3SG5A

Crystal structure of dimeric gcamp3-d380y, qp(linker 1), lp(linker 2)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
409
structure length
387
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSQPNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMADSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 124
structure length 387
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg5A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg5A01
2KQ6A 4KW9A 5AERA 4J8AA 4W72A 1RMMA 1W7UA 1NP8A 3OB2B 2I94A 2AWLA 3DQ9A 1OSAA 2JTTA 2Q4UA 1SL9A 3SG6A 5G08A 3EK4A 3NSIA 1SRAA 1W7JB 3DF0A 2G5ZB 3OX6A 5FYXA 4AQIA 2KI4B 3BOWB 3DQHA 3DVKA 2M0RA 2G6EA 3OP0A 4W69A 4JWQA 3GK1A 1MF8B 3E5TA 1M46A 5FVIA 1XFUO 1EH2A 3RWTA 3V3DA 1G7KA 4HVFA 2G16B 1CKKA 2Y0GA 1L7ZA 5B8IB 1SL8A 2OJKA 2WCEA 1EMLA 2KHNA 3ST2A 1PVBA 2AMIA 4Q9XA 2M3WA 3AAJA 4JF9A 3CGAA 1EL4A 3CR5X 1GGXA 4PHNA 1WLZA 3I19A 4DS7A 2M7LA 1C7VA 3DD4A 2OS8C 3SJSA 4TZAA 4C0LA 3VICA 1SK6D 1K9UA 2L4HA 4GGNA 4B5YA 2MRDA 1VRKA 3SIAA 2QT2A 3DQJA 5AQBB 1B4CA 1M39A 3VROA 2NCOA 3PATA 5JOLA 2NLNA 2KAYA 1A75A 2PXSA 3BXBA 4IK8A 3OSRA 5HKWA 1CFDA 3WLCA 1YRUB 1EMKA 1R6PA 3LSAA 1SCMB 4GUKA 1JWDA 3ST3A 1Q4DA 4Z4MA 3OB1B 3PJ7A 1QYQA 5EB6A 2BKHB 3QRXA 3O2PA 3P28A 4JPZB 2F3ZA 2IS9A 4LJDC 4MBEA 3A8SA 2JT3A 3MSEB 1LINA 1NCYA 2KGRA 2O24A 2CT9A 2LP2A 2H5RA 2ZMWA 4CLNA 2ZKMX 5K89A 1CDLA 4KGFA 3KO0A 2WNDA 2K2AA 1CNPA 1MYWA 2DUGA 1RJVA 1MUXA 5HLVA 1SR6C 4P2YB 1Z1QA 2BL0B 4RTCA 2HJOA 2M97A 4HRGA 5D69A 1BT6A 3WNXB 2AUCA 1MHOA 1XK4A 2P4MA 4M2QA 1QX7A 3UFZA 5KU1A 1GGZA 1H8BA 4ORCB 1KSMA 3NSOA 2RGIA 3KCTA 3DQIA 3DQFA 2A50B 3U0KA 2OTGC 4MN0A 3PJBA 5KTGA 4MZLA 1XFXO 4QJ5B 2LNKA 2Y1MA 4H48A 3SSYA 2VRGA 1IQ3A 1KFXL 1IG5A 1KCYA 3LK0A 3U8AA 1RK9A 4PHKA 3RLZA 1DTLA 4W6KA 5BTTB 3NEZA 4DIRA 2WCBA 2ZNEA 4JGEA 4P5OE 1XSSA 1YVHA 2O29A 2ZNDA 1MWNA 4I5NB 3PALA 3CBEA 4MZJA 3TMRA 1XA9A 3SS0A 1B8LA 2V4EC 1UHJA 2EMDA 2VADA 3OGOA 2BE4A 2M7NA 1TNWA 1A4PA 2PALA 2H61C 3SVCA 3NF0A 2M1KB 1Y6WA 3ZNIA 5LTRA 1ZGPA 1TN4A 1J7PA 1A29A 2YFPA 1YR5A 2BCBA 3DQ3A 3CB9A 2LP3A 5HZSA 3JVTB 4KPIA 1XO5A 2H5OA 1S3PA 2FOTA 1YJFA 2IE2A 3TMTA 2FWQA 4ZCVA 2IOVA 1F4QA 1LKJA 1OXDA 4GPLB 2GW3A 2GX0A 1EJ3A 5DU0A 3RM1A 1SCVA 4D1EA 2I7AA 1XFVO 2DUFA 5DPIA 2L0PA 4DUQA 1OQPA 2OTEA 1TCFA 2BCXA 2K2FA 1K96A 4W6FA 2KI4C 2AWKA 1DVIA 4A4BA 1JC2A 3DQ2A 1KWOB 4YI8A 4W6NA 1MOVA 1K90D 4FTGA 3AKBA 2JC2A 1NIWA 1JUOA 3TS5B 2GW4B 3D10A 2H9WA 4LJCA 4DCKA 1LVCD 4EDOA 2KBMA 1NUBA 3D0YA 5D7FA 5HBDA 5I8NA 3H4SE 2BTJA 4WQ3A 4HREE 3DQ6A 4GGFC 1HQVA 1QV1A 2MHHA 2M9GA 1OXFA 3PLFB 1LA3A 1QVIY 5CSNA 3LF4B 1RFJA 1AVSA 1J7QA 1RM9A 1N0YA 2HFCA 3U8CA 4W7RA 3OHMB 1BR4B 1RWYA 3FS7A 2SCPA 4KF5C 2LVVA 3SG3A 4ZIOA 4XGYA 2DUEA 2L51A 2MAZA 4PDZA 3SG2A 1UP5A 1YZWA 3EKJA 3CS1A 1CMGA 2WHSA 3F45A 1DF0B 5F9GA 4IL1A 3SVRA 4P76A 4L1IA 4ZF5A 3PFVA 4ZF4A 1NX1A 2JTZA 3E3RA 4W6IA 1SMGA 3WHUB 1SCMC 4PE0A 1F8HA 1B9CA 1RROA 4Q7UA 1JF2A 2K7OA 2B3PA 1W7TA 5T3IA 1NPQA 2BKIB 5DTLA 3OX5A 3CGLA 3NEDA 4LW5A 3ST0A 2LM5A 2NXQA 3H1OA 2OTBA 2G2SB 3DQ4A 4MSPA 4Q04A 1S6CA 5H89A 2Y1NA 3DF0B 4PHMA 3CZTX 4JEOA 1KQVA 2BL0C 2QLEA 4HQ9A 3E5VA 1N65A 3DQ7A 4DKNA 4IK5A 1CB1A 4B30A 3O6BA 4W7CA 2WHTA 4W6OA 4C0KA 3LS3A 1CLLA 5LTPA 2JULA 4ORNA 5CPVA 2LV7A 2CXJA 2LUXA 3SG4A 1YTZC 1S1EA 1XVJA 2PVBA 1TTXA 4PE4A 1YUSA 3JTDB 3VK1A 3HCMA 3SSTA 1IGVA 4HRHA 1KFUS 2ZO7A 4PFEA 4ZINA 1K95A 1A03A 4W75A 3M22A 3SSPA 5HW9A 5JJGA 1HCJA 5DRGA 5CSIA 4KW8A 2ZN9A 1QYFA 4OHSA 1QLSA 1M31A 2HQZA 2KAVA 4PE1A 4W6AA 1L2OB 3I5IC 2TN4A 5J2OA 1XFYO 3CR2A 4YI9A 1YHGA 1B7TY 2ZO6A 2K7CA 1KFXS 1B9AA 2QZ0A 2YE1A 4OCIA 4GBAA 3LVDA 1DJHA 3JVTC 1A75B 3NXAA 1FI6A 4EULA 1IJ5A 2BCAA 2L2EA 5TNCA 1WY9A 3DVMA 1FPWA 1G33A 3U0NA 4OQWA 4OY4A 1QIVA 5DTYA 1QS7A 3SV5A 2WORA 1QXPA 4H47A 3LVAA 2JNFA 2MA2A 3RWAA 2FL1A 1XFZO 5DKRA 4W6RA 2P6BB 3A4UB 2VVHA 2ICRA 1PSRA 2JT0A 3DQOA 1KK7Y 5KSZA 4ICBA 1CMFA 5HZOA 1PULA 3GJ2A 5HZTA 1KWOC 2KOTA 4QJ3B 5KTYA 4JQ0D 4W6HA 2QRFA 5AFPA 2HQ8A 1C07A 3AAKA 4NWSA 1DGVA 5AANA 4JFGA 5DKQA 3TS5C 4PPKA 4GESB 3GK4X 1U5IA 2ARLA 3TDIA 2KSPA 3PIBA 4IZNA 2LLTA 1F0BA 1JC0A 1WLMA 1G4YR 2JXCA 2JNXA 2LMUA 4OJ0A 5PALA 4NDBA 2KBIA 4DXNA 1KSOA 3CWGA 2EGDA 1Q4BA 1QTXA 1OMDA 1QIWA 4OKHA 3VHTA 2AHAA 1BJFA 2A54B 1ALVA 4AOMA 1F70A 1BOCA 2M49B 3AKOA 1J7OA 4L13A 3LK1A 1RRXA 3BXAA 3NT9A 1KFUL 2KGBC 3VRPA 1V1GA 4IK1A 1SL7A 4GNKB 1BLQA 1FBVA 4YGEB 3CD1A 1NWDA 2Z6ZA 4ETOA 5BPJA 4WRIA 3AI5A 2JQ6A 5EXUA 3ICBA 1Q80A 1DJIA 3LF3A 2H8QA 1NSHA 1S6JA 5H87A 4L9MA 5DPHA 1SY9A 2HRSA 1OMRA 4DKMA 2PASA 4F0ZB 1KYSA 4ORBB 5FVGA 4PHJA 2QPTA 3FWBA 1ZGOA 2VVJA 2G6YA 5EBJA 2M29A 1EMGA 1YJ2A 4HSZA 1OE9B 2E30A 3U8PA 2EHBA 4GOBA 4W77A 3AI4A 3IQQA 1AJ5A 2KI6D 1K94A 2QACA 1IH0A 4OR9B 1EG3A 1KYRA 5FVFA 4MEWA 3U0LA 5DTZA 3EVRA 2O5GA 4PE7A 2A56B 1RTP1 3DQMA 2E6WA 1JBZA 3NT3A 4W7AA 3SG7A 2DD9A 2IB6A 2GGZA 4EN1A 2FJUB 1JF0A 1ZFSA 3D0YB 2KNEA 1RMOA 2JU0A 4W7EA 4QJ4B 4RYSA 2LVIA 3JTDC 4MZKA 4YGDB 1JC1A 2LE9B 3KEVA 4NDCA 1GFLA 4PCWA 1ZOTB 3DQNA 3O77A 4L12A 1BR1B 1SYMA 4OVNF 3BUNB 3EVVA 2ZRSA 3I5FB 2Z1OA 1S6ZA 2ZFDA 1EG4A 4M2OA 1L2OC 5EB7A 1PK0D 1NX0A 4W6DA 1J1DA 1S36A 3BUMB 4N5XA 3IQOA 2MJWB 2JRFA 1CLBA 3TUYB 3EKHA 4W7FA 4LQUA 3SVSA 1QXTA 1AJ4A 1WDCB 2L98A 2I2RE 1H4BA 2AH8A 2MBXA 4OGSA 2B3QA 1Q4AA 1MOUA 2B1UA 4ANJA 4CFQA 5HLOA 3IR8A 2WOSA 4R1EA 3SVEA 1AP4A 1Z1PA 1RMPA 5CSFA 2AAOA 2Z6XA 1QVIZ 2LLSA 1H6RA 1XQMA 2QLGA 3HX4A 1S5GY 1MXEA 4AR7A 3WXAA 2DOQA 2JT8A 1J7RA 1NX2A 5HKZA 4Q9WA 1Y1AA 4N3DA 3TDUA 1EMAA 2KDHA 1XK4C 2NCPA 2LLUA 4B30B 3CFFA 1JBAA 2Q57A 2G3DB 2A48A 3BUXB 2PMYA 2AWJA 5EJUA 1BMOA 4Q7TA 1OZSA 1E8AA 4CFRA 1XFWO 2HGYA 4W6SA 5LTQA 4DXOA 1NX3A 1YX8A 3GEXA 3SSLA 2EC6B 5DRFA 1K8UA 1YFPA 4KAGA 1W7IB 3LVCA 1ALWA 4H3LA 2YDZA 1CDNA 4JC2A 1IQ5A 2G2BA 3BYAA 4ZCUA 4N1GA 1W7SA 2LCPA 3DPXA 1ZACA 3BXCA 3SVOA 1DJGA 1F4OA 1TCOB 1PVAA 3SVNA 1BODA 4LJDA 4I2YA 2DD7A 1TIZA 1G8IA 4R6DA 1SPYA 2DDDA 1KK8B 3VRRA 5EHUA 1JFJA 4DXIA 1GQMA 2G9BA 1X02A 3KPXA 4XYNA 5BQLA 4XJKA 3ZULA 1QX5B 2FCEA 5DY6A 5CSJA 2O2BA 2RH7A 4R6BA 3DQAA 2F3YA 2LHIA 3LCPC 4BY4A 2L50A 4MVFA 1CM1A 1FW4A 4U2VA 4U8DA 2KAXA 4IK3A 3BXKA 4H3MA 1SNLA 3DVEA 2M8UA 1UISA 2GX2A 4LQTA 4CPVA 2EMNA 1CDMA 3O78A 1QY3A 2K0JA 2LUCA 2L5XB 5DPJA 4W7XA 4C0JA 1BF5A 3ZUJA 2JPTA 1K2HA 3BX9A 3CD9A 2LVKA 3LL8B 1V1FA 3LLEA 1EMBA 2VZXA 2KFHA 2BECA 4W6TA 4W6BA 3TZ1A 2KQYA 2ZRTA 1KP5A 4ZBLA 1A2XA 2M1UA 3KF9A 1CM4A 1Q4CA 2QLHA 1HT9A 3BUOB 4W6PA 2GV5A 5LK4A 1MQ1A 2V4EA 1B7TZ 3NSKA 1PRWA 2JXLA 3PJ5A 3I5GB 2K7DA 3DQEA 3DPWA 1YVLA 2F2OA 1EMEA 2H61A 3UG0A 1U5IB 2A53B 3M24A 3PSRA 2Y4QA 2Q6PA 2WIQA 4DXPA 1CFCA 4BY5A 2YE0A 5ER5A 4YGCB 2KFFA 1F09A 1OMVA 4EDSA 2G6XA 2K61A 4N1FA 4XOWA 2BE6A 3VRQA 4NQGA 4IK9A 1QX2A 1XAEA 1K9PA 2EMOA 2LC5A 4HE4A 3SIBA 3I5FC 1RECA 2R2IA 4YBHB 3VHTB 1IWQA 2KFGA 4JRBA 4KF4A 3CLNA 1AHRA 1XA5A 2L4IA 3EVUA 4DXQA 1C4FA 4P1QA 4PALA 2DDCA 1KK7Z 4NDDA 2WHUA 3SSVA 1BU3A 2QLIA 2HQWA 4W6LA 3TUYC 2FCDA 3BOWA 2IB5A 4YGBB 3SVDA 5HZUA 4MRXA 2F2PA 5DTXA 4ZF3A 2A52B 1WDCC 3ZTFA 1QV0A 4YRUA 2CTNA 2HCGA 5HYDA 2OKWA 3ZWHA 2AWMA 1N2DA 1GGWA 3LA1A 1TOPA 2GGMA 1EXRA 2ISDA 2LMVA 5HKYA 2Y5IA 4AS8A 3FIAA 1ZGQA 2WC8A 5I2QA 4Q7RA 3O4YA 3KCSA 1CLMA 1FF1A 3FWCA 1OOJA 1YHHA 4GGFA 3PN7B 4W7DA 1JSAA 3VRNA 1SBJA 3GB3A 4PPLA 2CCMA 1YHIA 3SG5A 4XL5A 4KEXA 4H3NA 4DXMA 4GF6B 1YUUA 2VAEA 3TDZA 1M63B 1CV7A 1WRLA 4W73A 2HPSA 1C7WA 3S05A 4E68A 2FZUA 3I5HB 3DQ8A 4PPJA 3ED8A 1AUIB 4KF5A 1CFPA 1FI5A 3DVJA 3G9AA 1Y0VH 1IRJA 1ZUZA 1Y1UA 4LJBA 2KYFA 4MRYA 1UHKA 1KQMB 4CIDA 3ZUFA 1Q73A 2EC6C 1DGUA 3SRYA 1R2UA 2KI6C 3A8RA 1K9KA 1J1EA 1BFPA 3IF7A 1QYOA 1LXFC 3NSLA 1MXLC 2OPOA 2SASA 3WLDA 2A47A 1GJYA 1WRKA 2HQKA 4I5JA 1LA0A 5ER4X 1KYPA 4GFTA 1YURA 2JZIA 4AQJA 3DQCA 1AK8A 3OSQA 1KK8C 2BBMA 2JOJA 2HGDA 2A46A 1DJWA 1S6IA 5DPGA 1NYAA 4A4CA 2WSNA 3CR4X 3KHEA 3GK2A 1UHIA 4W6UA 3I5IB 1NCZA 1XMZA 4KGEA 2C9IA 3GL4A 4J89A 1BG1A 1UHHA 4BDUA 2LANA 5J3XA 1DT7B 3DQKA 1UUSA 1NCXA 2WURA 4USLA 4W6CA 5FHVA 1DMOA 1OXEA 1UHNA 5I2OA 2PXWA 3WHTB 1Q4EA 5DQMA 4W6JA 4W76A 1PSBA 3M0WA 5AEQA 1Y1XA 1M45A 2QLGB 2ZMUA 1QJTA 5BTTA 4XOVA 5BT0A 2CBLA 1J55A 2WISA 1CFFA 4IK4A 2OS8B 2A4JA 5IBWA 4W6MA 1IKUA 3VGOA 3GJ1A 3SSHA 2H6VA 3DQLA 2K8MB 3EK8A 3I5GC 1UURA 2H5QA 1B8CA 4HQCA 2HETA 2KYCA 2OGRA 3C1VA 3DQDA 1K93D 2WCFA 3DQ5A 1TNQA 1TRFA 4OV2A 1SKTA 1XYDA 3K21A 5EXCI 4M2PA 3PM8A 2VVIA 2CNPA 4I5LB 4EMQA 4KW4A 3CTNA 1DJXA 4W6GA 2JWWA 4Z4KA 3IP2A 3U0MA 2ZN8A 5HGEA 1DJZA 4J88A 4ZFSA 4GAOA 1B47A 1TNXA 2NZ0A 1MR8A 2HF5A 2LHLA 1S5GZ 4ORAB 2HPWA 4UTSA 1UWOA 1F54A 3ADFA 2H2KA 5H88A 5GQQC 5AXIA 4XVPA 2Z6YA 1YRTB 2D8NA 3DQUA 1TNPA 3CFAA 4HQ8A 1F71A 3BQ3A 2F33A 1YUTA 3DQ1A 4TZGA 1PALA 1EMFA 3P8UA 2QU1A 2BBNA 3BUWB 3W1DA 2I18A 1SR6B 4FQOA 1S26D 4XJKB 1QLKA 4KA9A 2DUIA 3MGFA 3W1CA 2LVJA 5DKNA 2G3OA 5I2LA 1ZUXA 2LAPA 2COLB 2F8PA 1JFKA 1IJ6A 5EXBA 1OZOA 4YGAA 2OTGB 2K7BA 3PN7C 3H1RA 1B8RA 1D1OA 2H5PA 3K1KA 1F55A 3ST4A 1EMCA 4MLWA 3SVBA 1B1GA 2DUHA 2LMTA 4W74A 3CFHA 3E5WA 4WQ2A 1QASA 4UPGA 3GOFA 1CTRA 2MLEC 3AKAA 3SVUA 1H4UA 3I5HC 4ZB1A 2POXA 1EMMA 4RYWA 2MLFC 2WSOA 1JBYA 3SSKA 1GL4A 2PSRA 4I5KA 1HUYA 1YX7A 2V4EB 4TNCA 5DQBA 2O60A 1KQMC 1DF0A 2JADA 3WCKA 1ZMZA 3EK7A 1WRZA 5F6TA 1SW8A 1QATA 4DRWA 2V53A 2C9JA 3EVPA 1CDPA 2PRUA 1ODBA 3DPZA 2OKYA 2Q91A 1DJYA
chains in the Genus database with same CATH superfamily
2KQ6A 4KW9A 3D76A 2ERBA 5AERA 4J8AA 4W72A 1RMMA 1W7UA 1NP8A 3OB2B 4IJ7A 2I94A 2AWLA 3DQ9A 1OSAA 2JTTA 2Q4UA 1SL9A 3SG6A 5G08A 3EK4A 3NSIA 1SRAA 1W7JB 3DF0A 2G5ZB 3OX6A 5FYXA 4AQIA 2KI4B 3BOWB 3DQHA 3DVKA 2FJYA 2M0RA 2G6EA 3OP0A 4W69A 4JWQA 3GK1A 1MF8B 3E5TA 1M46A 3L4AA 5FVIA 1XFUO 1EH2A 3RWTA 3V3DA 1G7KA 3DY9A 4HVFA 2G16B 1CKKA 1TUZA 2Y0GA 1L7ZA 5B8IB 1SL8A 2OJKA 2WCEA 1EMLA 2KHNA 3ST2A 1PVBA 2AMIA 1OW4A 4Q9XA 2M3WA 3AAJA 4JF9A 3CGAA 1EL4A 3CDNA 3CR5X 1GGXA 4PHNA 1WLZA 3I19A 4DS7A 2M7LA 1C7VA 3DD4A 2L5YA 2OS8C 3OBVA 5HL1A 3SJSA 4TZAA 4C0LA 3VICA 1SK6D 1K9UA 2L4HA 4GGNA 3BFAA 4B5YA 2MRDA 1VRKA 3SIAA 2QT2A 1IIOA 3DQJA 5AQBB 1B4CA 1M39A 3VROA 2NCOA 3PATA 5JOLA 2NLNA 2KAYA 1A75A 2PXSA 1DC1A 3BXBA 4IK8A 3OSRA 5HKWA 1CFDA 3WLCA 1YRUB 1EMKA 1R6PA 3LSAA 1SCMB 4GUKA 1JWDA 3ST3A 1Q4DA 4Z4MA 3D77A 3OB1B 3PJ7A 3IVTA 1QYQA 5EB6A 2BKHB 3QRXA 3O2PA 3B7AA 3P28A 4OZDA 4JPZB 2F3ZA 2IS9A 4LJDC 4MBEA 3A8SA 2JT3A 3MSEB 1LINA 1NCYA 2KGRA 2O24A 2CT9A 2LP2A 2H5RA 2ZMWA 4CLNA 2ZKMX 1DQEA 5K89A 1CDLA 4KGFA 3KO0A 2WNDA 2K2AA 1CNPA 1MYWA 2DUGA 1RJVA 1MUXA 5HLVA 1SR6C 4P2YB 1Z1QA 2BL0B 4RTCA 2HJOA 2M97A 4HRGA 5D69A 1BT6A 3WNXB 2AUCA 1MHOA 1XK4A 2P4MA 4M2QA 1QX7A 3UFZA 5KU1A 1GGZA 1H8BA 4ORCB 1KSMA 3NSOA 2RGIA 3KCTA 3DQIA 3DQFA 2A50B 3U0KA 2OTGC 4MN0A 3PJBA 5KTGA 4MZLA 1XFXO 4QJ5B 2LNKA 2Y1MA 4H48A 3SSYA 2VRGA 3CZ2A 1IQ3A 1KFXL 1IG5A 1KCYA 3LK0A 3U8AA 1RK9A 4PHKA 3RLZA 1DTLA 4W6KA 5BTTB 3NEZA 3CYZA 4DIRA 2WCBA 2ZNEA 4JGEA 4P5OE 1XSSA 1YVHA 2O29A 2ZNDA 1MWNA 4I5NB 3PALA 3R1PA 3CBEA 4MZJA 3TMRA 1XA9A 3SS0A 1B8LA 2V4EC 1UHJA 2EMDA 2VADA 3OGOA 2BE4A 2M7NA 1TNWA 1A4PA 2PALA 2H61C 3SVCA 3NF0A 2M1KB 1Y6WA 3ZNIA 5LTRA 1ZGPA 1TN4A 1J7PA 1A29A 2YFPA 1YR5A 2BCBA 3DQ3A 3CB9A 2LP3A 5HZSA 3JVTB 4KPIA 1XO5A 2H5OA 1S3PA 2YGUA 2FOTA 1YJFA 2IE2A 3TMTA 2FWQA 4ZCVA 2IOVA 1F4QA 1LKJA 1OXDA 4GPLB 2GW3A 2GX0A 1EJ3A 5DU0A 3RM1A 1SCVA 4D1EA 3FE9A 2I7AA 1XFVO 2DUFA 5DPIA 2L0PA 4DUQA 1OQPA 2OTEA 1TCFA 2BCXA 2K2FA 3K1EA 3UNWA 1K96A 4W6FA 2KI4C 2AWKA 1DVIA 3Q8IA 4A4BA 1JC2A 3DQ2A 1KWOB 4YI8A 4W6NA 1MOVA 1K90D 4FTGA 1QWVA 3AKBA 2JC2A 1NIWA 3D78A 1JUOA 2BNXA 3TS5B 2GW4B 3D10A 2H9WA 4LJCA 4DCKA 1LVCD 4EDOA 2KBMA 1NUBA 3D0YA 3CABA 5D7FA 1Z2CB 5HBDA 5I8NA 3H4SE 5FI2A 2BTJA 4WQ3A 4HREE 3DQ6A 4GGFC 1HQVA 1QV1A 2MHHA 2M9GA 1OXFA 3PLFB 1LA3A 1QVIY 5CSNA 3LF4B 1RFJA 1AVSA 1J7QA 1RM9A 1N0YA 3CZ0A 2HFCA 3U8CA 4W7RA 3OHMB 1BR4B 1RWYA 3FS7A 1ORGA 3NHIA 2SCPA 4KF5C 2LVVA 3SG3A 4ZIOA 4XGYA 2DUEA 2L51A 2MAZA 4PDZA 3SG2A 1UP5A 1YZWA 3S0GA 3EKJA 3CS1A 1CMGA 2WHSA 3F45A 1DF0B 5F9GA 4IL1A 3SVRA 4P76A 4L1IA 4ZF5A 3PFVA 4ZF4A 1NX1A 2JTZA 3E3RA 4W6IA 1SMGA 3WHUB 1SCMC 4PE0A 1F8HA 1B9CA 1RROA 4Q7UA 1JF2A 2K7OA 2B3PA 1W7TA 5T3IA 1NPQA 2BKIB 1TUJA 5DTLA 3OX5A 3CGLA 3NEDA 4LW5A 3ST0A 1OOIX 2LM5A 2NXQA 3H1OA 3L4LA 1SSEB 2OTBA 2G2SB 3DQ4A 2WC5A 4MSPA 4Q04A 1S6CA 5H89A 2Y1NA 3DF0B 4PHMA 3CZTX 4JEOA 3B6XA 2QLEA 1KQVA 2BL0C 4HQ9A 3E5VA 1N65A 3DYEA 3SS4A 3DQ7A 4DKNA 4IK5A 1CB1A 4B30A 3O6BA 4W7CA 2WHTA 4W6OA 4C0KA 3LS3A 3N7HA 1CLLA 5LTPA 2JULA 4ORNA 3V2LA 5CPVA 2LV7A 2CXJA 2LUXA 3SG4A 1YTZC 1S1EA 1XVJA 2PVBA 1TTXA 4PE4A 1YUSA 3JTDB 3VK1A 3HCMA 3SSTA 1IGVA 4HRHA 1KFUS 2ZO7A 4PFEA 4ZINA 1K95A 1A03A 4W75A 3M22A 3SSPA 5HW9A 5JJGA 1HCJA 5DRGA 5CSIA 4KW8A 5FI6A 2ZN9A 1QYFA 4OHSA 1QLSA 1M31A 2HQZA 2KAVA 4PE1A 4W6AA 1L2OB 3I5IC 2TN4A 5J2OA 1XFYO 3CR2A 4YI9A 1YHGA 1B7TY 2ZO6A 2K7CA 1KFXS 1B9AA 2QZ0A 2YE1A 4OCIA 4GBAA 3LVDA 5DICA 1DJHA 3JVTC 1A75B 3NXAA 1FI6A 2WCKA 4EULA 1IJ5A 2BCAA 2L2EA 5TNCA 1WY9A 3DVMA 1FPWA 1G33A 3U0NA 4OQWA 4OY4A 1QIVA 5DTYA 1QS7A 3SV5A 2WORA 1QXPA 4H47A 3LVAA 3RZSA 2JNFA 2MA2A 3RWAA 2FL1A 1XFZO 5DKRA 4W6RA 2P6BB 3A4UB 2VVHA 2ICRA 1PSRA 2JT0A 3DQOA 1KK7Y 5KSZA 4ICBA 1CMFA 5HZOA 2QEVA 1PULA 3GJ2A 5HZTA 1KWOC 2KOTA 4QJ3B 5KTYA 4JQ0D 4W6HA 2QRFA 1Z4HA 5AFPA 2QEOA 4PT1A 2HQ8A 1C07A 3AAKA 4NWSA 1DGVA 5AANA 2QDIA 4JFGA 5DKQA 3TS5C 4PPKA 4GESB 3GK4X 1U5IA 2ARLA 3TDIA 2KSPA 3PIBA 4IZNA 2LLTA 1F0BA 1JC0A 1WLMA 3D74A 1G4YR 2JXCA 2JNXA 2LMUA 4OJ0A 3DZTA 5PALA 4NDBA 2KBIA 4DXNA 1KSOA 3CWGA 2EGDA 1Q4BA 1QTXA 1OMDA 1QIWA 4OKHA 3VHTA 2AHAA 1BJFA 2A54B 1ALVA 4AOMA 1F70A 1BOCA 2M49B 3AKOA 1J7OA 4L13A 3LK1A 1RRXA 3BXAA 3NT9A 1KFUL 2KGBC 2QEHA 3VRPA 1V1GA 4IK1A 1SL7A 4GNKB 3SS5A 1BLQA 1FBVA 4YGEB 3CD1A 1NWDA 2Z6ZA 4ETOA 5BPJA 4WRIA 3AI5A 2JQ6A 5D3OA 5EXUA 3ICBA 1Q80A 1DJIA 3LF3A 2H8QA 1NSHA 1S6JA 5H87A 4L9MA 5DPHA 3S0EA 1SY9A 2HRSA 1OMRA 4DKMA 2PASA 4F0ZB 1KYSA 4ORBB 3S0DA 5FVGA 4PHJA 2QPTA 3FWBA 3S0BA 1ZGOA 2VVJA 2G6YA 5EBJA 2M29A 1EMGA 1YJ2A 3B87A 4HSZA 1OE9B 2E30A 3U8PA 2EHBA 4GOBA 4W77A 3AI4A 3IQQA 1AJ5A 2KI6D 1K94A 2QACA 1IH0A 3UO9A 4OR9B 1EG3A 1KYRA 5FVFA 4MEWA 3U0LA 5DTZA 3EVRA 2O5GA 4PE7A 2A56B 1RTP1 3DQMA 2E6WA 2PQLA 1JBZA 3NT3A 4W7AA 3SG7A 2DD9A 2IB6A 2GGZA 4EN1A 2FJUB 1JF0A 1ZFSA 3D0YB 2WC6A 2KNEA 1RMOA 2JU0A 4W7EA 4QJ4B 4RYSA 2LVIA 3JTDC 4MZKA 4YGDB 1JC1A 2LE9B 3KEVA 4NDCA 1GFLA 4PCWA 1ZOTB 3DQNA 3B88A 3O77A 4L12A 1BR1B 1SYMA 4OVNF 3BUNB 3EVVA 2ZRSA 3I5FB 2Z1OA 3FE6A 1S6ZA 1C3ZA 2ZFDA 1EG4A 4M2OA 1L2OC 5EB7A 1PK0D 1NX0A 4W6DA 1J1DA 1S36A 3BUMB 4N5XA 3IQOA 2MJWB 2JRFA 1CLBA 3TUYB 3EKHA 4W7FA 4LQUA 3SVSA 1QXTA 1AJ4A 1WDCB 2L98A 2I2RE 1H4BA 2AH8A 2MBXA 4OGSA 2B3QA 1Q4AA 1MOUA 2B1UA 4ANJA 4CFQA 5HLOA 3IR8A 2WOSA 3CZ1A 4R1EA 3SVEA 1OOGA 1AP4A 2P70A 1Z1PA 1RMPA 5CSFA 2AAOA 2Z6XA 1QVIZ 2LLSA 2QEBA 1H6RA 2P71A 1XQMA 2QLGA 3HX4A 1S5GY 3EG5B 1MXEA 4AR7A 3WXAA 2DOQA 2JT8A 1J7RA 1NX2A 5HKZA 5FI7A 4Q9WA 1Y1AA 4N3DA 3TDUA 1EMAA 2KDHA 1XFRA 1XK4C 2NCPA 2LLUA 4B30B 3CFFA 1JBAA 2Q57A 2G3DB 3R1OA 2A48A 3BUXB 2PMYA 2AWJA 5EJUA 1BMOA 4Q7TA 1OZSA 1E8AA 4CFRA 1XFWO 2HGYA 4W6SA 5LTQA 4DXOA 1NX3A 2WCJA 1YX8A 3GEXA 3SSLA 3S0FA 2EC6B 5DRFA 1K8UA 1YFPA 4KAGA 1W7IB 2JPOA 3LVCA 1ALWA 4H3LA 2YDZA 1CDNA 3D73A 4JC2A 1IQ5A 2G2BA 3BYAA 4ZCUA 4N1GA 1W7SA 1OOHA 2LCPA 3DPXA 1ZACA 3BXCA 3SVOA 1DJGA 2GTEA 1F4OA 1GM0A 1TCOB 3R72A 3L47A 1PVAA 3SVNA 1BODA 4LJDA 4I2YA 2DD7A 1W9ZA 3O4XA 1TIZA 1G8IA 4R6DA 1SPYA 2DDDA 1KK8B 3VRRA 5EHUA 1JFJA 4DXIA 1GQMA 2G9BA 1X02A 3KPXA 4XYNA 2BAPA 5BQLA 4XJKA 4FQTA 3ZULA 1QX5B 2FCEA 5DY6A 5CSJA 2O2BA 2RH7A 4R6BA 3DQAA 2F3YA 2LHIA 3LCPC 4BY4A 2L50A 4MVFA 1CM1A 1FW4A 4U2VA 4U8DA 2KAXA 4IK3A 3BXKA 4H3MA 1SNLA 3DVEA 2M8UA 1UISA 2GX2A 4LQTA 4CPVA 2EMNA 1CDMA 3O78A 1QY3A 2K0JA 4JKTA 2LUCA 2L5XB 5DPJA 4W7XA 4C0JA 1BF5A 3ZUJA 2JPTA 1K2HA 3BX9A 3CD9A 2LVKA 3LL8B 1V1FA 3LLEA 3D75A 1EMBA 2VZXA 2KFHA 2BECA 4W6TA 4W6BA 3TZ1A 2KQYA 2ZRTA 1KP5A 4ZBLA 1A2XA 2M1UA 3KF9A 1CM4A 1Q4CA 2QLHA 1HT9A 3BUOB 4W6PA 2GV5A 5LK4A 1MQ1A 2V4EA 1B7TZ 3NSKA 1PRWA 2JXLA 3I5GB 3PJ5A 2K7DA 3DQEA 3DPWA 1OOFA 1YVLA 2F2OA 3PM2A 1EMEA 2H61A 3UG0A 1U5IB 2A53B 3M24A 3PSRA 2Y4QA 2Q6PA 2WIQA 4DXPA 1CFCA 4BY5A 2YE0A 5ER5A 4YGCB 2KFFA 1F09A 1OMVA 4EDSA 2G6XA 2K61A 4N1FA 4XOWA 2BE6A 3VRQA 4NQGA 4IK9A 1QX2A 1XAEA 1K9PA 2EMOA 2LC5A 4HE4A 3SIBA 5I94A 3I5FC 1RECA 3BJHA 2R2IA 4YBHB 3VHTB 1IWQA 2KFGA 4JRBA 3CLNA 1AHRA 1XA5A 2L4IA 3EVUA 4KF4A 4DXQA 1C4FA 4P1QA 4PALA 2H8VA 2DDCA 1KK7Z 4NDDA 3B86A 2WHUA 3SSVA 1BU3A 2QLIA 2HQWA 4W6LA 3TUYC 2FCDA 3BOWA 2IB5A 4YGBB 3SVDA 5HZUA 4MRXA 2F2PA 5DTXA 4ZF3A 2A52B 1WDCC 3ZTFA 1QV0A 4YRUA 2CTNA 2HCGA 5HYDA 2OKWA 3ZWHA 2AWMA 1N2DA 1GGWA 3LA1A 1TOPA 2GGMA 1EXRA 2ISDA 2LMVA 2WCMA 5HKYA 2Y5IA 4AS8A 3FIAA 1ZGQA 2WC8A 5I2QA 4Q7RA 3O4YA 3OGNA 3KCSA 1CLMA 1FF1A 3FWCA 1OOJA 1YHHA 4GGFA 3PN7B 3SS3A 4W7DA 1JSAA 3VRNA 1SBJA 3GB3A 4PPLA 2CCMA 1YHIA 3SG5A 4XL5A 4KEXA 4H3NA 4DXMA 4GF6B 1YUUA 2VAEA 3TDZA 2K60A 1M63B 1CV7A 1WRLA 4W73A 2HPSA 1C7WA 3S05A 4E68A 2FZUA 3I5HB 3DQ8A 4PPJA 3ED8A 1AUIB 4KF5A 1CFPA 1FI5A 3DVJA 3G9AA 1Y0VH 1IRJA 1ZUZA 1Y1UA 4LJBA 2KYFA 4MRYA 1UHKA 1KQMB 4CIDA 3ZUFA 1Q73A 2EC6C 1DGUA 3SRYA 1R2UA 2KI6C 3A8RA 1K9KA 1J1EA 1BFPA 3IF7A 1QYOA 3QMEA 1LXFC 3NSLA 1MXLC 2OPOA 2SASA 3WLDA 2A47A 1GJYA 1WRKA 2HQKA 4I5JA 1LA0A 5ER4X 1KYPA 4GFTA 1YURA 2JZIA 4AQJA 3DQCA 3FE8A 1AK8A 3OSQA 1DELA 1KK8C 2BBMA 2JOJA 2HGDA 2A46A 1TWOA 1DJWA 1S6IA 5DPGA 1NYAA 4A4CA 2WSNA 3CR4X 3KHEA 3GK2A 1UHIA 4W6UA 3I5IB 1NCZA 1XMZA 4KGEA 2C9IA 3GL4A 3BFHA 4J89A 1BG1A 3BFBA 1UHHA 4BDUA 2LANA 5J3XA 5EL2A 1DT7B 3DQKA 1UUSA 1C3YA 1NCXA 2WURA 4USLA 4W6CA 5FHVA 1DMOA 1OXEA 1UHNA 5I2OA 2PXWA 3WHTB 2L2CA 1Q4EA 5DQMA 2KLDA 2WCLA 4W6JA 4W76A 1PSBA 3M0WA 5AEQA 3S0AA 1Y1XA 1M45A 2QLGB 2ZMUA 1QJTA 5BTTA 4XOVA 5BT0A 2CBLA 1J55A 4INWA 2WISA 1CFFA 4IK4A 2OS8B 2A4JA 5IBWA 4W6MA 1IKUA 3VGOA 3GJ1A 3SSHA 2H6VA 3DQLA 3NHTA 2K8MB 3EK8A 3R1VA 3I5GC 2KPHA 1UURA 2H5QA 1B8CA 4HQCA 2HETA 2KYCA 2OGRA 3C1VA 3DQDA 1K93D 1P28A 3NGVA 2WCFA 3DQ5A 1TNQA 1TRFA 4OV2A 1SKTA 1XYDA 3K21A 5EXCI 1DEKA 4M2PA 3PM8A 2VVIA 2CNPA 4I5LB 4EMQA 4KW4A 3CTNA 1DJXA 4INXA 4W6GA 2JWWA 4Z4KA 3IP2A 3U0MA 2ZN8A 5HGEA 1DJZA 4J88A 4ZFSA 4GAOA 1B47A 1TNXA 1T14A 2NZ0A 1MR8A 2HF5A 2LHLA 1S5GZ 4ORAB 2HPWA 4UTSA 1UWOA 1F54A 3ADFA 2H2KA 5H88A 5GQQC 5AXIA 4XVPA 2Z6YA 1YRTB 2D8NA 3DQUA 1TNPA 3CFAA 4HQ8A 1F71A 3BQ3A 2F33A 1YUTA 3DQ1A 1PALA 4TZGA 2KLEA 1EMFA 2QU1A 2BBNA 3BUWB 3P8UA 3W1DA 2I18A 1SR6B 4FQOA 1S26D 4XJKB 1QLKA 4KA9A 2DUIA 4JD9A 2WCHA 3MGFA 3W1CA 2LVJA 5DKNA 2G3OA 5I2LA 1ZUXA 2LAPA 3DXLA 2COLB 2F8PA 1JFKA 1IJ6A 5EXBA 1OZOA 4YGAA 2OTGB 2K7BA 3PN7C 2PYQA 3H1RA 1B8RA 1D1OA 2H5PA 1LS8A 4F7FA 3K1KA 1F55A 3ST4A 1EMCA 4MLWA 3SVBA 1B1GA 2DUHA 2LMTA 4W74A 3CFHA 3E5WA 4WQ2A 1QASA 4UPGA 3GOFA 1CTRA 2MLEC 3AKAA 3SVUA 1H4UA 3I5HC 4ZB1A 2POXA 4KYNA 1EMMA 4RYWA 2MLFC 2WSOA 1JBYA 3SSKA 1GL4A 2PSRA 4I5KA 1HUYA 1YX7A 2V4EB 4TNCA 5DQBA 2O60A 1KQMC 1DF0A 3VB1A 2JADA 3WCKA 1ZMZA 3EK7A 1WRZA 5F6TA 3PJIA 1SW8A 1QATA 4DRWA 2V53A 2C9JA 3EVPA 1CDPA 2PRUA 1ODBA 3DPZA 2OKYA 2Q91A 1DJYA
chains in the Genus database with same CATH topology
2KQ6A 4KW9A 5AERA 4J8AA 4W72A 1RMMA 1W7UA 1NP8A 3OB2B 2I94A 2AWLA 3DQ9A 1OSAA 2JTTA 2Q4UA 1SL9A 3SG6A 5G08A 3EK4A 3NSIA 1SRAA 1W7JB 3DF0A 2G5ZB 3OX6A 5FYXA 4AQIA 2KI4B 3BOWB 3DQHA 3DVKA 2M0RA 2G6EA 3OP0A 4W69A 4JWQA 3GK1A 1MF8B 3E5TA 1M46A 5FVIA 1XFUO 1EH2A 3RWTA 3V3DA 1G7KA 4HVFA 2G16B 1CKKA 2Y0GA 1L7ZA 5B8IB 1SL8A 2OJKA 2WCEA 1EMLA 2KHNA 3ST2A 1PVBA 2AMIA 4Q9XA 2M3WA 3AAJA 4JF9A 3CGAA 1EL4A 3CR5X 1GGXA 4PHNA 1WLZA 3I19A 4DS7A 2M7LA 1C7VA 3DD4A 2OS8C 3SJSA 4TZAA 4C0LA 3VICA 1SK6D 1K9UA 2L4HA 4GGNA 4B5YA 2MRDA 1VRKA 3SIAA 2QT2A 3DQJA 5AQBB 1B4CA 1M39A 3VROA 2NCOA 3PATA 5JOLA 2NLNA 2KAYA 1A75A 2PXSA 3BXBA 4IK8A 3OSRA 5HKWA 1CFDA 3WLCA 1YRUB 1EMKA 1R6PA 3LSAA 1SCMB 4GUKA 1JWDA 3ST3A 1Q4DA 4Z4MA 3OB1B 3PJ7A 1QYQA 5EB6A 2BKHB 3QRXA 3O2PA 3P28A 4JPZB 2F3ZA 2IS9A 4LJDC 4MBEA 3A8SA 2JT3A 3MSEB 1LINA 1NCYA 2KGRA 2O24A 2CT9A 2LP2A 2H5RA 2ZMWA 4CLNA 2ZKMX 5K89A 1CDLA 4KGFA 3KO0A 2WNDA 2K2AA 1CNPA 1MYWA 2DUGA 1RJVA 1MUXA 5HLVA 1SR6C 4P2YB 1Z1QA 2BL0B 4RTCA 2HJOA 2M97A 4HRGA 5D69A 1BT6A 3WNXB 2AUCA 1MHOA 1XK4A 2P4MA 4M2QA 1QX7A 3UFZA 5KU1A 1GGZA 1H8BA 4ORCB 1KSMA 3NSOA 2RGIA 3KCTA 3DQIA 3DQFA 2A50B 3U0KA 2OTGC 4MN0A 3PJBA 5KTGA 4MZLA 1XFXO 4QJ5B 2LNKA 2Y1MA 4H48A 3SSYA 2VRGA 1IQ3A 1KFXL 1IG5A 1KCYA 3LK0A 3U8AA 1RK9A 4PHKA 3RLZA 1DTLA 4W6KA 5BTTB 3NEZA 4DIRA 2WCBA 2ZNEA 4JGEA 4P5OE 1XSSA 1YVHA 2O29A 2ZNDA 1MWNA 4I5NB 3PALA 3CBEA 4MZJA 3TMRA 1XA9A 3SS0A 1B8LA 2V4EC 1UHJA 2EMDA 2VADA 3OGOA 2BE4A 2M7NA 1TNWA 1A4PA 2PALA 2H61C 3SVCA 3NF0A 2M1KB 1Y6WA 3ZNIA 5LTRA 1ZGPA 1TN4A 1J7PA 1A29A 2YFPA 1YR5A 2BCBA 3DQ3A 3CB9A 2LP3A 5HZSA 3JVTB 4KPIA 1XO5A 2H5OA 1S3PA 2FOTA 1YJFA 2IE2A 3TMTA 2FWQA 4ZCVA 2IOVA 1F4QA 1LKJA 1OXDA 4GPLB 2GW3A 2GX0A 1EJ3A 5DU0A 3RM1A 1SCVA 4D1EA 2I7AA 1XFVO 2DUFA 5DPIA 2L0PA 4DUQA 1OQPA 2OTEA 1TCFA 2BCXA 2K2FA 1K96A 4W6FA 2KI4C 2AWKA 1DVIA 4A4BA 1JC2A 3DQ2A 1KWOB 4YI8A 4W6NA 1MOVA 1K90D 4FTGA 3AKBA 2JC2A 1NIWA 1JUOA 3TS5B 2GW4B 3D10A 2H9WA 4LJCA 4DCKA 1LVCD 4EDOA 2KBMA 1NUBA 3D0YA 5D7FA 5HBDA 5I8NA 3H4SE 2BTJA 4WQ3A 4HREE 3DQ6A 4GGFC 1HQVA 1QV1A 2MHHA 2M9GA 1OXFA 3PLFB 1LA3A 1QVIY 5CSNA 3LF4B 1RFJA 1AVSA 1J7QA 1RM9A 1N0YA 2HFCA 3U8CA 4W7RA 3OHMB 1BR4B 1RWYA 3FS7A 2SCPA 4KF5C 2LVVA 3SG3A 4ZIOA 4XGYA 2DUEA 2L51A 2MAZA 4PDZA 3SG2A 1UP5A 1YZWA 3EKJA 3CS1A 1CMGA 2WHSA 3F45A 1DF0B 5F9GA 4IL1A 3SVRA 4P76A 4L1IA 4ZF5A 3PFVA 4ZF4A 1NX1A 2JTZA 3E3RA 4W6IA 1SMGA 3WHUB 1SCMC 4PE0A 1F8HA 1B9CA 1RROA 4Q7UA 1JF2A 2K7OA 2B3PA 1W7TA 5T3IA 1NPQA 2BKIB 5DTLA 3OX5A 3CGLA 3NEDA 4LW5A 3ST0A 2LM5A 2NXQA 3H1OA 2OTBA 2G2SB 3DQ4A 4MSPA 4Q04A 1S6CA 5H89A 2Y1NA 3DF0B 4PHMA 3CZTX 4JEOA 1KQVA 2BL0C 2QLEA 4HQ9A 3E5VA 1N65A 3DQ7A 4DKNA 4IK5A 1CB1A 4B30A 3O6BA 4W7CA 2WHTA 4W6OA 4C0KA 3LS3A 1CLLA 5LTPA 2JULA 4ORNA 5CPVA 2LV7A 2CXJA 2LUXA 3SG4A 1YTZC 1S1EA 1XVJA 2PVBA 1TTXA 4PE4A 1YUSA 3JTDB 3VK1A 3HCMA 3SSTA 1IGVA 4HRHA 1KFUS 2ZO7A 4PFEA 4ZINA 1K95A 1A03A 4W75A 3M22A 3SSPA 5HW9A 5JJGA 1HCJA 5DRGA 5CSIA 4KW8A 2ZN9A 1QYFA 4OHSA 1QLSA 1M31A 2HQZA 2KAVA 4PE1A 4W6AA 1L2OB 3I5IC 2TN4A 5J2OA 1XFYO 3CR2A 4YI9A 1YHGA 1B7TY 2ZO6A 2K7CA 1KFXS 1B9AA 2QZ0A 2YE1A 4OCIA 4GBAA 3LVDA 1DJHA 3JVTC 1A75B 3NXAA 1FI6A 4EULA 1IJ5A 2BCAA 2L2EA 5TNCA 1WY9A 3DVMA 1FPWA 1G33A 3U0NA 4OQWA 4OY4A 1QIVA 5DTYA 1QS7A 3SV5A 2WORA 1QXPA 4H47A 3LVAA 2JNFA 2MA2A 3RWAA 2FL1A 1XFZO 5DKRA 4W6RA 2P6BB 3A4UB 2VVHA 2ICRA 1PSRA 2JT0A 3DQOA 1KK7Y 5KSZA 4ICBA 1CMFA 5HZOA 1PULA 3GJ2A 5HZTA 1KWOC 2KOTA 4QJ3B 5KTYA 4JQ0D 4W6HA 2QRFA 5AFPA 2HQ8A 1C07A 3AAKA 4NWSA 1DGVA 5AANA 4JFGA 5DKQA 3TS5C 4PPKA 4GESB 3GK4X 1U5IA 2ARLA 3TDIA 2KSPA 3PIBA 4IZNA 2LLTA 1F0BA 1JC0A 1WLMA 1G4YR 2JXCA 2JNXA 2LMUA 4OJ0A 5PALA 4NDBA 2KBIA 4DXNA 1KSOA 3CWGA 2EGDA 1Q4BA 1QTXA 1OMDA 1QIWA 4OKHA 3VHTA 2AHAA 1BJFA 2A54B 1ALVA 4AOMA 1F70A 1BOCA 2M49B 3AKOA 1J7OA 4L13A 3LK1A 1RRXA 3BXAA 3NT9A 1KFUL 2KGBC 3VRPA 1V1GA 4IK1A 1SL7A 4GNKB 1BLQA 1FBVA 4YGEB 3CD1A 1NWDA 2Z6ZA 4ETOA 5BPJA 4WRIA 3AI5A 2JQ6A 5EXUA 3ICBA 1Q80A 1DJIA 3LF3A 2H8QA 1NSHA 1S6JA 5H87A 4L9MA 5DPHA 1SY9A 2HRSA 1OMRA 4DKMA 2PASA 4F0ZB 1KYSA 4ORBB 5FVGA 4PHJA 2QPTA 3FWBA 1ZGOA 2VVJA 2G6YA 5EBJA 2M29A 1EMGA 1YJ2A 4HSZA 1OE9B 2E30A 3U8PA 2EHBA 4GOBA 4W77A 3AI4A 3IQQA 1AJ5A 2KI6D 1K94A 2QACA 1IH0A 4OR9B 1EG3A 1KYRA 5FVFA 4MEWA 3U0LA 5DTZA 3EVRA 2O5GA 4PE7A 2A56B 1RTP1 3DQMA 2E6WA 1JBZA 3NT3A 4W7AA 3SG7A 2DD9A 2IB6A 2GGZA 4EN1A 2FJUB 1JF0A 1ZFSA 3D0YB 2KNEA 1RMOA 2JU0A 4W7EA 4QJ4B 4RYSA 2LVIA 3JTDC 4MZKA 4YGDB 1JC1A 2LE9B 3KEVA 4NDCA 1GFLA 4PCWA 1ZOTB 3DQNA 3O77A 4L12A 1BR1B 1SYMA 4OVNF 3BUNB 3EVVA 2ZRSA 3I5FB 2Z1OA 1S6ZA 2ZFDA 1EG4A 4M2OA 1L2OC 5EB7A 1PK0D 1NX0A 4W6DA 1J1DA 1S36A 3BUMB 4N5XA 3IQOA 2MJWB 2JRFA 1CLBA 3TUYB 3EKHA 4W7FA 4LQUA 3SVSA 1QXTA 1AJ4A 1WDCB 2L98A 2I2RE 1H4BA 2AH8A 2MBXA 4OGSA 2B3QA 1Q4AA 1MOUA 2B1UA 4ANJA 4CFQA 5HLOA 3IR8A 2WOSA 4R1EA 3SVEA 1AP4A 1Z1PA 1RMPA 5CSFA 2AAOA 2Z6XA 1QVIZ 2LLSA 1H6RA 1XQMA 2QLGA 3HX4A 1S5GY 1MXEA 4AR7A 3WXAA 2DOQA 2JT8A 1J7RA 1NX2A 5HKZA 4Q9WA 1Y1AA 4N3DA 3TDUA 1EMAA 2KDHA 1XK4C 2NCPA 2LLUA 4B30B 3CFFA 1JBAA 2Q57A 2G3DB 2A48A 3BUXB 2PMYA 2AWJA 5EJUA 1BMOA 4Q7TA 1OZSA 1E8AA 4CFRA 1XFWO 2HGYA 4W6SA 5LTQA 4DXOA 1NX3A 1YX8A 3GEXA 3SSLA 2EC6B 5DRFA 1K8UA 1YFPA 4KAGA 1W7IB 3LVCA 1ALWA 4H3LA 2YDZA 1CDNA 4JC2A 1IQ5A 2G2BA 3BYAA 4ZCUA 4N1GA 1W7SA 2LCPA 3DPXA 1ZACA 3BXCA 3SVOA 1DJGA 1F4OA 1TCOB 1PVAA 3SVNA 1BODA 4LJDA 4I2YA 2DD7A 1TIZA 1G8IA 4R6DA 1SPYA 2DDDA 1KK8B 3VRRA 5EHUA 1JFJA 4DXIA 1GQMA 2G9BA 1X02A 3KPXA 4XYNA 5BQLA 4XJKA 3ZULA 1QX5B 2FCEA 5DY6A 5CSJA 2O2BA 2RH7A 4R6BA 3DQAA 2F3YA 2LHIA 3LCPC 4BY4A 2L50A 4MVFA 1CM1A 1FW4A 4U2VA 4U8DA 2KAXA 4IK3A 3BXKA 4H3MA 1SNLA 3DVEA 2M8UA 1UISA 2GX2A 4LQTA 4CPVA 2EMNA 1CDMA 3O78A 1QY3A 2K0JA 2LUCA 2L5XB 5DPJA 4W7XA 4C0JA 1BF5A 3ZUJA 2JPTA 1K2HA 3BX9A 3CD9A 2LVKA 3LL8B 1V1FA 3LLEA 1EMBA 2VZXA 2KFHA 2BECA 4W6TA 4W6BA 3TZ1A 2KQYA 2ZRTA 1KP5A 4ZBLA 1A2XA 2M1UA 3KF9A 1CM4A 1Q4CA 2QLHA 1HT9A 3BUOB 4W6PA 2GV5A 5LK4A 1MQ1A 2V4EA 1B7TZ 3NSKA 1PRWA 2JXLA 3PJ5A 3I5GB 2K7DA 3DQEA 3DPWA 1YVLA 2F2OA 1EMEA 2H61A 3UG0A 1U5IB 2A53B 3M24A 3PSRA 2Y4QA 2Q6PA 2WIQA 4DXPA 1CFCA 4BY5A 2YE0A 5ER5A 4YGCB 2KFFA 1F09A 1OMVA 4EDSA 2G6XA 2K61A 4N1FA 4XOWA 2BE6A 3VRQA 4NQGA 4IK9A 1QX2A 1XAEA 1K9PA 2EMOA 2LC5A 4HE4A 3SIBA 3I5FC 1RECA 2R2IA 4YBHB 3VHTB 1IWQA 2KFGA 4JRBA 4KF4A 3CLNA 1AHRA 1XA5A 2L4IA 3EVUA 4DXQA 1C4FA 4P1QA 4PALA 2DDCA 1KK7Z 4NDDA 2WHUA 3SSVA 1BU3A 2QLIA 2HQWA 4W6LA 3TUYC 2FCDA 3BOWA 2IB5A 4YGBB 3SVDA 5HZUA 4MRXA 2F2PA 5DTXA 4ZF3A 2A52B 1WDCC 3ZTFA 1QV0A 4YRUA 2CTNA 2HCGA 5HYDA 2OKWA 3ZWHA 2AWMA 1N2DA 1GGWA 3LA1A 1TOPA 2GGMA 1EXRA 2ISDA 2LMVA 5HKYA 2Y5IA 4AS8A 3FIAA 1ZGQA 2WC8A 5I2QA 4Q7RA 3O4YA 3KCSA 1CLMA 1FF1A 3FWCA 1OOJA 1YHHA 4GGFA 3PN7B 4W7DA 1JSAA 3VRNA 1SBJA 3GB3A 4PPLA 2CCMA 1YHIA 3SG5A 4XL5A 4KEXA 4H3NA 4DXMA 4GF6B 1YUUA 2VAEA 3TDZA 1M63B 1CV7A 1WRLA 4W73A 2HPSA 1C7WA 3S05A 4E68A 2FZUA 3I5HB 3DQ8A 4PPJA 3ED8A 1AUIB 4KF5A 1CFPA 1FI5A 3DVJA 3G9AA 1Y0VH 1IRJA 1ZUZA 1Y1UA 4LJBA 2KYFA 4MRYA 1UHKA 1KQMB 4CIDA 3ZUFA 1Q73A 2EC6C 1DGUA 3SRYA 1R2UA 2KI6C 3A8RA 1K9KA 1J1EA 1BFPA 3IF7A 1QYOA 1LXFC 3NSLA 1MXLC 2OPOA 2SASA 3WLDA 2A47A 1GJYA 1WRKA 2HQKA 4I5JA 1LA0A 5ER4X 1KYPA 4GFTA 1YURA 2JZIA 4AQJA 3DQCA 1AK8A 3OSQA 1KK8C 2BBMA 2JOJA 2HGDA 2A46A 1DJWA 1S6IA 5DPGA 1NYAA 4A4CA 2WSNA 3CR4X 3KHEA 3GK2A 1UHIA 4W6UA 3I5IB 1NCZA 1XMZA 4KGEA 2C9IA 3GL4A 4J89A 1BG1A 1UHHA 4BDUA 2LANA 5J3XA 1DT7B 3DQKA 1UUSA 1NCXA 2WURA 4USLA 4W6CA 5FHVA 1DMOA 1OXEA 1UHNA 5I2OA 2PXWA 3WHTB 1Q4EA 5DQMA 4W6JA 4W76A 1PSBA 3M0WA 5AEQA 1Y1XA 1M45A 2QLGB 2ZMUA 1QJTA 5BTTA 4XOVA 5BT0A 2CBLA 1J55A 2WISA 1CFFA 4IK4A 2OS8B 2A4JA 5IBWA 4W6MA 1IKUA 3VGOA 3GJ1A 3SSHA 2H6VA 3DQLA 2K8MB 3EK8A 3I5GC 1UURA 2H5QA 1B8CA 4HQCA 2HETA 2KYCA 2OGRA 3C1VA 3DQDA 1K93D 2WCFA 3DQ5A 1TNQA 1TRFA 4OV2A 1SKTA 1XYDA 3K21A 5EXCI 4M2PA 3PM8A 2VVIA 2CNPA 4I5LB 4EMQA 4KW4A 3CTNA 1DJXA 4W6GA 2JWWA 4Z4KA 3IP2A 3U0MA 2ZN8A 5HGEA 1DJZA 4J88A 4ZFSA 4GAOA 1B47A 1TNXA 2NZ0A 1MR8A 2HF5A 2LHLA 1S5GZ 4ORAB 2HPWA 4UTSA 1UWOA 1F54A 3ADFA 2H2KA 5H88A 5GQQC 5AXIA 4XVPA 2Z6YA 1YRTB 2D8NA 3DQUA 1TNPA 3CFAA 4HQ8A 1F71A 3BQ3A 2F33A 1YUTA 3DQ1A 4TZGA 1PALA 1EMFA 3P8UA 2QU1A 2BBNA 3BUWB 3W1DA 2I18A 1SR6B 4FQOA 1S26D 4XJKB 1QLKA 4KA9A 2DUIA 3MGFA 3W1CA 2LVJA 5DKNA 2G3OA 5I2LA 1ZUXA 2LAPA 2COLB 2F8PA 1JFKA 1IJ6A 5EXBA 1OZOA 4YGAA 2OTGB 2K7BA 3PN7C 3H1RA 1B8RA 1D1OA 2H5PA 3K1KA 1F55A 3ST4A 1EMCA 4MLWA 3SVBA 1B1GA 2DUHA 2LMTA 4W74A 3CFHA 3E5WA 4WQ2A 1QASA 4UPGA 3GOFA 1CTRA 2MLEC 3AKAA 3SVUA 1H4UA 3I5HC 4ZB1A 2POXA 1EMMA 4RYWA 2MLFC 2WSOA 1JBYA 3SSKA 1GL4A 2PSRA 4I5KA 1HUYA 1YX7A 2V4EB 4TNCA 5DQBA 2O60A 1KQMC 1DF0A 2JADA 3WCKA 1ZMZA 3EK7A 1WRZA 5F6TA 1SW8A 1QATA 4DRWA 2V53A 2C9JA 3EVPA 1CDPA 2PRUA 1ODBA 3DPZA 2OKYA 2Q91A 1DJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ6 A;  4KW9 A;  5AER A;  4J8A A;  4W72 A;  1RMM A;  1W7U A;  1NP8 A;  3OB2 B;  2I94 A;  2AWL A;  3DQ9 A;  1OSA A;  2JTT A;  2Q4U A;  1SL9 A;  3SG6 A;  5G08 A;  3EK4 A;  3NSI A;  1SRA A;  1W7J B;  3DF0 A;  2G5Z B;  3OX6 A;  5FYX A;  4AQI A;  2KI4 B;  3BOW B;  3DQH A;  3DVK A;  2M0R A;  2G6E A;  3OP0 A;  4W69 A;  4JWQ A;  3GK1 A;  1MF8 B;  3E5T A;  1M46 A;  5FVI A;  1XFU O;  1EH2 A;  3RWT A;  3V3D A;  1G7K A;  4HVF A;  2G16 B;  1CKK A;  2Y0G A;  1L7Z A;  5B8I B;  1SL8 A;  2OJK A;  2WCE A;  1EML A;  2KHN A;  3ST2 A;  1PVB A;  2AMI A;  4Q9X A;  2M3W A;  3AAJ A;  4JF9 A;  3CGA A;  1EL4 A;  3CR5 X;  1GGX A;  4PHN A;  1WLZ A;  3I19 A;  4DS7 A;  2M7L A;  1C7V A;  3DD4 A;  2OS8 C;  3SJS A;  4TZA A;  4C0L A;  3VIC A;  1SK6 D;  1K9U A;  2L4H A;  4GGN A;  4B5Y A;  2MRD A;  1VRK A;  3SIA A;  2QT2 A;  3DQJ A;  5AQB B;  1B4C A;  1M39 A;  3VRO A;  2NCO A;  3PAT A;  5JOL A;  2NLN A;  2KAY A;  1A75 A;  2PXS A;  3BXB A;  4IK8 A;  3OSR A;  5HKW A;  1CFD A;  3WLC A;  1YRU B;  1EMK A;  1R6P A;  3LSA A;  1SCM B;  4GUK A;  1JWD A;  3ST3 A;  1Q4D A;  4Z4M A;  3OB1 B;  3PJ7 A;  1QYQ A;  5EB6 A;  2BKH B;  3QRX A;  3O2P A;  3P28 A;  4JPZ B;  2F3Z A;  2IS9 A;  4LJD C;  4MBE A;  3A8S A;  2JT3 A;  3MSE B;  1LIN A;  1NCY A;  2KGR A;  2O24 A;  2CT9 A;  2LP2 A;  2H5R A;  2ZMW A;  4CLN A;  2ZKM X;  5K89 A;  1CDL A;  4KGF A;  3KO0 A;  2WND A;  2K2A A;  1CNP A;  1MYW A;  2DUG A;  1RJV A;  1MUX A;  5HLV A;  1SR6 C;  4P2Y B;  1Z1Q A;  2BL0 B;  4RTC A;  2HJO A;  2M97 A;  4HRG A;  5D69 A;  1BT6 A;  3WNX B;  2AUC A;  1MHO A;  1XK4 A;  2P4M A;  4M2Q A;  1QX7 A;  3UFZ A;  5KU1 A;  1GGZ A;  1H8B A;  4ORC B;  1KSM A;  3NSO A;  2RGI A;  3KCT A;  3DQI A;  3DQF A;  2A50 B;  3U0K A;  2OTG C;  4MN0 A;  3PJB A;  5KTG A;  4MZL A;  1XFX O;  4QJ5 B;  2LNK A;  2Y1M A;  4H48 A;  3SSY A;  2VRG A;  1IQ3 A;  1KFX L;  1IG5 A;  1KCY A;  3LK0 A;  3U8A A;  1RK9 A;  4PHK A;  3RLZ A;  1DTL A;  4W6K A;  5BTT B;  3NEZ A;  4DIR A;  2WCB A;  2ZNE A;  4JGE A;  4P5O E;  1XSS A;  1YVH A;  2O29 A;  2ZND A;  1MWN A;  4I5N B;  3PAL A;  3CBE A;  4MZJ A;  3TMR A;  1XA9 A;  3SS0 A;  1B8L A;  2V4E C;  1UHJ A;  2EMD A;  2VAD A;  3OGO A;  2BE4 A;  2M7N A;  1TNW A;  1A4P A;  2PAL A;  2H61 C;  3SVC A;  3NF0 A;  2M1K B;  1Y6W A;  3ZNI A;  5LTR A;  1ZGP A;  1TN4 A;  1J7P A;  1A29 A;  2YFP A;  1YR5 A;  2BCB A;  3DQ3 A;  3CB9 A;  2LP3 A;  5HZS A;  3JVT B;  4KPI A;  1XO5 A;  2H5O A;  1S3P A;  2FOT A;  1YJF A;  2IE2 A;  3TMT A;  2FWQ A;  4ZCV A;  2IOV A;  1F4Q A;  1LKJ A;  1OXD A;  4GPL B;  2GW3 A;  2GX0 A;  1EJ3 A;  5DU0 A;  3RM1 A;  1SCV A;  4D1E A;  2I7A A;  1XFV O;  2DUF A;  5DPI A;  2L0P A;  4DUQ A;  1OQP A;  2OTE A;  1TCF A;  2BCX A;  2K2F A;  1K96 A;  4W6F A;  2KI4 C;  2AWK A;  1DVI A;  4A4B A;  1JC2 A;  3DQ2 A;  1KWO B;  4YI8 A;  4W6N A;  1MOV A;  1K90 D;  4FTG A;  3AKB A;  2JC2 A;  1NIW A;  1JUO A;  3TS5 B;  2GW4 B;  3D10 A;  2H9W A;  4LJC A;  4DCK A;  1LVC D;  4EDO A;  2KBM A;  1NUB A;  3D0Y A;  5D7F A;  5HBD A;  5I8N A;  3H4S E;  2BTJ A;  4WQ3 A;  4HRE E;  3DQ6 A;  4GGF C;  1HQV A;  1QV1 A;  2MHH A;  2M9G A;  1OXF A;  3PLF B;  1LA3 A;  1QVI Y;  5CSN A;  3LF4 B;  1RFJ A;  1AVS A;  1J7Q A;  1RM9 A;  1N0Y A;  2HFC A;  3U8C A;  4W7R A;  3OHM B;  1BR4 B;  1RWY A;  3FS7 A;  2SCP A;  4KF5 C;  2LVV A;  3SG3 A;  4ZIO A;  4XGY A;  2DUE A;  2L51 A;  2MAZ A;  4PDZ A;  3SG2 A;  1UP5 A;  1YZW A;  3EKJ A;  3CS1 A;  1CMG A;  2WHS A;  3F45 A;  1DF0 B;  5F9G A;  4IL1 A;  3SVR A;  4P76 A;  4L1I A;  4ZF5 A;  3PFV A;  4ZF4 A;  1NX1 A;  2JTZ A;  3E3R A;  4W6I A;  1SMG A;  3WHU B;  1SCM C;  4PE0 A;  1F8H A;  1B9C A;  1RRO A;  4Q7U A;  1JF2 A;  2K7O A;  2B3P A;  1W7T A;  5T3I A;  1NPQ A;  2BKI B;  5DTL A;  3OX5 A;  3CGL A;  3NED A;  4LW5 A;  3ST0 A;  2LM5 A;  2NXQ A;  3H1O A;  2OTB A;  2G2S B;  3DQ4 A;  4MSP A;  4Q04 A;  1S6C A;  5H89 A;  2Y1N A;  3DF0 B;  4PHM A;  3CZT X;  4JEO A;  1KQV A;  2BL0 C;  2QLE A;  4HQ9 A;  3E5V A;  1N65 A;  3DQ7 A;  4DKN A;  4IK5 A;  1CB1 A;  4B30 A;  3O6B A;  4W7C A;  2WHT A;  4W6O A;  4C0K A;  3LS3 A;  1CLL A;  5LTP A;  2JUL A;  4ORN A;  5CPV A;  2LV7 A;  2CXJ A;  2LUX A;  3SG4 A;  1YTZ C;  1S1E A;  1XVJ A;  2PVB A;  1TTX A;  4PE4 A;  1YUS A;  3JTD B;  3VK1 A;  3HCM A;  3SST A;  1IGV A;  4HRH A;  1KFU S;  2ZO7 A;  4PFE A;  4ZIN A;  1K95 A;  1A03 A;  4W75 A;  3M22 A;  3SSP A;  5HW9 A;  5JJG A;  1HCJ A;  5DRG A;  5CSI A;  4KW8 A;  2ZN9 A;  1QYF A;  4OHS A;  1QLS A;  1M31 A;  2HQZ A;  2KAV A;  4PE1 A;  4W6A A;  1L2O B;  3I5I C;  2TN4 A;  5J2O A;  1XFY O;  3CR2 A;  4YI9 A;  1YHG A;  1B7T Y;  2ZO6 A;  2K7C A;  1KFX S;  1B9A A;  2QZ0 A;  2YE1 A;  4OCI A;  4GBA A;  3LVD A;  1DJH A;  3JVT C;  1A75 B;  3NXA A;  1FI6 A;  4EUL A;  1IJ5 A;  2BCA A;  2L2E A;  5TNC A;  1WY9 A;  3DVM A;  1FPW A;  1G33 A;  3U0N A;  4OQW A;  4OY4 A;  1QIV A;  5DTY A;  1QS7 A;  3SV5 A;  2WOR A;  1QXP A;  4H47 A;  3LVA A;  2JNF A;  2MA2 A;  3RWA A;  2FL1 A;  1XFZ O;  5DKR A;  4W6R A;  2P6B B;  3A4U B;  2VVH A;  2ICR A;  1PSR A;  2JT0 A;  3DQO A;  1KK7 Y;  5KSZ A;  4ICB A;  1CMF A;  5HZO A;  1PUL A;  3GJ2 A;  5HZT A;  1KWO C;  2KOT A;  4QJ3 B;  5KTY A;  4JQ0 D;  4W6H A;  2QRF A;  5AFP A;  2HQ8 A;  1C07 A;  3AAK A;  4NWS A;  1DGV A;  5AAN A;  4JFG A;  5DKQ A;  3TS5 C;  4PPK A;  4GES B;  3GK4 X;  1U5I A;  2ARL A;  3TDI A;  2KSP A;  3PIB A;  4IZN A;  2LLT A;  1F0B A;  1JC0 A;  1WLM A;  1G4Y R;  2JXC A;  2JNX A;  2LMU A;  4OJ0 A;  5PAL A;  4NDB A;  2KBI A;  4DXN A;  1KSO A;  3CWG A;  2EGD A;  1Q4B A;  1QTX A;  1OMD A;  1QIW A;  4OKH A;  3VHT A;  2AHA A;  1BJF A;  2A54 B;  1ALV A;  4AOM A;  1F70 A;  1BOC A;  2M49 B;  3AKO A;  1J7O A;  4L13 A;  3LK1 A;  1RRX A;  3BXA A;  3NT9 A;  1KFU L;  2KGB C;  3VRP A;  1V1G A;  4IK1 A;  1SL7 A;  4GNK B;  1BLQ A;  1FBV A;  4YGE B;  3CD1 A;  1NWD A;  2Z6Z A;  4ETO A;  5BPJ A;  4WRI A;  3AI5 A;  2JQ6 A;  5EXU A;  3ICB A;  1Q80 A;  1DJI A;  3LF3 A;  2H8Q A;  1NSH A;  1S6J A;  5H87 A;  4L9M A;  5DPH A;  1SY9 A;  2HRS A;  1OMR A;  4DKM A;  2PAS A;  4F0Z B;  1KYS A;  4ORB B;  5FVG A;  4PHJ A;  2QPT A;  3FWB A;  1ZGO A;  2VVJ A;  2G6Y A;  5EBJ A;  2M29 A;  1EMG A;  1YJ2 A;  4HSZ A;  1OE9 B;  2E30 A;  3U8P A;  2EHB A;  4GOB A;  4W77 A;  3AI4 A;  3IQQ A;  1AJ5 A;  2KI6 D;  1K94 A;  2QAC A;  1IH0 A;  4OR9 B;  1EG3 A;  1KYR A;  5FVF A;  4MEW A;  3U0L A;  5DTZ A;  3EVR A;  2O5G A;  4PE7 A;  2A56 B;  1RTP 1;  3DQM A;  2E6W A;  1JBZ A;  3NT3 A;  4W7A A;  3SG7 A;  2DD9 A;  2IB6 A;  2GGZ A;  4EN1 A;  2FJU B;  1JF0 A;  1ZFS A;  3D0Y B;  2KNE A;  1RMO A;  2JU0 A;  4W7E A;  4QJ4 B;  4RYS A;  2LVI A;  3JTD C;  4MZK A;  4YGD B;  1JC1 A;  2LE9 B;  3KEV A;  4NDC A;  1GFL A;  4PCW A;  1ZOT B;  3DQN A;  3O77 A;  4L12 A;  1BR1 B;  1SYM A;  4OVN F;  3BUN B;  3EVV A;  2ZRS A;  3I5F B;  2Z1O A;  1S6Z A;  2ZFD A;  1EG4 A;  4M2O A;  1L2O C;  5EB7 A;  1PK0 D;  1NX0 A;  4W6D A;  1J1D A;  1S36 A;  3BUM B;  4N5X A;  3IQO A;  2MJW B;  2JRF A;  1CLB A;  3TUY B;  3EKH A;  4W7F A;  4LQU A;  3SVS A;  1QXT A;  1AJ4 A;  1WDC B;  2L98 A;  2I2R E;  1H4B A;  2AH8 A;  2MBX A;  4OGS A;  2B3Q A;  1Q4A A;  1MOU A;  2B1U A;  4ANJ A;  4CFQ A;  5HLO A;  3IR8 A;  2WOS A;  4R1E A;  3SVE A;  1AP4 A;  1Z1P A;  1RMP A;  5CSF A;  2AAO A;  2Z6X A;  1QVI Z;  2LLS A;  1H6R A;  1XQM A;  2QLG A;  3HX4 A;  1S5G Y;  1MXE A;  4AR7 A;  3WXA A;  2DOQ A;  2JT8 A;  1J7R A;  1NX2 A;  5HKZ A;  4Q9W A;  1Y1A A;  4N3D A;  3TDU A;  1EMA A;  2KDH A;  1XK4 C;  2NCP A;  2LLU A;  4B30 B;  3CFF A;  1JBA A;  2Q57 A;  2G3D B;  2A48 A;  3BUX B;  2PMY A;  2AWJ A;  5EJU A;  1BMO A;  4Q7T A;  1OZS A;  1E8A A;  4CFR A;  1XFW O;  2HGY A;  4W6S A;  5LTQ A;  4DXO A;  1NX3 A;  1YX8 A;  3GEX A;  3SSL A;  2EC6 B;  5DRF A;  1K8U A;  1YFP A;  4KAG A;  1W7I B;  3LVC A;  1ALW A;  4H3L A;  2YDZ A;  1CDN A;  4JC2 A;  1IQ5 A;  2G2B A;  3BYA A;  4ZCU A;  4N1G A;  1W7S A;  2LCP A;  3DPX A;  1ZAC A;  3BXC A;  3SVO A;  1DJG A;  1F4O A;  1TCO B;  1PVA A;  3SVN A;  1BOD A;  4LJD A;  4I2Y A;  2DD7 A;  1TIZ A;  1G8I A;  4R6D A;  1SPY A;  2DDD A;  1KK8 B;  3VRR A;  5EHU A;  1JFJ A;  4DXI A;  1GQM A;  2G9B A;  1X02 A;  3KPX A;  4XYN A;  5BQL A;  4XJK A;  3ZUL A;  1QX5 B;  2FCE A;  5DY6 A;  5CSJ A;  2O2B A;  2RH7 A;  4R6B A;  3DQA A;  2F3Y A;  2LHI A;  3LCP C;  4BY4 A;  2L50 A;  4MVF A;  1CM1 A;  1FW4 A;  4U2V A;  4U8D A;  2KAX A;  4IK3 A;  3BXK A;  4H3M A;  1SNL A;  3DVE A;  2M8U A;  1UIS A;  2GX2 A;  4LQT A;  4CPV A;  2EMN A;  1CDM A;  3O78 A;  1QY3 A;  2K0J A;  2LUC A;  2L5X B;  5DPJ A;  4W7X A;  4C0J A;  1BF5 A;  3ZUJ A;  2JPT A;  1K2H A;  3BX9 A;  3CD9 A;  2LVK A;  3LL8 B;  1V1F A;  3LLE A;  1EMB A;  2VZX A;  2KFH A;  2BEC A;  4W6T A;  4W6B A;  3TZ1 A;  2KQY A;  2ZRT A;  1KP5 A;  4ZBL A;  1A2X A;  2M1U A;  3KF9 A;  1CM4 A;  1Q4C A;  2QLH A;  1HT9 A;  3BUO B;  4W6P A;  2GV5 A;  5LK4 A;  1MQ1 A;  2V4E A;  1B7T Z;  3NSK A;  1PRW A;  2JXL A;  3PJ5 A;  3I5G B;  2K7D A;  3DQE A;  3DPW A;  1YVL A;  2F2O A;  1EME A;  2H61 A;  3UG0 A;  1U5I B;  2A53 B;  3M24 A;  3PSR A;  2Y4Q A;  2Q6P A;  2WIQ A;  4DXP A;  1CFC A;  4BY5 A;  2YE0 A;  5ER5 A;  4YGC B;  2KFF A;  1F09 A;  1OMV A;  4EDS A;  2G6X A;  2K61 A;  4N1F A;  4XOW A;  2BE6 A;  3VRQ A;  4NQG A;  4IK9 A;  1QX2 A;  1XAE A;  1K9P A;  2EMO A;  2LC5 A;  4HE4 A;  3SIB A;  3I5F C;  1REC A;  2R2I A;  4YBH B;  3VHT B;  1IWQ A;  2KFG A;  4JRB A;  4KF4 A;  3CLN A;  1AHR A;  1XA5 A;  2L4I A;  3EVU A;  4DXQ A;  1C4F A;  4P1Q A;  4PAL A;  2DDC A;  1KK7 Z;  4NDD A;  2WHU A;  3SSV A;  1BU3 A;  2QLI A;  2HQW A;  4W6L A;  3TUY C;  2FCD A;  3BOW A;  2IB5 A;  4YGB B;  3SVD A;  5HZU A;  4MRX A;  2F2P A;  5DTX A;  4ZF3 A;  2A52 B;  1WDC C;  3ZTF A;  1QV0 A;  4YRU A;  2CTN A;  2HCG A;  5HYD A;  2OKW A;  3ZWH A;  2AWM A;  1N2D A;  1GGW A;  3LA1 A;  1TOP A;  2GGM A;  1EXR A;  2ISD A;  2LMV A;  5HKY A;  2Y5I A;  4AS8 A;  3FIA A;  1ZGQ A;  2WC8 A;  5I2Q A;  4Q7R A;  3O4Y A;  3KCS A;  1CLM A;  1FF1 A;  3FWC A;  1OOJ A;  1YHH A;  4GGF A;  3PN7 B;  4W7D A;  1JSA A;  3VRN A;  1SBJ A;  3GB3 A;  4PPL A;  2CCM A;  1YHI A;  3SG5 A;  4XL5 A;  4KEX A;  4H3N A;  4DXM A;  4GF6 B;  1YUU A;  2VAE A;  3TDZ A;  1M63 B;  1CV7 A;  1WRL A;  4W73 A;  2HPS A;  1C7W A;  3S05 A;  4E68 A;  2FZU A;  3I5H B;  3DQ8 A;  4PPJ A;  3ED8 A;  1AUI B;  4KF5 A;  1CFP A;  1FI5 A;  3DVJ A;  3G9A A;  1Y0V H;  1IRJ A;  1ZUZ A;  1Y1U A;  4LJB A;  2KYF A;  4MRY A;  1UHK A;  1KQM B;  4CID A;  3ZUF A;  1Q73 A;  2EC6 C;  1DGU A;  3SRY A;  1R2U A;  2KI6 C;  3A8R A;  1K9K A;  1J1E A;  1BFP A;  3IF7 A;  1QYO A;  1LXF C;  3NSL A;  1MXL C;  2OPO A;  2SAS A;  3WLD A;  2A47 A;  1GJY A;  1WRK A;  2HQK A;  4I5J A;  1LA0 A;  5ER4 X;  1KYP A;  4GFT A;  1YUR A;  2JZI A;  4AQJ A;  3DQC A;  1AK8 A;  3OSQ A;  1KK8 C;  2BBM A;  2JOJ A;  2HGD A;  2A46 A;  1DJW A;  1S6I A;  5DPG A;  1NYA A;  4A4C A;  2WSN A;  3CR4 X;  3KHE A;  3GK2 A;  1UHI A;  4W6U A;  3I5I B;  1NCZ A;  1XMZ A;  4KGE A;  2C9I A;  3GL4 A;  4J89 A;  1BG1 A;  1UHH A;  4BDU A;  2LAN A;  5J3X A;  1DT7 B;  3DQK A;  1UUS A;  1NCX A;  2WUR A;  4USL A;  4W6C A;  5FHV A;  1DMO A;  1OXE A;  1UHN A;  5I2O A;  2PXW A;  3WHT B;  1Q4E A;  5DQM A;  4W6J A;  4W76 A;  1PSB A;  3M0W A;  5AEQ A;  1Y1X A;  1M45 A;  2QLG B;  2ZMU A;  1QJT A;  5BTT A;  4XOV A;  5BT0 A;  2CBL A;  1J55 A;  2WIS A;  1CFF A;  4IK4 A;  2OS8 B;  2A4J A;  5IBW A;  4W6M A;  1IKU A;  3VGO A;  3GJ1 A;  3SSH A;  2H6V A;  3DQL A;  2K8M B;  3EK8 A;  3I5G C;  1UUR A;  2H5Q A;  1B8C A;  4HQC A;  2HET A;  2KYC A;  2OGR A;  3C1V A;  3DQD A;  1K93 D;  2WCF A;  3DQ5 A;  1TNQ A;  1TRF A;  4OV2 A;  1SKT A;  1XYD A;  3K21 A;  5EXC I;  4M2P A;  3PM8 A;  2VVI A;  2CNP A;  4I5L B;  4EMQ A;  4KW4 A;  3CTN A;  1DJX A;  4W6G A;  2JWW A;  4Z4K A;  3IP2 A;  3U0M A;  2ZN8 A;  5HGE A;  1DJZ A;  4J88 A;  4ZFS A;  4GAO A;  1B47 A;  1TNX A;  2NZ0 A;  1MR8 A;  2HF5 A;  2LHL A;  1S5G Z;  4ORA B;  2HPW A;  4UTS A;  1UWO A;  1F54 A;  3ADF A;  2H2K A;  5H88 A;  5GQQ C;  5AXI A;  4XVP A;  2Z6Y A;  1YRT B;  2D8N A;  3DQU A;  1TNP A;  3CFA A;  4HQ8 A;  1F71 A;  3BQ3 A;  2F33 A;  1YUT A;  3DQ1 A;  4TZG A;  1PAL A;  1EMF A;  3P8U A;  2QU1 A;  2BBN A;  3BUW B;  3W1D A;  2I18 A;  1SR6 B;  4FQO A;  1S26 D;  4XJK B;  1QLK A;  4KA9 A;  2DUI A;  3MGF A;  3W1C A;  2LVJ A;  5DKN A;  2G3O A;  5I2L A;  1ZUX A;  2LAP A;  2COL B;  2F8P A;  1JFK A;  1IJ6 A;  5EXB A;  1OZO A;  4YGA A;  2OTG B;  2K7B A;  3PN7 C;  3H1R A;  1B8R A;  1D1O A;  2H5P A;  3K1K A;  1F55 A;  3ST4 A;  1EMC A;  4MLW A;  3SVB A;  1B1G A;  2DUH A;  2LMT A;  4W74 A;  3CFH A;  3E5W A;  4WQ2 A;  1QAS A;  4UPG A;  3GOF A;  1CTR A;  2MLE C;  3AKA A;  3SVU A;  1H4U A;  3I5H C;  4ZB1 A;  2POX A;  1EMM A;  4RYW A;  2MLF C;  2WSO A;  1JBY A;  3SSK A;  1GL4 A;  2PSR A;  4I5K A;  1HUY A;  1YX7 A;  2V4E B;  4TNC A;  5DQB A;  2O60 A;  1KQM C;  1DF0 A;  2JAD A;  3WCK A;  1ZMZ A;  3EK7 A;  1WRZ A;  5F6T A;  1SW8 A;  1QAT A;  4DRW A;  2V53 A;  2C9J A;  3EVP A;  1CDP A;  2PRU A;  1ODB A;  3DPZ A;  2OKY A;  2Q91 A;  1DJY A; 
#chains in the Genus database with same CATH topology
 2KQ6 A;  4KW9 A;  3D76 A;  2ERB A;  5AER A;  4J8A A;  4W72 A;  1RMM A;  1W7U A;  1NP8 A;  3OB2 B;  4IJ7 A;  2I94 A;  2AWL A;  3DQ9 A;  1OSA A;  2JTT A;  2Q4U A;  1SL9 A;  3SG6 A;  5G08 A;  3EK4 A;  3NSI A;  1SRA A;  1W7J B;  3DF0 A;  2G5Z B;  3OX6 A;  5FYX A;  4AQI A;  2KI4 B;  3BOW B;  3DQH A;  3DVK A;  2FJY A;  2M0R A;  2G6E A;  3OP0 A;  4W69 A;  4JWQ A;  3GK1 A;  1MF8 B;  3E5T A;  1M46 A;  3L4A A;  5FVI A;  1XFU O;  1EH2 A;  3RWT A;  3V3D A;  1G7K A;  3DY9 A;  4HVF A;  2G16 B;  1CKK A;  1TUZ A;  2Y0G A;  1L7Z A;  5B8I B;  1SL8 A;  2OJK A;  2WCE A;  1EML A;  2KHN A;  3ST2 A;  1PVB A;  2AMI A;  1OW4 A;  4Q9X A;  2M3W A;  3AAJ A;  4JF9 A;  3CGA A;  1EL4 A;  3CDN A;  3CR5 X;  1GGX A;  4PHN A;  1WLZ A;  3I19 A;  4DS7 A;  2M7L A;  1C7V A;  3DD4 A;  2L5Y A;  2OS8 C;  3OBV A;  5HL1 A;  3SJS A;  4TZA A;  4C0L A;  3VIC A;  1SK6 D;  1K9U A;  2L4H A;  4GGN A;  3BFA A;  4B5Y A;  2MRD A;  1VRK A;  3SIA A;  2QT2 A;  1IIO A;  3DQJ A;  5AQB B;  1B4C A;  1M39 A;  3VRO A;  2NCO A;  3PAT A;  5JOL A;  2NLN A;  2KAY A;  1A75 A;  2PXS A;  1DC1 A;  3BXB A;  4IK8 A;  3OSR A;  5HKW A;  1CFD A;  3WLC A;  1YRU B;  1EMK A;  1R6P A;  3LSA A;  1SCM B;  4GUK A;  1JWD A;  3ST3 A;  1Q4D A;  4Z4M A;  3D77 A;  3OB1 B;  3PJ7 A;  3IVT A;  1QYQ A;  5EB6 A;  2BKH B;  3QRX A;  3O2P A;  3B7A A;  3P28 A;  4OZD A;  4JPZ B;  2F3Z A;  2IS9 A;  4LJD C;  4MBE A;  3A8S A;  2JT3 A;  3MSE B;  1LIN A;  1NCY A;  2KGR A;  2O24 A;  2CT9 A;  2LP2 A;  2H5R A;  2ZMW A;  4CLN A;  2ZKM X;  1DQE A;  5K89 A;  1CDL A;  4KGF A;  3KO0 A;  2WND A;  2K2A A;  1CNP A;  1MYW A;  2DUG A;  1RJV A;  1MUX A;  5HLV A;  1SR6 C;  4P2Y B;  1Z1Q A;  2BL0 B;  4RTC A;  2HJO A;  2M97 A;  4HRG A;  5D69 A;  1BT6 A;  3WNX B;  2AUC A;  1MHO A;  1XK4 A;  2P4M A;  4M2Q A;  1QX7 A;  3UFZ A;  5KU1 A;  1GGZ A;  1H8B A;  4ORC B;  1KSM A;  3NSO A;  2RGI A;  3KCT A;  3DQI A;  3DQF A;  2A50 B;  3U0K A;  2OTG C;  4MN0 A;  3PJB A;  5KTG A;  4MZL A;  1XFX O;  4QJ5 B;  2LNK A;  2Y1M A;  4H48 A;  3SSY A;  2VRG A;  3CZ2 A;  1IQ3 A;  1KFX L;  1IG5 A;  1KCY A;  3LK0 A;  3U8A A;  1RK9 A;  4PHK A;  3RLZ A;  1DTL A;  4W6K A;  5BTT B;  3NEZ A;  3CYZ A;  4DIR A;  2WCB A;  2ZNE A;  4JGE A;  4P5O E;  1XSS A;  1YVH A;  2O29 A;  2ZND A;  1MWN A;  4I5N B;  3PAL A;  3R1P A;  3CBE A;  4MZJ A;  3TMR A;  1XA9 A;  3SS0 A;  1B8L A;  2V4E C;  1UHJ A;  2EMD A;  2VAD A;  3OGO A;  2BE4 A;  2M7N A;  1TNW A;  1A4P A;  2PAL A;  2H61 C;  3SVC A;  3NF0 A;  2M1K B;  1Y6W A;  3ZNI A;  5LTR A;  1ZGP A;  1TN4 A;  1J7P A;  1A29 A;  2YFP A;  1YR5 A;  2BCB A;  3DQ3 A;  3CB9 A;  2LP3 A;  5HZS A;  3JVT B;  4KPI A;  1XO5 A;  2H5O A;  1S3P A;  2YGU A;  2FOT A;  1YJF A;  2IE2 A;  3TMT A;  2FWQ A;  4ZCV A;  2IOV A;  1F4Q A;  1LKJ A;  1OXD A;  4GPL B;  2GW3 A;  2GX0 A;  1EJ3 A;  5DU0 A;  3RM1 A;  1SCV A;  4D1E A;  3FE9 A;  2I7A A;  1XFV O;  2DUF A;  5DPI A;  2L0P A;  4DUQ A;  1OQP A;  2OTE A;  1TCF A;  2BCX A;  2K2F A;  3K1E A;  3UNW A;  1K96 A;  4W6F A;  2KI4 C;  2AWK A;  1DVI A;  3Q8I A;  4A4B A;  1JC2 A;  3DQ2 A;  1KWO B;  4YI8 A;  4W6N A;  1MOV A;  1K90 D;  4FTG A;  1QWV A;  3AKB A;  2JC2 A;  1NIW A;  3D78 A;  1JUO A;  2BNX A;  3TS5 B;  2GW4 B;  3D10 A;  2H9W A;  4LJC A;  4DCK A;  1LVC D;  4EDO A;  2KBM A;  1NUB A;  3D0Y A;  3CAB A;  5D7F A;  1Z2C B;  5HBD A;  5I8N A;  3H4S E;  5FI2 A;  2BTJ A;  4WQ3 A;  4HRE E;  3DQ6 A;  4GGF C;  1HQV A;  1QV1 A;  2MHH A;  2M9G A;  1OXF A;  3PLF B;  1LA3 A;  1QVI Y;  5CSN A;  3LF4 B;  1RFJ A;  1AVS A;  1J7Q A;  1RM9 A;  1N0Y A;  3CZ0 A;  2HFC A;  3U8C A;  4W7R A;  3OHM B;  1BR4 B;  1RWY A;  3FS7 A;  1ORG A;  3NHI A;  2SCP A;  4KF5 C;  2LVV A;  3SG3 A;  4ZIO A;  4XGY A;  2DUE A;  2L51 A;  2MAZ A;  4PDZ A;  3SG2 A;  1UP5 A;  1YZW A;  3S0G A;  3EKJ A;  3CS1 A;  1CMG A;  2WHS A;  3F45 A;  1DF0 B;  5F9G A;  4IL1 A;  3SVR A;  4P76 A;  4L1I A;  4ZF5 A;  3PFV A;  4ZF4 A;  1NX1 A;  2JTZ A;  3E3R A;  4W6I A;  1SMG A;  3WHU B;  1SCM C;  4PE0 A;  1F8H A;  1B9C A;  1RRO A;  4Q7U A;  1JF2 A;  2K7O A;  2B3P A;  1W7T A;  5T3I A;  1NPQ A;  2BKI B;  1TUJ A;  5DTL A;  3OX5 A;  3CGL A;  3NED A;  4LW5 A;  3ST0 A;  1OOI X;  2LM5 A;  2NXQ A;  3H1O A;  3L4L A;  1SSE B;  2OTB A;  2G2S B;  3DQ4 A;  2WC5 A;  4MSP A;  4Q04 A;  1S6C A;  5H89 A;  2Y1N A;  3DF0 B;  4PHM A;  3CZT X;  4JEO A;  3B6X A;  2QLE A;  1KQV A;  2BL0 C;  4HQ9 A;  3E5V A;  1N65 A;  3DYE A;  3SS4 A;  3DQ7 A;  4DKN A;  4IK5 A;  1CB1 A;  4B30 A;  3O6B A;  4W7C A;  2WHT A;  4W6O A;  4C0K A;  3LS3 A;  3N7H A;  1CLL A;  5LTP A;  2JUL A;  4ORN A;  3V2L A;  5CPV A;  2LV7 A;  2CXJ A;  2LUX A;  3SG4 A;  1YTZ C;  1S1E A;  1XVJ A;  2PVB A;  1TTX A;  4PE4 A;  1YUS A;  3JTD B;  3VK1 A;  3HCM A;  3SST A;  1IGV A;  4HRH A;  1KFU S;  2ZO7 A;  4PFE A;  4ZIN A;  1K95 A;  1A03 A;  4W75 A;  3M22 A;  3SSP A;  5HW9 A;  5JJG A;  1HCJ A;  5DRG A;  5CSI A;  4KW8 A;  5FI6 A;  2ZN9 A;  1QYF A;  4OHS A;  1QLS A;  1M31 A;  2HQZ A;  2KAV A;  4PE1 A;  4W6A A;  1L2O B;  3I5I C;  2TN4 A;  5J2O A;  1XFY O;  3CR2 A;  4YI9 A;  1YHG A;  1B7T Y;  2ZO6 A;  2K7C A;  1KFX S;  1B9A A;  2QZ0 A;  2YE1 A;  4OCI A;  4GBA A;  3LVD A;  5DIC A;  1DJH A;  3JVT C;  1A75 B;  3NXA A;  1FI6 A;  2WCK A;  4EUL A;  1IJ5 A;  2BCA A;  2L2E A;  5TNC A;  1WY9 A;  3DVM A;  1FPW A;  1G33 A;  3U0N A;  4OQW A;  4OY4 A;  1QIV A;  5DTY A;  1QS7 A;  3SV5 A;  2WOR A;  1QXP A;  4H47 A;  3LVA A;  3RZS A;  2JNF A;  2MA2 A;  3RWA A;  2FL1 A;  1XFZ O;  5DKR A;  4W6R A;  2P6B B;  3A4U B;  2VVH A;  2ICR A;  1PSR A;  2JT0 A;  3DQO A;  1KK7 Y;  5KSZ A;  4ICB A;  1CMF A;  5HZO A;  2QEV A;  1PUL A;  3GJ2 A;  5HZT A;  1KWO C;  2KOT A;  4QJ3 B;  5KTY A;  4JQ0 D;  4W6H A;  2QRF A;  1Z4H A;  5AFP A;  2QEO A;  4PT1 A;  2HQ8 A;  1C07 A;  3AAK A;  4NWS A;  1DGV A;  5AAN A;  2QDI A;  4JFG A;  5DKQ A;  3TS5 C;  4PPK A;  4GES B;  3GK4 X;  1U5I A;  2ARL A;  3TDI A;  2KSP A;  3PIB A;  4IZN A;  2LLT A;  1F0B A;  1JC0 A;  1WLM A;  3D74 A;  1G4Y R;  2JXC A;  2JNX A;  2LMU A;  4OJ0 A;  3DZT A;  5PAL A;  4NDB A;  2KBI A;  4DXN A;  1KSO A;  3CWG A;  2EGD A;  1Q4B A;  1QTX A;  1OMD A;  1QIW A;  4OKH A;  3VHT A;  2AHA A;  1BJF A;  2A54 B;  1ALV A;  4AOM A;  1F70 A;  1BOC A;  2M49 B;  3AKO A;  1J7O A;  4L13 A;  3LK1 A;  1RRX A;  3BXA A;  3NT9 A;  1KFU L;  2KGB C;  2QEH A;  3VRP A;  1V1G A;  4IK1 A;  1SL7 A;  4GNK B;  3SS5 A;  1BLQ A;  1FBV A;  4YGE B;  3CD1 A;  1NWD A;  2Z6Z A;  4ETO A;  5BPJ A;  4WRI A;  3AI5 A;  2JQ6 A;  5D3O A;  5EXU A;  3ICB A;  1Q80 A;  1DJI A;  3LF3 A;  2H8Q A;  1NSH A;  1S6J A;  5H87 A;  4L9M A;  5DPH A;  3S0E A;  1SY9 A;  2HRS A;  1OMR A;  4DKM A;  2PAS A;  4F0Z B;  1KYS A;  4ORB B;  3S0D A;  5FVG A;  4PHJ A;  2QPT A;  3FWB A;  3S0B A;  1ZGO A;  2VVJ A;  2G6Y A;  5EBJ A;  2M29 A;  1EMG A;  1YJ2 A;  3B87 A;  4HSZ A;  1OE9 B;  2E30 A;  3U8P A;  2EHB A;  4GOB A;  4W77 A;  3AI4 A;  3IQQ A;  1AJ5 A;  2KI6 D;  1K94 A;  2QAC A;  1IH0 A;  3UO9 A;  4OR9 B;  1EG3 A;  1KYR A;  5FVF A;  4MEW A;  3U0L A;  5DTZ A;  3EVR A;  2O5G A;  4PE7 A;  2A56 B;  1RTP 1;  3DQM A;  2E6W A;  2PQL A;  1JBZ A;  3NT3 A;  4W7A A;  3SG7 A;  2DD9 A;  2IB6 A;  2GGZ A;  4EN1 A;  2FJU B;  1JF0 A;  1ZFS A;  3D0Y B;  2WC6 A;  2KNE A;  1RMO A;  2JU0 A;  4W7E A;  4QJ4 B;  4RYS A;  2LVI A;  3JTD C;  4MZK A;  4YGD B;  1JC1 A;  2LE9 B;  3KEV A;  4NDC A;  1GFL A;  4PCW A;  1ZOT B;  3DQN A;  3B88 A;  3O77 A;  4L12 A;  1BR1 B;  1SYM A;  4OVN F;  3BUN B;  3EVV A;  2ZRS A;  3I5F B;  2Z1O A;  3FE6 A;  1S6Z A;  1C3Z A;  2ZFD A;  1EG4 A;  4M2O A;  1L2O C;  5EB7 A;  1PK0 D;  1NX0 A;  4W6D A;  1J1D A;  1S36 A;  3BUM B;  4N5X A;  3IQO A;  2MJW B;  2JRF A;  1CLB A;  3TUY B;  3EKH A;  4W7F A;  4LQU A;  3SVS A;  1QXT A;  1AJ4 A;  1WDC B;  2L98 A;  2I2R E;  1H4B A;  2AH8 A;  2MBX A;  4OGS A;  2B3Q A;  1Q4A A;  1MOU A;  2B1U A;  4ANJ A;  4CFQ A;  5HLO A;  3IR8 A;  2WOS A;  3CZ1 A;  4R1E A;  3SVE A;  1OOG A;  1AP4 A;  2P70 A;  1Z1P A;  1RMP A;  5CSF A;  2AAO A;  2Z6X A;  1QVI Z;  2LLS A;  2QEB A;  1H6R A;  2P71 A;  1XQM A;  2QLG A;  3HX4 A;  1S5G Y;  3EG5 B;  1MXE A;  4AR7 A;  3WXA A;  2DOQ A;  2JT8 A;  1J7R A;  1NX2 A;  5HKZ A;  5FI7 A;  4Q9W A;  1Y1A A;  4N3D A;  3TDU A;  1EMA A;  2KDH A;  1XFR A;  1XK4 C;  2NCP A;  2LLU A;  4B30 B;  3CFF A;  1JBA A;  2Q57 A;  2G3D B;  3R1O A;  2A48 A;  3BUX B;  2PMY A;  2AWJ A;  5EJU A;  1BMO A;  4Q7T A;  1OZS A;  1E8A A;  4CFR A;  1XFW O;  2HGY A;  4W6S A;  5LTQ A;  4DXO A;  1NX3 A;  2WCJ A;  1YX8 A;  3GEX A;  3SSL A;  3S0F A;  2EC6 B;  5DRF A;  1K8U A;  1YFP A;  4KAG A;  1W7I B;  2JPO A;  3LVC A;  1ALW A;  4H3L A;  2YDZ A;  1CDN A;  3D73 A;  4JC2 A;  1IQ5 A;  2G2B A;  3BYA A;  4ZCU A;  4N1G A;  1W7S A;  1OOH A;  2LCP A;  3DPX A;  1ZAC A;  3BXC A;  3SVO A;  1DJG A;  2GTE A;  1F4O A;  1GM0 A;  1TCO B;  3R72 A;  3L47 A;  1PVA A;  3SVN A;  1BOD A;  4LJD A;  4I2Y A;  2DD7 A;  1W9Z A;  3O4X A;  1TIZ A;  1G8I A;  4R6D A;  1SPY A;  2DDD A;  1KK8 B;  3VRR A;  5EHU A;  1JFJ A;  4DXI A;  1GQM A;  2G9B A;  1X02 A;  3KPX A;  4XYN A;  2BAP A;  5BQL A;  4XJK A;  4FQT A;  3ZUL A;  1QX5 B;  2FCE A;  5DY6 A;  5CSJ A;  2O2B A;  2RH7 A;  4R6B A;  3DQA A;  2F3Y A;  2LHI A;  3LCP C;  4BY4 A;  2L50 A;  4MVF A;  1CM1 A;  1FW4 A;  4U2V A;  4U8D A;  2KAX A;  4IK3 A;  3BXK A;  4H3M A;  1SNL A;  3DVE A;  2M8U A;  1UIS A;  2GX2 A;  4LQT A;  4CPV A;  2EMN A;  1CDM A;  3O78 A;  1QY3 A;  2K0J A;  4JKT A;  2LUC A;  2L5X B;  5DPJ A;  4W7X A;  4C0J A;  1BF5 A;  3ZUJ A;  2JPT A;  1K2H A;  3BX9 A;  3CD9 A;  2LVK A;  3LL8 B;  1V1F A;  3LLE A;  3D75 A;  1EMB A;  2VZX A;  2KFH A;  2BEC A;  4W6T A;  4W6B A;  3TZ1 A;  2KQY A;  2ZRT A;  1KP5 A;  4ZBL A;  1A2X A;  2M1U A;  3KF9 A;  1CM4 A;  1Q4C A;  2QLH A;  1HT9 A;  3BUO B;  4W6P A;  2GV5 A;  5LK4 A;  1MQ1 A;  2V4E A;  1B7T Z;  3NSK A;  1PRW A;  2JXL A;  3I5G B;  3PJ5 A;  2K7D A;  3DQE A;  3DPW A;  1OOF A;  1YVL A;  2F2O A;  3PM2 A;  1EME A;  2H61 A;  3UG0 A;  1U5I B;  2A53 B;  3M24 A;  3PSR A;  2Y4Q A;  2Q6P A;  2WIQ A;  4DXP A;  1CFC A;  4BY5 A;  2YE0 A;  5ER5 A;  4YGC B;  2KFF A;  1F09 A;  1OMV A;  4EDS A;  2G6X A;  2K61 A;  4N1F A;  4XOW A;  2BE6 A;  3VRQ A;  4NQG A;  4IK9 A;  1QX2 A;  1XAE A;  1K9P A;  2EMO A;  2LC5 A;  4HE4 A;  3SIB A;  5I94 A;  3I5F C;  1REC A;  3BJH A;  2R2I A;  4YBH B;  3VHT B;  1IWQ A;  2KFG A;  4JRB A;  3CLN A;  1AHR A;  1XA5 A;  2L4I A;  3EVU A;  4KF4 A;  4DXQ A;  1C4F A;  4P1Q A;  4PAL A;  2H8V A;  2DDC A;  1KK7 Z;  4NDD A;  3B86 A;  2WHU A;  3SSV A;  1BU3 A;  2QLI A;  2HQW A;  4W6L A;  3TUY C;  2FCD A;  3BOW A;  2IB5 A;  4YGB B;  3SVD A;  5HZU A;  4MRX A;  2F2P A;  5DTX A;  4ZF3 A;  2A52 B;  1WDC C;  3ZTF A;  1QV0 A;  4YRU A;  2CTN A;  2HCG A;  5HYD A;  2OKW A;  3ZWH A;  2AWM A;  1N2D A;  1GGW A;  3LA1 A;  1TOP A;  2GGM A;  1EXR A;  2ISD A;  2LMV A;  2WCM A;  5HKY A;  2Y5I A;  4AS8 A;  3FIA A;  1ZGQ A;  2WC8 A;  5I2Q A;  4Q7R A;  3O4Y A;  3OGN A;  3KCS A;  1CLM A;  1FF1 A;  3FWC A;  1OOJ A;  1YHH A;  4GGF A;  3PN7 B;  3SS3 A;  4W7D A;  1JSA A;  3VRN A;  1SBJ A;  3GB3 A;  4PPL A;  2CCM A;  1YHI A;  3SG5 A;  4XL5 A;  4KEX A;  4H3N A;  4DXM A;  4GF6 B;  1YUU A;  2VAE A;  3TDZ A;  2K60 A;  1M63 B;  1CV7 A;  1WRL A;  4W73 A;  2HPS A;  1C7W A;  3S05 A;  4E68 A;  2FZU A;  3I5H B;  3DQ8 A;  4PPJ A;  3ED8 A;  1AUI B;  4KF5 A;  1CFP A;  1FI5 A;  3DVJ A;  3G9A A;  1Y0V H;  1IRJ A;  1ZUZ A;  1Y1U A;  4LJB A;  2KYF A;  4MRY A;  1UHK A;  1KQM B;  4CID A;  3ZUF A;  1Q73 A;  2EC6 C;  1DGU A;  3SRY A;  1R2U A;  2KI6 C;  3A8R A;  1K9K A;  1J1E A;  1BFP A;  3IF7 A;  1QYO A;  3QME A;  1LXF C;  3NSL A;  1MXL C;  2OPO A;  2SAS A;  3WLD A;  2A47 A;  1GJY A;  1WRK A;  2HQK A;  4I5J A;  1LA0 A;  5ER4 X;  1KYP A;  4GFT A;  1YUR A;  2JZI A;  4AQJ A;  3DQC A;  3FE8 A;  1AK8 A;  3OSQ A;  1DEL A;  1KK8 C;  2BBM A;  2JOJ A;  2HGD A;  2A46 A;  1TWO A;  1DJW A;  1S6I A;  5DPG A;  1NYA A;  4A4C A;  2WSN A;  3CR4 X;  3KHE A;  3GK2 A;  1UHI A;  4W6U A;  3I5I B;  1NCZ A;  1XMZ A;  4KGE A;  2C9I A;  3GL4 A;  3BFH A;  4J89 A;  1BG1 A;  3BFB A;  1UHH A;  4BDU A;  2LAN A;  5J3X A;  5EL2 A;  1DT7 B;  3DQK A;  1UUS A;  1C3Y A;  1NCX A;  2WUR A;  4USL A;  4W6C A;  5FHV A;  1DMO A;  1OXE A;  1UHN A;  5I2O A;  2PXW A;  3WHT B;  2L2C A;  1Q4E A;  5DQM A;  2KLD A;  2WCL A;  4W6J A;  4W76 A;  1PSB A;  3M0W A;  5AEQ A;  3S0A A;  1Y1X A;  1M45 A;  2QLG B;  2ZMU A;  1QJT A;  5BTT A;  4XOV A;  5BT0 A;  2CBL A;  1J55 A;  4INW A;  2WIS A;  1CFF A;  4IK4 A;  2OS8 B;  2A4J A;  5IBW A;  4W6M A;  1IKU A;  3VGO A;  3GJ1 A;  3SSH A;  2H6V A;  3DQL A;  3NHT A;  2K8M B;  3EK8 A;  3R1V A;  3I5G C;  2KPH A;  1UUR A;  2H5Q A;  1B8C A;  4HQC A;  2HET A;  2KYC A;  2OGR A;  3C1V A;  3DQD A;  1K93 D;  1P28 A;  3NGV A;  2WCF A;  3DQ5 A;  1TNQ A;  1TRF A;  4OV2 A;  1SKT A;  1XYD A;  3K21 A;  5EXC I;  1DEK A;  4M2P A;  3PM8 A;  2VVI A;  2CNP A;  4I5L B;  4EMQ A;  4KW4 A;  3CTN A;  1DJX A;  4INX A;  4W6G A;  2JWW A;  4Z4K A;  3IP2 A;  3U0M A;  2ZN8 A;  5HGE A;  1DJZ A;  4J88 A;  4ZFS A;  4GAO A;  1B47 A;  1TNX A;  1T14 A;  2NZ0 A;  1MR8 A;  2HF5 A;  2LHL A;  1S5G Z;  4ORA B;  2HPW A;  4UTS A;  1UWO A;  1F54 A;  3ADF A;  2H2K A;  5H88 A;  5GQQ C;  5AXI A;  4XVP A;  2Z6Y A;  1YRT B;  2D8N A;  3DQU A;  1TNP A;  3CFA A;  4HQ8 A;  1F71 A;  3BQ3 A;  2F33 A;  1YUT A;  3DQ1 A;  1PAL A;  4TZG A;  2KLE A;  1EMF A;  2QU1 A;  2BBN A;  3BUW B;  3P8U A;  3W1D A;  2I18 A;  1SR6 B;  4FQO A;  1S26 D;  4XJK B;  1QLK A;  4KA9 A;  2DUI A;  4JD9 A;  2WCH A;  3MGF A;  3W1C A;  2LVJ A;  5DKN A;  2G3O A;  5I2L A;  1ZUX A;  2LAP A;  3DXL A;  2COL B;  2F8P A;  1JFK A;  1IJ6 A;  5EXB A;  1OZO A;  4YGA A;  2OTG B;  2K7B A;  3PN7 C;  2PYQ A;  3H1R A;  1B8R A;  1D1O A;  2H5P A;  1LS8 A;  4F7F A;  3K1K A;  1F55 A;  3ST4 A;  1EMC A;  4MLW A;  3SVB A;  1B1G A;  2DUH A;  2LMT A;  4W74 A;  3CFH A;  3E5W A;  4WQ2 A;  1QAS A;  4UPG A;  3GOF A;  1CTR A;  2MLE C;  3AKA A;  3SVU A;  1H4U A;  3I5H C;  4ZB1 A;  2POX A;  4KYN A;  1EMM A;  4RYW A;  2MLF C;  2WSO A;  1JBY A;  3SSK A;  1GL4 A;  2PSR A;  4I5K A;  1HUY A;  1YX7 A;  2V4E B;  4TNC A;  5DQB A;  2O60 A;  1KQM C;  1DF0 A;  3VB1 A;  2JAD A;  3WCK A;  1ZMZ A;  3EK7 A;  1WRZ A;  5F6T A;  3PJI A;  1SW8 A;  1QAT A;  4DRW A;  2V53 A;  2C9J A;  3EVP A;  1CDP A;  2PRU A;  1ODB A;  3DPZ A;  2OKY A;  2Q91 A;  1DJY A; 
#chains in the Genus database with same CATH homology
 2KQ6 A;  4KW9 A;  5AER A;  4J8A A;  4W72 A;  1RMM A;  1W7U A;  1NP8 A;  3OB2 B;  2I94 A;  2AWL A;  3DQ9 A;  1OSA A;  2JTT A;  2Q4U A;  1SL9 A;  3SG6 A;  5G08 A;  3EK4 A;  3NSI A;  1SRA A;  1W7J B;  3DF0 A;  2G5Z B;  3OX6 A;  5FYX A;  4AQI A;  2KI4 B;  3BOW B;  3DQH A;  3DVK A;  2M0R A;  2G6E A;  3OP0 A;  4W69 A;  4JWQ A;  3GK1 A;  1MF8 B;  3E5T A;  1M46 A;  5FVI A;  1XFU O;  1EH2 A;  3RWT A;  3V3D A;  1G7K A;  4HVF A;  2G16 B;  1CKK A;  2Y0G A;  1L7Z A;  5B8I B;  1SL8 A;  2OJK A;  2WCE A;  1EML A;  2KHN A;  3ST2 A;  1PVB A;  2AMI A;  4Q9X A;  2M3W A;  3AAJ A;  4JF9 A;  3CGA A;  1EL4 A;  3CR5 X;  1GGX A;  4PHN A;  1WLZ A;  3I19 A;  4DS7 A;  2M7L A;  1C7V A;  3DD4 A;  2OS8 C;  3SJS A;  4TZA A;  4C0L A;  3VIC A;  1SK6 D;  1K9U A;  2L4H A;  4GGN A;  4B5Y A;  2MRD A;  1VRK A;  3SIA A;  2QT2 A;  3DQJ A;  5AQB B;  1B4C A;  1M39 A;  3VRO A;  2NCO A;  3PAT A;  5JOL A;  2NLN A;  2KAY A;  1A75 A;  2PXS A;  3BXB A;  4IK8 A;  3OSR A;  5HKW A;  1CFD A;  3WLC A;  1YRU B;  1EMK A;  1R6P A;  3LSA A;  1SCM B;  4GUK A;  1JWD A;  3ST3 A;  1Q4D A;  4Z4M A;  3OB1 B;  3PJ7 A;  1QYQ A;  5EB6 A;  2BKH B;  3QRX A;  3O2P A;  3P28 A;  4JPZ B;  2F3Z A;  2IS9 A;  4LJD C;  4MBE A;  3A8S A;  2JT3 A;  3MSE B;  1LIN A;  1NCY A;  2KGR A;  2O24 A;  2CT9 A;  2LP2 A;  2H5R A;  2ZMW A;  4CLN A;  2ZKM X;  5K89 A;  1CDL A;  4KGF A;  3KO0 A;  2WND A;  2K2A A;  1CNP A;  1MYW A;  2DUG A;  1RJV A;  1MUX A;  5HLV A;  1SR6 C;  4P2Y B;  1Z1Q A;  2BL0 B;  4RTC A;  2HJO A;  2M97 A;  4HRG A;  5D69 A;  1BT6 A;  3WNX B;  2AUC A;  1MHO A;  1XK4 A;  2P4M A;  4M2Q A;  1QX7 A;  3UFZ A;  5KU1 A;  1GGZ A;  1H8B A;  4ORC B;  1KSM A;  3NSO A;  2RGI A;  3KCT A;  3DQI A;  3DQF A;  2A50 B;  3U0K A;  2OTG C;  4MN0 A;  3PJB A;  5KTG A;  4MZL A;  1XFX O;  4QJ5 B;  2LNK A;  2Y1M A;  4H48 A;  3SSY A;  2VRG A;  1IQ3 A;  1KFX L;  1IG5 A;  1KCY A;  3LK0 A;  3U8A A;  1RK9 A;  4PHK A;  3RLZ A;  1DTL A;  4W6K A;  5BTT B;  3NEZ A;  4DIR A;  2WCB A;  2ZNE A;  4JGE A;  4P5O E;  1XSS A;  1YVH A;  2O29 A;  2ZND A;  1MWN A;  4I5N B;  3PAL A;  3CBE A;  4MZJ A;  3TMR A;  1XA9 A;  3SS0 A;  1B8L A;  2V4E C;  1UHJ A;  2EMD A;  2VAD A;  3OGO A;  2BE4 A;  2M7N A;  1TNW A;  1A4P A;  2PAL A;  2H61 C;  3SVC A;  3NF0 A;  2M1K B;  1Y6W A;  3ZNI A;  5LTR A;  1ZGP A;  1TN4 A;  1J7P A;  1A29 A;  2YFP A;  1YR5 A;  2BCB A;  3DQ3 A;  3CB9 A;  2LP3 A;  5HZS A;  3JVT B;  4KPI A;  1XO5 A;  2H5O A;  1S3P A;  2FOT A;  1YJF A;  2IE2 A;  3TMT A;  2FWQ A;  4ZCV A;  2IOV A;  1F4Q A;  1LKJ A;  1OXD A;  4GPL B;  2GW3 A;  2GX0 A;  1EJ3 A;  5DU0 A;  3RM1 A;  1SCV A;  4D1E A;  2I7A A;  1XFV O;  2DUF A;  5DPI A;  2L0P A;  4DUQ A;  1OQP A;  2OTE A;  1TCF A;  2BCX A;  2K2F A;  1K96 A;  4W6F A;  2KI4 C;  2AWK A;  1DVI A;  4A4B A;  1JC2 A;  3DQ2 A;  1KWO B;  4YI8 A;  4W6N A;  1MOV A;  1K90 D;  4FTG A;  3AKB A;  2JC2 A;  1NIW A;  1JUO A;  3TS5 B;  2GW4 B;  3D10 A;  2H9W A;  4LJC A;  4DCK A;  1LVC D;  4EDO A;  2KBM A;  1NUB A;  3D0Y A;  5D7F A;  5HBD A;  5I8N A;  3H4S E;  2BTJ A;  4WQ3 A;  4HRE E;  3DQ6 A;  4GGF C;  1HQV A;  1QV1 A;  2MHH A;  2M9G A;  1OXF A;  3PLF B;  1LA3 A;  1QVI Y;  5CSN A;  3LF4 B;  1RFJ A;  1AVS A;  1J7Q A;  1RM9 A;  1N0Y A;  2HFC A;  3U8C A;  4W7R A;  3OHM B;  1BR4 B;  1RWY A;  3FS7 A;  2SCP A;  4KF5 C;  2LVV A;  3SG3 A;  4ZIO A;  4XGY A;  2DUE A;  2L51 A;  2MAZ A;  4PDZ A;  3SG2 A;  1UP5 A;  1YZW A;  3EKJ A;  3CS1 A;  1CMG A;  2WHS A;  3F45 A;  1DF0 B;  5F9G A;  4IL1 A;  3SVR A;  4P76 A;  4L1I A;  4ZF5 A;  3PFV A;  4ZF4 A;  1NX1 A;  2JTZ A;  3E3R A;  4W6I A;  1SMG A;  3WHU B;  1SCM C;  4PE0 A;  1F8H A;  1B9C A;  1RRO A;  4Q7U A;  1JF2 A;  2K7O A;  2B3P A;  1W7T A;  5T3I A;  1NPQ A;  2BKI B;  5DTL A;  3OX5 A;  3CGL A;  3NED A;  4LW5 A;  3ST0 A;  2LM5 A;  2NXQ A;  3H1O A;  2OTB A;  2G2S B;  3DQ4 A;  4MSP A;  4Q04 A;  1S6C A;  5H89 A;  2Y1N A;  3DF0 B;  4PHM A;  3CZT X;  4JEO A;  1KQV A;  2BL0 C;  2QLE A;  4HQ9 A;  3E5V A;  1N65 A;  3DQ7 A;  4DKN A;  4IK5 A;  1CB1 A;  4B30 A;  3O6B A;  4W7C A;  2WHT A;  4W6O A;  4C0K A;  3LS3 A;  1CLL A;  5LTP A;  2JUL A;  4ORN A;  5CPV A;  2LV7 A;  2CXJ A;  2LUX A;  3SG4 A;  1YTZ C;  1S1E A;  1XVJ A;  2PVB A;  1TTX A;  4PE4 A;  1YUS A;  3JTD B;  3VK1 A;  3HCM A;  3SST A;  1IGV A;  4HRH A;  1KFU S;  2ZO7 A;  4PFE A;  4ZIN A;  1K95 A;  1A03 A;  4W75 A;  3M22 A;  3SSP A;  5HW9 A;  5JJG A;  1HCJ A;  5DRG A;  5CSI A;  4KW8 A;  2ZN9 A;  1QYF A;  4OHS A;  1QLS A;  1M31 A;  2HQZ A;  2KAV A;  4PE1 A;  4W6A A;  1L2O B;  3I5I C;  2TN4 A;  5J2O A;  1XFY O;  3CR2 A;  4YI9 A;  1YHG A;  1B7T Y;  2ZO6 A;  2K7C A;  1KFX S;  1B9A A;  2QZ0 A;  2YE1 A;  4OCI A;  4GBA A;  3LVD A;  1DJH A;  3JVT C;  1A75 B;  3NXA A;  1FI6 A;  4EUL A;  1IJ5 A;  2BCA A;  2L2E A;  5TNC A;  1WY9 A;  3DVM A;  1FPW A;  1G33 A;  3U0N A;  4OQW A;  4OY4 A;  1QIV A;  5DTY A;  1QS7 A;  3SV5 A;  2WOR A;  1QXP A;  4H47 A;  3LVA A;  2JNF A;  2MA2 A;  3RWA A;  2FL1 A;  1XFZ O;  5DKR A;  4W6R A;  2P6B B;  3A4U B;  2VVH A;  2ICR A;  1PSR A;  2JT0 A;  3DQO A;  1KK7 Y;  5KSZ A;  4ICB A;  1CMF A;  5HZO A;  1PUL A;  3GJ2 A;  5HZT A;  1KWO C;  2KOT A;  4QJ3 B;  5KTY A;  4JQ0 D;  4W6H A;  2QRF A;  5AFP A;  2HQ8 A;  1C07 A;  3AAK A;  4NWS A;  1DGV A;  5AAN A;  4JFG A;  5DKQ A;  3TS5 C;  4PPK A;  4GES B;  3GK4 X;  1U5I A;  2ARL A;  3TDI A;  2KSP A;  3PIB A;  4IZN A;  2LLT A;  1F0B A;  1JC0 A;  1WLM A;  1G4Y R;  2JXC A;  2JNX A;  2LMU A;  4OJ0 A;  5PAL A;  4NDB A;  2KBI A;  4DXN A;  1KSO A;  3CWG A;  2EGD A;  1Q4B A;  1QTX A;  1OMD A;  1QIW A;  4OKH A;  3VHT A;  2AHA A;  1BJF A;  2A54 B;  1ALV A;  4AOM A;  1F70 A;  1BOC A;  2M49 B;  3AKO A;  1J7O A;  4L13 A;  3LK1 A;  1RRX A;  3BXA A;  3NT9 A;  1KFU L;  2KGB C;  3VRP A;  1V1G A;  4IK1 A;  1SL7 A;  4GNK B;  1BLQ A;  1FBV A;  4YGE B;  3CD1 A;  1NWD A;  2Z6Z A;  4ETO A;  5BPJ A;  4WRI A;  3AI5 A;  2JQ6 A;  5EXU A;  3ICB A;  1Q80 A;  1DJI A;  3LF3 A;  2H8Q A;  1NSH A;  1S6J A;  5H87 A;  4L9M A;  5DPH A;  1SY9 A;  2HRS A;  1OMR A;  4DKM A;  2PAS A;  4F0Z B;  1KYS A;  4ORB B;  5FVG A;  4PHJ A;  2QPT A;  3FWB A;  1ZGO A;  2VVJ A;  2G6Y A;  5EBJ A;  2M29 A;  1EMG A;  1YJ2 A;  4HSZ A;  1OE9 B;  2E30 A;  3U8P A;  2EHB A;  4GOB A;  4W77 A;  3AI4 A;  3IQQ A;  1AJ5 A;  2KI6 D;  1K94 A;  2QAC A;  1IH0 A;  4OR9 B;  1EG3 A;  1KYR A;  5FVF A;  4MEW A;  3U0L A;  5DTZ A;  3EVR A;  2O5G A;  4PE7 A;  2A56 B;  1RTP 1;  3DQM A;  2E6W A;  1JBZ A;  3NT3 A;  4W7A A;  3SG7 A;  2DD9 A;  2IB6 A;  2GGZ A;  4EN1 A;  2FJU B;  1JF0 A;  1ZFS A;  3D0Y B;  2KNE A;  1RMO A;  2JU0 A;  4W7E A;  4QJ4 B;  4RYS A;  2LVI A;  3JTD C;  4MZK A;  4YGD B;  1JC1 A;  2LE9 B;  3KEV A;  4NDC A;  1GFL A;  4PCW A;  1ZOT B;  3DQN A;  3O77 A;  4L12 A;  1BR1 B;  1SYM A;  4OVN F;  3BUN B;  3EVV A;  2ZRS A;  3I5F B;  2Z1O A;  1S6Z A;  2ZFD A;  1EG4 A;  4M2O A;  1L2O C;  5EB7 A;  1PK0 D;  1NX0 A;  4W6D A;  1J1D A;  1S36 A;  3BUM B;  4N5X A;  3IQO A;  2MJW B;  2JRF A;  1CLB A;  3TUY B;  3EKH A;  4W7F A;  4LQU A;  3SVS A;  1QXT A;  1AJ4 A;  1WDC B;  2L98 A;  2I2R E;  1H4B A;  2AH8 A;  2MBX A;  4OGS A;  2B3Q A;  1Q4A A;  1MOU A;  2B1U A;  4ANJ A;  4CFQ A;  5HLO A;  3IR8 A;  2WOS A;  4R1E A;  3SVE A;  1AP4 A;  1Z1P A;  1RMP A;  5CSF A;  2AAO A;  2Z6X A;  1QVI Z;  2LLS A;  1H6R A;  1XQM A;  2QLG A;  3HX4 A;  1S5G Y;  1MXE A;  4AR7 A;  3WXA A;  2DOQ A;  2JT8 A;  1J7R A;  1NX2 A;  5HKZ A;  4Q9W A;  1Y1A A;  4N3D A;  3TDU A;  1EMA A;  2KDH A;  1XK4 C;  2NCP A;  2LLU A;  4B30 B;  3CFF A;  1JBA A;  2Q57 A;  2G3D B;  2A48 A;  3BUX B;  2PMY A;  2AWJ A;  5EJU A;  1BMO A;  4Q7T A;  1OZS A;  1E8A A;  4CFR A;  1XFW O;  2HGY A;  4W6S A;  5LTQ A;  4DXO A;  1NX3 A;  1YX8 A;  3GEX A;  3SSL A;  2EC6 B;  5DRF A;  1K8U A;  1YFP A;  4KAG A;  1W7I B;  3LVC A;  1ALW A;  4H3L A;  2YDZ A;  1CDN A;  4JC2 A;  1IQ5 A;  2G2B A;  3BYA A;  4ZCU A;  4N1G A;  1W7S A;  2LCP A;  3DPX A;  1ZAC A;  3BXC A;  3SVO A;  1DJG A;  1F4O A;  1TCO B;  1PVA A;  3SVN A;  1BOD A;  4LJD A;  4I2Y A;  2DD7 A;  1TIZ A;  1G8I A;  4R6D A;  1SPY A;  2DDD A;  1KK8 B;  3VRR A;  5EHU A;  1JFJ A;  4DXI A;  1GQM A;  2G9B A;  1X02 A;  3KPX A;  4XYN A;  5BQL A;  4XJK A;  3ZUL A;  1QX5 B;  2FCE A;  5DY6 A;  5CSJ A;  2O2B A;  2RH7 A;  4R6B A;  3DQA A;  2F3Y A;  2LHI A;  3LCP C;  4BY4 A;  2L50 A;  4MVF A;  1CM1 A;  1FW4 A;  4U2V A;  4U8D A;  2KAX A;  4IK3 A;  3BXK A;  4H3M A;  1SNL A;  3DVE A;  2M8U A;  1UIS A;  2GX2 A;  4LQT A;  4CPV A;  2EMN A;  1CDM A;  3O78 A;  1QY3 A;  2K0J A;  2LUC A;  2L5X B;  5DPJ A;  4W7X A;  4C0J A;  1BF5 A;  3ZUJ A;  2JPT A;  1K2H A;  3BX9 A;  3CD9 A;  2LVK A;  3LL8 B;  1V1F A;  3LLE A;  1EMB A;  2VZX A;  2KFH A;  2BEC A;  4W6T A;  4W6B A;  3TZ1 A;  2KQY A;  2ZRT A;  1KP5 A;  4ZBL A;  1A2X A;  2M1U A;  3KF9 A;  1CM4 A;  1Q4C A;  2QLH A;  1HT9 A;  3BUO B;  4W6P A;  2GV5 A;  5LK4 A;  1MQ1 A;  2V4E A;  1B7T Z;  3NSK A;  1PRW A;  2JXL A;  3PJ5 A;  3I5G B;  2K7D A;  3DQE A;  3DPW A;  1YVL A;  2F2O A;  1EME A;  2H61 A;  3UG0 A;  1U5I B;  2A53 B;  3M24 A;  3PSR A;  2Y4Q A;  2Q6P A;  2WIQ A;  4DXP A;  1CFC A;  4BY5 A;  2YE0 A;  5ER5 A;  4YGC B;  2KFF A;  1F09 A;  1OMV A;  4EDS A;  2G6X A;  2K61 A;  4N1F A;  4XOW A;  2BE6 A;  3VRQ A;  4NQG A;  4IK9 A;  1QX2 A;  1XAE A;  1K9P A;  2EMO A;  2LC5 A;  4HE4 A;  3SIB A;  3I5F C;  1REC A;  2R2I A;  4YBH B;  3VHT B;  1IWQ A;  2KFG A;  4JRB A;  4KF4 A;  3CLN A;  1AHR A;  1XA5 A;  2L4I A;  3EVU A;  4DXQ A;  1C4F A;  4P1Q A;  4PAL A;  2DDC A;  1KK7 Z;  4NDD A;  2WHU A;  3SSV A;  1BU3 A;  2QLI A;  2HQW A;  4W6L A;  3TUY C;  2FCD A;  3BOW A;  2IB5 A;  4YGB B;  3SVD A;  5HZU A;  4MRX A;  2F2P A;  5DTX A;  4ZF3 A;  2A52 B;  1WDC C;  3ZTF A;  1QV0 A;  4YRU A;  2CTN A;  2HCG A;  5HYD A;  2OKW A;  3ZWH A;  2AWM A;  1N2D A;  1GGW A;  3LA1 A;  1TOP A;  2GGM A;  1EXR A;  2ISD A;  2LMV A;  5HKY A;  2Y5I A;  4AS8 A;  3FIA A;  1ZGQ A;  2WC8 A;  5I2Q A;  4Q7R A;  3O4Y A;  3KCS A;  1CLM A;  1FF1 A;  3FWC A;  1OOJ A;  1YHH A;  4GGF A;  3PN7 B;  4W7D A;  1JSA A;  3VRN A;  1SBJ A;  3GB3 A;  4PPL A;  2CCM A;  1YHI A;  3SG5 A;  4XL5 A;  4KEX A;  4H3N A;  4DXM A;  4GF6 B;  1YUU A;  2VAE A;  3TDZ A;  1M63 B;  1CV7 A;  1WRL A;  4W73 A;  2HPS A;  1C7W A;  3S05 A;  4E68 A;  2FZU A;  3I5H B;  3DQ8 A;  4PPJ A;  3ED8 A;  1AUI B;  4KF5 A;  1CFP A;  1FI5 A;  3DVJ A;  3G9A A;  1Y0V H;  1IRJ A;  1ZUZ A;  1Y1U A;  4LJB A;  2KYF A;  4MRY A;  1UHK A;  1KQM B;  4CID A;  3ZUF A;  1Q73 A;  2EC6 C;  1DGU A;  3SRY A;  1R2U A;  2KI6 C;  3A8R A;  1K9K A;  1J1E A;  1BFP A;  3IF7 A;  1QYO A;  1LXF C;  3NSL A;  1MXL C;  2OPO A;  2SAS A;  3WLD A;  2A47 A;  1GJY A;  1WRK A;  2HQK A;  4I5J A;  1LA0 A;  5ER4 X;  1KYP A;  4GFT A;  1YUR A;  2JZI A;  4AQJ A;  3DQC A;  1AK8 A;  3OSQ A;  1KK8 C;  2BBM A;  2JOJ A;  2HGD A;  2A46 A;  1DJW A;  1S6I A;  5DPG A;  1NYA A;  4A4C A;  2WSN A;  3CR4 X;  3KHE A;  3GK2 A;  1UHI A;  4W6U A;  3I5I B;  1NCZ A;  1XMZ A;  4KGE A;  2C9I A;  3GL4 A;  4J89 A;  1BG1 A;  1UHH A;  4BDU A;  2LAN A;  5J3X A;  1DT7 B;  3DQK A;  1UUS A;  1NCX A;  2WUR A;  4USL A;  4W6C A;  5FHV A;  1DMO A;  1OXE A;  1UHN A;  5I2O A;  2PXW A;  3WHT B;  1Q4E A;  5DQM A;  4W6J A;  4W76 A;  1PSB A;  3M0W A;  5AEQ A;  1Y1X A;  1M45 A;  2QLG B;  2ZMU A;  1QJT A;  5BTT A;  4XOV A;  5BT0 A;  2CBL A;  1J55 A;  2WIS A;  1CFF A;  4IK4 A;  2OS8 B;  2A4J A;  5IBW A;  4W6M A;  1IKU A;  3VGO A;  3GJ1 A;  3SSH A;  2H6V A;  3DQL A;  2K8M B;  3EK8 A;  3I5G C;  1UUR A;  2H5Q A;  1B8C A;  4HQC A;  2HET A;  2KYC A;  2OGR A;  3C1V A;  3DQD A;  1K93 D;  2WCF A;  3DQ5 A;  1TNQ A;  1TRF A;  4OV2 A;  1SKT A;  1XYD A;  3K21 A;  5EXC I;  4M2P A;  3PM8 A;  2VVI A;  2CNP A;  4I5L B;  4EMQ A;  4KW4 A;  3CTN A;  1DJX A;  4W6G A;  2JWW A;  4Z4K A;  3IP2 A;  3U0M A;  2ZN8 A;  5HGE A;  1DJZ A;  4J88 A;  4ZFS A;  4GAO A;  1B47 A;  1TNX A;  2NZ0 A;  1MR8 A;  2HF5 A;  2LHL A;  1S5G Z;  4ORA B;  2HPW A;  4UTS A;  1UWO A;  1F54 A;  3ADF A;  2H2K A;  5H88 A;  5GQQ C;  5AXI A;  4XVP A;  2Z6Y A;  1YRT B;  2D8N A;  3DQU A;  1TNP A;  3CFA A;  4HQ8 A;  1F71 A;  3BQ3 A;  2F33 A;  1YUT A;  3DQ1 A;  4TZG A;  1PAL A;  1EMF A;  3P8U A;  2QU1 A;  2BBN A;  3BUW B;  3W1D A;  2I18 A;  1SR6 B;  4FQO A;  1S26 D;  4XJK B;  1QLK A;  4KA9 A;  2DUI A;  3MGF A;  3W1C A;  2LVJ A;  5DKN A;  2G3O A;  5I2L A;  1ZUX A;  2LAP A;  2COL B;  2F8P A;  1JFK A;  1IJ6 A;  5EXB A;  1OZO A;  4YGA A;  2OTG B;  2K7B A;  3PN7 C;  3H1R A;  1B8R A;  1D1O A;  2H5P A;  3K1K A;  1F55 A;  3ST4 A;  1EMC A;  4MLW A;  3SVB A;  1B1G A;  2DUH A;  2LMT A;  4W74 A;  3CFH A;  3E5W A;  4WQ2 A;  1QAS A;  4UPG A;  3GOF A;  1CTR A;  2MLE C;  3AKA A;  3SVU A;  1H4U A;  3I5H C;  4ZB1 A;  2POX A;  1EMM A;  4RYW A;  2MLF C;  2WSO A;  1JBY A;  3SSK A;  1GL4 A;  2PSR A;  4I5K A;  1HUY A;  1YX7 A;  2V4E B;  4TNC A;  5DQB A;  2O60 A;  1KQM C;  1DF0 A;  2JAD A;  3WCK A;  1ZMZ A;  3EK7 A;  1WRZ A;  5F6T A;  1SW8 A;  1QAT A;  4DRW A;  2V53 A;  2C9J A;  3EVP A;  1CDP A;  2PRU A;  1ODB A;  3DPZ A;  2OKY A;  2Q91 A;  1DJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...