5KTYA 2O5GA 1QASA 5HZSA 2O2BA 3CD1A 3ST4A 4GOBA 1NX3A 1F54A 3O77A 3SG3A 4UPGA 2WURA 1A29A 3VICA 4OY4A 5HBDA 3D10A 5I2OA 4HQ9A 3VHTB 1Y0VH 2AWJA 2JULA 2WISA 1DMOA 1QYOA 3PJ7A 1JF0A 1XFVO 1E8AA 4LW5A 3BQ3A 4DRWA 4Q9XA 2QLEA 1OOJA 4WQ2A 4JRBA 1K9KA 3WXAA 3LSAA 3SSLA 2DD7A 2L5XB 5F6TA 2PRUA 1EXRA 2LLUA 1S1EA 3GK1A 4U8DA 1F4OA 3FWCA 5CPVA 2KI6C 5AEQA 4B30B 1Y1AA 2AAOA 2ISDA 3BUXB 4IK4A 3SG4A 3M0WA 1JBAA 3SSKA 2K7CA 3GEXA 4YBHB 3NSKA 4MZLA 3U8AA 2M49B 3TUYC 3LS3A 4L12A 2QPTA 3DVEA 2LAPA 2IE2A 1J1DA 3LVDA 1DVIA 3KCTA 5DPIA 2MHHA 1IJ5A 4QJ4B 3HX4A 3CFFA 1S36A 1KFUS 3CS1A 5HZUA 2KAYA 3EVUA 1CV7A 2DDDA 3AKBA 4HRGA 4M2QA 4W6UA 3SG5A 3CTNA 4GGFC 3IQQA 4ICBA 1EMEA 1QY3A 1K8UA 1HT9A 3I5IB 2QRFA 4DKNA 5K89A 3SSYA 1PVBA 4GGFA 2Y0GA 1SBJA 1OXFA 1QX7A 1RJVA 2EC6B 1MYWA 2M9GA 1XK4C 2MRDA 1YUUA 3DPWA 3K21A 5DTZA 1HCJA 1ZMZA 4C0JA 1EG4A 4LJBA 5FHVA 1XK4A 4J89A 3BUMB 3KCSA 3LA1A 2ZMWA 1DF0A 2FOTA 2G6YA 3DQ9A 2BBMA 2ICRA 1D1OA 3DQJA 1EL4A 5ER5A 1L7ZA 2KAVA 2AHAA 2LC5A 1NP8A 4W7XA 4DXNA 2M7NA 2BL0B 1PK0D 1AUIB 4JQ0D 2CTNA 1B7TZ 4EDOA 2Z6ZA 3TDZA 4ETOA 2QLHA 3M22A 1B8LA 2P6BB 5F9GA 2LE9B 3GL4A 3O6BA 4EN1A 3DQ4A 2LM5A 1SPYA 1H4UA 2QLGA 4YRUA 4PE7A 4AQIA 1N65A 4YI9A 4ORNA 4GBAA 3BOWB 4W6HA 3SS0A 5CSFA 5FVGA 1QIWA 4W6IA 1JF2A 2Y1NA 1EMFA 3BUOB 3BXKA 3IP2A 1LVCD 3FIAA 2WNDA 1CNPA 4KAGA 5DKQA 4ZINA 3IF7A 1IG5A 2G3OA 4OHSA 2HGYA 2I7AA 4I5LB 1EG3A 1S26D 1L2OC 1XFZO 2K7BA 2LNKA 4TZGA 3MGFA 3U0LA 5DQMA 2LUCA 1YUSA 3VK1A 2BE4A 2JU0A 4I5NB 2AMIA 2CXJA 1JC0A 4DS7A 1SMGA 3DQ3A 2WCBA 1SR6C 5I2LA 4NDCA 1PULA 1EMMA 1K96A 5LTPA 1TN4A 2YE0A 3OX5A 5B8IB 3AKAA 2VVJA 2G6XA 2HGDA 2PMYA 1FBVA 2MLEC 2WCFA 1M63B 4A4BA 4PDZA 3ICBA 1KCYA 4AS8A 5JOLA 3DQEA 5HGEA 4OKHA 2PALA 2ZFDA 3KPXA 1DJGA 1EH2A 2DUHA 1QYQA 1AJ4A 4PCWA 4EDSA 2H8QA 4IK3A 4W6BA 4J8AA 3W1CA 1G4YR 2LMTA 2KQYA 1OSAA 2HPSA 2WHTA 2V4EC 5HKWA 3SIAA 3SSPA 5H88A 3AI5A 1OZOA 4EULA 3DQLA 3SRYA 1S5GY 2MA2A 2V4EA 1Q4BA 3JVTB 3TDIA 1UHIA 4U2VA 1FW4A 2ZMUA 4MBEA 1RK9A 5IBWA 2Q4UA 2OGRA 5EXBA 1SR6B 3CGAA 1BMOA 3EK8A 4PE1A 2Y5IA 4H3NA 3NXAA 1RROA 4YGAA 1KWOC 2I2RE 1U5IB 1QJTA 3CBEA 4XYNA 1SNLA 3GOFA 1QS7A 2WHUA 4DXPA 1KQMC 4B5YA 2A56B 4JWQA 3NSOA 1QXTA 2VAEA 2MLFC 1DJXA 5DTXA 4ZF3A 2IS9A 3WHUB 3WNXB 2WIQA 1B1GA 3CLNA 3LF3A 1NSHA 2C9IA 1TCFA 1V1FA 2EMDA 1YR5A 4ZFSA 1SYMA 1ZOTB 1MHOA 1A03A 2V4EB 3BXCA 1MR8A 4QJ3B 2AWKA 2CNPA 1EMCA 1GGXA 5H87A 1CMFA 2H5OA 1XYDA 4AQJA 4GESB 3ZUFA 4W6JA 3CZTX 2KNEA 1QV0A 1YHHA 1RMOA 1KK8C 2V53A 3SVOA 3I5HC 3NSLA 1EMBA 2VVIA 1ZACA 1BR4B 4W7RA 4NQGA 1Y1XA 1B9CA 1K9PA 2KSPA 1SKTA 3TZ1A 4N1FA 2H2KA 1JBZA 1H8BA 1CDMA 2WC8A 1KYSA 1Z1PA 1OXEA 1WRKA 1XAEA 4J88A 1J7OA 2BCBA 4Q7TA 2L50A 1J7PA 1SL8A 5I8NA 1F09A 3E5TA 4MEWA 1QX2A 1PSBA 1CTRA 4OJ0A 1BR1B 2JTTA 5BTTA 1QIVA 5CSNA 4LJDC 3GK4X 4YGCB 2EHBA 1KK8B 2DOQA 2JXCA 4P1QA 4PHMA 3I5HB 4YGBB 1ZUZA 1B9AA 4LJDA 5GQQC 2K7DA 1QATA 2WHSA 2G5ZB 4OCIA 1VRKA 1MOVA 4W7DA 3GJ2A 1OXDA 2A47A 1QX5B 1ZFSA 4R6DA 1S6ZA 1V1GA 1XFWO 5J2OA 2ZN8A 2DUFA 5BQLA 1H4BA 2LMVA 3K1KA 4KW8A 1GL4A 1A75B 1AJ5A 1G33A 2KFGA 3CFHA 1UUSA 3SVNA 1SCVA 5JJGA 3IQOA 1DGUA 1LA3A 1K90D 4ZBLA 3DQIA 1BFPA 3OGOA 4ZB1A 5EJUA 2F33A 1ALVA 1KK7Y 1DTLA 2SASA 3SVEA 5AERA 1TOPA 1IH0A 4HREE 2L51A 2FJUB 2F2PA 5KTGA 2HFCA 3LCPC 1B47A 2ZO6A 2QZ0A 3JTDB 3VRNA 2DUIA 1K2HA 1ZGPA 1F0BA 5HLVA 1N0YA 3GK2A 1JUOA 1LKJA 4W76A 4DCKA 4H3MA 2KI6D 1JFJA 3DQ2A 3DQHA 4W6KA 2B3PA 3I5FB 4ORBB 2ARLA 1SCMC 3AI4A 3DVJA 2KYCA 2HJOA 3I19A 1IJ6A 3NT3A 1BJFA 2HF5A 4BY4A 2OJKA 1Q4DA 3WLDA 1CM4A 4MRXA 2FL1A 2YE1A 2LVVA 4MSPA 5DY6A 2JWWA 4KF5C 2HQKA 1YZWA 1IGVA 2ZKMX 2ZRTA 2C9JA 1YRTB 5H89A 1BG1A 4KF5A 4KEXA 2MJWB 2M97A 2KAXA 4N3DA 4QJ5B 3DF0A 1QVIY 5KU1A 2EMNA 4HQCA 2LP2A 1Q80A 1WDCC 1DGVA 1KYRA 1DT7B 2A46A 3PALA 2BCXA 1AHRA 1EMGA 3BXAA 2NCOA 3DQAA 2VZXA 2O60A 4WQ3A 4YGEB 1Q4EA 4W6NA 1SCMB 3DQKA 3VRQA 3PN7C 3G9AA 1EMLA 2KFHA 2G2BA 1CDPA 1PRWA 1KYPA 4CLNA 2F3YA 1PVAA 1KP5A 1IRJA 3E5WA 3ED8A 2WORA 1C7VA 1QLKA 4XVPA 2ZNEA 3TUYB 2LMUA 3NEDA 3DF0B 4P76A 2HPWA 3ST2A 4OV2A 4FTGA 1YFPA 1TNQA 1A4PA 2LANA 3BUWB 2F3ZA 1CDNA 2M8UA 1CLMA 4W72A 1SW8A 1WDCB 2MBXA 1OE9B 1YUTA 4PFEA 4ZCVA 1GJYA 3GB3A 4OQWA 3PN7B 5FVFA 4FQOA 2D8NA 3SSTA 4W6CA 1YTZC 4KW4A 1SL9A 1TTXA 1LINA 2OKYA 5DRGA 3CR2A 1ZGQA 1DF0B 1IKUA 1F4QA 1XQMA 5HKZA 1YJ2A 2MAZA 2H5PA 4EMQA 1OZSA 4W6TA 1M39A 4IK5A 2Q57A 2K8MB 3EKHA 1ALWA 1KFUL 3EVPA 5HZOA 3P8UA 1S5GZ 1YHIA 2HRSA 2JT0A 1K93D 3EK7A 5ER4X 4KF4A 3AKOA 3KEVA 4TNCA 2QACA 2Q6PA 2QLGB 2AWMA 1W7SA 3KF9A 4JFGA 4GPLB 5EB6A 3LVCA 2G6EA 1MQ1A 4JF9A 4W6FA 1MXEA 2JQ6A 3U8PA 4R1EA 2PXWA 3DQ7A 1Z1QA 5HYDA 4W7FA 4MN0A 1K95A 1PSRA 3CR4X 2WSOA 2ZO7A 3IR8A 4W69A 3OP0A 1DJYA 1KSMA 2TN4A 4PPLA 4JEOA 5AXIA 2KI4C 3RWTA 4ZF5A 4AR7A 2Z1OA 4DXQA 1L2OB 2RGIA 3H4SE 1Q4AA 4IK8A 4RYWA 1NX2A 1AK8A 1EJ3A 1CLBA 4DIRA 1Y1UA 3DQMA 2H6VA 1M46A 2YDZA 3AAJA 2NXQA 2OKWA 4PALA 2FWQA 3ZUJA 1TNXA 4W6GA 2A50B 5CSJA 4P5OE 1YURA 4PHJA 2BTJA 1BU3A 1CMGA 4I5JA 1UHNA 2I94A 4Q7UA 4Q9WA 2DUGA 2RH7A 2GX2A 1CFFA 2KOTA 1SK6D 2LLTA 3VRRA 2GX0A 3LL8B 4L9MA 1JC2A 3DPZA 3OHMB 4GFTA 1YHGA 1QTXA
chains in the Genus database with same CATH superfamily
2NCPA 4LQTA 2ERBA 3TS5C 1SL7A 5KSZA 3DQ6A 2KI4B 3DD4A 4W6AA 3ZWHA 1W7IB 1WRLA 2KHNA 3U8CA 4KGFA 2M1KB 1XVJA 5FVIA 1HQVA 2PSRA 4A4CA 2JT3A 2SCPA 4HRHA 1RTP1 2NZ0A 4W73A 5HLOA 3LF4B 3PSRA 2F8PA 3W1DA 4MVFA 5DKRA 3DQFA 2K2FA 4W74A 4ANJA 2LHLA 4W77A 1W7UA 1B8RA 3OX6A 4W6OA 2QEOA 1AVSA 3ST0A 2LUXA 2G3DB 1KWOB 5HW9A 1R6PA 2GW4B 5TNCA 4PT1A 2A48A 3QRXA 1F71A 1KFXS 3ZNIA 1KQMB 5AQBB 2JRFA 1OMDA 1EMAA 2BECA 4W6DA 4Z4KA 4I5KA 2O24A 1SY9A 5DTLA 4YI8A 2HQ8A 3SJSA 2ZN9A 3UO9A 2YFPA 4N1GA 2Z6YA 3SSHA 2GGMA 4JGEA 1XFUO 3DQNA 4USLA 2P70A 3NSIA 3SVUA 3FWBA 1KK7Z 1WLMA 1OQPA 5FYXA 3SSVA 3DQCA 1XA9A 5DPJA 3NT9A 1TRFA 4WRIA 1YX7A 3PJIA 1BODA 5CSIA 3S0DA 2QEHA 2JNFA 2IOVA 3EKJA 1Q4CA 2LLSA 4GGNA 4GUKA 4NWSA 3O78A 3C1VA 2WSNA 3VB1A 3A4UB 4N5XA 1BLQA 3DVKA 3S0FA 2LVJA 2LVIA 1C07A 2B3QA 3V3DA 2Z6XA 1NWDA 4I2YA 1BT6A 4LQUA 1S6JA 2LVKA 2L4IA 4AOMA 2WOSA 2LV7A 4NDBA 4HE4A 4PPKA 2A54B 3TMRA 5D69A 1GM0A 1MWNA 1QXPA 1XMZA 1YX8A 3SV5A 4JPZB 4BY5A 1W7TA 3CABA 2FJYA 1RMPA 5BTTB 2WCEA 3KHEA 5HKYA 3BYAA 2I18A 1ZUXA 2K61A 3D0YA 1H6RA 3P28A 4OZDA 2QU1A 4RYSA 3PATA 4DXMA 4W7EA 2FCDA 4RTCA 4E68A 2G2SB 4B30A 3D77A 4ZF4A 2GV5A 2QEBA 1JC1A 1RMMA 5LK4A 1ZGOA 1W7JB 1QVIZ 3DQUA 4R6BA 5HZTA 1UHJA 2LCPA 4W6RA 2K2AA 4C0LA 1KFXL 4LJCA 2JZIA 3CFAA 4P2YB 1JSAA 4W7AA 4M2PA 2OPOA 4Z4MA 4CFRA 4IL1A 1CKKA 2HQZA 4MZJA 1KQVA 3GJ1A 3MSEB 2A4JA 1NCYA 3VRPA 4KW9A 3I5IC 3DQOA 3SVSA 3D0YB 2PVBA 1MXLC 4H47A 4IK1A 1W9ZA 4JKTA 3BUNB 4H3LA 3VROA 2K7OA 3A8RA 2EC6C 2PASA 3DVMA 1KSOA 1LA0A 3PM8A 3SG6A 1CLLA 4W75A 1OOHA 3HCMA 3SVCA 2F2OA 5HL1A 2Y1MA 2B1UA 2HQWA 2M7LA 2KDHA 3FS7A 2DUEA 2E6WA 3B88A 2BKHB 1QLSA 2HCGA 1M45A 1K94A 3R72A 2L98A 3PM2A 1XFXO 1YJFA 4HQ8A 2BBNA 3A8SA 1AP4A 3VGOA 5LTQA 2VRGA 2JADA 2M1UA 2JOJA 2BL0C 3OB2B 1XFRA 3DQ1A 1B8CA 2KBMA 2GW3A 1IQ5A 1FPWA 1TNPA 1NX0A 1UURA 1WLZA 4PE4A 3UG0A 3EK4A 5DPHA 4L1IA 4IK9A 3H1RA 1YVLA 1WRZA 1Y6WA 2COLB 1RM9A 2DDCA 1Q73A 3O4YA 2BKIB 1S6IA 3KO0A 2M3WA 2G16B 3OGNA 2K0JA 3DPXA 2JPTA 3I5GC 1YVHA 4PPJA 2WCKA 4XOVA 2BE6A 3BOWA 1RECA 5T3IA 3ADFA 5BT0A 4GNKB 1C7WA 5DU0A 1C4FA 3ST3A 1BOCA 3EG5B 1SRAA 4PHKA 1NPQA 1XSSA 3PFVA 4JC2A 1J55A 5I2QA 2A53B 1G7KA 3H1OA 4M2OA 1X02A 3QMEA 3WHTB 5G08A 1GFLA 3CGLA 3FE6A 2HETA 4XGYA 2JC2A 2FZUA 3SIBA 1TNWA 4ORCB 1OOFA 3LVAA 1DJZA 1GGZA 3U0MA 3BXBA 4IJ7A 5DRFA 1JFKA 3OB1B 4KPIA 3PJ5A 2H61C 1M31A 3I5GB 3DQ8A 4OVNF 2H61A 4C0KA 1IWQA 3CWGA 3WLCA 3DY9A 3CYZA 3DQ5A 5EXCI 2KGRA 3PJBA 3O4XA 1BF5A 3TDUA 1A2XA 1CDLA 3S05A 3U0NA 4INXA 1FI6A 4W7CA 3RM1A 5DQBA 2KGBC 4L13A 3UFZA 3R1OA 1B4CA 2JTZA 1UP5A 5J3XA 3L4LA 1WY9A 3JVTC 3CB9A 4DKMA 4MRYA 3AAKA 3D75A 5EBJA 1B7TY 2M0RA 4CFQA 5EL2A 3LLEA 2FCEA 3L4AA 2LHIA 1OW4A 1JWDA 4IZNA 2VVHA 1HUYA 3LK1A 4XJKA 3WCKA 2LP3A 1MOUA 2GGZA 2P71A 4MLWA 3Q8IA 2O29A 1QYFA 1QV1A 2BCAA 3PIBA 2DD9A 4H48A 4PE0A 1U5IA 4W6PA 1PALA 4DXIA 2OTEA 2QLIA 3RZSA 2CBLA 2OTGC 3E5VA 2EGDA 1CB1A 1C3ZA 5EB7A 4W6LA 1F55A 1RWYA 5D7FA 1XO5A 2POXA 2KBIA 1IQ3A 1JBYA 2KQ6A 4HVFA 5AFPA 2R2IA 2IB6A 4NDDA 3SVDA 1G8IA 4W6MA 3B86A 4XJKB 5DKNA 3SG7A 1CFCA 4KA9A 1GQMA 2CCMA 2NLNA 1UHKA 1DJHA 2L2EA 3CD9A 1CFPA 3SVRA 3LK0A 5DTYA 2AWLA 1J7RA 1RFJA 1N2DA 2K60A 2Q91A 1CFDA 2H5RA 4BDUA 1S6CA 1XA5A 2G9BA 3S0GA 1NX1A 3ZULA 1NIWA 4XL5A 3TMTA 2E30A 2AUCA 1UHHA 3NF0A 3SVBA 4CIDA 4OR9B 2OTBA 4D1EA 2OTGB 3OSQA 3D74A 5EHUA 1FI5A 1OMVA 3OSRA 2OS8C 3U0KA 2JNXA 2ZNDA 3PLFB 2JXLA 2QT2A 3ZTFA 1UISA 5DPGA 4DXOA 1CM1A 1LXFC 4PHNA 3EVRA 2KFFA 3RWAA 1K9UA 2VADA 3EVVA 1MUXA 1NCXA 2IB5A 1MF8B 1S3PA 3BX9A 3CR5X 4YGDB 3DQDA 1XFYO 3RLZA 4HSZA 1F70A 2KYFA 3TS5B 2PXSA 4ORAB 5BPJA 1FF1A 1NYAA 4Q7RA 1TCOB 2ZRSA 2M29A 2EMOA 1TIZA 3M24A 5PALA 2P4MA 3NEZA 5LTRA 2QEVA 4KYNA 1ODBA 1A75A 3O2PA 2Y4QA 1UWOA 2OS8B 1NUBA 3SG2A 1F8HA 4DUQA 5D3OA 3BJHA 3B87A 3R1PA 2H9WA 2AH8A 2JT8A 4ZIOA 4XOWA 2L5YA 1R2UA 2L4HA 5FI6A 1DJWA 1RRXA 1YRUB 2H5QA 4MZKA 1EMKA 4UTSA 4GF6B 4KGEA 3VHTA 3JTDC 4Q04A 4CPVA 4TZAA 3E3RA 1J7QA 4ZCUA 4F0ZB 5AANA 1J1EA 2L0PA 2A52B 1OMRA 3F45A 4F7FA 4GAOA 3BFBA 3I5FC 1GGWA 4OGSA 1DJIA 2CT9A 1NCZA 5EXUA 4W6SA 5KTYA 2O5GA 1QASA 5HZSA 2O2BA 3CD1A 3ST4A 4GOBA 1NX3A 1F54A 3O77A 3CZ0A 3SG3A 4UPGA 2WURA 1A29A 3VICA 4OY4A 5HBDA 3OBVA 3SS4A 3D10A 5I2OA 2QDIA 4HQ9A 3VHTB 1Y0VH 2AWJA 2JULA 2WISA 1DMOA 1QYOA 3PJ7A 1JF0A 1DEKA 1XFVO 1E8AA 4LW5A 3BQ3A 4DRWA 4Q9XA 2QLEA 1OOJA 4WQ2A 4JRBA 1K9KA 3WXAA 3LSAA 3SSLA 2DD7A 2L5XB 5F6TA 2PRUA 1EXRA 2LLUA 1S1EA 3GK1A 4U8DA 1F4OA 3FWCA 5CPVA 2KI6C 5AEQA 4B30B 1Y1AA 2AAOA 2ISDA 3S0AA 3BUXB 4IK4A 3SG4A 3M0WA 1JBAA 3SSKA 2BNXA 2K7CA 3GEXA 4YBHB 3NSKA 4MZLA 3U8AA 2M49B 3TUYC 3LS3A 4L12A 2QPTA 3DVEA 2LAPA 2IE2A 1J1DA 3LVDA 1DVIA 3KCTA 5DPIA 2MHHA 1IJ5A 2BAPA 4QJ4B 3HX4A 3CFFA 1S36A 1KFUS 3CS1A 5HZUA 2KAYA 3EVUA 1CV7A 3N7HA 2DDDA 3AKBA 4HRGA 4M2QA 4W6UA 3SG5A 3CTNA 4GGFC 3IQQA 4ICBA 1EMEA 1QY3A 1K8UA 1HT9A 3I5IB 2QRFA 4DKNA 5K89A 1OOIX 3SSYA 1PVBA 3B6XA 4GGFA 2Y0GA 1SBJA 1OXFA 1QX7A 1RJVA 2EC6B 1MYWA 2M9GA 1XK4C 2MRDA 1YUUA 3DPWA 3K21A 5DTZA 1HCJA 1ZMZA 4C0JA 1EG4A 4LJBA 5FHVA 1XK4A 4J89A 3BUMB 3KCSA 3LA1A 2L2CA 2ZMWA 1DF0A 2FOTA 2G6YA 3DQ9A 2BBMA 2ICRA 1D1OA 3DQJA 1EL4A 5ER5A 3NHTA 1L7ZA 2KAVA 2AHAA 2LC5A 4INWA 1NP8A 4W7XA 3R1VA 4DXNA 2M7NA 2BL0B 1PK0D 1AUIB 4JQ0D 2CTNA 1B7TZ 4EDOA 2Z6ZA 3TDZA 4ETOA 2QLHA 3D78A 1B8LA 3M22A 2P6BB 5F9GA 2LE9B 3GL4A 3O6BA 4EN1A 1DC1A 3DQ4A 2LM5A 1SPYA 1H4UA 2QLGA 4YRUA 4PE7A 4AQIA 1N65A 4YI9A 4ORNA 4GBAA 3BOWB 4W6HA 3SS0A 5CSFA 5FVGA 1QIWA 4W6IA 1JF2A 2Y1NA 5DICA 1EMFA 3BUOB 3BXKA 2WCJA 3IP2A 1LVCD 3FIAA 2WNDA 1CNPA 4KAGA 5DKQA 4ZINA 3IF7A 1IG5A 2G3OA 4OHSA 2HGYA 2I7AA 4I5LB 1EG3A 1S26D 1L2OC 1XFZO 2K7BA 2LNKA 3S0BA 4TZGA 3MGFA 3U0LA 5DQMA 2LUCA 3B7AA 1YUSA 3VK1A 2BE4A 2JU0A 4I5NB 2AMIA 2CXJA 1JC0A 4DS7A 1SMGA 1TUJA 3DQ3A 2WCBA 1SR6C 5I2LA 4NDCA 1PULA 1EMMA 1K96A 5LTPA 1TN4A 2YE0A 3OX5A 5B8IB 3AKAA 2VVJA 2G6XA 5FI7A 3NHIA 2HGDA 2PMYA 1FBVA 2MLEC 2WCFA 1M63B 4A4BA 4PDZA 3ICBA 1KCYA 4AS8A 5JOLA 3DQEA 5HGEA 4OKHA 2PALA 2ZFDA 3KPXA 1DJGA 1EH2A 2WC6A 1QYQA 2DUHA 1AJ4A 2PYQA 4PCWA 4EDSA 2H8QA 4IK3A 4W6BA 3D73A 3SS3A 4J8AA 3W1CA 3L47A 1G4YR 2JPOA 2LMTA 2KQYA 1OSAA 2HPSA 2WHTA 2V4EC 5HKWA 3SIAA 3SSPA 5H88A 3AI5A 2WCLA 1OZOA 4EULA 3DQLA 3SRYA 1S5GY 2MA2A 2V4EA 1Q4BA 3JVTB 3TDIA 1UHIA 3DXLA 4U2VA 1FW4A 2ZMUA 4MBEA 1RK9A 1OOGA 5IBWA 2Q4UA 2OGRA 5EXBA 1SR6B 3CGAA 1BMOA 3EK8A 4PE1A 2Y5IA 4H3NA 1TWOA 3NXAA 1RROA 3DYEA 4YGAA 1KWOC 2I2RE 1U5IB 1QJTA 1C3YA 3CBEA 2KPHA 4XYNA 1SNLA 3GOFA 1QS7A 2WHUA 3NGVA 4DXPA 1KQMC 4B5YA 2A56B 4JWQA 3NSOA 1QXTA 2VAEA 2MLFC 1DJXA 5DTXA 4ZF3A 2IS9A 3WHUB 1LS8A 3WNXB 2WIQA 1B1GA 3CLNA 3LF3A 1NSHA 2C9IA 1TCFA 1V1FA 2EMDA 1YR5A 4ZFSA 1SYMA 1ZOTB 1MHOA 1A03A 2V4EB 3BXCA 1MR8A 4QJ3B 2AWKA 2CNPA 1EMCA 1QWVA 2H8VA 1GGXA 5H87A 1CMFA 2H5OA 1XYDA 3FE9A 4AQJA 4GESB 3IVTA 3ZUFA 3CZTX 2KNEA 1QV0A 4W6JA 1YHHA 1RMOA 1KK8C 2V53A 3SVOA 3I5HC 3NSLA 1EMBA 2VVIA 1ZACA 1BR4B 4W7RA 4NQGA 1Y1XA 1B9CA 1K9PA 2KSPA 1SKTA 3TZ1A 4N1FA 3D76A 2H2KA 1JBZA 1H8BA 1CDMA 2WC8A 1KYSA 1Z1PA 1OXEA 1WRKA 2KLDA 1XAEA 4J88A 1J7OA 2BCBA 4Q7TA 2L50A 2GTEA 1J7PA 1SL8A 5I8NA 1F09A 3E5TA 4MEWA 1QX2A 1PSBA 1CTRA 2YGUA 4OJ0A 1BR1B 3S0EA 2JTTA 5BTTA 1QIVA 5CSNA 2KLEA 4LJDC 3GK4X 4YGCB 1P28A 1IIOA 2EHBA 1KK8B 2DOQA 2JXCA 1DELA 4P1QA 4PHMA 3I5HB 4YGBB 1ZUZA 1B9AA 4LJDA 5GQQC 2K7DA 3BFAA 1QATA 2WHSA 2G5ZB 4OCIA 1VRKA 1MOVA 4W7DA 3GJ2A 1OXDA 2A47A 1QX5B 1ZFSA 4R6DA 1S6ZA 1V1GA 1XFWO 5J2OA 2ZN8A 2DUFA 3K1EA 5BQLA 2PQLA 1H4BA 2LMVA 3K1KA 4KW8A 1GL4A 1A75B 1AJ5A 1G33A 2KFGA 3CFHA 1UUSA 3SVNA 1SCVA 5JJGA 3IQOA 1DGUA 1LA3A 1K90D 4ZBLA 3DQIA 1BFPA 3OGOA 4ZB1A 1DQEA 5EJUA 2F33A 1ALVA 1KK7Y 1DTLA 2SASA 1ORGA 3SVEA 5AERA 1TOPA 1IH0A 4HREE 2L51A 2FJUB 2F2PA 5KTGA 2HFCA 3LCPC 1B47A 2ZO6A 2QZ0A 3JTDB 3VRNA 2DUIA 1K2HA 1ZGPA 1F0BA 5HLVA 1N0YA 3GK2A 1JUOA 1LKJA 4W76A 4DCKA 4H3MA 2KI6D 1JFJA 3DQ2A 3DQHA 4W6KA 2B3PA 3I5FB 4ORBB 2ARLA 1SCMC 3AI4A 3DVJA 1Z4HA 2KYCA 1TUZA 2HJOA 3I19A 1IJ6A 3NT3A 1BJFA 2HF5A 4BY4A 2OJKA 1Q4DA 3WLDA 1CM4A 4MRXA 2FL1A 3UNWA 2YE1A 2LVVA 4MSPA 5DY6A 2JWWA 4KF5C 2HQKA 2WC5A 1YZWA 1IGVA 2ZKMX 2ZRTA 2C9JA 1YRTB 5H89A 1BG1A 4KF5A 4KEXA 2MJWB 2M97A 2KAXA 4N3DA 4QJ5B 3DF0A 1QVIY 5KU1A 2EMNA 4HQCA 2LP2A 1Q80A 1WDCC 1Z2CB 1DGVA 1KYRA 1DT7B 2A46A 3PALA 1AHRA 2BCXA 1EMGA 3BXAA 2NCOA 3DQAA 2VZXA 2O60A 3V2LA 4WQ3A 4YGEB 1Q4EA 4W6NA 1SCMB 3DQKA 3VRQA 3PN7C 3G9AA 1EMLA 2KFHA 2G2BA 1CDPA 1PRWA 1KYPA 4CLNA 2F3YA 1PVAA 1KP5A 1IRJA 3CDNA 3E5WA 3ED8A 2WORA 1C7VA 1QLKA 4XVPA 2ZNEA 3TUYB 2LMUA 3DF0B 3NEDA 4P76A 2HPWA 5FI2A 3ST2A 4FQTA 4OV2A 4FTGA 1YFPA 1TNQA 1A4PA 2LANA 3BFHA 3BUWB 2F3ZA 1CDNA 2M8UA 1CLMA 4W72A 1SW8A 1WDCB 2MBXA 1OE9B 1SSEB 1YUTA 4PFEA 4ZCVA 1GJYA 3FE8A 3GB3A 4OQWA 3PN7B 4JD9A 5FVFA 4FQOA 2D8NA 3SSTA 4W6CA 1YTZC 4KW4A 1SL9A 1TTXA 1LINA 2OKYA 5DRGA 3CR2A 3DZTA 1ZGQA 1DF0B 1IKUA 1F4QA 1XQMA 5HKZA 1YJ2A 2MAZA 2H5PA 4EMQA 1OZSA 4W6TA 1M39A 4IK5A 2Q57A 2K8MB 3EKHA 1ALWA 1KFUL 3EVPA 3CZ2A 5HZOA 3P8UA 1S5GZ 1YHIA 2HRSA 2JT0A 1K93D 3EK7A 2WCHA 5ER4X 4KF4A 3AKOA 3KEVA 4TNCA 2QACA 2Q6PA 2QLGB 2AWMA 1W7SA 3KF9A 4JFGA 4GPLB 5EB6A 3LVCA 2G6EA 1MQ1A 4JF9A 4W6FA 1MXEA 2JQ6A 3U8PA 4R1EA 2PXWA 3DQ7A 1Z1QA 5HYDA 4W7FA 4MN0A 1K95A 1PSRA 3CR4X 2WSOA 2ZO7A 3SS5A 5I94A 3IR8A 4W69A 3OP0A 1DJYA 1KSMA 2TN4A 4PPLA 4JEOA 5AXIA 2KI4C 3RWTA 4ZF5A 4AR7A 2Z1OA 4DXQA 1L2OB 2RGIA 3H4SE 1Q4AA 4IK8A 4RYWA 1NX2A 1AK8A 1EJ3A 1CLBA 4DIRA 1Y1UA 3DQMA 2H6VA 1M46A 2YDZA 3AAJA 2NXQA 2OKWA 4PALA 2FWQA 3ZUJA 1TNXA 4W6GA 2A50B 5CSJA 2WCMA 4P5OE 1YURA 4PHJA 2BTJA 1BU3A 1CMGA 4I5JA 1UHNA 2I94A 4Q7UA 4Q9WA 1T14A 2DUGA 2RH7A 3CZ1A 2GX2A 1CFFA 2KOTA 1SK6D 2LLTA 3VRRA 2GX0A 3LL8B 4L9MA 1JC2A 3DPZA 3OHMB 4GFTA 1YHGA 1QTXA
chains in the Genus database with same CATH topology
2NCPA 4LQTA 3TS5C 1SL7A 5KSZA 3DQ6A 2KI4B 3DD4A 4W6AA 3ZWHA 1W7IB 1WRLA 2KHNA 3U8CA 4KGFA 2M1KB 1XVJA 5FVIA 1HQVA 2PSRA 4A4CA 2JT3A 2SCPA 4HRHA 1RTP1 2NZ0A 4W73A 5HLOA 3LF4B 3PSRA 2F8PA 3W1DA 4MVFA 5DKRA 3DQFA 2K2FA 4W74A 4ANJA 2LHLA 4W77A 1W7UA 1B8RA 3OX6A 4W6OA 1AVSA 3ST0A 2LUXA 2G3DB 1KWOB 5HW9A 1R6PA 2GW4B 5TNCA 2A48A 3QRXA 1F71A 1KFXS 3ZNIA 1KQMB 5AQBB 2JRFA 1OMDA 1EMAA 2BECA 4W6DA 4Z4KA 4I5KA 2O24A 1SY9A 5DTLA 4YI8A 2HQ8A 3SJSA 2ZN9A 2YFPA 4N1GA 2Z6YA 3SSHA 2GGMA 4JGEA 1XFUO 3DQNA 4USLA 3NSIA 3SVUA 3FWBA 1KK7Z 1WLMA 1OQPA 5FYXA 3SSVA 3DQCA 1XA9A 5DPJA 3NT9A 1TRFA 4WRIA 1YX7A 1BODA 5CSIA 2JNFA 2IOVA 3EKJA 1Q4CA 2LLSA 4GGNA 4GUKA 4NWSA 3O78A 3C1VA 2WSNA 3A4UB 4N5XA 1BLQA 3DVKA 2LVJA 2LVIA 1C07A 2B3QA 3V3DA 2Z6XA 1NWDA 4I2YA 1BT6A 4LQUA 1S6JA 2LVKA 2L4IA 4AOMA 2WOSA 2LV7A 4NDBA 4HE4A 4PPKA 2A54B 3TMRA 5D69A 1MWNA 1QXPA 1XMZA 1YX8A 3SV5A 4JPZB 4BY5A 1W7TA 1RMPA 5BTTB 2WCEA 3KHEA 5HKYA 3BYAA 2I18A 1ZUXA 2K61A 3D0YA 1H6RA 3P28A 4RYSA 2QU1A 3PATA 4DXMA 4W7EA 2FCDA 4RTCA 4E68A 2G2SB 4B30A 4ZF4A 2GV5A 1JC1A 1RMMA 5LK4A 1ZGOA 1W7JB 1QVIZ 3DQUA 4R6BA 5HZTA 1UHJA 2LCPA 4W6RA 2K2AA 4C0LA 1KFXL 4LJCA 2JZIA 3CFAA 4P2YB 1JSAA 4W7AA 4M2PA 2OPOA 4Z4MA 4CFRA 4IL1A 1CKKA 2HQZA 4MZJA 1KQVA 3GJ1A 3MSEB 2A4JA 1NCYA 3VRPA 4KW9A 3I5IC 3DQOA 3SVSA 3D0YB 2PVBA 1MXLC 4H47A 4IK1A 3BUNB 4H3LA 3VROA 2K7OA 3A8RA 2EC6C 2PASA 3DVMA 1KSOA 1LA0A 3PM8A 3SG6A 1CLLA 4W75A 3HCMA 3SVCA 2F2OA 2Y1MA 2B1UA 2HQWA 2M7LA 2KDHA 3FS7A 2DUEA 2E6WA 2BKHB 1QLSA 2HCGA 1M45A 1K94A 2L98A 1XFXO 1YJFA 4HQ8A 2BBNA 3A8SA 1AP4A 3VGOA 5LTQA 2VRGA 2JADA 2M1UA 2JOJA 2BL0C 3OB2B 3DQ1A 1B8CA 2KBMA 2GW3A 1IQ5A 1FPWA 1TNPA 1NX0A 1UURA 1WLZA 4PE4A 3UG0A 3EK4A 5DPHA 4L1IA 4IK9A 3H1RA 1YVLA 1WRZA 1Y6WA 2COLB 1RM9A 2DDCA 1Q73A 3O4YA 2BKIB 1S6IA 3KO0A 2M3WA 2G16B 2K0JA 3DPXA 2JPTA 3I5GC 1YVHA 4PPJA 4XOVA 2BE6A 3BOWA 1RECA 5T3IA 3ADFA 5BT0A 4GNKB 1C7WA 5DU0A 1C4FA 3ST3A 1BOCA 1SRAA 4PHKA 1NPQA 1XSSA 3PFVA 4JC2A 1J55A 5I2QA 2A53B 1G7KA 3H1OA 4M2OA 1X02A 3WHTB 5G08A 1GFLA 3CGLA 2HETA 4XGYA 2JC2A 2FZUA 3SIBA 1TNWA 4ORCB 3LVAA 1DJZA 1GGZA 3U0MA 3BXBA 5DRFA 1JFKA 3OB1B 4KPIA 3PJ5A 2H61C 1M31A 3I5GB 3DQ8A 4OVNF 2H61A 4C0KA 1IWQA 3CWGA 3WLCA 3DQ5A 5EXCI 2KGRA 3PJBA 1BF5A 3TDUA 1A2XA 1CDLA 3S05A 3U0NA 1FI6A 4W7CA 3RM1A 5DQBA 2KGBC 4L13A 3UFZA 1B4CA 2JTZA 1UP5A 5J3XA 1WY9A 3JVTC 3CB9A 4DKMA 4MRYA 3AAKA 5EBJA 1B7TY 2M0RA 4CFQA 3LLEA 2FCEA 2LHIA 1JWDA 4IZNA 2VVHA 1HUYA 3LK1A 4XJKA 3WCKA 2LP3A 1MOUA 2GGZA 4MLWA 2O29A 1QYFA 1QV1A 2BCAA 3PIBA 2DD9A 4H48A 4PE0A 1U5IA 4W6PA 1PALA 4DXIA 2OTEA 2QLIA 2CBLA 2OTGC 3E5VA 2EGDA 1CB1A 5EB7A 4W6LA 1F55A 1RWYA 5D7FA 1XO5A 2POXA 2KBIA 1IQ3A 1JBYA 2KQ6A 4HVFA 5AFPA 2R2IA 2IB6A 4NDDA 3SVDA 1G8IA 4W6MA 3SG7A 4XJKB 5DKNA 1CFCA 4KA9A 1GQMA 2CCMA 2NLNA 1UHKA 1DJHA 2L2EA 3CD9A 1CFPA 3SVRA 3LK0A 5DTYA 2AWLA 1J7RA 1RFJA 1N2DA 2Q91A 1CFDA 2H5RA 4BDUA 1S6CA 1XA5A 2G9BA 1NX1A 3ZULA 1NIWA 4XL5A 3TMTA 2E30A 2AUCA 1UHHA 3NF0A 3SVBA 4CIDA 4OR9B 2OTBA 4D1EA 2OTGB 3OSQA 5EHUA 1FI5A 1OMVA 3OSRA 2OS8C 3U0KA 2JNXA 2ZNDA 3PLFB 2JXLA 2QT2A 3ZTFA 1UISA 5DPGA 4DXOA 1CM1A 1LXFC 4PHNA 3EVRA 2KFFA 3RWAA 1K9UA 2VADA 3EVVA 1MUXA 1NCXA 2IB5A 1MF8B 1S3PA 3BX9A 3CR5X 4YGDB 3DQDA 1XFYO 3RLZA 4HSZA 1F70A 2KYFA 3TS5B 2PXSA 4ORAB 5BPJA 1FF1A 1NYAA 4Q7RA 1TCOB 2ZRSA 2M29A 2EMOA 1TIZA 3M24A 5PALA 2P4MA 3NEZA 5LTRA 1ODBA 1A75A 3O2PA 2Y4QA 1UWOA 2OS8B 1NUBA 3SG2A 1F8HA 4DUQA 2H9WA 2AH8A 2JT8A 4ZIOA 4XOWA 1R2UA 2L4HA 1DJWA 1RRXA 1YRUB 2H5QA 4MZKA 1EMKA 4UTSA 4GF6B 4KGEA 3VHTA 3JTDC 4Q04A 4CPVA 4TZAA 3E3RA 1J7QA 4ZCUA 4F0ZB 5AANA 1J1EA 2L0PA 2A52B 1OMRA 3F45A 4GAOA 3I5FC 1GGWA 4OGSA 1DJIA 2CT9A 1NCZA 5EXUA 4W6SA 5KTYA 2O5GA 1QASA 5HZSA 2O2BA 3CD1A 3ST4A 4GOBA 1NX3A 1F54A 3O77A 3SG3A 4UPGA 2WURA 1A29A 3VICA 4OY4A 5HBDA 3D10A 5I2OA 4HQ9A 3VHTB 1Y0VH 2AWJA 2JULA 2WISA 1DMOA 1QYOA 3PJ7A 1JF0A 1XFVO 1E8AA 4LW5A 3BQ3A 4DRWA 4Q9XA 2QLEA 1OOJA 4WQ2A 4JRBA 1K9KA 3WXAA 3LSAA 3SSLA 2DD7A 2L5XB 5F6TA 2PRUA 1EXRA 2LLUA 1S1EA 3GK1A 4U8DA 1F4OA 3FWCA 5CPVA 2KI6C 5AEQA 4B30B 1Y1AA 2AAOA 2ISDA 3BUXB 4IK4A 3SG4A 3M0WA 1JBAA 3SSKA 2K7CA 3GEXA 4YBHB 3NSKA 4MZLA 3U8AA 2M49B 3TUYC 3LS3A 4L12A 2QPTA 3DVEA 2LAPA 2IE2A 1J1DA 3LVDA 1DVIA 3KCTA 5DPIA 2MHHA 1IJ5A 4QJ4B 3HX4A 3CFFA 1S36A 1KFUS 3CS1A 5HZUA 2KAYA 3EVUA 1CV7A 2DDDA 3AKBA 4HRGA 4M2QA 4W6UA 3SG5A 3CTNA 4GGFC 3IQQA 4ICBA 1EMEA 1QY3A 1K8UA 1HT9A 3I5IB 2QRFA 4DKNA 5K89A 3SSYA 1PVBA 4GGFA 2Y0GA 1SBJA 1OXFA 1QX7A 1RJVA 2EC6B 1MYWA 2M9GA 1XK4C 2MRDA 1YUUA 3DPWA 3K21A 5DTZA 1HCJA 1ZMZA 4C0JA 1EG4A 4LJBA 5FHVA 1XK4A 4J89A 3BUMB 3KCSA 3LA1A 2ZMWA 1DF0A 2FOTA 2G6YA 3DQ9A 2BBMA 2ICRA 1D1OA 3DQJA 1EL4A 5ER5A 1L7ZA 2KAVA 2AHAA 2LC5A 1NP8A 4W7XA 4DXNA 2M7NA 2BL0B 1PK0D 1AUIB 4JQ0D 2CTNA 1B7TZ 4EDOA 2Z6ZA 3TDZA 4ETOA 2QLHA 3M22A 1B8LA 2P6BB 5F9GA 2LE9B 3GL4A 3O6BA 4EN1A 3DQ4A 2LM5A 1SPYA 1H4UA 2QLGA 4YRUA 4PE7A 4AQIA 1N65A 4YI9A 4ORNA 4GBAA 3BOWB 4W6HA 3SS0A 5CSFA 5FVGA 1QIWA 4W6IA 1JF2A 2Y1NA 1EMFA 3BUOB 3BXKA 3IP2A 1LVCD 3FIAA 2WNDA 1CNPA 4KAGA 5DKQA 4ZINA 3IF7A 1IG5A 2G3OA 4OHSA 2HGYA 2I7AA 4I5LB 1EG3A 1S26D 1L2OC 1XFZO 2K7BA 2LNKA 4TZGA 3MGFA 3U0LA 5DQMA 2LUCA 1YUSA 3VK1A 2BE4A 2JU0A 4I5NB 2AMIA 2CXJA 1JC0A 4DS7A 1SMGA 3DQ3A 2WCBA 1SR6C 5I2LA 4NDCA 1PULA 1EMMA 1K96A 5LTPA 1TN4A 2YE0A 3OX5A 5B8IB 3AKAA 2VVJA 2G6XA 2HGDA 2PMYA 1FBVA 2MLEC 2WCFA 1M63B 4A4BA 4PDZA 3ICBA 1KCYA 4AS8A 5JOLA 3DQEA 5HGEA 4OKHA 2PALA 2ZFDA 3KPXA 1DJGA 1EH2A 2DUHA 1QYQA 1AJ4A 4PCWA 4EDSA 2H8QA 4IK3A 4W6BA 4J8AA 3W1CA 1G4YR 2LMTA 2KQYA 1OSAA 2HPSA 2WHTA 2V4EC 5HKWA 3SIAA 3SSPA 5H88A 3AI5A 1OZOA 4EULA 3DQLA 3SRYA 1S5GY 2MA2A 2V4EA 1Q4BA 3JVTB 3TDIA 1UHIA 4U2VA 1FW4A 2ZMUA 4MBEA 1RK9A 5IBWA 2Q4UA 2OGRA 5EXBA 1SR6B 3CGAA 1BMOA 3EK8A 4PE1A 2Y5IA 4H3NA 3NXAA 1RROA 4YGAA 1KWOC 2I2RE 1U5IB 1QJTA 3CBEA 4XYNA 1SNLA 3GOFA 1QS7A 2WHUA 4DXPA 1KQMC 4B5YA 2A56B 4JWQA 3NSOA 1QXTA 2VAEA 2MLFC 1DJXA 5DTXA 4ZF3A 2IS9A 3WHUB 3WNXB 2WIQA 1B1GA 3CLNA 3LF3A 1NSHA 2C9IA 1TCFA 1V1FA 2EMDA 1YR5A 4ZFSA 1SYMA 1ZOTB 1MHOA 1A03A 2V4EB 3BXCA 1MR8A 4QJ3B 2AWKA 2CNPA 1EMCA 1GGXA 5H87A 1CMFA 2H5OA 1XYDA 4AQJA 4GESB 3ZUFA 4W6JA 3CZTX 2KNEA 1QV0A 1YHHA 1RMOA 1KK8C 2V53A 3SVOA 3I5HC 3NSLA 1EMBA 2VVIA 1ZACA 1BR4B 4W7RA 4NQGA 1Y1XA 1B9CA 1K9PA 2KSPA 1SKTA 3TZ1A 4N1FA 2H2KA 1JBZA 1H8BA 1CDMA 2WC8A 1KYSA 1Z1PA 1OXEA 1WRKA 1XAEA 4J88A 1J7OA 2BCBA 4Q7TA 2L50A 1J7PA 1SL8A 5I8NA 1F09A 3E5TA 4MEWA 1QX2A 1PSBA 1CTRA 4OJ0A 1BR1B 2JTTA 5BTTA 1QIVA 5CSNA 4LJDC 3GK4X 4YGCB 2EHBA 1KK8B 2DOQA 2JXCA 4P1QA 4PHMA 3I5HB 4YGBB 1ZUZA 1B9AA 4LJDA 5GQQC 2K7DA 1QATA 2WHSA 2G5ZB 4OCIA 1VRKA 1MOVA 4W7DA 3GJ2A 1OXDA 2A47A 1QX5B 1ZFSA 4R6DA 1S6ZA 1V1GA 1XFWO 5J2OA 2ZN8A 2DUFA 5BQLA 1H4BA 2LMVA 3K1KA 4KW8A 1GL4A 1A75B 1AJ5A 1G33A 2KFGA 3CFHA 1UUSA 3SVNA 1SCVA 5JJGA 3IQOA 1DGUA 1LA3A 1K90D 4ZBLA 3DQIA 1BFPA 3OGOA 4ZB1A 5EJUA 2F33A 1ALVA 1KK7Y 1DTLA 2SASA 3SVEA 5AERA 1TOPA 1IH0A 4HREE 2L51A 2FJUB 2F2PA 5KTGA 2HFCA 3LCPC 1B47A 2ZO6A 2QZ0A 3JTDB 3VRNA 2DUIA 1K2HA 1ZGPA 1F0BA 5HLVA 1N0YA 3GK2A 1JUOA 1LKJA 4W76A 4DCKA 4H3MA 2KI6D 1JFJA 3DQ2A 3DQHA 4W6KA 2B3PA 3I5FB 4ORBB 2ARLA 1SCMC 3AI4A 3DVJA 2KYCA 2HJOA 3I19A 1IJ6A 3NT3A 1BJFA 2HF5A 4BY4A 2OJKA 1Q4DA 3WLDA 1CM4A 4MRXA 2FL1A 2YE1A 2LVVA 4MSPA 5DY6A 2JWWA 4KF5C 2HQKA 1YZWA 1IGVA 2ZKMX 2ZRTA 2C9JA 1YRTB 5H89A 1BG1A 4KF5A 4KEXA 2MJWB 2M97A 2KAXA 4N3DA 4QJ5B 3DF0A 1QVIY 5KU1A 2EMNA 4HQCA 2LP2A 1Q80A 1WDCC 1DGVA 1KYRA 1DT7B 2A46A 3PALA 2BCXA 1AHRA 1EMGA 3BXAA 2NCOA 3DQAA 2VZXA 2O60A 4WQ3A 4YGEB 1Q4EA 4W6NA 1SCMB 3DQKA 3VRQA 3PN7C 3G9AA 1EMLA 2KFHA 2G2BA 1CDPA 1PRWA 1KYPA 4CLNA 2F3YA 1PVAA 1KP5A 1IRJA 3E5WA 3ED8A 2WORA 1C7VA 1QLKA 4XVPA 2ZNEA 3TUYB 2LMUA 3NEDA 3DF0B 4P76A 2HPWA 3ST2A 4OV2A 4FTGA 1YFPA 1TNQA 1A4PA 2LANA 3BUWB 2F3ZA 1CDNA 2M8UA 1CLMA 4W72A 1SW8A 1WDCB 2MBXA 1OE9B 1YUTA 4PFEA 4ZCVA 1GJYA 3GB3A 4OQWA 3PN7B 5FVFA 4FQOA 2D8NA 3SSTA 4W6CA 1YTZC 4KW4A 1SL9A 1TTXA 1LINA 2OKYA 5DRGA 3CR2A 1ZGQA 1DF0B 1IKUA 1F4QA 1XQMA 5HKZA 1YJ2A 2MAZA 2H5PA 4EMQA 1OZSA 4W6TA 1M39A 4IK5A 2Q57A 2K8MB 3EKHA 1ALWA 1KFUL 3EVPA 5HZOA 3P8UA 1S5GZ 1YHIA 2HRSA 2JT0A 1K93D 3EK7A 5ER4X 4KF4A 3AKOA 3KEVA 4TNCA 2QACA 2Q6PA 2QLGB 2AWMA 1W7SA 3KF9A 4JFGA 4GPLB 5EB6A 3LVCA 2G6EA 1MQ1A 4JF9A 4W6FA 1MXEA 2JQ6A 3U8PA 4R1EA 2PXWA 3DQ7A 1Z1QA 5HYDA 4W7FA 4MN0A 1K95A 1PSRA 3CR4X 2WSOA 2ZO7A 3IR8A 4W69A 3OP0A 1DJYA 1KSMA 2TN4A 4PPLA 4JEOA 5AXIA 2KI4C 3RWTA 4ZF5A 4AR7A 2Z1OA 4DXQA 1L2OB 2RGIA 3H4SE 1Q4AA 4IK8A 4RYWA 1NX2A 1AK8A 1EJ3A 1CLBA 4DIRA 1Y1UA 3DQMA 2H6VA 1M46A 2YDZA 3AAJA 2NXQA 2OKWA 4PALA 2FWQA 3ZUJA 1TNXA 4W6GA 2A50B 5CSJA 4P5OE 1YURA 4PHJA 2BTJA 1BU3A 1CMGA 4I5JA 1UHNA 2I94A 4Q7UA 4Q9WA 2DUGA 2RH7A 2GX2A 1CFFA 2KOTA 1SK6D 2LLTA 3VRRA 2GX0A 3LL8B 4L9MA 1JC2A 3DPZA 3OHMB 4GFTA 1YHGA 1QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCP A;  4LQT A;  3TS5 C;  1SL7 A;  5KSZ A;  3DQ6 A;  2KI4 B;  3DD4 A;  4W6A A;  3ZWH A;  1W7I B;  1WRL A;  2KHN A;  3U8C A;  4KGF A;  2M1K B;  1XVJ A;  5FVI A;  1HQV A;  2PSR A;  4A4C A;  2JT3 A;  2SCP A;  4HRH A;  1RTP 1;  2NZ0 A;  4W73 A;  5HLO A;  3LF4 B;  3PSR A;  2F8P A;  3W1D A;  4MVF A;  5DKR A;  3DQF A;  2K2F A;  4W74 A;  4ANJ A;  2LHL A;  4W77 A;  1W7U A;  1B8R A;  3OX6 A;  4W6O A;  1AVS A;  3ST0 A;  2LUX A;  2G3D B;  1KWO B;  5HW9 A;  1R6P A;  2GW4 B;  5TNC A;  2A48 A;  3QRX A;  1F71 A;  1KFX S;  3ZNI A;  1KQM B;  5AQB B;  2JRF A;  1OMD A;  1EMA A;  2BEC A;  4W6D A;  4Z4K A;  4I5K A;  2O24 A;  1SY9 A;  5DTL A;  4YI8 A;  2HQ8 A;  3SJS A;  2ZN9 A;  2YFP A;  4N1G A;  2Z6Y A;  3SSH A;  2GGM A;  4JGE A;  1XFU O;  3DQN A;  4USL A;  3NSI A;  3SVU A;  3FWB A;  1KK7 Z;  1WLM A;  1OQP A;  5FYX A;  3SSV A;  3DQC A;  1XA9 A;  5DPJ A;  3NT9 A;  1TRF A;  4WRI A;  1YX7 A;  1BOD A;  5CSI A;  2JNF A;  2IOV A;  3EKJ A;  1Q4C A;  2LLS A;  4GGN A;  4GUK A;  4NWS A;  3O78 A;  3C1V A;  2WSN A;  3A4U B;  4N5X A;  1BLQ A;  3DVK A;  2LVJ A;  2LVI A;  1C07 A;  2B3Q A;  3V3D A;  2Z6X A;  1NWD A;  4I2Y A;  1BT6 A;  4LQU A;  1S6J A;  2LVK A;  2L4I A;  4AOM A;  2WOS A;  2LV7 A;  4NDB A;  4HE4 A;  4PPK A;  2A54 B;  3TMR A;  5D69 A;  1MWN A;  1QXP A;  1XMZ A;  1YX8 A;  3SV5 A;  4JPZ B;  4BY5 A;  1W7T A;  1RMP A;  5BTT B;  2WCE A;  3KHE A;  5HKY A;  3BYA A;  2I18 A;  1ZUX A;  2K61 A;  3D0Y A;  1H6R A;  3P28 A;  4RYS A;  2QU1 A;  3PAT A;  4DXM A;  4W7E A;  2FCD A;  4RTC A;  4E68 A;  2G2S B;  4B30 A;  4ZF4 A;  2GV5 A;  1JC1 A;  1RMM A;  5LK4 A;  1ZGO A;  1W7J B;  1QVI Z;  3DQU A;  4R6B A;  5HZT A;  1UHJ A;  2LCP A;  4W6R A;  2K2A A;  4C0L A;  1KFX L;  4LJC A;  2JZI A;  3CFA A;  4P2Y B;  1JSA A;  4W7A A;  4M2P A;  2OPO A;  4Z4M A;  4CFR A;  4IL1 A;  1CKK A;  2HQZ A;  4MZJ A;  1KQV A;  3GJ1 A;  3MSE B;  2A4J A;  1NCY A;  3VRP A;  4KW9 A;  3I5I C;  3DQO A;  3SVS A;  3D0Y B;  2PVB A;  1MXL C;  4H47 A;  4IK1 A;  3BUN B;  4H3L A;  3VRO A;  2K7O A;  3A8R A;  2EC6 C;  2PAS A;  3DVM A;  1KSO A;  1LA0 A;  3PM8 A;  3SG6 A;  1CLL A;  4W75 A;  3HCM A;  3SVC A;  2F2O A;  2Y1M A;  2B1U A;  2HQW A;  2M7L A;  2KDH A;  3FS7 A;  2DUE A;  2E6W A;  2BKH B;  1QLS A;  2HCG A;  1M45 A;  1K94 A;  2L98 A;  1XFX O;  1YJF A;  4HQ8 A;  2BBN A;  3A8S A;  1AP4 A;  3VGO A;  5LTQ A;  2VRG A;  2JAD A;  2M1U A;  2JOJ A;  2BL0 C;  3OB2 B;  3DQ1 A;  1B8C A;  2KBM A;  2GW3 A;  1IQ5 A;  1FPW A;  1TNP A;  1NX0 A;  1UUR A;  1WLZ A;  4PE4 A;  3UG0 A;  3EK4 A;  5DPH A;  4L1I A;  4IK9 A;  3H1R A;  1YVL A;  1WRZ A;  1Y6W A;  2COL B;  1RM9 A;  2DDC A;  1Q73 A;  3O4Y A;  2BKI B;  1S6I A;  3KO0 A;  2M3W A;  2G16 B;  2K0J A;  3DPX A;  2JPT A;  3I5G C;  1YVH A;  4PPJ A;  4XOV A;  2BE6 A;  3BOW A;  1REC A;  5T3I A;  3ADF A;  5BT0 A;  4GNK B;  1C7W A;  5DU0 A;  1C4F A;  3ST3 A;  1BOC A;  1SRA A;  4PHK A;  1NPQ A;  1XSS A;  3PFV A;  4JC2 A;  1J55 A;  5I2Q A;  2A53 B;  1G7K A;  3H1O A;  4M2O A;  1X02 A;  3WHT B;  5G08 A;  1GFL A;  3CGL A;  2HET A;  4XGY A;  2JC2 A;  2FZU A;  3SIB A;  1TNW A;  4ORC B;  3LVA A;  1DJZ A;  1GGZ A;  3U0M A;  3BXB A;  5DRF A;  1JFK A;  3OB1 B;  4KPI A;  3PJ5 A;  2H61 C;  1M31 A;  3I5G B;  3DQ8 A;  4OVN F;  2H61 A;  4C0K A;  1IWQ A;  3CWG A;  3WLC A;  3DQ5 A;  5EXC I;  2KGR A;  3PJB A;  1BF5 A;  3TDU A;  1A2X A;  1CDL A;  3S05 A;  3U0N A;  1FI6 A;  4W7C A;  3RM1 A;  5DQB A;  2KGB C;  4L13 A;  3UFZ A;  1B4C A;  2JTZ A;  1UP5 A;  5J3X A;  1WY9 A;  3JVT C;  3CB9 A;  4DKM A;  4MRY A;  3AAK A;  5EBJ A;  1B7T Y;  2M0R A;  4CFQ A;  3LLE A;  2FCE A;  2LHI A;  1JWD A;  4IZN A;  2VVH A;  1HUY A;  3LK1 A;  4XJK A;  3WCK A;  2LP3 A;  1MOU A;  2GGZ A;  4MLW A;  2O29 A;  1QYF A;  1QV1 A;  2BCA A;  3PIB A;  2DD9 A;  4H48 A;  4PE0 A;  1U5I A;  4W6P A;  1PAL A;  4DXI A;  2OTE A;  2QLI A;  2CBL A;  2OTG C;  3E5V A;  2EGD A;  1CB1 A;  5EB7 A;  4W6L A;  1F55 A;  1RWY A;  5D7F A;  1XO5 A;  2POX A;  2KBI A;  1IQ3 A;  1JBY A;  2KQ6 A;  4HVF A;  5AFP A;  2R2I A;  2IB6 A;  4NDD A;  3SVD A;  1G8I A;  4W6M A;  3SG7 A;  4XJK B;  5DKN A;  1CFC A;  4KA9 A;  1GQM A;  2CCM A;  2NLN A;  1UHK A;  1DJH A;  2L2E A;  3CD9 A;  1CFP A;  3SVR A;  3LK0 A;  5DTY A;  2AWL A;  1J7R A;  1RFJ A;  1N2D A;  2Q91 A;  1CFD A;  2H5R A;  4BDU A;  1S6C A;  1XA5 A;  2G9B A;  1NX1 A;  3ZUL A;  1NIW A;  4XL5 A;  3TMT A;  2E30 A;  2AUC A;  1UHH A;  3NF0 A;  3SVB A;  4CID A;  4OR9 B;  2OTB A;  4D1E A;  2OTG B;  3OSQ A;  5EHU A;  1FI5 A;  1OMV A;  3OSR A;  2OS8 C;  3U0K A;  2JNX A;  2ZND A;  3PLF B;  2JXL A;  2QT2 A;  3ZTF A;  1UIS A;  5DPG A;  4DXO A;  1CM1 A;  1LXF C;  4PHN A;  3EVR A;  2KFF A;  3RWA A;  1K9U A;  2VAD A;  3EVV A;  1MUX A;  1NCX A;  2IB5 A;  1MF8 B;  1S3P A;  3BX9 A;  3CR5 X;  4YGD B;  3DQD A;  1XFY O;  3RLZ A;  4HSZ A;  1F70 A;  2KYF A;  3TS5 B;  2PXS A;  4ORA B;  5BPJ A;  1FF1 A;  1NYA A;  4Q7R A;  1TCO B;  2ZRS A;  2M29 A;  2EMO A;  1TIZ A;  3M24 A;  5PAL A;  2P4M A;  3NEZ A;  5LTR A;  1ODB A;  1A75 A;  3O2P A;  2Y4Q A;  1UWO A;  2OS8 B;  1NUB A;  3SG2 A;  1F8H A;  4DUQ A;  2H9W A;  2AH8 A;  2JT8 A;  4ZIO A;  4XOW A;  1R2U A;  2L4H A;  1DJW A;  1RRX A;  1YRU B;  2H5Q A;  4MZK A;  1EMK A;  4UTS A;  4GF6 B;  4KGE A;  3VHT A;  3JTD C;  4Q04 A;  4CPV A;  4TZA A;  3E3R A;  1J7Q A;  4ZCU A;  4F0Z B;  5AAN A;  1J1E A;  2L0P A;  2A52 B;  1OMR A;  3F45 A;  4GAO A;  3I5F C;  1GGW A;  4OGS A;  1DJI A;  2CT9 A;  1NCZ A;  5EXU A;  4W6S A;  5KTY A;  2O5G A;  1QAS A;  5HZS A;  2O2B A;  3CD1 A;  3ST4 A;  4GOB A;  1NX3 A;  1F54 A;  3O77 A;  3SG3 A;  4UPG A;  2WUR A;  1A29 A;  3VIC A;  4OY4 A;  5HBD A;  3D10 A;  5I2O A;  4HQ9 A;  3VHT B;  1Y0V H;  2AWJ A;  2JUL A;  2WIS A;  1DMO A;  1QYO A;  3PJ7 A;  1JF0 A;  1XFV O;  1E8A A;  4LW5 A;  3BQ3 A;  4DRW A;  4Q9X A;  2QLE A;  1OOJ A;  4WQ2 A;  4JRB A;  1K9K A;  3WXA A;  3LSA A;  3SSL A;  2DD7 A;  2L5X B;  5F6T A;  2PRU A;  1EXR A;  2LLU A;  1S1E A;  3GK1 A;  4U8D A;  1F4O A;  3FWC A;  5CPV A;  2KI6 C;  5AEQ A;  4B30 B;  1Y1A A;  2AAO A;  2ISD A;  3BUX B;  4IK4 A;  3SG4 A;  3M0W A;  1JBA A;  3SSK A;  2K7C A;  3GEX A;  4YBH B;  3NSK A;  4MZL A;  3U8A A;  2M49 B;  3TUY C;  3LS3 A;  4L12 A;  2QPT A;  3DVE A;  2LAP A;  2IE2 A;  1J1D A;  3LVD A;  1DVI A;  3KCT A;  5DPI A;  2MHH A;  1IJ5 A;  4QJ4 B;  3HX4 A;  3CFF A;  1S36 A;  1KFU S;  3CS1 A;  5HZU A;  2KAY A;  3EVU A;  1CV7 A;  2DDD A;  3AKB A;  4HRG A;  4M2Q A;  4W6U A;  3SG5 A;  3CTN A;  4GGF C;  3IQQ A;  4ICB A;  1EME A;  1QY3 A;  1K8U A;  1HT9 A;  3I5I B;  2QRF A;  4DKN A;  5K89 A;  3SSY A;  1PVB A;  4GGF A;  2Y0G A;  1SBJ A;  1OXF A;  1QX7 A;  1RJV A;  2EC6 B;  1MYW A;  2M9G A;  1XK4 C;  2MRD A;  1YUU A;  3DPW A;  3K21 A;  5DTZ A;  1HCJ A;  1ZMZ A;  4C0J A;  1EG4 A;  4LJB A;  5FHV A;  1XK4 A;  4J89 A;  3BUM B;  3KCS A;  3LA1 A;  2ZMW A;  1DF0 A;  2FOT A;  2G6Y A;  3DQ9 A;  2BBM A;  2ICR A;  1D1O A;  3DQJ A;  1EL4 A;  5ER5 A;  1L7Z A;  2KAV A;  2AHA A;  2LC5 A;  1NP8 A;  4W7X A;  4DXN A;  2M7N A;  2BL0 B;  1PK0 D;  1AUI B;  4JQ0 D;  2CTN A;  1B7T Z;  4EDO A;  2Z6Z A;  3TDZ A;  4ETO A;  2QLH A;  3M22 A;  1B8L A;  2P6B B;  5F9G A;  2LE9 B;  3GL4 A;  3O6B A;  4EN1 A;  3DQ4 A;  2LM5 A;  1SPY A;  1H4U A;  2QLG A;  4YRU A;  4PE7 A;  4AQI A;  1N65 A;  4YI9 A;  4ORN A;  4GBA A;  3BOW B;  4W6H A;  3SS0 A;  5CSF A;  5FVG A;  1QIW A;  4W6I A;  1JF2 A;  2Y1N A;  1EMF A;  3BUO B;  3BXK A;  3IP2 A;  1LVC D;  3FIA A;  2WND A;  1CNP A;  4KAG A;  5DKQ A;  4ZIN A;  3IF7 A;  1IG5 A;  2G3O A;  4OHS A;  2HGY A;  2I7A A;  4I5L B;  1EG3 A;  1S26 D;  1L2O C;  1XFZ O;  2K7B A;  2LNK A;  4TZG A;  3MGF A;  3U0L A;  5DQM A;  2LUC A;  1YUS A;  3VK1 A;  2BE4 A;  2JU0 A;  4I5N B;  2AMI A;  2CXJ A;  1JC0 A;  4DS7 A;  1SMG A;  3DQ3 A;  2WCB A;  1SR6 C;  5I2L A;  4NDC A;  1PUL A;  1EMM A;  1K96 A;  5LTP A;  1TN4 A;  2YE0 A;  3OX5 A;  5B8I B;  3AKA A;  2VVJ A;  2G6X A;  2HGD A;  2PMY A;  1FBV A;  2MLE C;  2WCF A;  1M63 B;  4A4B A;  4PDZ A;  3ICB A;  1KCY A;  4AS8 A;  5JOL A;  3DQE A;  5HGE A;  4OKH A;  2PAL A;  2ZFD A;  3KPX A;  1DJG A;  1EH2 A;  2DUH A;  1QYQ A;  1AJ4 A;  4PCW A;  4EDS A;  2H8Q A;  4IK3 A;  4W6B A;  4J8A A;  3W1C A;  1G4Y R;  2LMT A;  2KQY A;  1OSA A;  2HPS A;  2WHT A;  2V4E C;  5HKW A;  3SIA A;  3SSP A;  5H88 A;  3AI5 A;  1OZO A;  4EUL A;  3DQL A;  3SRY A;  1S5G Y;  2MA2 A;  2V4E A;  1Q4B A;  3JVT B;  3TDI A;  1UHI A;  4U2V A;  1FW4 A;  2ZMU A;  4MBE A;  1RK9 A;  5IBW A;  2Q4U A;  2OGR A;  5EXB A;  1SR6 B;  3CGA A;  1BMO A;  3EK8 A;  4PE1 A;  2Y5I A;  4H3N A;  3NXA A;  1RRO A;  4YGA A;  1KWO C;  2I2R E;  1U5I B;  1QJT A;  3CBE A;  4XYN A;  1SNL A;  3GOF A;  1QS7 A;  2WHU A;  4DXP A;  1KQM C;  4B5Y A;  2A56 B;  4JWQ A;  3NSO A;  1QXT A;  2VAE A;  2MLF C;  1DJX A;  5DTX A;  4ZF3 A;  2IS9 A;  3WHU B;  3WNX B;  2WIQ A;  1B1G A;  3CLN A;  3LF3 A;  1NSH A;  2C9I A;  1TCF A;  1V1F A;  2EMD A;  1YR5 A;  4ZFS A;  1SYM A;  1ZOT B;  1MHO A;  1A03 A;  2V4E B;  3BXC A;  1MR8 A;  4QJ3 B;  2AWK A;  2CNP A;  1EMC A;  1GGX A;  5H87 A;  1CMF A;  2H5O A;  1XYD A;  4AQJ A;  4GES B;  3ZUF A;  4W6J A;  3CZT X;  2KNE A;  1QV0 A;  1YHH A;  1RMO A;  1KK8 C;  2V53 A;  3SVO A;  3I5H C;  3NSL A;  1EMB A;  2VVI A;  1ZAC A;  1BR4 B;  4W7R A;  4NQG A;  1Y1X A;  1B9C A;  1K9P A;  2KSP A;  1SKT A;  3TZ1 A;  4N1F A;  2H2K A;  1JBZ A;  1H8B A;  1CDM A;  2WC8 A;  1KYS A;  1Z1P A;  1OXE A;  1WRK A;  1XAE A;  4J88 A;  1J7O A;  2BCB A;  4Q7T A;  2L50 A;  1J7P A;  1SL8 A;  5I8N A;  1F09 A;  3E5T A;  4MEW A;  1QX2 A;  1PSB A;  1CTR A;  4OJ0 A;  1BR1 B;  2JTT A;  5BTT A;  1QIV A;  5CSN A;  4LJD C;  3GK4 X;  4YGC B;  2EHB A;  1KK8 B;  2DOQ A;  2JXC A;  4P1Q A;  4PHM A;  3I5H B;  4YGB B;  1ZUZ A;  1B9A A;  4LJD A;  5GQQ C;  2K7D A;  1QAT A;  2WHS A;  2G5Z B;  4OCI A;  1VRK A;  1MOV A;  4W7D A;  3GJ2 A;  1OXD A;  2A47 A;  1QX5 B;  1ZFS A;  4R6D A;  1S6Z A;  1V1G A;  1XFW O;  5J2O A;  2ZN8 A;  2DUF A;  5BQL A;  1H4B A;  2LMV A;  3K1K A;  4KW8 A;  1GL4 A;  1A75 B;  1AJ5 A;  1G33 A;  2KFG A;  3CFH A;  1UUS A;  3SVN A;  1SCV A;  5JJG A;  3IQO A;  1DGU A;  1LA3 A;  1K90 D;  4ZBL A;  3DQI A;  1BFP A;  3OGO A;  4ZB1 A;  5EJU A;  2F33 A;  1ALV A;  1KK7 Y;  1DTL A;  2SAS A;  3SVE A;  5AER A;  1TOP A;  1IH0 A;  4HRE E;  2L51 A;  2FJU B;  2F2P A;  5KTG A;  2HFC A;  3LCP C;  1B47 A;  2ZO6 A;  2QZ0 A;  3JTD B;  3VRN A;  2DUI A;  1K2H A;  1ZGP A;  1F0B A;  5HLV A;  1N0Y A;  3GK2 A;  1JUO A;  1LKJ A;  4W76 A;  4DCK A;  4H3M A;  2KI6 D;  1JFJ A;  3DQ2 A;  3DQH A;  4W6K A;  2B3P A;  3I5F B;  4ORB B;  2ARL A;  1SCM C;  3AI4 A;  3DVJ A;  2KYC A;  2HJO A;  3I19 A;  1IJ6 A;  3NT3 A;  1BJF A;  2HF5 A;  4BY4 A;  2OJK A;  1Q4D A;  3WLD A;  1CM4 A;  4MRX A;  2FL1 A;  2YE1 A;  2LVV A;  4MSP A;  5DY6 A;  2JWW A;  4KF5 C;  2HQK A;  1YZW A;  1IGV A;  2ZKM X;  2ZRT A;  2C9J A;  1YRT B;  5H89 A;  1BG1 A;  4KF5 A;  4KEX A;  2MJW B;  2M97 A;  2KAX A;  4N3D A;  4QJ5 B;  3DF0 A;  1QVI Y;  5KU1 A;  2EMN A;  4HQC A;  2LP2 A;  1Q80 A;  1WDC C;  1DGV A;  1KYR A;  1DT7 B;  2A46 A;  3PAL A;  2BCX A;  1AHR A;  1EMG A;  3BXA A;  2NCO A;  3DQA A;  2VZX A;  2O60 A;  4WQ3 A;  4YGE B;  1Q4E A;  4W6N A;  1SCM B;  3DQK A;  3VRQ A;  3PN7 C;  3G9A A;  1EML A;  2KFH A;  2G2B A;  1CDP A;  1PRW A;  1KYP A;  4CLN A;  2F3Y A;  1PVA A;  1KP5 A;  1IRJ A;  3E5W A;  3ED8 A;  2WOR A;  1C7V A;  1QLK A;  4XVP A;  2ZNE A;  3TUY B;  2LMU A;  3NED A;  3DF0 B;  4P76 A;  2HPW A;  3ST2 A;  4OV2 A;  4FTG A;  1YFP A;  1TNQ A;  1A4P A;  2LAN A;  3BUW B;  2F3Z A;  1CDN A;  2M8U A;  1CLM A;  4W72 A;  1SW8 A;  1WDC B;  2MBX A;  1OE9 B;  1YUT A;  4PFE A;  4ZCV A;  1GJY A;  3GB3 A;  4OQW A;  3PN7 B;  5FVF A;  4FQO A;  2D8N A;  3SST A;  4W6C A;  1YTZ C;  4KW4 A;  1SL9 A;  1TTX A;  1LIN A;  2OKY A;  5DRG A;  3CR2 A;  1ZGQ A;  1DF0 B;  1IKU A;  1F4Q A;  1XQM A;  5HKZ A;  1YJ2 A;  2MAZ A;  2H5P A;  4EMQ A;  1OZS A;  4W6T A;  1M39 A;  4IK5 A;  2Q57 A;  2K8M B;  3EKH A;  1ALW A;  1KFU L;  3EVP A;  5HZO A;  3P8U A;  1S5G Z;  1YHI A;  2HRS A;  2JT0 A;  1K93 D;  3EK7 A;  5ER4 X;  4KF4 A;  3AKO A;  3KEV A;  4TNC A;  2QAC A;  2Q6P A;  2QLG B;  2AWM A;  1W7S A;  3KF9 A;  4JFG A;  4GPL B;  5EB6 A;  3LVC A;  2G6E A;  1MQ1 A;  4JF9 A;  4W6F A;  1MXE A;  2JQ6 A;  3U8P A;  4R1E A;  2PXW A;  3DQ7 A;  1Z1Q A;  5HYD A;  4W7F A;  4MN0 A;  1K95 A;  1PSR A;  3CR4 X;  2WSO A;  2ZO7 A;  3IR8 A;  4W69 A;  3OP0 A;  1DJY A;  1KSM A;  2TN4 A;  4PPL A;  4JEO A;  5AXI A;  2KI4 C;  3RWT A;  4ZF5 A;  4AR7 A;  2Z1O A;  4DXQ A;  1L2O B;  2RGI A;  3H4S E;  1Q4A A;  4IK8 A;  4RYW A;  1NX2 A;  1AK8 A;  1EJ3 A;  1CLB A;  4DIR A;  1Y1U A;  3DQM A;  2H6V A;  1M46 A;  2YDZ A;  3AAJ A;  2NXQ A;  2OKW A;  4PAL A;  2FWQ A;  3ZUJ A;  1TNX A;  4W6G A;  2A50 B;  5CSJ A;  4P5O E;  1YUR A;  4PHJ A;  2BTJ A;  1BU3 A;  1CMG A;  4I5J A;  1UHN A;  2I94 A;  4Q7U A;  4Q9W A;  2DUG A;  2RH7 A;  2GX2 A;  1CFF A;  2KOT A;  1SK6 D;  2LLT A;  3VRR A;  2GX0 A;  3LL8 B;  4L9M A;  1JC2 A;  3DPZ A;  3OHM B;  4GFT A;  1YHG A;  1QTX A; 
#chains in the Genus database with same CATH topology
 2NCP A;  4LQT A;  2ERB A;  3TS5 C;  1SL7 A;  5KSZ A;  3DQ6 A;  2KI4 B;  3DD4 A;  4W6A A;  3ZWH A;  1W7I B;  1WRL A;  2KHN A;  3U8C A;  4KGF A;  2M1K B;  1XVJ A;  5FVI A;  1HQV A;  2PSR A;  4A4C A;  2JT3 A;  2SCP A;  4HRH A;  1RTP 1;  2NZ0 A;  4W73 A;  5HLO A;  3LF4 B;  3PSR A;  2F8P A;  3W1D A;  4MVF A;  5DKR A;  3DQF A;  2K2F A;  4W74 A;  4ANJ A;  2LHL A;  4W77 A;  1W7U A;  1B8R A;  3OX6 A;  4W6O A;  2QEO A;  1AVS A;  3ST0 A;  2LUX A;  2G3D B;  1KWO B;  5HW9 A;  1R6P A;  2GW4 B;  5TNC A;  4PT1 A;  2A48 A;  3QRX A;  1F71 A;  1KFX S;  3ZNI A;  1KQM B;  5AQB B;  2JRF A;  1OMD A;  1EMA A;  2BEC A;  4W6D A;  4Z4K A;  4I5K A;  2O24 A;  1SY9 A;  5DTL A;  4YI8 A;  2HQ8 A;  3SJS A;  2ZN9 A;  3UO9 A;  2YFP A;  4N1G A;  2Z6Y A;  3SSH A;  2GGM A;  4JGE A;  1XFU O;  3DQN A;  4USL A;  2P70 A;  3NSI A;  3SVU A;  3FWB A;  1KK7 Z;  1WLM A;  1OQP A;  5FYX A;  3SSV A;  3DQC A;  1XA9 A;  5DPJ A;  3NT9 A;  1TRF A;  4WRI A;  1YX7 A;  3PJI A;  1BOD A;  5CSI A;  3S0D A;  2QEH A;  2JNF A;  2IOV A;  3EKJ A;  1Q4C A;  2LLS A;  4GGN A;  4GUK A;  4NWS A;  3O78 A;  3C1V A;  2WSN A;  3VB1 A;  3A4U B;  4N5X A;  1BLQ A;  3DVK A;  3S0F A;  2LVJ A;  2LVI A;  1C07 A;  2B3Q A;  3V3D A;  2Z6X A;  1NWD A;  4I2Y A;  1BT6 A;  4LQU A;  1S6J A;  2LVK A;  2L4I A;  4AOM A;  2WOS A;  2LV7 A;  4NDB A;  4HE4 A;  4PPK A;  2A54 B;  3TMR A;  5D69 A;  1GM0 A;  1MWN A;  1QXP A;  1XMZ A;  1YX8 A;  3SV5 A;  4JPZ B;  4BY5 A;  1W7T A;  3CAB A;  2FJY A;  1RMP A;  5BTT B;  2WCE A;  3KHE A;  5HKY A;  3BYA A;  2I18 A;  1ZUX A;  2K61 A;  3D0Y A;  1H6R A;  3P28 A;  4OZD A;  2QU1 A;  4RYS A;  3PAT A;  4DXM A;  4W7E A;  2FCD A;  4RTC A;  4E68 A;  2G2S B;  4B30 A;  3D77 A;  4ZF4 A;  2GV5 A;  2QEB A;  1JC1 A;  1RMM A;  5LK4 A;  1ZGO A;  1W7J B;  1QVI Z;  3DQU A;  4R6B A;  5HZT A;  1UHJ A;  2LCP A;  4W6R A;  2K2A A;  4C0L A;  1KFX L;  4LJC A;  2JZI A;  3CFA A;  4P2Y B;  1JSA A;  4W7A A;  4M2P A;  2OPO A;  4Z4M A;  4CFR A;  4IL1 A;  1CKK A;  2HQZ A;  4MZJ A;  1KQV A;  3GJ1 A;  3MSE B;  2A4J A;  1NCY A;  3VRP A;  4KW9 A;  3I5I C;  3DQO A;  3SVS A;  3D0Y B;  2PVB A;  1MXL C;  4H47 A;  4IK1 A;  1W9Z A;  4JKT A;  3BUN B;  4H3L A;  3VRO A;  2K7O A;  3A8R A;  2EC6 C;  2PAS A;  3DVM A;  1KSO A;  1LA0 A;  3PM8 A;  3SG6 A;  1CLL A;  4W75 A;  1OOH A;  3HCM A;  3SVC A;  2F2O A;  5HL1 A;  2Y1M A;  2B1U A;  2HQW A;  2M7L A;  2KDH A;  3FS7 A;  2DUE A;  2E6W A;  3B88 A;  2BKH B;  1QLS A;  2HCG A;  1M45 A;  1K94 A;  3R72 A;  2L98 A;  3PM2 A;  1XFX O;  1YJF A;  4HQ8 A;  2BBN A;  3A8S A;  1AP4 A;  3VGO A;  5LTQ A;  2VRG A;  2JAD A;  2M1U A;  2JOJ A;  2BL0 C;  3OB2 B;  1XFR A;  3DQ1 A;  1B8C A;  2KBM A;  2GW3 A;  1IQ5 A;  1FPW A;  1TNP A;  1NX0 A;  1UUR A;  1WLZ A;  4PE4 A;  3UG0 A;  3EK4 A;  5DPH A;  4L1I A;  4IK9 A;  3H1R A;  1YVL A;  1WRZ A;  1Y6W A;  2COL B;  1RM9 A;  2DDC A;  1Q73 A;  3O4Y A;  2BKI B;  1S6I A;  3KO0 A;  2M3W A;  2G16 B;  3OGN A;  2K0J A;  3DPX A;  2JPT A;  3I5G C;  1YVH A;  4PPJ A;  2WCK A;  4XOV A;  2BE6 A;  3BOW A;  1REC A;  5T3I A;  3ADF A;  5BT0 A;  4GNK B;  1C7W A;  5DU0 A;  1C4F A;  3ST3 A;  1BOC A;  3EG5 B;  1SRA A;  4PHK A;  1NPQ A;  1XSS A;  3PFV A;  4JC2 A;  1J55 A;  5I2Q A;  2A53 B;  1G7K A;  3H1O A;  4M2O A;  1X02 A;  3QME A;  3WHT B;  5G08 A;  1GFL A;  3CGL A;  3FE6 A;  2HET A;  4XGY A;  2JC2 A;  2FZU A;  3SIB A;  1TNW A;  4ORC B;  1OOF A;  3LVA A;  1DJZ A;  1GGZ A;  3U0M A;  3BXB A;  4IJ7 A;  5DRF A;  1JFK A;  3OB1 B;  4KPI A;  3PJ5 A;  2H61 C;  1M31 A;  3I5G B;  3DQ8 A;  4OVN F;  2H61 A;  4C0K A;  1IWQ A;  3CWG A;  3WLC A;  3DY9 A;  3CYZ A;  3DQ5 A;  5EXC I;  2KGR A;  3PJB A;  3O4X A;  1BF5 A;  3TDU A;  1A2X A;  1CDL A;  3S05 A;  3U0N A;  4INX A;  1FI6 A;  4W7C A;  3RM1 A;  5DQB A;  2KGB C;  4L13 A;  3UFZ A;  3R1O A;  1B4C A;  2JTZ A;  1UP5 A;  5J3X A;  3L4L A;  1WY9 A;  3JVT C;  3CB9 A;  4DKM A;  4MRY A;  3AAK A;  3D75 A;  5EBJ A;  1B7T Y;  2M0R A;  4CFQ A;  5EL2 A;  3LLE A;  2FCE A;  3L4A A;  2LHI A;  1OW4 A;  1JWD A;  4IZN A;  2VVH A;  1HUY A;  3LK1 A;  4XJK A;  3WCK A;  2LP3 A;  1MOU A;  2GGZ A;  2P71 A;  4MLW A;  3Q8I A;  2O29 A;  1QYF A;  1QV1 A;  2BCA A;  3PIB A;  2DD9 A;  4H48 A;  4PE0 A;  1U5I A;  4W6P A;  1PAL A;  4DXI A;  2OTE A;  2QLI A;  3RZS A;  2CBL A;  2OTG C;  3E5V A;  2EGD A;  1CB1 A;  1C3Z A;  5EB7 A;  4W6L A;  1F55 A;  1RWY A;  5D7F A;  1XO5 A;  2POX A;  2KBI A;  1IQ3 A;  1JBY A;  2KQ6 A;  4HVF A;  5AFP A;  2R2I A;  2IB6 A;  4NDD A;  3SVD A;  1G8I A;  4W6M A;  3B86 A;  4XJK B;  5DKN A;  3SG7 A;  1CFC A;  4KA9 A;  1GQM A;  2CCM A;  2NLN A;  1UHK A;  1DJH A;  2L2E A;  3CD9 A;  1CFP A;  3SVR A;  3LK0 A;  5DTY A;  2AWL A;  1J7R A;  1RFJ A;  1N2D A;  2K60 A;  2Q91 A;  1CFD A;  2H5R A;  4BDU A;  1S6C A;  1XA5 A;  2G9B A;  3S0G A;  1NX1 A;  3ZUL A;  1NIW A;  4XL5 A;  3TMT A;  2E30 A;  2AUC A;  1UHH A;  3NF0 A;  3SVB A;  4CID A;  4OR9 B;  2OTB A;  4D1E A;  2OTG B;  3OSQ A;  3D74 A;  5EHU A;  1FI5 A;  1OMV A;  3OSR A;  2OS8 C;  3U0K A;  2JNX A;  2ZND A;  3PLF B;  2JXL A;  2QT2 A;  3ZTF A;  1UIS A;  5DPG A;  4DXO A;  1CM1 A;  1LXF C;  4PHN A;  3EVR A;  2KFF A;  3RWA A;  1K9U A;  2VAD A;  3EVV A;  1MUX A;  1NCX A;  2IB5 A;  1MF8 B;  1S3P A;  3BX9 A;  3CR5 X;  4YGD B;  3DQD A;  1XFY O;  3RLZ A;  4HSZ A;  1F70 A;  2KYF A;  3TS5 B;  2PXS A;  4ORA B;  5BPJ A;  1FF1 A;  1NYA A;  4Q7R A;  1TCO B;  2ZRS A;  2M29 A;  2EMO A;  1TIZ A;  3M24 A;  5PAL A;  2P4M A;  3NEZ A;  5LTR A;  2QEV A;  4KYN A;  1ODB A;  1A75 A;  3O2P A;  2Y4Q A;  1UWO A;  2OS8 B;  1NUB A;  3SG2 A;  1F8H A;  4DUQ A;  5D3O A;  3BJH A;  3B87 A;  3R1P A;  2H9W A;  2AH8 A;  2JT8 A;  4ZIO A;  4XOW A;  2L5Y A;  1R2U A;  2L4H A;  5FI6 A;  1DJW A;  1RRX A;  1YRU B;  2H5Q A;  4MZK A;  1EMK A;  4UTS A;  4GF6 B;  4KGE A;  3VHT A;  3JTD C;  4Q04 A;  4CPV A;  4TZA A;  3E3R A;  1J7Q A;  4ZCU A;  4F0Z B;  5AAN A;  1J1E A;  2L0P A;  2A52 B;  1OMR A;  3F45 A;  4F7F A;  4GAO A;  3BFB A;  3I5F C;  1GGW A;  4OGS A;  1DJI A;  2CT9 A;  1NCZ A;  5EXU A;  4W6S A;  5KTY A;  2O5G A;  1QAS A;  5HZS A;  2O2B A;  3CD1 A;  3ST4 A;  4GOB A;  1NX3 A;  1F54 A;  3O77 A;  3CZ0 A;  3SG3 A;  4UPG A;  2WUR A;  1A29 A;  3VIC A;  4OY4 A;  5HBD A;  3OBV A;  3SS4 A;  3D10 A;  5I2O A;  2QDI A;  4HQ9 A;  3VHT B;  1Y0V H;  2AWJ A;  2JUL A;  2WIS A;  1DMO A;  1QYO A;  3PJ7 A;  1JF0 A;  1DEK A;  1XFV O;  1E8A A;  4LW5 A;  3BQ3 A;  4DRW A;  4Q9X A;  2QLE A;  1OOJ A;  4WQ2 A;  4JRB A;  1K9K A;  3WXA A;  3LSA A;  3SSL A;  2DD7 A;  2L5X B;  5F6T A;  2PRU A;  1EXR A;  2LLU A;  1S1E A;  3GK1 A;  4U8D A;  1F4O A;  3FWC A;  5CPV A;  2KI6 C;  5AEQ A;  4B30 B;  1Y1A A;  2AAO A;  2ISD A;  3S0A A;  3BUX B;  4IK4 A;  3SG4 A;  3M0W A;  1JBA A;  3SSK A;  2BNX A;  2K7C A;  3GEX A;  4YBH B;  3NSK A;  4MZL A;  3U8A A;  2M49 B;  3TUY C;  3LS3 A;  4L12 A;  2QPT A;  3DVE A;  2LAP A;  2IE2 A;  1J1D A;  3LVD A;  1DVI A;  3KCT A;  5DPI A;  2MHH A;  1IJ5 A;  2BAP A;  4QJ4 B;  3HX4 A;  3CFF A;  1S36 A;  1KFU S;  3CS1 A;  5HZU A;  2KAY A;  3EVU A;  1CV7 A;  3N7H A;  2DDD A;  3AKB A;  4HRG A;  4M2Q A;  4W6U A;  3SG5 A;  3CTN A;  4GGF C;  3IQQ A;  4ICB A;  1EME A;  1QY3 A;  1K8U A;  1HT9 A;  3I5I B;  2QRF A;  4DKN A;  5K89 A;  1OOI X;  3SSY A;  1PVB A;  3B6X A;  4GGF A;  2Y0G A;  1SBJ A;  1OXF A;  1QX7 A;  1RJV A;  2EC6 B;  1MYW A;  2M9G A;  1XK4 C;  2MRD A;  1YUU A;  3DPW A;  3K21 A;  5DTZ A;  1HCJ A;  1ZMZ A;  4C0J A;  1EG4 A;  4LJB A;  5FHV A;  1XK4 A;  4J89 A;  3BUM B;  3KCS A;  3LA1 A;  2L2C A;  2ZMW A;  1DF0 A;  2FOT A;  2G6Y A;  3DQ9 A;  2BBM A;  2ICR A;  1D1O A;  3DQJ A;  1EL4 A;  5ER5 A;  3NHT A;  1L7Z A;  2KAV A;  2AHA A;  2LC5 A;  4INW A;  1NP8 A;  4W7X A;  3R1V A;  4DXN A;  2M7N A;  2BL0 B;  1PK0 D;  1AUI B;  4JQ0 D;  2CTN A;  1B7T Z;  4EDO A;  2Z6Z A;  3TDZ A;  4ETO A;  2QLH A;  3D78 A;  1B8L A;  3M22 A;  2P6B B;  5F9G A;  2LE9 B;  3GL4 A;  3O6B A;  4EN1 A;  1DC1 A;  3DQ4 A;  2LM5 A;  1SPY A;  1H4U A;  2QLG A;  4YRU A;  4PE7 A;  4AQI A;  1N65 A;  4YI9 A;  4ORN A;  4GBA A;  3BOW B;  4W6H A;  3SS0 A;  5CSF A;  5FVG A;  1QIW A;  4W6I A;  1JF2 A;  2Y1N A;  5DIC A;  1EMF A;  3BUO B;  3BXK A;  2WCJ A;  3IP2 A;  1LVC D;  3FIA A;  2WND A;  1CNP A;  4KAG A;  5DKQ A;  4ZIN A;  3IF7 A;  1IG5 A;  2G3O A;  4OHS A;  2HGY A;  2I7A A;  4I5L B;  1EG3 A;  1S26 D;  1L2O C;  1XFZ O;  2K7B A;  2LNK A;  3S0B A;  4TZG A;  3MGF A;  3U0L A;  5DQM A;  2LUC A;  3B7A A;  1YUS A;  3VK1 A;  2BE4 A;  2JU0 A;  4I5N B;  2AMI A;  2CXJ A;  1JC0 A;  4DS7 A;  1SMG A;  1TUJ A;  3DQ3 A;  2WCB A;  1SR6 C;  5I2L A;  4NDC A;  1PUL A;  1EMM A;  1K96 A;  5LTP A;  1TN4 A;  2YE0 A;  3OX5 A;  5B8I B;  3AKA A;  2VVJ A;  2G6X A;  5FI7 A;  3NHI A;  2HGD A;  2PMY A;  1FBV A;  2MLE C;  2WCF A;  1M63 B;  4A4B A;  4PDZ A;  3ICB A;  1KCY A;  4AS8 A;  5JOL A;  3DQE A;  5HGE A;  4OKH A;  2PAL A;  2ZFD A;  3KPX A;  1DJG A;  1EH2 A;  2WC6 A;  1QYQ A;  2DUH A;  1AJ4 A;  2PYQ A;  4PCW A;  4EDS A;  2H8Q A;  4IK3 A;  4W6B A;  3D73 A;  3SS3 A;  4J8A A;  3W1C A;  3L47 A;  1G4Y R;  2JPO A;  2LMT A;  2KQY A;  1OSA A;  2HPS A;  2WHT A;  2V4E C;  5HKW A;  3SIA A;  3SSP A;  5H88 A;  3AI5 A;  2WCL A;  1OZO A;  4EUL A;  3DQL A;  3SRY A;  1S5G Y;  2MA2 A;  2V4E A;  1Q4B A;  3JVT B;  3TDI A;  1UHI A;  3DXL A;  4U2V A;  1FW4 A;  2ZMU A;  4MBE A;  1RK9 A;  1OOG A;  5IBW A;  2Q4U A;  2OGR A;  5EXB A;  1SR6 B;  3CGA A;  1BMO A;  3EK8 A;  4PE1 A;  2Y5I A;  4H3N A;  1TWO A;  3NXA A;  1RRO A;  3DYE A;  4YGA A;  1KWO C;  2I2R E;  1U5I B;  1QJT A;  1C3Y A;  3CBE A;  2KPH A;  4XYN A;  1SNL A;  3GOF A;  1QS7 A;  2WHU A;  3NGV A;  4DXP A;  1KQM C;  4B5Y A;  2A56 B;  4JWQ A;  3NSO A;  1QXT A;  2VAE A;  2MLF C;  1DJX A;  5DTX A;  4ZF3 A;  2IS9 A;  3WHU B;  1LS8 A;  3WNX B;  2WIQ A;  1B1G A;  3CLN A;  3LF3 A;  1NSH A;  2C9I A;  1TCF A;  1V1F A;  2EMD A;  1YR5 A;  4ZFS A;  1SYM A;  1ZOT B;  1MHO A;  1A03 A;  2V4E B;  3BXC A;  1MR8 A;  4QJ3 B;  2AWK A;  2CNP A;  1EMC A;  1QWV A;  2H8V A;  1GGX A;  5H87 A;  1CMF A;  2H5O A;  1XYD A;  3FE9 A;  4AQJ A;  4GES B;  3IVT A;  3ZUF A;  3CZT X;  2KNE A;  1QV0 A;  4W6J A;  1YHH A;  1RMO A;  1KK8 C;  2V53 A;  3SVO A;  3I5H C;  3NSL A;  1EMB A;  2VVI A;  1ZAC A;  1BR4 B;  4W7R A;  4NQG A;  1Y1X A;  1B9C A;  1K9P A;  2KSP A;  1SKT A;  3TZ1 A;  4N1F A;  3D76 A;  2H2K A;  1JBZ A;  1H8B A;  1CDM A;  2WC8 A;  1KYS A;  1Z1P A;  1OXE A;  1WRK A;  2KLD A;  1XAE A;  4J88 A;  1J7O A;  2BCB A;  4Q7T A;  2L50 A;  2GTE A;  1J7P A;  1SL8 A;  5I8N A;  1F09 A;  3E5T A;  4MEW A;  1QX2 A;  1PSB A;  1CTR A;  2YGU A;  4OJ0 A;  1BR1 B;  3S0E A;  2JTT A;  5BTT A;  1QIV A;  5CSN A;  2KLE A;  4LJD C;  3GK4 X;  4YGC B;  1P28 A;  1IIO A;  2EHB A;  1KK8 B;  2DOQ A;  2JXC A;  1DEL A;  4P1Q A;  4PHM A;  3I5H B;  4YGB B;  1ZUZ A;  1B9A A;  4LJD A;  5GQQ C;  2K7D A;  3BFA A;  1QAT A;  2WHS A;  2G5Z B;  4OCI A;  1VRK A;  1MOV A;  4W7D A;  3GJ2 A;  1OXD A;  2A47 A;  1QX5 B;  1ZFS A;  4R6D A;  1S6Z A;  1V1G A;  1XFW O;  5J2O A;  2ZN8 A;  2DUF A;  3K1E A;  5BQL A;  2PQL A;  1H4B A;  2LMV A;  3K1K A;  4KW8 A;  1GL4 A;  1A75 B;  1AJ5 A;  1G33 A;  2KFG A;  3CFH A;  1UUS A;  3SVN A;  1SCV A;  5JJG A;  3IQO A;  1DGU A;  1LA3 A;  1K90 D;  4ZBL A;  3DQI A;  1BFP A;  3OGO A;  4ZB1 A;  1DQE A;  5EJU A;  2F33 A;  1ALV A;  1KK7 Y;  1DTL A;  2SAS A;  1ORG A;  3SVE A;  5AER A;  1TOP A;  1IH0 A;  4HRE E;  2L51 A;  2FJU B;  2F2P A;  5KTG A;  2HFC A;  3LCP C;  1B47 A;  2ZO6 A;  2QZ0 A;  3JTD B;  3VRN A;  2DUI A;  1K2H A;  1ZGP A;  1F0B A;  5HLV A;  1N0Y A;  3GK2 A;  1JUO A;  1LKJ A;  4W76 A;  4DCK A;  4H3M A;  2KI6 D;  1JFJ A;  3DQ2 A;  3DQH A;  4W6K A;  2B3P A;  3I5F B;  4ORB B;  2ARL A;  1SCM C;  3AI4 A;  3DVJ A;  1Z4H A;  2KYC A;  1TUZ A;  2HJO A;  3I19 A;  1IJ6 A;  3NT3 A;  1BJF A;  2HF5 A;  4BY4 A;  2OJK A;  1Q4D A;  3WLD A;  1CM4 A;  4MRX A;  2FL1 A;  3UNW A;  2YE1 A;  2LVV A;  4MSP A;  5DY6 A;  2JWW A;  4KF5 C;  2HQK A;  2WC5 A;  1YZW A;  1IGV A;  2ZKM X;  2ZRT A;  2C9J A;  1YRT B;  5H89 A;  1BG1 A;  4KF5 A;  4KEX A;  2MJW B;  2M97 A;  2KAX A;  4N3D A;  4QJ5 B;  3DF0 A;  1QVI Y;  5KU1 A;  2EMN A;  4HQC A;  2LP2 A;  1Q80 A;  1WDC C;  1Z2C B;  1DGV A;  1KYR A;  1DT7 B;  2A46 A;  3PAL A;  1AHR A;  2BCX A;  1EMG A;  3BXA A;  2NCO A;  3DQA A;  2VZX A;  2O60 A;  3V2L A;  4WQ3 A;  4YGE B;  1Q4E A;  4W6N A;  1SCM B;  3DQK A;  3VRQ A;  3PN7 C;  3G9A A;  1EML A;  2KFH A;  2G2B A;  1CDP A;  1PRW A;  1KYP A;  4CLN A;  2F3Y A;  1PVA A;  1KP5 A;  1IRJ A;  3CDN A;  3E5W A;  3ED8 A;  2WOR A;  1C7V A;  1QLK A;  4XVP A;  2ZNE A;  3TUY B;  2LMU A;  3DF0 B;  3NED A;  4P76 A;  2HPW A;  5FI2 A;  3ST2 A;  4FQT A;  4OV2 A;  4FTG A;  1YFP A;  1TNQ A;  1A4P A;  2LAN A;  3BFH A;  3BUW B;  2F3Z A;  1CDN A;  2M8U A;  1CLM A;  4W72 A;  1SW8 A;  1WDC B;  2MBX A;  1OE9 B;  1SSE B;  1YUT A;  4PFE A;  4ZCV A;  1GJY A;  3FE8 A;  3GB3 A;  4OQW A;  3PN7 B;  4JD9 A;  5FVF A;  4FQO A;  2D8N A;  3SST A;  4W6C A;  1YTZ C;  4KW4 A;  1SL9 A;  1TTX A;  1LIN A;  2OKY A;  5DRG A;  3CR2 A;  3DZT A;  1ZGQ A;  1DF0 B;  1IKU A;  1F4Q A;  1XQM A;  5HKZ A;  1YJ2 A;  2MAZ A;  2H5P A;  4EMQ A;  1OZS A;  4W6T A;  1M39 A;  4IK5 A;  2Q57 A;  2K8M B;  3EKH A;  1ALW A;  1KFU L;  3EVP A;  3CZ2 A;  5HZO A;  3P8U A;  1S5G Z;  1YHI A;  2HRS A;  2JT0 A;  1K93 D;  3EK7 A;  2WCH A;  5ER4 X;  4KF4 A;  3AKO A;  3KEV A;  4TNC A;  2QAC A;  2Q6P A;  2QLG B;  2AWM A;  1W7S A;  3KF9 A;  4JFG A;  4GPL B;  5EB6 A;  3LVC A;  2G6E A;  1MQ1 A;  4JF9 A;  4W6F A;  1MXE A;  2JQ6 A;  3U8P A;  4R1E A;  2PXW A;  3DQ7 A;  1Z1Q A;  5HYD A;  4W7F A;  4MN0 A;  1K95 A;  1PSR A;  3CR4 X;  2WSO A;  2ZO7 A;  3SS5 A;  5I94 A;  3IR8 A;  4W69 A;  3OP0 A;  1DJY A;  1KSM A;  2TN4 A;  4PPL A;  4JEO A;  5AXI A;  2KI4 C;  3RWT A;  4ZF5 A;  4AR7 A;  2Z1O A;  4DXQ A;  1L2O B;  2RGI A;  3H4S E;  1Q4A A;  4IK8 A;  4RYW A;  1NX2 A;  1AK8 A;  1EJ3 A;  1CLB A;  4DIR A;  1Y1U A;  3DQM A;  2H6V A;  1M46 A;  2YDZ A;  3AAJ A;  2NXQ A;  2OKW A;  4PAL A;  2FWQ A;  3ZUJ A;  1TNX A;  4W6G A;  2A50 B;  5CSJ A;  2WCM A;  4P5O E;  1YUR A;  4PHJ A;  2BTJ A;  1BU3 A;  1CMG A;  4I5J A;  1UHN A;  2I94 A;  4Q7U A;  4Q9W A;  1T14 A;  2DUG A;  2RH7 A;  3CZ1 A;  2GX2 A;  1CFF A;  2KOT A;  1SK6 D;  2LLT A;  3VRR A;  2GX0 A;  3LL8 B;  4L9M A;  1JC2 A;  3DPZ A;  3OHM B;  4GFT A;  1YHG A;  1QTX A; 
#chains in the Genus database with same CATH homology
 2NCP A;  4LQT A;  3TS5 C;  1SL7 A;  5KSZ A;  3DQ6 A;  2KI4 B;  3DD4 A;  4W6A A;  3ZWH A;  1W7I B;  1WRL A;  2KHN A;  3U8C A;  4KGF A;  2M1K B;  1XVJ A;  5FVI A;  1HQV A;  2PSR A;  4A4C A;  2JT3 A;  2SCP A;  4HRH A;  1RTP 1;  2NZ0 A;  4W73 A;  5HLO A;  3LF4 B;  3PSR A;  2F8P A;  3W1D A;  4MVF A;  5DKR A;  3DQF A;  2K2F A;  4W74 A;  4ANJ A;  2LHL A;  4W77 A;  1W7U A;  1B8R A;  3OX6 A;  4W6O A;  1AVS A;  3ST0 A;  2LUX A;  2G3D B;  1KWO B;  5HW9 A;  1R6P A;  2GW4 B;  5TNC A;  2A48 A;  3QRX A;  1F71 A;  1KFX S;  3ZNI A;  1KQM B;  5AQB B;  2JRF A;  1OMD A;  1EMA A;  2BEC A;  4W6D A;  4Z4K A;  4I5K A;  2O24 A;  1SY9 A;  5DTL A;  4YI8 A;  2HQ8 A;  3SJS A;  2ZN9 A;  2YFP A;  4N1G A;  2Z6Y A;  3SSH A;  2GGM A;  4JGE A;  1XFU O;  3DQN A;  4USL A;  3NSI A;  3SVU A;  3FWB A;  1KK7 Z;  1WLM A;  1OQP A;  5FYX A;  3SSV A;  3DQC A;  1XA9 A;  5DPJ A;  3NT9 A;  1TRF A;  4WRI A;  1YX7 A;  1BOD A;  5CSI A;  2JNF A;  2IOV A;  3EKJ A;  1Q4C A;  2LLS A;  4GGN A;  4GUK A;  4NWS A;  3O78 A;  3C1V A;  2WSN A;  3A4U B;  4N5X A;  1BLQ A;  3DVK A;  2LVJ A;  2LVI A;  1C07 A;  2B3Q A;  3V3D A;  2Z6X A;  1NWD A;  4I2Y A;  1BT6 A;  4LQU A;  1S6J A;  2LVK A;  2L4I A;  4AOM A;  2WOS A;  2LV7 A;  4NDB A;  4HE4 A;  4PPK A;  2A54 B;  3TMR A;  5D69 A;  1MWN A;  1QXP A;  1XMZ A;  1YX8 A;  3SV5 A;  4JPZ B;  4BY5 A;  1W7T A;  1RMP A;  5BTT B;  2WCE A;  3KHE A;  5HKY A;  3BYA A;  2I18 A;  1ZUX A;  2K61 A;  3D0Y A;  1H6R A;  3P28 A;  4RYS A;  2QU1 A;  3PAT A;  4DXM A;  4W7E A;  2FCD A;  4RTC A;  4E68 A;  2G2S B;  4B30 A;  4ZF4 A;  2GV5 A;  1JC1 A;  1RMM A;  5LK4 A;  1ZGO A;  1W7J B;  1QVI Z;  3DQU A;  4R6B A;  5HZT A;  1UHJ A;  2LCP A;  4W6R A;  2K2A A;  4C0L A;  1KFX L;  4LJC A;  2JZI A;  3CFA A;  4P2Y B;  1JSA A;  4W7A A;  4M2P A;  2OPO A;  4Z4M A;  4CFR A;  4IL1 A;  1CKK A;  2HQZ A;  4MZJ A;  1KQV A;  3GJ1 A;  3MSE B;  2A4J A;  1NCY A;  3VRP A;  4KW9 A;  3I5I C;  3DQO A;  3SVS A;  3D0Y B;  2PVB A;  1MXL C;  4H47 A;  4IK1 A;  3BUN B;  4H3L A;  3VRO A;  2K7O A;  3A8R A;  2EC6 C;  2PAS A;  3DVM A;  1KSO A;  1LA0 A;  3PM8 A;  3SG6 A;  1CLL A;  4W75 A;  3HCM A;  3SVC A;  2F2O A;  2Y1M A;  2B1U A;  2HQW A;  2M7L A;  2KDH A;  3FS7 A;  2DUE A;  2E6W A;  2BKH B;  1QLS A;  2HCG A;  1M45 A;  1K94 A;  2L98 A;  1XFX O;  1YJF A;  4HQ8 A;  2BBN A;  3A8S A;  1AP4 A;  3VGO A;  5LTQ A;  2VRG A;  2JAD A;  2M1U A;  2JOJ A;  2BL0 C;  3OB2 B;  3DQ1 A;  1B8C A;  2KBM A;  2GW3 A;  1IQ5 A;  1FPW A;  1TNP A;  1NX0 A;  1UUR A;  1WLZ A;  4PE4 A;  3UG0 A;  3EK4 A;  5DPH A;  4L1I A;  4IK9 A;  3H1R A;  1YVL A;  1WRZ A;  1Y6W A;  2COL B;  1RM9 A;  2DDC A;  1Q73 A;  3O4Y A;  2BKI B;  1S6I A;  3KO0 A;  2M3W A;  2G16 B;  2K0J A;  3DPX A;  2JPT A;  3I5G C;  1YVH A;  4PPJ A;  4XOV A;  2BE6 A;  3BOW A;  1REC A;  5T3I A;  3ADF A;  5BT0 A;  4GNK B;  1C7W A;  5DU0 A;  1C4F A;  3ST3 A;  1BOC A;  1SRA A;  4PHK A;  1NPQ A;  1XSS A;  3PFV A;  4JC2 A;  1J55 A;  5I2Q A;  2A53 B;  1G7K A;  3H1O A;  4M2O A;  1X02 A;  3WHT B;  5G08 A;  1GFL A;  3CGL A;  2HET A;  4XGY A;  2JC2 A;  2FZU A;  3SIB A;  1TNW A;  4ORC B;  3LVA A;  1DJZ A;  1GGZ A;  3U0M A;  3BXB A;  5DRF A;  1JFK A;  3OB1 B;  4KPI A;  3PJ5 A;  2H61 C;  1M31 A;  3I5G B;  3DQ8 A;  4OVN F;  2H61 A;  4C0K A;  1IWQ A;  3CWG A;  3WLC A;  3DQ5 A;  5EXC I;  2KGR A;  3PJB A;  1BF5 A;  3TDU A;  1A2X A;  1CDL A;  3S05 A;  3U0N A;  1FI6 A;  4W7C A;  3RM1 A;  5DQB A;  2KGB C;  4L13 A;  3UFZ A;  1B4C A;  2JTZ A;  1UP5 A;  5J3X A;  1WY9 A;  3JVT C;  3CB9 A;  4DKM A;  4MRY A;  3AAK A;  5EBJ A;  1B7T Y;  2M0R A;  4CFQ A;  3LLE A;  2FCE A;  2LHI A;  1JWD A;  4IZN A;  2VVH A;  1HUY A;  3LK1 A;  4XJK A;  3WCK A;  2LP3 A;  1MOU A;  2GGZ A;  4MLW A;  2O29 A;  1QYF A;  1QV1 A;  2BCA A;  3PIB A;  2DD9 A;  4H48 A;  4PE0 A;  1U5I A;  4W6P A;  1PAL A;  4DXI A;  2OTE A;  2QLI A;  2CBL A;  2OTG C;  3E5V A;  2EGD A;  1CB1 A;  5EB7 A;  4W6L A;  1F55 A;  1RWY A;  5D7F A;  1XO5 A;  2POX A;  2KBI A;  1IQ3 A;  1JBY A;  2KQ6 A;  4HVF A;  5AFP A;  2R2I A;  2IB6 A;  4NDD A;  3SVD A;  1G8I A;  4W6M A;  3SG7 A;  4XJK B;  5DKN A;  1CFC A;  4KA9 A;  1GQM A;  2CCM A;  2NLN A;  1UHK A;  1DJH A;  2L2E A;  3CD9 A;  1CFP A;  3SVR A;  3LK0 A;  5DTY A;  2AWL A;  1J7R A;  1RFJ A;  1N2D A;  2Q91 A;  1CFD A;  2H5R A;  4BDU A;  1S6C A;  1XA5 A;  2G9B A;  1NX1 A;  3ZUL A;  1NIW A;  4XL5 A;  3TMT A;  2E30 A;  2AUC A;  1UHH A;  3NF0 A;  3SVB A;  4CID A;  4OR9 B;  2OTB A;  4D1E A;  2OTG B;  3OSQ A;  5EHU A;  1FI5 A;  1OMV A;  3OSR A;  2OS8 C;  3U0K A;  2JNX A;  2ZND A;  3PLF B;  2JXL A;  2QT2 A;  3ZTF A;  1UIS A;  5DPG A;  4DXO A;  1CM1 A;  1LXF C;  4PHN A;  3EVR A;  2KFF A;  3RWA A;  1K9U A;  2VAD A;  3EVV A;  1MUX A;  1NCX A;  2IB5 A;  1MF8 B;  1S3P A;  3BX9 A;  3CR5 X;  4YGD B;  3DQD A;  1XFY O;  3RLZ A;  4HSZ A;  1F70 A;  2KYF A;  3TS5 B;  2PXS A;  4ORA B;  5BPJ A;  1FF1 A;  1NYA A;  4Q7R A;  1TCO B;  2ZRS A;  2M29 A;  2EMO A;  1TIZ A;  3M24 A;  5PAL A;  2P4M A;  3NEZ A;  5LTR A;  1ODB A;  1A75 A;  3O2P A;  2Y4Q A;  1UWO A;  2OS8 B;  1NUB A;  3SG2 A;  1F8H A;  4DUQ A;  2H9W A;  2AH8 A;  2JT8 A;  4ZIO A;  4XOW A;  1R2U A;  2L4H A;  1DJW A;  1RRX A;  1YRU B;  2H5Q A;  4MZK A;  1EMK A;  4UTS A;  4GF6 B;  4KGE A;  3VHT A;  3JTD C;  4Q04 A;  4CPV A;  4TZA A;  3E3R A;  1J7Q A;  4ZCU A;  4F0Z B;  5AAN A;  1J1E A;  2L0P A;  2A52 B;  1OMR A;  3F45 A;  4GAO A;  3I5F C;  1GGW A;  4OGS A;  1DJI A;  2CT9 A;  1NCZ A;  5EXU A;  4W6S A;  5KTY A;  2O5G A;  1QAS A;  5HZS A;  2O2B A;  3CD1 A;  3ST4 A;  4GOB A;  1NX3 A;  1F54 A;  3O77 A;  3SG3 A;  4UPG A;  2WUR A;  1A29 A;  3VIC A;  4OY4 A;  5HBD A;  3D10 A;  5I2O A;  4HQ9 A;  3VHT B;  1Y0V H;  2AWJ A;  2JUL A;  2WIS A;  1DMO A;  1QYO A;  3PJ7 A;  1JF0 A;  1XFV O;  1E8A A;  4LW5 A;  3BQ3 A;  4DRW A;  4Q9X A;  2QLE A;  1OOJ A;  4WQ2 A;  4JRB A;  1K9K A;  3WXA A;  3LSA A;  3SSL A;  2DD7 A;  2L5X B;  5F6T A;  2PRU A;  1EXR A;  2LLU A;  1S1E A;  3GK1 A;  4U8D A;  1F4O A;  3FWC A;  5CPV A;  2KI6 C;  5AEQ A;  4B30 B;  1Y1A A;  2AAO A;  2ISD A;  3BUX B;  4IK4 A;  3SG4 A;  3M0W A;  1JBA A;  3SSK A;  2K7C A;  3GEX A;  4YBH B;  3NSK A;  4MZL A;  3U8A A;  2M49 B;  3TUY C;  3LS3 A;  4L12 A;  2QPT A;  3DVE A;  2LAP A;  2IE2 A;  1J1D A;  3LVD A;  1DVI A;  3KCT A;  5DPI A;  2MHH A;  1IJ5 A;  4QJ4 B;  3HX4 A;  3CFF A;  1S36 A;  1KFU S;  3CS1 A;  5HZU A;  2KAY A;  3EVU A;  1CV7 A;  2DDD A;  3AKB A;  4HRG A;  4M2Q A;  4W6U A;  3SG5 A;  3CTN A;  4GGF C;  3IQQ A;  4ICB A;  1EME A;  1QY3 A;  1K8U A;  1HT9 A;  3I5I B;  2QRF A;  4DKN A;  5K89 A;  3SSY A;  1PVB A;  4GGF A;  2Y0G A;  1SBJ A;  1OXF A;  1QX7 A;  1RJV A;  2EC6 B;  1MYW A;  2M9G A;  1XK4 C;  2MRD A;  1YUU A;  3DPW A;  3K21 A;  5DTZ A;  1HCJ A;  1ZMZ A;  4C0J A;  1EG4 A;  4LJB A;  5FHV A;  1XK4 A;  4J89 A;  3BUM B;  3KCS A;  3LA1 A;  2ZMW A;  1DF0 A;  2FOT A;  2G6Y A;  3DQ9 A;  2BBM A;  2ICR A;  1D1O A;  3DQJ A;  1EL4 A;  5ER5 A;  1L7Z A;  2KAV A;  2AHA A;  2LC5 A;  1NP8 A;  4W7X A;  4DXN A;  2M7N A;  2BL0 B;  1PK0 D;  1AUI B;  4JQ0 D;  2CTN A;  1B7T Z;  4EDO A;  2Z6Z A;  3TDZ A;  4ETO A;  2QLH A;  3M22 A;  1B8L A;  2P6B B;  5F9G A;  2LE9 B;  3GL4 A;  3O6B A;  4EN1 A;  3DQ4 A;  2LM5 A;  1SPY A;  1H4U A;  2QLG A;  4YRU A;  4PE7 A;  4AQI A;  1N65 A;  4YI9 A;  4ORN A;  4GBA A;  3BOW B;  4W6H A;  3SS0 A;  5CSF A;  5FVG A;  1QIW A;  4W6I A;  1JF2 A;  2Y1N A;  1EMF A;  3BUO B;  3BXK A;  3IP2 A;  1LVC D;  3FIA A;  2WND A;  1CNP A;  4KAG A;  5DKQ A;  4ZIN A;  3IF7 A;  1IG5 A;  2G3O A;  4OHS A;  2HGY A;  2I7A A;  4I5L B;  1EG3 A;  1S26 D;  1L2O C;  1XFZ O;  2K7B A;  2LNK A;  4TZG A;  3MGF A;  3U0L A;  5DQM A;  2LUC A;  1YUS A;  3VK1 A;  2BE4 A;  2JU0 A;  4I5N B;  2AMI A;  2CXJ A;  1JC0 A;  4DS7 A;  1SMG A;  3DQ3 A;  2WCB A;  1SR6 C;  5I2L A;  4NDC A;  1PUL A;  1EMM A;  1K96 A;  5LTP A;  1TN4 A;  2YE0 A;  3OX5 A;  5B8I B;  3AKA A;  2VVJ A;  2G6X A;  2HGD A;  2PMY A;  1FBV A;  2MLE C;  2WCF A;  1M63 B;  4A4B A;  4PDZ A;  3ICB A;  1KCY A;  4AS8 A;  5JOL A;  3DQE A;  5HGE A;  4OKH A;  2PAL A;  2ZFD A;  3KPX A;  1DJG A;  1EH2 A;  2DUH A;  1QYQ A;  1AJ4 A;  4PCW A;  4EDS A;  2H8Q A;  4IK3 A;  4W6B A;  4J8A A;  3W1C A;  1G4Y R;  2LMT A;  2KQY A;  1OSA A;  2HPS A;  2WHT A;  2V4E C;  5HKW A;  3SIA A;  3SSP A;  5H88 A;  3AI5 A;  1OZO A;  4EUL A;  3DQL A;  3SRY A;  1S5G Y;  2MA2 A;  2V4E A;  1Q4B A;  3JVT B;  3TDI A;  1UHI A;  4U2V A;  1FW4 A;  2ZMU A;  4MBE A;  1RK9 A;  5IBW A;  2Q4U A;  2OGR A;  5EXB A;  1SR6 B;  3CGA A;  1BMO A;  3EK8 A;  4PE1 A;  2Y5I A;  4H3N A;  3NXA A;  1RRO A;  4YGA A;  1KWO C;  2I2R E;  1U5I B;  1QJT A;  3CBE A;  4XYN A;  1SNL A;  3GOF A;  1QS7 A;  2WHU A;  4DXP A;  1KQM C;  4B5Y A;  2A56 B;  4JWQ A;  3NSO A;  1QXT A;  2VAE A;  2MLF C;  1DJX A;  5DTX A;  4ZF3 A;  2IS9 A;  3WHU B;  3WNX B;  2WIQ A;  1B1G A;  3CLN A;  3LF3 A;  1NSH A;  2C9I A;  1TCF A;  1V1F A;  2EMD A;  1YR5 A;  4ZFS A;  1SYM A;  1ZOT B;  1MHO A;  1A03 A;  2V4E B;  3BXC A;  1MR8 A;  4QJ3 B;  2AWK A;  2CNP A;  1EMC A;  1GGX A;  5H87 A;  1CMF A;  2H5O A;  1XYD A;  4AQJ A;  4GES B;  3ZUF A;  4W6J A;  3CZT X;  2KNE A;  1QV0 A;  1YHH A;  1RMO A;  1KK8 C;  2V53 A;  3SVO A;  3I5H C;  3NSL A;  1EMB A;  2VVI A;  1ZAC A;  1BR4 B;  4W7R A;  4NQG A;  1Y1X A;  1B9C A;  1K9P A;  2KSP A;  1SKT A;  3TZ1 A;  4N1F A;  2H2K A;  1JBZ A;  1H8B A;  1CDM A;  2WC8 A;  1KYS A;  1Z1P A;  1OXE A;  1WRK A;  1XAE A;  4J88 A;  1J7O A;  2BCB A;  4Q7T A;  2L50 A;  1J7P A;  1SL8 A;  5I8N A;  1F09 A;  3E5T A;  4MEW A;  1QX2 A;  1PSB A;  1CTR A;  4OJ0 A;  1BR1 B;  2JTT A;  5BTT A;  1QIV A;  5CSN A;  4LJD C;  3GK4 X;  4YGC B;  2EHB A;  1KK8 B;  2DOQ A;  2JXC A;  4P1Q A;  4PHM A;  3I5H B;  4YGB B;  1ZUZ A;  1B9A A;  4LJD A;  5GQQ C;  2K7D A;  1QAT A;  2WHS A;  2G5Z B;  4OCI A;  1VRK A;  1MOV A;  4W7D A;  3GJ2 A;  1OXD A;  2A47 A;  1QX5 B;  1ZFS A;  4R6D A;  1S6Z A;  1V1G A;  1XFW O;  5J2O A;  2ZN8 A;  2DUF A;  5BQL A;  1H4B A;  2LMV A;  3K1K A;  4KW8 A;  1GL4 A;  1A75 B;  1AJ5 A;  1G33 A;  2KFG A;  3CFH A;  1UUS A;  3SVN A;  1SCV A;  5JJG A;  3IQO A;  1DGU A;  1LA3 A;  1K90 D;  4ZBL A;  3DQI A;  1BFP A;  3OGO A;  4ZB1 A;  5EJU A;  2F33 A;  1ALV A;  1KK7 Y;  1DTL A;  2SAS A;  3SVE A;  5AER A;  1TOP A;  1IH0 A;  4HRE E;  2L51 A;  2FJU B;  2F2P A;  5KTG A;  2HFC A;  3LCP C;  1B47 A;  2ZO6 A;  2QZ0 A;  3JTD B;  3VRN A;  2DUI A;  1K2H A;  1ZGP A;  1F0B A;  5HLV A;  1N0Y A;  3GK2 A;  1JUO A;  1LKJ A;  4W76 A;  4DCK A;  4H3M A;  2KI6 D;  1JFJ A;  3DQ2 A;  3DQH A;  4W6K A;  2B3P A;  3I5F B;  4ORB B;  2ARL A;  1SCM C;  3AI4 A;  3DVJ A;  2KYC A;  2HJO A;  3I19 A;  1IJ6 A;  3NT3 A;  1BJF A;  2HF5 A;  4BY4 A;  2OJK A;  1Q4D A;  3WLD A;  1CM4 A;  4MRX A;  2FL1 A;  2YE1 A;  2LVV A;  4MSP A;  5DY6 A;  2JWW A;  4KF5 C;  2HQK A;  1YZW A;  1IGV A;  2ZKM X;  2ZRT A;  2C9J A;  1YRT B;  5H89 A;  1BG1 A;  4KF5 A;  4KEX A;  2MJW B;  2M97 A;  2KAX A;  4N3D A;  4QJ5 B;  3DF0 A;  1QVI Y;  5KU1 A;  2EMN A;  4HQC A;  2LP2 A;  1Q80 A;  1WDC C;  1DGV A;  1KYR A;  1DT7 B;  2A46 A;  3PAL A;  2BCX A;  1AHR A;  1EMG A;  3BXA A;  2NCO A;  3DQA A;  2VZX A;  2O60 A;  4WQ3 A;  4YGE B;  1Q4E A;  4W6N A;  1SCM B;  3DQK A;  3VRQ A;  3PN7 C;  3G9A A;  1EML A;  2KFH A;  2G2B A;  1CDP A;  1PRW A;  1KYP A;  4CLN A;  2F3Y A;  1PVA A;  1KP5 A;  1IRJ A;  3E5W A;  3ED8 A;  2WOR A;  1C7V A;  1QLK A;  4XVP A;  2ZNE A;  3TUY B;  2LMU A;  3NED A;  3DF0 B;  4P76 A;  2HPW A;  3ST2 A;  4OV2 A;  4FTG A;  1YFP A;  1TNQ A;  1A4P A;  2LAN A;  3BUW B;  2F3Z A;  1CDN A;  2M8U A;  1CLM A;  4W72 A;  1SW8 A;  1WDC B;  2MBX A;  1OE9 B;  1YUT A;  4PFE A;  4ZCV A;  1GJY A;  3GB3 A;  4OQW A;  3PN7 B;  5FVF A;  4FQO A;  2D8N A;  3SST A;  4W6C A;  1YTZ C;  4KW4 A;  1SL9 A;  1TTX A;  1LIN A;  2OKY A;  5DRG A;  3CR2 A;  1ZGQ A;  1DF0 B;  1IKU A;  1F4Q A;  1XQM A;  5HKZ A;  1YJ2 A;  2MAZ A;  2H5P A;  4EMQ A;  1OZS A;  4W6T A;  1M39 A;  4IK5 A;  2Q57 A;  2K8M B;  3EKH A;  1ALW A;  1KFU L;  3EVP A;  5HZO A;  3P8U A;  1S5G Z;  1YHI A;  2HRS A;  2JT0 A;  1K93 D;  3EK7 A;  5ER4 X;  4KF4 A;  3AKO A;  3KEV A;  4TNC A;  2QAC A;  2Q6P A;  2QLG B;  2AWM A;  1W7S A;  3KF9 A;  4JFG A;  4GPL B;  5EB6 A;  3LVC A;  2G6E A;  1MQ1 A;  4JF9 A;  4W6F A;  1MXE A;  2JQ6 A;  3U8P A;  4R1E A;  2PXW A;  3DQ7 A;  1Z1Q A;  5HYD A;  4W7F A;  4MN0 A;  1K95 A;  1PSR A;  3CR4 X;  2WSO A;  2ZO7 A;  3IR8 A;  4W69 A;  3OP0 A;  1DJY A;  1KSM A;  2TN4 A;  4PPL A;  4JEO A;  5AXI A;  2KI4 C;  3RWT A;  4ZF5 A;  4AR7 A;  2Z1O A;  4DXQ A;  1L2O B;  2RGI A;  3H4S E;  1Q4A A;  4IK8 A;  4RYW A;  1NX2 A;  1AK8 A;  1EJ3 A;  1CLB A;  4DIR A;  1Y1U A;  3DQM A;  2H6V A;  1M46 A;  2YDZ A;  3AAJ A;  2NXQ A;  2OKW A;  4PAL A;  2FWQ A;  3ZUJ A;  1TNX A;  4W6G A;  2A50 B;  5CSJ A;  4P5O E;  1YUR A;  4PHJ A;  2BTJ A;  1BU3 A;  1CMG A;  4I5J A;  1UHN A;  2I94 A;  4Q7U A;  4Q9W A;  2DUG A;  2RH7 A;  2GX2 A;  1CFF A;  2KOT A;  1SK6 D;  2LLT A;  3VRR A;  2GX0 A;  3LL8 B;  4L9M A;  1JC2 A;  3DPZ A;  3OHM B;  4GFT A;  1YHG A;  1QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...