3SG5A

Crystal structure of dimeric gcamp3-d380y, qp(linker 1), lp(linker 2)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
409
structure length
387
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSQPNVYIKADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLPDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMADSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of a GCaMP calcium indicator for neural activity imaging.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 124
structure length 387
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3sg5A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3sg5A01
1YRTB 1YUSA 1K95A 3K1KA 1JBAA 4MRYA 2F2PA 2KHNA 4OKHA 1AP4A 3JTDC 2Y4QA 4PE4A 3AI4A 5DPGA 5EHUA 5DTYA 3SVSA 5KSZA 1OMDA 2JU0A 1K90D 4KW9A 3CWGA 1NYAA 2M97A 1AJ4A 4W6MA 1HQVA 1YX8A 1F8HA 4GBAA 2ZMUA 2H6VA 3DD4A 3LCPC 1KYSA 5I2LA 1JUOA 1A75B 2JOJA 3DF0A 3DPWA 4JC2A 1WY9A 3SG5A 1C07A 3EK7A 2KFFA 1B8CA 1QV0A 4I5LB 2GW4B 2WURA 3SVDA 4WQ2A 2TN4A 1XQMA 4YI9A 2H61C 2HPSA 2M9GA 2A46A 2DUIA 4LQUA 4H3NA 1AUIB 3TZ1A 2M3WA 2KI6C 3VGOA 1M39A 1CFDA 3I19A 4LJDA 5FVGA 1EG4A 4OVNF 3SVEA 1PSBA 1OSAA 5I2QA 5DY6A 1XFXO 4PE1A 1QTXA 1EJ3A 1J7PA 1CFPA 3BYAA 4XJKB 3TMTA 4D1EA 3H1OA 4W6IA 4MLWA 2AH8A 2MBXA 4PPKA 4Q7TA 1XFUO 4GUKA 1KWOC 1VRKA 2BL0C 1B9CA 4DRWA 1EG3A 2HCGA 4PHNA 1CM1A 1DJIA 1JBYA 3VROA 1W7SA 4W6LA 2WIQA 2JTZA 1AJ5A 3KCSA 1HT9A 2M7LA 3LF4B 1XO5A 1B47A 3FIAA 3JVTB 4BY4A 1KK7Y 2KAXA 4FTGA 1DJWA 1BR4B 2BKIB 3ZUFA 3IP2A 3BUWB 1FPWA 2HGYA 4M2PA 1E8AA 1TIZA 3CS1A 1SMGA 2LMUA 1LINA 4H47A 5EBJA 4W77A 4HRGA 1QVIZ 3DQKA 1B7TY 4YI8A 2LP3A 2WHTA 2PVBA 1YX7A 1PK0D 2R2IA 4W76A 2H5OA 2WHSA 3PIBA 1IRJA 3PN7B 1G4YR 4QJ4B 2K61A 1CMGA 4W75A 2AMIA 1DJYA 1L7ZA 4JQ0D 3LVDA 4ICBA 3VRPA 3EKHA 1QV1A 2ZMWA 4W6HA 1CDNA 5D69A 4IK4A 2KQYA 2DUEA 2WSOA 3S05A 3I5IB 2YFPA 1BMOA 3SG6A 3UFZA 3BUOB 2V4EB 3O2PA 4FQOA 4KEXA 1CV7A 1FF1A 4CFQA 4TZAA 4NDCA 3V3DA 3NSIA 1S1EA 2CT9A 4IK3A 3IF7A 3BX9A 5DTZA 1CKKA 2K7CA 1XMZA 2Y5IA 1OXDA 3AKAA 3VHTA 1JSAA 4KF5C 1S3PA 3I5GC 2KYFA 4LJCA 5EXUA 1A03A 4B30B 1RM9A 2DOQA 1UURA 2A52B 1A29A 3PALA 1QX7A 1NX3A 4EULA 2F2OA 4I2YA 2LLSA 5DPJA 5D7FA 1HUYA 5DPIA 3A8RA 1ZGOA 4DIRA 4OQWA 3D10A 2P4MA 3CB9A 1N0YA 2P6BB 4W74A 1AK8A 4GNKB 3GJ1A 3NSLA 4DXPA 1YRUB 1XVJA 4I5JA 5DQBA 2BECA 2KSPA 5H87A 2PXSA 2WSNA 1GL4A 2FOTA 4Q9WA 3SSHA 4XOWA 4W6OA 1H4BA 4DXNA 3OX6A 1H4UA 1C4FA 2LCPA 4MZKA 3EVPA 2V53A 1S6IA 2Y0GA 5KU1A 1MHOA 2WHUA 4P5OE 3PJBA 3VK1A 2QLIA 1KK8B 1IJ5A 1OZOA 2WCEA 2PSRA 2LAPA 1KYRA 2BKHB 4PFEA 2QLEA 4HVFA 2LM5A 1RRXA 3ST3A 4WRIA 4ZINA 1DJHA 3DQFA 1J7QA 1XYDA 5DTXA 4W6PA 1JC2A 1QYOA 3GB3A 2EHBA 1KWOB 2QLHA 5J2OA 2EGDA 1DGUA 2LANA 3SVUA 2QLGA 2COLB 3RLZA 2HQZA 4HE4A 3DVKA 3RM1A 1Q4CA 1DF0B 2QZ0A 5AERA 1KSMA 2JQ6A 2D8NA 4CLNA 2WOSA 3O78A 1ODBA 2DUFA 3H1RA 1GJYA 4CFRA 3GK2A 1SCMC 3O4YA 4M2OA 1OXFA 3WLCA 3EK8A 5HKWA 3DQMA 2O24A 3MGFA 3NF0A 4N3DA 1RMMA 1CDPA 5HYDA 4GPLB 2K2FA 1Y1XA 3SG2A 4BDUA 1ZFSA 3WHUB 1V1GA 3EK4A 4ORNA 4H3MA 4KPIA 3ADFA 2MLEC 4MN0A 2ZN8A 5EXBA 1UP5A 3LL8B 2KAYA 2LUCA 1SR6B 3SVBA 1RK9A 1Q73A 1ZACA 1TCOB 1UWOA 5F9GA 3SG4A 3AKBA 4KGEA 3ICBA 1DJXA 4YRUA 4MBEA 2LVKA 1SL7A 4W6KA 1RMOA 2MHHA 3VRNA 3GK1A 1KSOA 3DQHA 2L50A 1YHGA 1KQMB 1YVHA 1KYPA 2V4EC 3GEXA 2A50B 3CBEA 1NCYA 5T3IA 4IK1A 3M22A 3VICA 1DVIA 2HQ8A 4PALA 3IQOA 3O77A 2JULA 1WLMA 5B8IB 4NQGA 2GX2A 1S6CA 2BE6A 4ZF5A 1U5IB 4TZGA 4KGFA 2QLGB 3E3RA 4W7DA 4OJ0A 4HSZA 2ZO7A 3DQCA 1JWDA 1BOCA 3FWCA 2L4IA 1F4OA 1CTRA 1S36A 1KFXS 2MRDA 1WRZA 3KPXA 2G6XA 5HBDA 1HCJA 4OCIA 2HQKA 4PHJA 1K93D 4ZB1A 5AFPA 2PRUA 2LVIA 3VRQA 3SIAA 4R6DA 3DVJA 1OQPA 4A4BA 1B7TZ 1WLZA 1RJVA 1NIWA 1EMMA 4XVPA 1C7VA 4BY5A 2F3ZA 3E5WA 3P28A 2ICRA 1QLSA 2BTJA 1TTXA 2DUGA 1K9PA 2NCPA 3OP0A 2GX0A 2SCPA 2HRSA 2L0PA 2H8QA 2ZNDA 5LTQA 2HETA 4KW4A 3DVMA 2LNKA 3OB1B 3ST4A 1IQ5A 4XYNA 4OV2A 2HFCA 1F09A 4L9MA 3G9AA 1R2UA 4WQ3A 3DF0B 2H61A 2K8MB 3CFFA 3CD9A 2CNPA 5HGEA 2PALA 3CR2A 4JRBA 1NUBA 3BXBA 5J3XA 2I18A 1S5GZ 2VZXA 1L2OB 1BR1B 1SBJA 1XFZO 2HPWA 5HLVA 1CM4A 4YGDB 4L12A 3I5IC 3FS7A 2E30A 1QYFA 1JFKA 3W1DA 4EN1A 2G16B 5AQBB 3OGOA 4GESB 4HQCA 2OPOA 4DXQA 3I5HC 4RTCA 2LLUA 1YURA 1PRWA 3NXAA 1F4QA 1B8RA 1F71A 1Q80A 2BCAA 4C0JA 1TNPA 2JXLA 3K21A 3CR5X 3H4SE 1LA3A 1QATA 4M2QA 4JWQA 2O29A 4Q7RA 1TNQA 2QACA 4CPVA 3EVVA 3BOWA 5EB7A 3CTNA 3DQEA 4KF4A 1TNWA 3BXKA 4J8AA 2F33A 2L2EA 3RWAA 2ZO6A 4C0LA 3I5GB 3ED8A 4LJBA 2H9WA 5BPJA 2B3PA 2M8UA 4P76A 2A47A 5HLOA 5FVFA 4DKNA 4N5XA 4UPGA 4W6GA 3TUYB 3OX5A 2KOTA 2OTEA 1OMVA 2PXWA 3WCKA 5ER4X 3LF3A 4DXOA 5FVIA 1YVLA 1UHJA 1BF5A 4KF5A 2WISA 3PJ5A 1CDLA 4F0ZB 1OXEA 5EXCI 4OHSA 4DXIA 3NEDA 4W6DA 2FCDA 4Q9XA 5K89A 5CSIA 3DQ6A 1IQ3A 3NSOA 2OKYA 2KYCA 4Q04A 4Z4MA 2L51A 1MR8A 2WCBA 1EMFA 2MA2A 1SCVA 2DDDA 1MQ1A 2A4JA 2G6YA 5AANA 2EMNA 3BUMB 1TCFA 5DPHA 4KA9A 3DQJA 4MZJA 5BQLA 2O5GA 4PE0A 4HRHA 5IBWA 2OTGB 1B1GA 1TRFA 5HZSA 2V4EA 3LVCA 4ZFSA 1XA5A 2NCOA 2JT0A 2LP2A 4Q7UA 3DPZA 4W7RA 1LXFC 5HZOA 4ORBB 1NX0A 3TS5C 1KFUL 2K7BA 5H88A 1SL9A 2F3YA 1J1DA 1X02A 4JPZB 2SASA 4ZF4A 1Q4EA 2QRFA 5CSJA 2JRFA 3SG3A 2BL0B 4GGFA 2OTBA 4MEWA 3ZULA 2CBLA 2DUHA 2FWQA 3OB2B 3PFVA 3U0KA 3TMRA 1EMLA 4XJKA 4R6BA 5GQQC 4U2VA 2OS8C 2GGMA 3UG0A 3NT9A 4W6UA 4IK9A 3LS3A 2VRGA 3NT3A 3HCMA 3VRRA 3A4UB 5JJGA 2GW3A 3AAJA 2CXJA 1H6RA 1AHRA 5BTTB 2YE1A 2H5QA 4NDDA 1ZGPA 1BFPA 5DKRA 2ZKMX 5EJUA 4ANJA 4JFGA 2VADA 3CFAA 3MSEB 3ST2A 4L1IA 4PE7A 1SK6D 4IK8A 2B1UA 1RFJA 2LLTA 4LW5A 1MOVA 3GK4X 1YJFA 1UHNA 2Z6XA 2LMTA 4W6NA 2I94A 4KW8A 5FYXA 3EVUA 1SR6C 2CCMA 1J7OA 1MOUA 4YGAA 5DTLA 3SSPA 2QPTA 1RMPA 1UHKA 4IZNA 1PULA 3CZTX 3E5TA 1ZUXA 2ISDA 1K2HA 5HZUA 2PASA 4I5KA 2ZFDA 4EDSA 1U5IA 1PVAA 1Z1PA 4P1QA 5CSFA 2LE9B 3I5FC 2OGRA 1ALVA 3VHTB 2MAZA 3TDUA 3CR4X 4USLA 1GGXA 2BCXA 1YZWA 2KFHA 1OMRA 2LHLA 4HREE 1PSRA 1OOJA 3SG7A 4L13A 3DVEA 3WHTB 3I5FB 2LVVA 1KP5A 2QU1A 5CSNA 2F8PA 1M45A 2LC5A 1EMGA 1KCYA 1UUSA 5DU0A 3CFHA 1ZMZA 3LLEA 1CB1A 2ZRTA 1NWDA 2MJWB 3DQ8A 3EVRA 2VVJA 4OY4A 5LTPA 1SL8A 2BCBA 1SY9A 2EC6C 3TDZA 1A2XA 4Z4KA 1QJTA 3DQOA 4QJ3B 2A56B 4W6JA 1IH0A 1G8IA 3ZUJA 4PDZA 2AWLA 1M46A 2ZN9A 1ZGQA 5LTRA 1MXEA 3IR8A 2KGBC 1XAEA 3KHEA 2A54B 2Q91A 3GJ2A 4ZIOA 1W7TA 2HF5A 1SRAA 1BU3A 2O60A 2BBNA 4J88A 2YDZA 1EL4A 1KK8C 1QLKA 3I5HB 3DQAA 2YE0A 1PVBA 3SJSA 1EMKA 1W7IB 4ZBLA 1B4CA 3CLNA 5DKNA 4YGEB 1C7WA 1SKTA 3KCTA 5LK4A 1CLMA 4GGFC 5KTYA 2KDHA 2IS9A 4PPLA 1CMFA 2H5RA 1SW8A 1FW4A 2L4HA 4W73A 2AHAA 3SV5A 1CDMA 1LA0A 4CIDA 2WNDA 3GL4A 1YHIA 4IL1A 1UHHA 2GGZA 1DTLA 3DQUA 1SCMB 1W7UA 1IKUA 3LK0A 2GV5A 2IB6A 4ZF3A 4PCWA 4W7XA 3BOWB 2JPTA 3AI5A 3OSQA 3KO0A 4DCKA 3NEZA 1NCXA 3LA1A 4I5NB 2JZIA 4QJ5B 2FZUA 4DS7A 1SPYA 2A53B 1Q4DA 4XOVA 3W1CA 2E6WA 2H5PA 1A4PA 1RECA 2CTNA 1EH2A 2BBMA 2KNEA 5HW9A 4P2YB 2PMYA 5JOLA 2RGIA 1ZUZA 2L5XB 2KI4C 1K9UA 2AWJA 1QIVA 2EMDA 3U8PA 4U8DA 2HGDA 3U0NA 1G33A 1Y0VH 5ER5A 3DQIA 2KI6D 4TNCA 4W7EA 5DRFA 3SVOA 1OE9B 1MUXA 1J55A 2G6EA 1FBVA 3U8CA 2AWMA 5PALA 3BUXB 1V1FA 3M0WA 4DKMA 1Y1UA 3SVRA 2Y1NA 2K7OA 1YJ2A 4E68A 4GOBA 3DQ2A 2L98A 1EMAA 3E5VA 3KF9A 2AAOA 1YTZC 4AS8A 3DQ4A 1F0BA 4OR9B 4W6RA 1IWQA 1ZOTB 3KEVA 1CNPA 1RROA 1B8LA 1SYMA 1B9AA 3SSLA 1DJZA 1BG1A 2G2BA 1F55A 2EC6B 3CGAA 3P8UA 1QXTA 4PHKA 2JC2A 2KQ6A 3U0LA 1NCZA 1GGWA 2LUXA 3SSYA 2C9IA 1WDCC 1RWYA 2OJKA 1Q4AA 1WRLA 1YUTA 2M0RA 3SRYA 3DPXA 3AKOA 4KAGA 4LJDC 1NSHA 1QY3A 1K9KA 2JT3A 1NX1A 3DQ5A 1KFUS 3ZNIA 1N65A 4IK5A 3WLDA 4GF6B 1QASA 2WC8A 4YGCB 3NSKA 2Y1MA 2G2SB 4ORAB 1JC1A 4W6FA 3DQDA 3DQLA 2FL1A 1KQVA 2M29A 2VVIA 1BJFA 3RWTA 3M24A 1TOPA 5CPVA 1J1EA 1DF0A 3D0YA 4XL5A 1XK4C 1DGVA 1QIWA 3GOFA 2C9JA 1MWNA 4J89A 3OSRA 2JTTA 4GAOA 1Y6WA 2Z6ZA 3TUYC 3SSTA 1N2DA 1JFJA 2M49B 1IG5A 2KFGA 4YBHB 1ALWA 5AXIA 2FCEA 4A4CA 2KBIA 1YR5A 1WDCB 3DQ7A 3DQ3A 2VAEA 4OGSA 1QXPA 2VVHA 1NP8A 1F70A 2KI4B 2G9BA 2LHIA 2G3DB 2AUCA 2H2KA 2JXCA 1TN4A 2Q57A 3A8SA 4MRXA 1F54A 4W6SA 2HQWA 1TNXA 4ORCB 2DDCA 1Z1QA 4H3LA 4R1EA 3LK1A 3U0MA 1MXLC 1EXRA 2I7AA 4ZCVA 5FHVA 1MYWA 3FWBA 3QRXA 4W72A 5EB6A 4XGYA 4W7AA 3O6BA 3PATA 2JADA 4GFTA 2EMOA 1QVIY 1KK7Z 2WORA 1JBZA 5KTGA 4MZLA 1EMBA 4GGNA 3SVNA 2LV7A 4NWSA 4B5YA 4W6AA 1NPQA 2POXA 1Y1AA 2Z6YA 2BE4A 1XFWO 4ZCUA 1K8UA 4JF9A 2KAVA 1S5GY 1GFLA 5F6TA 4PPJA 2Z1OA 1PALA 2IB5A 3D0YB 1QX5B 4W6CA 4EMQA 1BT6A 1BODA 3PLFB 3JTDB 3AAKA 1YFPA 1XFYO 5I8NA 3CGLA 5BTTA 4YGBB 1CFCA 3SIBA 2WCFA 2QT2A 1XSSA 2I2RE 1L2OC 2JT8A 2AWKA 1OZSA 1UISA 2LMVA 2NZ0A 2M7NA 1WRKA 1SNLA 4MSPA 1QYQA 2M1UA 3SSKA 3SSVA 2FJUB 1DMOA 1YUUA 3DQNA 3U8AA 3PN7C 3DQ1A 1JF0A 4AOMA 2HJOA 3BXAA 2K2AA 4N1GA 1DT7B 4AR7A 3ZTFA 3BQ3A 1S6ZA 2IOVA 2JNXA 2K7DA 4HQ9A 2A48A 1NX2A 3ST0A 3F45A 3WXAA 3WNXB 5HZTA 1J7RA 4JEOA 3LSAA 5HKYA 1CLLA 1XFVO 1JC0A 3TS5B 4NDBA 3C1VA 2LVJA 2JWWA 5G08A 1XK4A 5DQMA 4W6TA 4W7FA 1FI5A 3JVTC 3TDIA 3IQQA 1RTP1 2ZRSA 2ARLA 1QS7A 5AEQA 1GQMA 4RYSA 4ETOA 5DRGA 1JF2A 1D1OA 3BXCA 3ZWHA 2M1KB 4DUQA 5I2OA 2KBMA 2DD9A 2K0JA 2DD7A 2ZNEA 4N1FA 1LVCD 1MF8B 2OKWA 1AVSA 1G7KA 4PHMA 1Q4BA 1EMCA 3HX4A 1XA9A 1S26D 4JGEA 2Q4UA 3CD1A 1K96A 3PJ7A 4HQ8A 3LVAA 1DJGA 1K94A 1IJ6A 2RH7A 4AQIA 4RYWA 5H89A 1LKJA 1KFXL 1H8BA 2O2BA 1BLQA 2IE2A 4C0KA 1QX2A 1GGZA 1CFFA 1IGVA 4LQTA 4W6BA 5DKQA 4W69A 3SS0A 2KGRA 1M63B 2OS8B 4B30A 1FI6A 4MVFA 5TNCA 2G3OA 4EDOA 4DXMA 2NXQA 1UHIA 1M31A 3PSRA 3DQ9A 5HKZA 4W7CA 4AQJA 2OTGC 1KQMC 1YHHA 1S6JA 1W7JB 2JNFA 3SVCA 2NLNA 4H48A 1R6PA 3OHMB 3EKJA 2G5ZB 4UTSA 3BUNB 2B3QA 2MLFC 2Q6PA 3PM8A 5BT0A 1A75A 1EMEA 1CLBA
chains in the Genus database with same CATH superfamily
1YRTB 3CZ2A 1YUSA 1K95A 3K1KA 1JBAA 4MRYA 2F2PA 2KHNA 4OKHA 1OOHA 1AP4A 3VB1A 3JTDC 2Y4QA 5FI7A 3R1PA 4PE4A 3AI4A 5DPGA 5EHUA 5DTYA 3SVSA 5KSZA 1OMDA 2JU0A 1K90D 4KW9A 3B87A 3CWGA 1NYAA 2M97A 1AJ4A 4W6MA 1HQVA 1YX8A 1F8HA 4JKTA 4GBAA 2ZMUA 2H6VA 3DD4A 3LCPC 1KYSA 5I2LA 1JUOA 1A75B 2JOJA 3DF0A 3DPWA 4JC2A 1OOGA 1WY9A 3SG5A 1C07A 3EK7A 2KFFA 1B8CA 1QV0A 4I5LB 2GW4B 2WURA 3SVDA 4WQ2A 2TN4A 1XQMA 4YI9A 2H61C 2HPSA 2M9GA 2A46A 2DUIA 4LQUA 3S0AA 4H3NA 1AUIB 3TZ1A 3IVTA 2M3WA 2KI6C 3VGOA 1M39A 3R1OA 1CFDA 3I19A 4LJDA 5FVGA 1EG4A 4OVNF 3SVEA 1PSBA 1OSAA 5I2QA 5DY6A 3L47A 1XFXO 4PE1A 1QTXA 3CABA 1EJ3A 1J7PA 1CFPA 3BYAA 4XJKB 3TMTA 4D1EA 3H1OA 4W6IA 1ORGA 4MLWA 2AH8A 2MBXA 4PPKA 4Q7TA 1XFUO 4GUKA 1KWOC 1VRKA 2BL0C 3SS5A 1B9CA 4DRWA 1EG3A 2HCGA 4PHNA 1CM1A 1DJIA 1JBYA 3VROA 1W7SA 4W6LA 2WIQA 2JTZA 1AJ5A 1DQEA 3KCSA 1HT9A 2M7LA 3LF4B 1XO5A 1B47A 3FIAA 3JVTB 3NHIA 4BY4A 1KK7Y 2KAXA 4FTGA 1DJWA 1BR4B 2BKIB 1SSEB 3ZUFA 3NHTA 3IP2A 3BUWB 1FPWA 2HGYA 3PM2A 2L2CA 4M2PA 1E8AA 1TIZA 3CS1A 3UO9A 1SMGA 2LMUA 1LINA 4H47A 5EBJA 4W77A 4HRGA 1QVIZ 3DQKA 1B7TY 4YI8A 2LP3A 2WHTA 2PVBA 1YX7A 1PK0D 2R2IA 4W76A 2H5OA 3CZ0A 2WHSA 3PIBA 1IRJA 3PN7B 1G4YR 5FI2A 4QJ4B 2PYQA 2K61A 1CMGA 4W75A 2AMIA 1DJYA 1L7ZA 4JQ0D 3LVDA 4ICBA 3VRPA 3CYZA 3EKHA 1QV1A 2ZMWA 4W6HA 1CDNA 5D69A 4IK4A 2KQYA 2DUEA 2WSOA 3S05A 3I5IB 2YFPA 1BMOA 3SG6A 3UFZA 3BUOB 2K60A 2V4EB 3O2PA 4FQOA 4KEXA 2P71A 1CV7A 1FF1A 4CFQA 4TZAA 3EG5B 4NDCA 2QEBA 3V3DA 3NSIA 1S1EA 2CT9A 4IK3A 3IF7A 3BX9A 5DTZA 1CKKA 2K7CA 1XMZA 2Y5IA 1OXDA 3FE9A 3AKAA 3VHTA 1JSAA 4KF5C 1S3PA 3I5GC 2KYFA 4LJCA 5EXUA 1A03A 4B30B 1RM9A 3BFBA 2DOQA 1UURA 2A52B 1A29A 3PALA 1QX7A 1NX3A 4EULA 2F2OA 4I2YA 2LLSA 5DPJA 5D7FA 1HUYA 5DPIA 3A8RA 1ZGOA 4DIRA 4OQWA 3D10A 2P4MA 3CB9A 1N0YA 2P6BB 3D75A 4W74A 1AK8A 4GNKB 3B6XA 3GJ1A 3NSLA 4DXPA 1YRUB 1XVJA 4I5JA 1DELA 5DQBA 1LS8A 2BECA 2KSPA 5H87A 2PXSA 2WSNA 1GL4A 2FOTA 4Q9WA 3SSHA 4XOWA 4W6OA 1H4BA 4DXNA 3OX6A 1H4UA 5HL1A 1C4FA 2LCPA 4MZKA 3EVPA 2QEOA 2V53A 1S6IA 2Y0GA 5KU1A 1MHOA 2WHUA 4P5OE 3PJBA 3VK1A 2QLIA 1KK8B 1IJ5A 1OZOA 2WCEA 2PSRA 2LAPA 1KYRA 2BKHB 4PFEA 2QLEA 4HVFA 2LM5A 1RRXA 3ST3A 4WRIA 4ZINA 3BJHA 1DJHA 3DQFA 1J7QA 1XYDA 5DTXA 4W6PA 1JC2A 1QYOA 3GB3A 2EHBA 1KWOB 2QLHA 5J2OA 2EGDA 1DGUA 2LANA 3SVUA 3D77A 2QLGA 2COLB 3RLZA 2HQZA 4HE4A 3DVKA 3RM1A 1Q4CA 1DF0B 2QZ0A 5AERA 1KSMA 2JQ6A 2D8NA 4CLNA 2WOSA 3O78A 1ODBA 2DUFA 3H1RA 1GJYA 4CFRA 3GK2A 1SCMC 3O4YA 4M2OA 1GM0A 1OXFA 3WLCA 3EK8A 5HKWA 3DQMA 2O24A 3MGFA 3NF0A 4N3DA 1RMMA 1CDPA 5HYDA 4GPLB 2K2FA 3DXLA 1Y1XA 3SG2A 4BDUA 3FE6A 1ZFSA 3WHUB 1V1GA 3EK4A 4ORNA 4H3MA 4KPIA 3ADFA 2MLEC 4MN0A 2ZN8A 5EXBA 1UP5A 3LL8B 2KAYA 2LUCA 1SR6B 3SVBA 1RK9A 1Q73A 1ZACA 1TCOB 1UWOA 5F9GA 3SG4A 3AKBA 4KGEA 3ICBA 1DJXA 4YRUA 4MBEA 2LVKA 1SL7A 4W6KA 1RMOA 2MHHA 3VRNA 3GK1A 1KSOA 3DQHA 2L50A 1YHGA 1KQMB 1YVHA 1KYPA 2V4EC 3GEXA 2A50B 3CBEA 1NCYA 5T3IA 3N7HA 4IK1A 3M22A 3VICA 1DVIA 2HQ8A 4PALA 3IQOA 3O77A 2JULA 1WLMA 5B8IB 4NQGA 2GX2A 1S6CA 2BE6A 4ZF5A 1U5IB 4TZGA 4KGFA 2QLGB 3E3RA 4W7DA 4KYNA 4OJ0A 4HSZA 2ZO7A 3DQCA 1JWDA 1BOCA 3FWCA 2L4IA 1F4OA 3CZ1A 1CTRA 1S36A 1KFXS 2MRDA 1WRZA 3KPXA 2G6XA 5HBDA 1HCJA 4OCIA 2HQKA 4PHJA 1K93D 2YGUA 4ZB1A 5AFPA 2PRUA 2LVIA 2WCJA 3VRQA 3SIAA 4R6DA 1C3YA 3DVJA 1OQPA 4A4BA 1B7TZ 1WLZA 1RJVA 1NIWA 1EMMA 4XVPA 1C7VA 4BY5A 2F3ZA 3E5WA 3P28A 2ICRA 1QLSA 2BTJA 1TTXA 2DUGA 1K9PA 2NCPA 3OP0A 2GX0A 2SCPA 2HRSA 2L0PA 2H8QA 3B88A 2ZNDA 5LTQA 2HETA 4KW4A 3D78A 3DVMA 2LNKA 3OB1B 3ST4A 1IQ5A 4XYNA 4OV2A 2HFCA 1F09A 4L9MA 2KPHA 3S0BA 3G9AA 1R2UA 4WQ3A 3V2LA 3DF0B 2H61A 2K8MB 3CFFA 5I94A 3CD9A 2CNPA 5HGEA 2PALA 3CR2A 4JRBA 1NUBA 3BXBA 5J3XA 2I18A 1S5GZ 2VZXA 5D3OA 1L2OB 1BR1B 1SBJA 1XFZO 2HPWA 5HLVA 2WCHA 1CM4A 4YGDB 4L12A 2QEHA 3I5IC 3FS7A 2E30A 1QYFA 1JFKA 3W1DA 4EN1A 2G16B 5AQBB 3OGOA 4GESB 4HQCA 2OPOA 4DXQA 3I5HC 2BAPA 4RTCA 2LLUA 3B86A 1YURA 1PRWA 3NXAA 1F4QA 3OGNA 1B8RA 1F71A 1Q80A 2BCAA 4C0JA 1TNPA 2JXLA 3K21A 3CR5X 3H4SE 1LA3A 1QATA 4M2QA 4JWQA 2O29A 4Q7RA 1TNQA 2QACA 4CPVA 3EVVA 3BOWA 5EB7A 3CTNA 3DQEA 4KF4A 1TNWA 3BXKA 4J8AA 2F33A 2L2EA 3RWAA 2ZO6A 3L4LA 2WC6A 4C0LA 3I5GB 3ED8A 4LJBA 2H9WA 5BPJA 2B3PA 2M8UA 4P76A 3D74A 2A47A 5HLOA 5FVFA 4DKNA 4N5XA 4UPGA 4W6GA 3TUYB 3OX5A 2KOTA 2OTEA 2PQLA 1OMVA 2PXWA 3WCKA 4INXA 5ER4X 3LF3A 4DXOA 5FVIA 1YVLA 1UHJA 1BF5A 1Z4HA 4KF5A 2WISA 3PJ5A 1P28A 1CDLA 4F0ZB 1OXEA 5EXCI 4OHSA 4DXIA 3NEDA 4W6DA 2FCDA 4Q9XA 5K89A 5CSIA 1TWOA 3DQ6A 1IQ3A 3NSOA 2OKYA 2KYCA 4Q04A 4Z4MA 2L51A 1MR8A 2WCBA 1EMFA 2MA2A 1SCVA 2DDDA 1MQ1A 2A4JA 2G6YA 5AANA 2EMNA 2WCMA 3BUMB 1TCFA 5DPHA 4KA9A 3DQJA 4MZJA 5BQLA 2O5GA 4PE0A 3FE8A 4HRHA 5IBWA 2OTGB 1B1GA 1TRFA 5HZSA 2V4EA 3LVCA 4ZFSA 1XA5A 2NCOA 2JT0A 2LP2A 4Q7UA 3DPZA 4W7RA 1LXFC 5HZOA 4ORBB 2WCLA 1NX0A 3TS5C 1KFUL 2K7BA 5H88A 1SL9A 2F3YA 1J1DA 1X02A 4JPZB 2SASA 4ZF4A 1Q4EA 2QRFA 5CSJA 1XFRA 2JRFA 3SG3A 2BL0B 4GGFA 2OTBA 4MEWA 3ZULA 2CBLA 2DUHA 2FWQA 3OB2B 3PFVA 3U0KA 3TMRA 1EMLA 4XJKA 4R6BA 5GQQC 4U2VA 2OS8C 2GGMA 3UG0A 3NT9A 3BFAA 4W6UA 4IK9A 3LS3A 2VRGA 3NT3A 3HCMA 3VRRA 3A4UB 5JJGA 2GW3A 3AAJA 2CXJA 1H6RA 1AHRA 5BTTB 3S0DA 2YE1A 2H5QA 4NDDA 1ZGPA 1BFPA 5DKRA 2ZKMX 5EJUA 4ANJA 4JFGA 2VADA 3CFAA 3MSEB 3ST2A 4L1IA 4PE7A 1SK6D 3O4XA 4IK8A 1OOIX 2B1UA 1RFJA 2LLTA 4LW5A 4JD9A 1MOVA 3CDNA 3GK4X 1YJFA 1UHNA 2Z6XA 2LMTA 4W6NA 2I94A 4KW8A 5FYXA 3EVUA 1SR6C 2CCMA 1J7OA 1MOUA 4YGAA 5DTLA 3SSPA 2QPTA 2KLDA 1RMPA 1UHKA 4IZNA 1PULA 3CZTX 3E5TA 1ZUXA 2ISDA 1K2HA 5HZUA 2PASA 4I5KA 2ZFDA 4EDSA 1U5IA 1PVAA 1Z1PA 4P1QA 5CSFA 2LE9B 1DC1A 3I5FC 2OGRA 1TUZA 1ALVA 3VHTB 2MAZA 3TDUA 3CR4X 4USLA 1GGXA 3D73A 2WC5A 2BCXA 1YZWA 2KFHA 1OMRA 2LHLA 4HREE 1PSRA 1OOJA 3SG7A 4L13A 3DVEA 3WHTB 3I5FB 2LVVA 1KP5A 2QU1A 5CSNA 2F8PA 1W9ZA 1M45A 2LC5A 1EMGA 1KCYA 1UUSA 5DU0A 3CFHA 1ZMZA 3LLEA 1CB1A 2ZRTA 1NWDA 2MJWB 3DQ8A 3EVRA 1TUJA 2VVJA 4OY4A 5LTPA 3PJIA 1SL8A 2BCBA 1SY9A 2EC6C 3TDZA 1A2XA 2GTEA 4Z4KA 1QJTA 3DQOA 4QJ3B 2A56B 4W6JA 3UNWA 1IH0A 1G8IA 3OBVA 3ZUJA 4PDZA 2AWLA 1M46A 2ZN9A 1ZGQA 5LTRA 1MXEA 3IR8A 2KGBC 1XAEA 3KHEA 2A54B 2Q91A 3GJ2A 3DZTA 3D76A 4ZIOA 1W7TA 2HF5A 1SRAA 1BU3A 2O60A 2BBNA 4J88A 2YDZA 1EL4A 1KK8C 1QLKA 3I5HB 1QWVA 1DEKA 3DQAA 2YE0A 1PVBA 3SJSA 1EMKA 1W7IB 4ZBLA 1B4CA 3CLNA 5DKNA 4YGEB 1C7WA 3R72A 1SKTA 3KCTA 5LK4A 1CLMA 4GGFC 5KTYA 2KDHA 2IS9A 4PPLA 1CMFA 2QEVA 2H5RA 1SW8A 1FW4A 2L4HA 4W73A 2AHAA 3SV5A 1CDMA 2KLEA 1LA0A 4CIDA 2WNDA 3GL4A 1YHIA 4IL1A 1UHHA 2GGZA 1DTLA 3DQUA 1SCMB 1W7UA 1IKUA 3LK0A 2GV5A 2IB6A 4ZF3A 4PCWA 4OZDA 4W7XA 3BOWB 2JPTA 3AI5A 3OSQA 3KO0A 4DCKA 3NEZA 1NCXA 3QMEA 3LA1A 3S0FA 4I5NB 2JZIA 4QJ5B 2FZUA 4DS7A 1SPYA 2A53B 1Q4DA 4XOVA 3W1CA 2E6WA 2H5PA 1A4PA 1RECA 2CTNA 1EH2A 2BBMA 2KNEA 5HW9A 4P2YB 2PMYA 5JOLA 2RGIA 1ZUZA 2L5XB 2KI4C 1K9UA 2AWJA 1QIVA 2EMDA 3U8PA 4U8DA 2HGDA 3U0NA 1G33A 1Y0VH 5ER5A 3DQIA 2KI6D 3SS4A 4TNCA 4W7EA 5DRFA 3SVOA 1OE9B 1MUXA 1J55A 2G6EA 1FBVA 3U8CA 2AWMA 5PALA 3BUXB 2BNXA 1V1FA 3M0WA 4DKMA 1Y1UA 3SVRA 2Y1NA 2K7OA 1YJ2A 4E68A 4GOBA 3DQ2A 2L98A 1EMAA 3E5VA 3KF9A 2AAOA 1YTZC 4AS8A 3DQ4A 4FQTA 1F0BA 3R1VA 4OR9B 4W6RA 1IWQA 1OW4A 1ZOTB 3KEVA 2WCKA 1CNPA 1RROA 2L5YA 1B8LA 1SYMA 2H8VA 1B9AA 3SSLA 1DJZA 1BG1A 2G2BA 1F55A 2EC6B 3CGAA 3P8UA 4F7FA 1QXTA 4PHKA 2JC2A 2KQ6A 3U0LA 1NCZA 1GGWA 2LUXA 2ERBA 3SSYA 2C9IA 1WDCC 1RWYA 2OJKA 1Q4AA 1WRLA 1YUTA 2M0RA 3SRYA 5FI6A 3DPXA 3AKOA 4KAGA 4LJDC 1NSHA 1QY3A 1K9KA 2JT3A 1NX1A 1OOFA 3DQ5A 1KFUS 3ZNIA 1N65A 4IK5A 3WLDA 4GF6B 1QASA 2WC8A 4YGCB 3NSKA 2Y1MA 2G2SB 5EL2A 4ORAB 1JC1A 4W6FA 3DQDA 3DQLA 2FL1A 1KQVA 2M29A 2VVIA 1T14A 1BJFA 3RWTA 3M24A 1TOPA 5CPVA 3Q8IA 1J1EA 1DF0A 3D0YA 4XL5A 1XK4C 1DGVA 1QIWA 3GOFA 2C9JA 1MWNA 4J89A 3OSRA 1C3ZA 2JTTA 4GAOA 1Y6WA 3RZSA 2Z6ZA 3TUYC 3SSTA 1N2DA 1JFJA 3NGVA 2M49B 1IG5A 2KFGA 4YBHB 1ALWA 5AXIA 2FCEA 4A4CA 2KBIA 1YR5A 1WDCB 3DQ7A 3DQ3A 2VAEA 4OGSA 1QXPA 2VVHA 1NP8A 1F70A 2KI4B 2G9BA 2LHIA 4IJ7A 2G3DB 2AUCA 2H2KA 2JXCA 1TN4A 2Q57A 3A8SA 4MRXA 1F54A 4W6SA 2HQWA 2QDIA 1TNXA 4ORCB 2DDCA 1Z1QA 4H3LA 4R1EA 3LK1A 3U0MA 1MXLC 1EXRA 2I7AA 4ZCVA 5FHVA 1MYWA 3FWBA 3QRXA 4W72A 5EB6A 4XGYA 4W7AA 3O6BA 3PATA 2JADA 4GFTA 2EMOA 1QVIY 1KK7Z 2WORA 1JBZA 5KTGA 4MZLA 1EMBA 4GGNA 3SVNA 3L4AA 2LV7A 4NWSA 4B5YA 4W6AA 1NPQA 1Z2CB 2POXA 1Y1AA 2Z6YA 2BE4A 3DYEA 1XFWO 4ZCUA 1K8UA 4JF9A 2KAVA 1S5GY 3SS3A 1GFLA 5F6TA 4PPJA 2Z1OA 1PALA 2IB5A 3D0YB 1QX5B 4W6CA 4EMQA 3B7AA 1BT6A 1BODA 3PLFB 3JTDB 3AAKA 1YFPA 1XFYO 5I8NA 3CGLA 5BTTA 4YGBB 1CFCA 3SIBA 2WCFA 2QT2A 1XSSA 2FJYA 2I2RE 1L2OC 2JT8A 4INWA 2AWKA 1OZSA 3K1EA 4PT1A 1UISA 2LMVA 2NZ0A 1IIOA 2M7NA 1WRKA 1SNLA 4MSPA 1QYQA 2M1UA 3SSKA 3SSVA 2FJUB 1DMOA 5DICA 1YUUA 2JPOA 3DQNA 3U8AA 3PN7C 3DY9A 3DQ1A 1JF0A 4AOMA 2HJOA 3BXAA 2K2AA 4N1GA 1DT7B 4AR7A 3ZTFA 3BQ3A 1S6ZA 2IOVA 2JNXA 2K7DA 3BFHA 4HQ9A 2A48A 1NX2A 3ST0A 3F45A 3WXAA 3WNXB 5HZTA 1J7RA 4JEOA 3LSAA 5HKYA 1CLLA 1XFVO 1JC0A 3TS5B 4NDBA 3C1VA 2LVJA 2JWWA 5G08A 1XK4A 5DQMA 4W6TA 4W7FA 1FI5A 3JVTC 3TDIA 3IQQA 1RTP1 2ZRSA 2ARLA 1QS7A 5AEQA 1GQMA 4RYSA 4ETOA 5DRGA 1JF2A 1D1OA 3BXCA 3ZWHA 2M1KB 4DUQA 5I2OA 2KBMA 2DD9A 2K0JA 2DD7A 2ZNEA 4N1FA 1LVCD 1MF8B 2OKWA 1AVSA 1G7KA 4PHMA 1Q4BA 1EMCA 3HX4A 1XA9A 1S26D 4JGEA 2Q4UA 3CD1A 1K96A 3PJ7A 4HQ8A 3LVAA 1DJGA 1K94A 1IJ6A 2RH7A 4AQIA 4RYWA 5H89A 1LKJA 1KFXL 1H8BA 3S0EA 2O2BA 1BLQA 2IE2A 4C0KA 1QX2A 1GGZA 1CFFA 1IGVA 4LQTA 4W6BA 5DKQA 4W69A 3SS0A 2KGRA 1M63B 2OS8B 4B30A 1FI6A 4MVFA 5TNCA 2G3OA 4EDOA 2P70A 4DXMA 2NXQA 1UHIA 1M31A 3PSRA 3DQ9A 5HKZA 4W7CA 4AQJA 2OTGC 1KQMC 1YHHA 1S6JA 1W7JB 2JNFA 3S0GA 3SVCA 2NLNA 4H48A 1R6PA 3OHMB 3EKJA 4UTSA 2G5ZB 3BUNB 2B3QA 2MLFC 2Q6PA 3PM8A 5BT0A 1A75A 1EMEA 1CLBA
chains in the Genus database with same CATH topology
1YRTB 1YUSA 1K95A 3K1KA 1JBAA 4MRYA 2F2PA 2KHNA 4OKHA 1AP4A 3JTDC 2Y4QA 4PE4A 3AI4A 5DPGA 5EHUA 5DTYA 3SVSA 5KSZA 1OMDA 2JU0A 1K90D 4KW9A 3CWGA 1NYAA 2M97A 1AJ4A 4W6MA 1HQVA 1YX8A 1F8HA 4GBAA 2ZMUA 2H6VA 3DD4A 3LCPC 1KYSA 5I2LA 1JUOA 1A75B 2JOJA 3DF0A 3DPWA 4JC2A 1WY9A 3SG5A 1C07A 3EK7A 2KFFA 1B8CA 1QV0A 4I5LB 2GW4B 2WURA 3SVDA 4WQ2A 2TN4A 1XQMA 4YI9A 2H61C 2HPSA 2M9GA 2A46A 2DUIA 4LQUA 4H3NA 1AUIB 3TZ1A 2M3WA 2KI6C 3VGOA 1M39A 1CFDA 3I19A 4LJDA 5FVGA 1EG4A 4OVNF 3SVEA 1PSBA 1OSAA 5I2QA 5DY6A 1XFXO 4PE1A 1QTXA 1EJ3A 1J7PA 1CFPA 3BYAA 4XJKB 3TMTA 4D1EA 3H1OA 4W6IA 4MLWA 2AH8A 2MBXA 4PPKA 4Q7TA 1XFUO 4GUKA 1KWOC 1VRKA 2BL0C 1B9CA 4DRWA 1EG3A 2HCGA 4PHNA 1CM1A 1DJIA 1JBYA 3VROA 1W7SA 4W6LA 2WIQA 2JTZA 1AJ5A 3KCSA 1HT9A 2M7LA 3LF4B 1XO5A 1B47A 3FIAA 3JVTB 4BY4A 1KK7Y 2KAXA 4FTGA 1DJWA 1BR4B 2BKIB 3ZUFA 3IP2A 3BUWB 1FPWA 2HGYA 4M2PA 1E8AA 1TIZA 3CS1A 1SMGA 2LMUA 1LINA 4H47A 5EBJA 4W77A 4HRGA 1QVIZ 3DQKA 1B7TY 4YI8A 2LP3A 2WHTA 2PVBA 1YX7A 1PK0D 2R2IA 4W76A 2H5OA 2WHSA 3PIBA 1IRJA 3PN7B 1G4YR 4QJ4B 2K61A 1CMGA 4W75A 2AMIA 1DJYA 1L7ZA 4JQ0D 3LVDA 4ICBA 3VRPA 3EKHA 1QV1A 2ZMWA 4W6HA 1CDNA 5D69A 4IK4A 2KQYA 2DUEA 2WSOA 3S05A 3I5IB 2YFPA 1BMOA 3SG6A 3UFZA 3BUOB 2V4EB 3O2PA 4FQOA 4KEXA 1CV7A 1FF1A 4CFQA 4TZAA 4NDCA 3V3DA 3NSIA 1S1EA 2CT9A 4IK3A 3IF7A 3BX9A 5DTZA 1CKKA 2K7CA 1XMZA 2Y5IA 1OXDA 3AKAA 3VHTA 1JSAA 4KF5C 1S3PA 3I5GC 2KYFA 4LJCA 5EXUA 1A03A 4B30B 1RM9A 2DOQA 1UURA 2A52B 1A29A 3PALA 1QX7A 1NX3A 4EULA 2F2OA 4I2YA 2LLSA 5DPJA 5D7FA 1HUYA 5DPIA 3A8RA 1ZGOA 4DIRA 4OQWA 3D10A 2P4MA 3CB9A 1N0YA 2P6BB 4W74A 1AK8A 4GNKB 3GJ1A 3NSLA 4DXPA 1YRUB 1XVJA 4I5JA 5DQBA 2BECA 2KSPA 5H87A 2PXSA 2WSNA 1GL4A 2FOTA 4Q9WA 3SSHA 4XOWA 4W6OA 1H4BA 4DXNA 3OX6A 1H4UA 1C4FA 2LCPA 4MZKA 3EVPA 2V53A 1S6IA 2Y0GA 5KU1A 1MHOA 2WHUA 4P5OE 3PJBA 3VK1A 2QLIA 1KK8B 1IJ5A 1OZOA 2WCEA 2PSRA 2LAPA 1KYRA 2BKHB 4PFEA 2QLEA 4HVFA 2LM5A 1RRXA 3ST3A 4WRIA 4ZINA 1DJHA 3DQFA 1J7QA 1XYDA 5DTXA 4W6PA 1JC2A 1QYOA 3GB3A 2EHBA 1KWOB 2QLHA 5J2OA 2EGDA 1DGUA 2LANA 3SVUA 2QLGA 2COLB 3RLZA 2HQZA 4HE4A 3DVKA 3RM1A 1Q4CA 1DF0B 2QZ0A 5AERA 1KSMA 2JQ6A 2D8NA 4CLNA 2WOSA 3O78A 1ODBA 2DUFA 3H1RA 1GJYA 4CFRA 3GK2A 1SCMC 3O4YA 4M2OA 1OXFA 3WLCA 3EK8A 5HKWA 3DQMA 2O24A 3MGFA 3NF0A 4N3DA 1RMMA 1CDPA 5HYDA 4GPLB 2K2FA 1Y1XA 3SG2A 4BDUA 1ZFSA 3WHUB 1V1GA 3EK4A 4ORNA 4H3MA 4KPIA 3ADFA 2MLEC 4MN0A 2ZN8A 5EXBA 1UP5A 3LL8B 2KAYA 2LUCA 1SR6B 3SVBA 1RK9A 1Q73A 1ZACA 1TCOB 1UWOA 5F9GA 3SG4A 3AKBA 4KGEA 3ICBA 1DJXA 4YRUA 4MBEA 2LVKA 1SL7A 4W6KA 1RMOA 2MHHA 3VRNA 3GK1A 1KSOA 3DQHA 2L50A 1YHGA 1KQMB 1YVHA 1KYPA 2V4EC 3GEXA 2A50B 3CBEA 1NCYA 5T3IA 4IK1A 3M22A 3VICA 1DVIA 2HQ8A 4PALA 3IQOA 3O77A 2JULA 1WLMA 5B8IB 4NQGA 2GX2A 1S6CA 2BE6A 4ZF5A 1U5IB 4TZGA 4KGFA 2QLGB 3E3RA 4W7DA 4OJ0A 4HSZA 2ZO7A 3DQCA 1JWDA 1BOCA 3FWCA 2L4IA 1F4OA 1CTRA 1S36A 1KFXS 2MRDA 1WRZA 3KPXA 2G6XA 5HBDA 1HCJA 4OCIA 2HQKA 4PHJA 1K93D 4ZB1A 5AFPA 2PRUA 2LVIA 3VRQA 3SIAA 4R6DA 3DVJA 1OQPA 4A4BA 1B7TZ 1WLZA 1RJVA 1NIWA 1EMMA 4XVPA 1C7VA 4BY5A 2F3ZA 3E5WA 3P28A 2ICRA 1QLSA 2BTJA 1TTXA 2DUGA 1K9PA 2NCPA 3OP0A 2GX0A 2SCPA 2HRSA 2L0PA 2H8QA 2ZNDA 5LTQA 2HETA 4KW4A 3DVMA 2LNKA 3OB1B 3ST4A 1IQ5A 4XYNA 4OV2A 2HFCA 1F09A 4L9MA 3G9AA 1R2UA 4WQ3A 3DF0B 2H61A 2K8MB 3CFFA 3CD9A 2CNPA 5HGEA 2PALA 3CR2A 4JRBA 1NUBA 3BXBA 5J3XA 2I18A 1S5GZ 2VZXA 1L2OB 1BR1B 1SBJA 1XFZO 2HPWA 5HLVA 1CM4A 4YGDB 4L12A 3I5IC 3FS7A 2E30A 1QYFA 1JFKA 3W1DA 4EN1A 2G16B 5AQBB 3OGOA 4GESB 4HQCA 2OPOA 4DXQA 3I5HC 4RTCA 2LLUA 1YURA 1PRWA 3NXAA 1F4QA 1B8RA 1F71A 1Q80A 2BCAA 4C0JA 1TNPA 2JXLA 3K21A 3CR5X 3H4SE 1LA3A 1QATA 4M2QA 4JWQA 2O29A 4Q7RA 1TNQA 2QACA 4CPVA 3EVVA 3BOWA 5EB7A 3CTNA 3DQEA 4KF4A 1TNWA 3BXKA 4J8AA 2F33A 2L2EA 3RWAA 2ZO6A 4C0LA 3I5GB 3ED8A 4LJBA 2H9WA 5BPJA 2B3PA 2M8UA 4P76A 2A47A 5HLOA 5FVFA 4DKNA 4N5XA 4UPGA 4W6GA 3TUYB 3OX5A 2KOTA 2OTEA 1OMVA 2PXWA 3WCKA 5ER4X 3LF3A 4DXOA 5FVIA 1YVLA 1UHJA 1BF5A 4KF5A 2WISA 3PJ5A 1CDLA 4F0ZB 1OXEA 5EXCI 4OHSA 4DXIA 3NEDA 4W6DA 2FCDA 4Q9XA 5K89A 5CSIA 3DQ6A 1IQ3A 3NSOA 2OKYA 2KYCA 4Q04A 4Z4MA 2L51A 1MR8A 2WCBA 1EMFA 2MA2A 1SCVA 2DDDA 1MQ1A 2A4JA 2G6YA 5AANA 2EMNA 3BUMB 1TCFA 5DPHA 4KA9A 3DQJA 4MZJA 5BQLA 2O5GA 4PE0A 4HRHA 5IBWA 2OTGB 1B1GA 1TRFA 5HZSA 2V4EA 3LVCA 4ZFSA 1XA5A 2NCOA 2JT0A 2LP2A 4Q7UA 3DPZA 4W7RA 1LXFC 5HZOA 4ORBB 1NX0A 3TS5C 1KFUL 2K7BA 5H88A 1SL9A 2F3YA 1J1DA 1X02A 4JPZB 2SASA 4ZF4A 1Q4EA 2QRFA 5CSJA 2JRFA 3SG3A 2BL0B 4GGFA 2OTBA 4MEWA 3ZULA 2CBLA 2DUHA 2FWQA 3OB2B 3PFVA 3U0KA 3TMRA 1EMLA 4XJKA 4R6BA 5GQQC 4U2VA 2OS8C 2GGMA 3UG0A 3NT9A 4W6UA 4IK9A 3LS3A 2VRGA 3NT3A 3HCMA 3VRRA 3A4UB 5JJGA 2GW3A 3AAJA 2CXJA 1H6RA 1AHRA 5BTTB 2YE1A 2H5QA 4NDDA 1ZGPA 1BFPA 5DKRA 2ZKMX 5EJUA 4ANJA 4JFGA 2VADA 3CFAA 3MSEB 3ST2A 4L1IA 4PE7A 1SK6D 4IK8A 2B1UA 1RFJA 2LLTA 4LW5A 1MOVA 3GK4X 1YJFA 1UHNA 2Z6XA 2LMTA 4W6NA 2I94A 4KW8A 5FYXA 3EVUA 1SR6C 2CCMA 1J7OA 1MOUA 4YGAA 5DTLA 3SSPA 2QPTA 1RMPA 1UHKA 4IZNA 1PULA 3CZTX 3E5TA 1ZUXA 2ISDA 1K2HA 5HZUA 2PASA 4I5KA 2ZFDA 4EDSA 1U5IA 1PVAA 1Z1PA 4P1QA 5CSFA 2LE9B 3I5FC 2OGRA 1ALVA 3VHTB 2MAZA 3TDUA 3CR4X 4USLA 1GGXA 2BCXA 1YZWA 2KFHA 1OMRA 2LHLA 4HREE 1PSRA 1OOJA 3SG7A 4L13A 3DVEA 3WHTB 3I5FB 2LVVA 1KP5A 2QU1A 5CSNA 2F8PA 1M45A 2LC5A 1EMGA 1KCYA 1UUSA 5DU0A 3CFHA 1ZMZA 3LLEA 1CB1A 2ZRTA 1NWDA 2MJWB 3DQ8A 3EVRA 2VVJA 4OY4A 5LTPA 1SL8A 2BCBA 1SY9A 2EC6C 3TDZA 1A2XA 4Z4KA 1QJTA 3DQOA 4QJ3B 2A56B 4W6JA 1IH0A 1G8IA 3ZUJA 4PDZA 2AWLA 1M46A 2ZN9A 1ZGQA 5LTRA 1MXEA 3IR8A 2KGBC 1XAEA 3KHEA 2A54B 2Q91A 3GJ2A 4ZIOA 1W7TA 2HF5A 1SRAA 1BU3A 2O60A 2BBNA 4J88A 2YDZA 1EL4A 1KK8C 1QLKA 3I5HB 3DQAA 2YE0A 1PVBA 3SJSA 1EMKA 1W7IB 4ZBLA 1B4CA 3CLNA 5DKNA 4YGEB 1C7WA 1SKTA 3KCTA 5LK4A 1CLMA 4GGFC 5KTYA 2KDHA 2IS9A 4PPLA 1CMFA 2H5RA 1SW8A 1FW4A 2L4HA 4W73A 2AHAA 3SV5A 1CDMA 1LA0A 4CIDA 2WNDA 3GL4A 1YHIA 4IL1A 1UHHA 2GGZA 1DTLA 3DQUA 1SCMB 1W7UA 1IKUA 3LK0A 2GV5A 2IB6A 4ZF3A 4PCWA 4W7XA 3BOWB 2JPTA 3AI5A 3OSQA 3KO0A 4DCKA 3NEZA 1NCXA 3LA1A 4I5NB 2JZIA 4QJ5B 2FZUA 4DS7A 1SPYA 2A53B 1Q4DA 4XOVA 3W1CA 2E6WA 2H5PA 1A4PA 1RECA 2CTNA 1EH2A 2BBMA 2KNEA 5HW9A 4P2YB 2PMYA 5JOLA 2RGIA 1ZUZA 2L5XB 2KI4C 1K9UA 2AWJA 1QIVA 2EMDA 3U8PA 4U8DA 2HGDA 3U0NA 1G33A 1Y0VH 5ER5A 3DQIA 2KI6D 4TNCA 4W7EA 5DRFA 3SVOA 1OE9B 1MUXA 1J55A 2G6EA 1FBVA 3U8CA 2AWMA 5PALA 3BUXB 1V1FA 3M0WA 4DKMA 1Y1UA 3SVRA 2Y1NA 2K7OA 1YJ2A 4E68A 4GOBA 3DQ2A 2L98A 1EMAA 3E5VA 3KF9A 2AAOA 1YTZC 4AS8A 3DQ4A 1F0BA 4OR9B 4W6RA 1IWQA 1ZOTB 3KEVA 1CNPA 1RROA 1B8LA 1SYMA 1B9AA 3SSLA 1DJZA 1BG1A 2G2BA 1F55A 2EC6B 3CGAA 3P8UA 1QXTA 4PHKA 2JC2A 2KQ6A 3U0LA 1NCZA 1GGWA 2LUXA 3SSYA 2C9IA 1WDCC 1RWYA 2OJKA 1Q4AA 1WRLA 1YUTA 2M0RA 3SRYA 3DPXA 3AKOA 4KAGA 4LJDC 1NSHA 1QY3A 1K9KA 2JT3A 1NX1A 3DQ5A 1KFUS 3ZNIA 1N65A 4IK5A 3WLDA 4GF6B 1QASA 2WC8A 4YGCB 3NSKA 2Y1MA 2G2SB 4ORAB 1JC1A 4W6FA 3DQDA 3DQLA 2FL1A 1KQVA 2M29A 2VVIA 1BJFA 3RWTA 3M24A 1TOPA 5CPVA 1J1EA 1DF0A 3D0YA 4XL5A 1XK4C 1DGVA 1QIWA 3GOFA 2C9JA 1MWNA 4J89A 3OSRA 2JTTA 4GAOA 1Y6WA 2Z6ZA 3TUYC 3SSTA 1N2DA 1JFJA 2M49B 1IG5A 2KFGA 4YBHB 1ALWA 5AXIA 2FCEA 4A4CA 2KBIA 1YR5A 1WDCB 3DQ7A 3DQ3A 2VAEA 4OGSA 1QXPA 2VVHA 1NP8A 1F70A 2KI4B 2G9BA 2LHIA 2G3DB 2AUCA 2H2KA 2JXCA 1TN4A 2Q57A 3A8SA 4MRXA 1F54A 4W6SA 2HQWA 1TNXA 4ORCB 2DDCA 1Z1QA 4H3LA 4R1EA 3LK1A 3U0MA 1MXLC 1EXRA 2I7AA 4ZCVA 5FHVA 1MYWA 3FWBA 3QRXA 4W72A 5EB6A 4XGYA 4W7AA 3O6BA 3PATA 2JADA 4GFTA 2EMOA 1QVIY 1KK7Z 2WORA 1JBZA 5KTGA 4MZLA 1EMBA 4GGNA 3SVNA 2LV7A 4NWSA 4B5YA 4W6AA 1NPQA 2POXA 1Y1AA 2Z6YA 2BE4A 1XFWO 4ZCUA 1K8UA 4JF9A 2KAVA 1S5GY 1GFLA 5F6TA 4PPJA 2Z1OA 1PALA 2IB5A 3D0YB 1QX5B 4W6CA 4EMQA 1BT6A 1BODA 3PLFB 3JTDB 3AAKA 1YFPA 1XFYO 5I8NA 3CGLA 5BTTA 4YGBB 1CFCA 3SIBA 2WCFA 2QT2A 1XSSA 2I2RE 1L2OC 2JT8A 2AWKA 1OZSA 1UISA 2LMVA 2NZ0A 2M7NA 1WRKA 1SNLA 4MSPA 1QYQA 2M1UA 3SSKA 3SSVA 2FJUB 1DMOA 1YUUA 3DQNA 3U8AA 3PN7C 3DQ1A 1JF0A 4AOMA 2HJOA 3BXAA 2K2AA 4N1GA 1DT7B 4AR7A 3ZTFA 3BQ3A 1S6ZA 2IOVA 2JNXA 2K7DA 4HQ9A 2A48A 1NX2A 3ST0A 3F45A 3WXAA 3WNXB 5HZTA 1J7RA 4JEOA 3LSAA 5HKYA 1CLLA 1XFVO 1JC0A 3TS5B 4NDBA 3C1VA 2LVJA 2JWWA 5G08A 1XK4A 5DQMA 4W6TA 4W7FA 1FI5A 3JVTC 3TDIA 3IQQA 1RTP1 2ZRSA 2ARLA 1QS7A 5AEQA 1GQMA 4RYSA 4ETOA 5DRGA 1JF2A 1D1OA 3BXCA 3ZWHA 2M1KB 4DUQA 5I2OA 2KBMA 2DD9A 2K0JA 2DD7A 2ZNEA 4N1FA 1LVCD 1MF8B 2OKWA 1AVSA 1G7KA 4PHMA 1Q4BA 1EMCA 3HX4A 1XA9A 1S26D 4JGEA 2Q4UA 3CD1A 1K96A 3PJ7A 4HQ8A 3LVAA 1DJGA 1K94A 1IJ6A 2RH7A 4AQIA 4RYWA 5H89A 1LKJA 1KFXL 1H8BA 2O2BA 1BLQA 2IE2A 4C0KA 1QX2A 1GGZA 1CFFA 1IGVA 4LQTA 4W6BA 5DKQA 4W69A 3SS0A 2KGRA 1M63B 2OS8B 4B30A 1FI6A 4MVFA 5TNCA 2G3OA 4EDOA 4DXMA 2NXQA 1UHIA 1M31A 3PSRA 3DQ9A 5HKZA 4W7CA 4AQJA 2OTGC 1KQMC 1YHHA 1S6JA 1W7JB 2JNFA 3SVCA 2NLNA 4H48A 1R6PA 3OHMB 3EKJA 2G5ZB 4UTSA 3BUNB 2B3QA 2MLFC 2Q6PA 3PM8A 5BT0A 1A75A 1EMEA 1CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRT B;  1YUS A;  1K95 A;  3K1K A;  1JBA A;  4MRY A;  2F2P A;  2KHN A;  4OKH A;  1AP4 A;  3JTD C;  2Y4Q A;  4PE4 A;  3AI4 A;  5DPG A;  5EHU A;  5DTY A;  3SVS A;  5KSZ A;  1OMD A;  2JU0 A;  1K90 D;  4KW9 A;  3CWG A;  1NYA A;  2M97 A;  1AJ4 A;  4W6M A;  1HQV A;  1YX8 A;  1F8H A;  4GBA A;  2ZMU A;  2H6V A;  3DD4 A;  3LCP C;  1KYS A;  5I2L A;  1JUO A;  1A75 B;  2JOJ A;  3DF0 A;  3DPW A;  4JC2 A;  1WY9 A;  3SG5 A;  1C07 A;  3EK7 A;  2KFF A;  1B8C A;  1QV0 A;  4I5L B;  2GW4 B;  2WUR A;  3SVD A;  4WQ2 A;  2TN4 A;  1XQM A;  4YI9 A;  2H61 C;  2HPS A;  2M9G A;  2A46 A;  2DUI A;  4LQU A;  4H3N A;  1AUI B;  3TZ1 A;  2M3W A;  2KI6 C;  3VGO A;  1M39 A;  1CFD A;  3I19 A;  4LJD A;  5FVG A;  1EG4 A;  4OVN F;  3SVE A;  1PSB A;  1OSA A;  5I2Q A;  5DY6 A;  1XFX O;  4PE1 A;  1QTX A;  1EJ3 A;  1J7P A;  1CFP A;  3BYA A;  4XJK B;  3TMT A;  4D1E A;  3H1O A;  4W6I A;  4MLW A;  2AH8 A;  2MBX A;  4PPK A;  4Q7T A;  1XFU O;  4GUK A;  1KWO C;  1VRK A;  2BL0 C;  1B9C A;  4DRW A;  1EG3 A;  2HCG A;  4PHN A;  1CM1 A;  1DJI A;  1JBY A;  3VRO A;  1W7S A;  4W6L A;  2WIQ A;  2JTZ A;  1AJ5 A;  3KCS A;  1HT9 A;  2M7L A;  3LF4 B;  1XO5 A;  1B47 A;  3FIA A;  3JVT B;  4BY4 A;  1KK7 Y;  2KAX A;  4FTG A;  1DJW A;  1BR4 B;  2BKI B;  3ZUF A;  3IP2 A;  3BUW B;  1FPW A;  2HGY A;  4M2P A;  1E8A A;  1TIZ A;  3CS1 A;  1SMG A;  2LMU A;  1LIN A;  4H47 A;  5EBJ A;  4W77 A;  4HRG A;  1QVI Z;  3DQK A;  1B7T Y;  4YI8 A;  2LP3 A;  2WHT A;  2PVB A;  1YX7 A;  1PK0 D;  2R2I A;  4W76 A;  2H5O A;  2WHS A;  3PIB A;  1IRJ A;  3PN7 B;  1G4Y R;  4QJ4 B;  2K61 A;  1CMG A;  4W75 A;  2AMI A;  1DJY A;  1L7Z A;  4JQ0 D;  3LVD A;  4ICB A;  3VRP A;  3EKH A;  1QV1 A;  2ZMW A;  4W6H A;  1CDN A;  5D69 A;  4IK4 A;  2KQY A;  2DUE A;  2WSO A;  3S05 A;  3I5I B;  2YFP A;  1BMO A;  3SG6 A;  3UFZ A;  3BUO B;  2V4E B;  3O2P A;  4FQO A;  4KEX A;  1CV7 A;  1FF1 A;  4CFQ A;  4TZA A;  4NDC A;  3V3D A;  3NSI A;  1S1E A;  2CT9 A;  4IK3 A;  3IF7 A;  3BX9 A;  5DTZ A;  1CKK A;  2K7C A;  1XMZ A;  2Y5I A;  1OXD A;  3AKA A;  3VHT A;  1JSA A;  4KF5 C;  1S3P A;  3I5G C;  2KYF A;  4LJC A;  5EXU A;  1A03 A;  4B30 B;  1RM9 A;  2DOQ A;  1UUR A;  2A52 B;  1A29 A;  3PAL A;  1QX7 A;  1NX3 A;  4EUL A;  2F2O A;  4I2Y A;  2LLS A;  5DPJ A;  5D7F A;  1HUY A;  5DPI A;  3A8R A;  1ZGO A;  4DIR A;  4OQW A;  3D10 A;  2P4M A;  3CB9 A;  1N0Y A;  2P6B B;  4W74 A;  1AK8 A;  4GNK B;  3GJ1 A;  3NSL A;  4DXP A;  1YRU B;  1XVJ A;  4I5J A;  5DQB A;  2BEC A;  2KSP A;  5H87 A;  2PXS A;  2WSN A;  1GL4 A;  2FOT A;  4Q9W A;  3SSH A;  4XOW A;  4W6O A;  1H4B A;  4DXN A;  3OX6 A;  1H4U A;  1C4F A;  2LCP A;  4MZK A;  3EVP A;  2V53 A;  1S6I A;  2Y0G A;  5KU1 A;  1MHO A;  2WHU A;  4P5O E;  3PJB A;  3VK1 A;  2QLI A;  1KK8 B;  1IJ5 A;  1OZO A;  2WCE A;  2PSR A;  2LAP A;  1KYR A;  2BKH B;  4PFE A;  2QLE A;  4HVF A;  2LM5 A;  1RRX A;  3ST3 A;  4WRI A;  4ZIN A;  1DJH A;  3DQF A;  1J7Q A;  1XYD A;  5DTX A;  4W6P A;  1JC2 A;  1QYO A;  3GB3 A;  2EHB A;  1KWO B;  2QLH A;  5J2O A;  2EGD A;  1DGU A;  2LAN A;  3SVU A;  2QLG A;  2COL B;  3RLZ A;  2HQZ A;  4HE4 A;  3DVK A;  3RM1 A;  1Q4C A;  1DF0 B;  2QZ0 A;  5AER A;  1KSM A;  2JQ6 A;  2D8N A;  4CLN A;  2WOS A;  3O78 A;  1ODB A;  2DUF A;  3H1R A;  1GJY A;  4CFR A;  3GK2 A;  1SCM C;  3O4Y A;  4M2O A;  1OXF A;  3WLC A;  3EK8 A;  5HKW A;  3DQM A;  2O24 A;  3MGF A;  3NF0 A;  4N3D A;  1RMM A;  1CDP A;  5HYD A;  4GPL B;  2K2F A;  1Y1X A;  3SG2 A;  4BDU A;  1ZFS A;  3WHU B;  1V1G A;  3EK4 A;  4ORN A;  4H3M A;  4KPI A;  3ADF A;  2MLE C;  4MN0 A;  2ZN8 A;  5EXB A;  1UP5 A;  3LL8 B;  2KAY A;  2LUC A;  1SR6 B;  3SVB A;  1RK9 A;  1Q73 A;  1ZAC A;  1TCO B;  1UWO A;  5F9G A;  3SG4 A;  3AKB A;  4KGE A;  3ICB A;  1DJX A;  4YRU A;  4MBE A;  2LVK A;  1SL7 A;  4W6K A;  1RMO A;  2MHH A;  3VRN A;  3GK1 A;  1KSO A;  3DQH A;  2L50 A;  1YHG A;  1KQM B;  1YVH A;  1KYP A;  2V4E C;  3GEX A;  2A50 B;  3CBE A;  1NCY A;  5T3I A;  4IK1 A;  3M22 A;  3VIC A;  1DVI A;  2HQ8 A;  4PAL A;  3IQO A;  3O77 A;  2JUL A;  1WLM A;  5B8I B;  4NQG A;  2GX2 A;  1S6C A;  2BE6 A;  4ZF5 A;  1U5I B;  4TZG A;  4KGF A;  2QLG B;  3E3R A;  4W7D A;  4OJ0 A;  4HSZ A;  2ZO7 A;  3DQC A;  1JWD A;  1BOC A;  3FWC A;  2L4I A;  1F4O A;  1CTR A;  1S36 A;  1KFX S;  2MRD A;  1WRZ A;  3KPX A;  2G6X A;  5HBD A;  1HCJ A;  4OCI A;  2HQK A;  4PHJ A;  1K93 D;  4ZB1 A;  5AFP A;  2PRU A;  2LVI A;  3VRQ A;  3SIA A;  4R6D A;  3DVJ A;  1OQP A;  4A4B A;  1B7T Z;  1WLZ A;  1RJV A;  1NIW A;  1EMM A;  4XVP A;  1C7V A;  4BY5 A;  2F3Z A;  3E5W A;  3P28 A;  2ICR A;  1QLS A;  2BTJ A;  1TTX A;  2DUG A;  1K9P A;  2NCP A;  3OP0 A;  2GX0 A;  2SCP A;  2HRS A;  2L0P A;  2H8Q A;  2ZND A;  5LTQ A;  2HET A;  4KW4 A;  3DVM A;  2LNK A;  3OB1 B;  3ST4 A;  1IQ5 A;  4XYN A;  4OV2 A;  2HFC A;  1F09 A;  4L9M A;  3G9A A;  1R2U A;  4WQ3 A;  3DF0 B;  2H61 A;  2K8M B;  3CFF A;  3CD9 A;  2CNP A;  5HGE A;  2PAL A;  3CR2 A;  4JRB A;  1NUB A;  3BXB A;  5J3X A;  2I18 A;  1S5G Z;  2VZX A;  1L2O B;  1BR1 B;  1SBJ A;  1XFZ O;  2HPW A;  5HLV A;  1CM4 A;  4YGD B;  4L12 A;  3I5I C;  3FS7 A;  2E30 A;  1QYF A;  1JFK A;  3W1D A;  4EN1 A;  2G16 B;  5AQB B;  3OGO A;  4GES B;  4HQC A;  2OPO A;  4DXQ A;  3I5H C;  4RTC A;  2LLU A;  1YUR A;  1PRW A;  3NXA A;  1F4Q A;  1B8R A;  1F71 A;  1Q80 A;  2BCA A;  4C0J A;  1TNP A;  2JXL A;  3K21 A;  3CR5 X;  3H4S E;  1LA3 A;  1QAT A;  4M2Q A;  4JWQ A;  2O29 A;  4Q7R A;  1TNQ A;  2QAC A;  4CPV A;  3EVV A;  3BOW A;  5EB7 A;  3CTN A;  3DQE A;  4KF4 A;  1TNW A;  3BXK A;  4J8A A;  2F33 A;  2L2E A;  3RWA A;  2ZO6 A;  4C0L A;  3I5G B;  3ED8 A;  4LJB A;  2H9W A;  5BPJ A;  2B3P A;  2M8U A;  4P76 A;  2A47 A;  5HLO A;  5FVF A;  4DKN A;  4N5X A;  4UPG A;  4W6G A;  3TUY B;  3OX5 A;  2KOT A;  2OTE A;  1OMV A;  2PXW A;  3WCK A;  5ER4 X;  3LF3 A;  4DXO A;  5FVI A;  1YVL A;  1UHJ A;  1BF5 A;  4KF5 A;  2WIS A;  3PJ5 A;  1CDL A;  4F0Z B;  1OXE A;  5EXC I;  4OHS A;  4DXI A;  3NED A;  4W6D A;  2FCD A;  4Q9X A;  5K89 A;  5CSI A;  3DQ6 A;  1IQ3 A;  3NSO A;  2OKY A;  2KYC A;  4Q04 A;  4Z4M A;  2L51 A;  1MR8 A;  2WCB A;  1EMF A;  2MA2 A;  1SCV A;  2DDD A;  1MQ1 A;  2A4J A;  2G6Y A;  5AAN A;  2EMN A;  3BUM B;  1TCF A;  5DPH A;  4KA9 A;  3DQJ A;  4MZJ A;  5BQL A;  2O5G A;  4PE0 A;  4HRH A;  5IBW A;  2OTG B;  1B1G A;  1TRF A;  5HZS A;  2V4E A;  3LVC A;  4ZFS A;  1XA5 A;  2NCO A;  2JT0 A;  2LP2 A;  4Q7U A;  3DPZ A;  4W7R A;  1LXF C;  5HZO A;  4ORB B;  1NX0 A;  3TS5 C;  1KFU L;  2K7B A;  5H88 A;  1SL9 A;  2F3Y A;  1J1D A;  1X02 A;  4JPZ B;  2SAS A;  4ZF4 A;  1Q4E A;  2QRF A;  5CSJ A;  2JRF A;  3SG3 A;  2BL0 B;  4GGF A;  2OTB A;  4MEW A;  3ZUL A;  2CBL A;  2DUH A;  2FWQ A;  3OB2 B;  3PFV A;  3U0K A;  3TMR A;  1EML A;  4XJK A;  4R6B A;  5GQQ C;  4U2V A;  2OS8 C;  2GGM A;  3UG0 A;  3NT9 A;  4W6U A;  4IK9 A;  3LS3 A;  2VRG A;  3NT3 A;  3HCM A;  3VRR A;  3A4U B;  5JJG A;  2GW3 A;  3AAJ A;  2CXJ A;  1H6R A;  1AHR A;  5BTT B;  2YE1 A;  2H5Q A;  4NDD A;  1ZGP A;  1BFP A;  5DKR A;  2ZKM X;  5EJU A;  4ANJ A;  4JFG A;  2VAD A;  3CFA A;  3MSE B;  3ST2 A;  4L1I A;  4PE7 A;  1SK6 D;  4IK8 A;  2B1U A;  1RFJ A;  2LLT A;  4LW5 A;  1MOV A;  3GK4 X;  1YJF A;  1UHN A;  2Z6X A;  2LMT A;  4W6N A;  2I94 A;  4KW8 A;  5FYX A;  3EVU A;  1SR6 C;  2CCM A;  1J7O A;  1MOU A;  4YGA A;  5DTL A;  3SSP A;  2QPT A;  1RMP A;  1UHK A;  4IZN A;  1PUL A;  3CZT X;  3E5T A;  1ZUX A;  2ISD A;  1K2H A;  5HZU A;  2PAS A;  4I5K A;  2ZFD A;  4EDS A;  1U5I A;  1PVA A;  1Z1P A;  4P1Q A;  5CSF A;  2LE9 B;  3I5F C;  2OGR A;  1ALV A;  3VHT B;  2MAZ A;  3TDU A;  3CR4 X;  4USL A;  1GGX A;  2BCX A;  1YZW A;  2KFH A;  1OMR A;  2LHL A;  4HRE E;  1PSR A;  1OOJ A;  3SG7 A;  4L13 A;  3DVE A;  3WHT B;  3I5F B;  2LVV A;  1KP5 A;  2QU1 A;  5CSN A;  2F8P A;  1M45 A;  2LC5 A;  1EMG A;  1KCY A;  1UUS A;  5DU0 A;  3CFH A;  1ZMZ A;  3LLE A;  1CB1 A;  2ZRT A;  1NWD A;  2MJW B;  3DQ8 A;  3EVR A;  2VVJ A;  4OY4 A;  5LTP A;  1SL8 A;  2BCB A;  1SY9 A;  2EC6 C;  3TDZ A;  1A2X A;  4Z4K A;  1QJT A;  3DQO A;  4QJ3 B;  2A56 B;  4W6J A;  1IH0 A;  1G8I A;  3ZUJ A;  4PDZ A;  2AWL A;  1M46 A;  2ZN9 A;  1ZGQ A;  5LTR A;  1MXE A;  3IR8 A;  2KGB C;  1XAE A;  3KHE A;  2A54 B;  2Q91 A;  3GJ2 A;  4ZIO A;  1W7T A;  2HF5 A;  1SRA A;  1BU3 A;  2O60 A;  2BBN A;  4J88 A;  2YDZ A;  1EL4 A;  1KK8 C;  1QLK A;  3I5H B;  3DQA A;  2YE0 A;  1PVB A;  3SJS A;  1EMK A;  1W7I B;  4ZBL A;  1B4C A;  3CLN A;  5DKN A;  4YGE B;  1C7W A;  1SKT A;  3KCT A;  5LK4 A;  1CLM A;  4GGF C;  5KTY A;  2KDH A;  2IS9 A;  4PPL A;  1CMF A;  2H5R A;  1SW8 A;  1FW4 A;  2L4H A;  4W73 A;  2AHA A;  3SV5 A;  1CDM A;  1LA0 A;  4CID A;  2WND A;  3GL4 A;  1YHI A;  4IL1 A;  1UHH A;  2GGZ A;  1DTL A;  3DQU A;  1SCM B;  1W7U A;  1IKU A;  3LK0 A;  2GV5 A;  2IB6 A;  4ZF3 A;  4PCW A;  4W7X A;  3BOW B;  2JPT A;  3AI5 A;  3OSQ A;  3KO0 A;  4DCK A;  3NEZ A;  1NCX A;  3LA1 A;  4I5N B;  2JZI A;  4QJ5 B;  2FZU A;  4DS7 A;  1SPY A;  2A53 B;  1Q4D A;  4XOV A;  3W1C A;  2E6W A;  2H5P A;  1A4P A;  1REC A;  2CTN A;  1EH2 A;  2BBM A;  2KNE A;  5HW9 A;  4P2Y B;  2PMY A;  5JOL A;  2RGI A;  1ZUZ A;  2L5X B;  2KI4 C;  1K9U A;  2AWJ A;  1QIV A;  2EMD A;  3U8P A;  4U8D A;  2HGD A;  3U0N A;  1G33 A;  1Y0V H;  5ER5 A;  3DQI A;  2KI6 D;  4TNC A;  4W7E A;  5DRF A;  3SVO A;  1OE9 B;  1MUX A;  1J55 A;  2G6E A;  1FBV A;  3U8C A;  2AWM A;  5PAL A;  3BUX B;  1V1F A;  3M0W A;  4DKM A;  1Y1U A;  3SVR A;  2Y1N A;  2K7O A;  1YJ2 A;  4E68 A;  4GOB A;  3DQ2 A;  2L98 A;  1EMA A;  3E5V A;  3KF9 A;  2AAO A;  1YTZ C;  4AS8 A;  3DQ4 A;  1F0B A;  4OR9 B;  4W6R A;  1IWQ A;  1ZOT B;  3KEV A;  1CNP A;  1RRO A;  1B8L A;  1SYM A;  1B9A A;  3SSL A;  1DJZ A;  1BG1 A;  2G2B A;  1F55 A;  2EC6 B;  3CGA A;  3P8U A;  1QXT A;  4PHK A;  2JC2 A;  2KQ6 A;  3U0L A;  1NCZ A;  1GGW A;  2LUX A;  3SSY A;  2C9I A;  1WDC C;  1RWY A;  2OJK A;  1Q4A A;  1WRL A;  1YUT A;  2M0R A;  3SRY A;  3DPX A;  3AKO A;  4KAG A;  4LJD C;  1NSH A;  1QY3 A;  1K9K A;  2JT3 A;  1NX1 A;  3DQ5 A;  1KFU S;  3ZNI A;  1N65 A;  4IK5 A;  3WLD A;  4GF6 B;  1QAS A;  2WC8 A;  4YGC B;  3NSK A;  2Y1M A;  2G2S B;  4ORA B;  1JC1 A;  4W6F A;  3DQD A;  3DQL A;  2FL1 A;  1KQV A;  2M29 A;  2VVI A;  1BJF A;  3RWT A;  3M24 A;  1TOP A;  5CPV A;  1J1E A;  1DF0 A;  3D0Y A;  4XL5 A;  1XK4 C;  1DGV A;  1QIW A;  3GOF A;  2C9J A;  1MWN A;  4J89 A;  3OSR A;  2JTT A;  4GAO A;  1Y6W A;  2Z6Z A;  3TUY C;  3SST A;  1N2D A;  1JFJ A;  2M49 B;  1IG5 A;  2KFG A;  4YBH B;  1ALW A;  5AXI A;  2FCE A;  4A4C A;  2KBI A;  1YR5 A;  1WDC B;  3DQ7 A;  3DQ3 A;  2VAE A;  4OGS A;  1QXP A;  2VVH A;  1NP8 A;  1F70 A;  2KI4 B;  2G9B A;  2LHI A;  2G3D B;  2AUC A;  2H2K A;  2JXC A;  1TN4 A;  2Q57 A;  3A8S A;  4MRX A;  1F54 A;  4W6S A;  2HQW A;  1TNX A;  4ORC B;  2DDC A;  1Z1Q A;  4H3L A;  4R1E A;  3LK1 A;  3U0M A;  1MXL C;  1EXR A;  2I7A A;  4ZCV A;  5FHV A;  1MYW A;  3FWB A;  3QRX A;  4W72 A;  5EB6 A;  4XGY A;  4W7A A;  3O6B A;  3PAT A;  2JAD A;  4GFT A;  2EMO A;  1QVI Y;  1KK7 Z;  2WOR A;  1JBZ A;  5KTG A;  4MZL A;  1EMB A;  4GGN A;  3SVN A;  2LV7 A;  4NWS A;  4B5Y A;  4W6A A;  1NPQ A;  2POX A;  1Y1A A;  2Z6Y A;  2BE4 A;  1XFW O;  4ZCU A;  1K8U A;  4JF9 A;  2KAV A;  1S5G Y;  1GFL A;  5F6T A;  4PPJ A;  2Z1O A;  1PAL A;  2IB5 A;  3D0Y B;  1QX5 B;  4W6C A;  4EMQ A;  1BT6 A;  1BOD A;  3PLF B;  3JTD B;  3AAK A;  1YFP A;  1XFY O;  5I8N A;  3CGL A;  5BTT A;  4YGB B;  1CFC A;  3SIB A;  2WCF A;  2QT2 A;  1XSS A;  2I2R E;  1L2O C;  2JT8 A;  2AWK A;  1OZS A;  1UIS A;  2LMV A;  2NZ0 A;  2M7N A;  1WRK A;  1SNL A;  4MSP A;  1QYQ A;  2M1U A;  3SSK A;  3SSV A;  2FJU B;  1DMO A;  1YUU A;  3DQN A;  3U8A A;  3PN7 C;  3DQ1 A;  1JF0 A;  4AOM A;  2HJO A;  3BXA A;  2K2A A;  4N1G A;  1DT7 B;  4AR7 A;  3ZTF A;  3BQ3 A;  1S6Z A;  2IOV A;  2JNX A;  2K7D A;  4HQ9 A;  2A48 A;  1NX2 A;  3ST0 A;  3F45 A;  3WXA A;  3WNX B;  5HZT A;  1J7R A;  4JEO A;  3LSA A;  5HKY A;  1CLL A;  1XFV O;  1JC0 A;  3TS5 B;  4NDB A;  3C1V A;  2LVJ A;  2JWW A;  5G08 A;  1XK4 A;  5DQM A;  4W6T A;  4W7F A;  1FI5 A;  3JVT C;  3TDI A;  3IQQ A;  1RTP 1;  2ZRS A;  2ARL A;  1QS7 A;  5AEQ A;  1GQM A;  4RYS A;  4ETO A;  5DRG A;  1JF2 A;  1D1O A;  3BXC A;  3ZWH A;  2M1K B;  4DUQ A;  5I2O A;  2KBM A;  2DD9 A;  2K0J A;  2DD7 A;  2ZNE A;  4N1F A;  1LVC D;  1MF8 B;  2OKW A;  1AVS A;  1G7K A;  4PHM A;  1Q4B A;  1EMC A;  3HX4 A;  1XA9 A;  1S26 D;  4JGE A;  2Q4U A;  3CD1 A;  1K96 A;  3PJ7 A;  4HQ8 A;  3LVA A;  1DJG A;  1K94 A;  1IJ6 A;  2RH7 A;  4AQI A;  4RYW A;  5H89 A;  1LKJ A;  1KFX L;  1H8B A;  2O2B A;  1BLQ A;  2IE2 A;  4C0K A;  1QX2 A;  1GGZ A;  1CFF A;  1IGV A;  4LQT A;  4W6B A;  5DKQ A;  4W69 A;  3SS0 A;  2KGR A;  1M63 B;  2OS8 B;  4B30 A;  1FI6 A;  4MVF A;  5TNC A;  2G3O A;  4EDO A;  4DXM A;  2NXQ A;  1UHI A;  1M31 A;  3PSR A;  3DQ9 A;  5HKZ A;  4W7C A;  4AQJ A;  2OTG C;  1KQM C;  1YHH A;  1S6J A;  1W7J B;  2JNF A;  3SVC A;  2NLN A;  4H48 A;  1R6P A;  3OHM B;  3EKJ A;  2G5Z B;  4UTS A;  3BUN B;  2B3Q A;  2MLF C;  2Q6P A;  3PM8 A;  5BT0 A;  1A75 A;  1EME A;  1CLB A; 
#chains in the Genus database with same CATH topology
 1YRT B;  3CZ2 A;  1YUS A;  1K95 A;  3K1K A;  1JBA A;  4MRY A;  2F2P A;  2KHN A;  4OKH A;  1OOH A;  1AP4 A;  3VB1 A;  3JTD C;  2Y4Q A;  5FI7 A;  3R1P A;  4PE4 A;  3AI4 A;  5DPG A;  5EHU A;  5DTY A;  3SVS A;  5KSZ A;  1OMD A;  2JU0 A;  1K90 D;  4KW9 A;  3B87 A;  3CWG A;  1NYA A;  2M97 A;  1AJ4 A;  4W6M A;  1HQV A;  1YX8 A;  1F8H A;  4JKT A;  4GBA A;  2ZMU A;  2H6V A;  3DD4 A;  3LCP C;  1KYS A;  5I2L A;  1JUO A;  1A75 B;  2JOJ A;  3DF0 A;  3DPW A;  4JC2 A;  1OOG A;  1WY9 A;  3SG5 A;  1C07 A;  3EK7 A;  2KFF A;  1B8C A;  1QV0 A;  4I5L B;  2GW4 B;  2WUR A;  3SVD A;  4WQ2 A;  2TN4 A;  1XQM A;  4YI9 A;  2H61 C;  2HPS A;  2M9G A;  2A46 A;  2DUI A;  4LQU A;  3S0A A;  4H3N A;  1AUI B;  3TZ1 A;  3IVT A;  2M3W A;  2KI6 C;  3VGO A;  1M39 A;  3R1O A;  1CFD A;  3I19 A;  4LJD A;  5FVG A;  1EG4 A;  4OVN F;  3SVE A;  1PSB A;  1OSA A;  5I2Q A;  5DY6 A;  3L47 A;  1XFX O;  4PE1 A;  1QTX A;  3CAB A;  1EJ3 A;  1J7P A;  1CFP A;  3BYA A;  4XJK B;  3TMT A;  4D1E A;  3H1O A;  4W6I A;  1ORG A;  4MLW A;  2AH8 A;  2MBX A;  4PPK A;  4Q7T A;  1XFU O;  4GUK A;  1KWO C;  1VRK A;  2BL0 C;  3SS5 A;  1B9C A;  4DRW A;  1EG3 A;  2HCG A;  4PHN A;  1CM1 A;  1DJI A;  1JBY A;  3VRO A;  1W7S A;  4W6L A;  2WIQ A;  2JTZ A;  1AJ5 A;  1DQE A;  3KCS A;  1HT9 A;  2M7L A;  3LF4 B;  1XO5 A;  1B47 A;  3FIA A;  3JVT B;  3NHI A;  4BY4 A;  1KK7 Y;  2KAX A;  4FTG A;  1DJW A;  1BR4 B;  2BKI B;  1SSE B;  3ZUF A;  3NHT A;  3IP2 A;  3BUW B;  1FPW A;  2HGY A;  3PM2 A;  2L2C A;  4M2P A;  1E8A A;  1TIZ A;  3CS1 A;  3UO9 A;  1SMG A;  2LMU A;  1LIN A;  4H47 A;  5EBJ A;  4W77 A;  4HRG A;  1QVI Z;  3DQK A;  1B7T Y;  4YI8 A;  2LP3 A;  2WHT A;  2PVB A;  1YX7 A;  1PK0 D;  2R2I A;  4W76 A;  2H5O A;  3CZ0 A;  2WHS A;  3PIB A;  1IRJ A;  3PN7 B;  1G4Y R;  5FI2 A;  4QJ4 B;  2PYQ A;  2K61 A;  1CMG A;  4W75 A;  2AMI A;  1DJY A;  1L7Z A;  4JQ0 D;  3LVD A;  4ICB A;  3VRP A;  3CYZ A;  3EKH A;  1QV1 A;  2ZMW A;  4W6H A;  1CDN A;  5D69 A;  4IK4 A;  2KQY A;  2DUE A;  2WSO A;  3S05 A;  3I5I B;  2YFP A;  1BMO A;  3SG6 A;  3UFZ A;  3BUO B;  2K60 A;  2V4E B;  3O2P A;  4FQO A;  4KEX A;  2P71 A;  1CV7 A;  1FF1 A;  4CFQ A;  4TZA A;  3EG5 B;  4NDC A;  2QEB A;  3V3D A;  3NSI A;  1S1E A;  2CT9 A;  4IK3 A;  3IF7 A;  3BX9 A;  5DTZ A;  1CKK A;  2K7C A;  1XMZ A;  2Y5I A;  1OXD A;  3FE9 A;  3AKA A;  3VHT A;  1JSA A;  4KF5 C;  1S3P A;  3I5G C;  2KYF A;  4LJC A;  5EXU A;  1A03 A;  4B30 B;  1RM9 A;  3BFB A;  2DOQ A;  1UUR A;  2A52 B;  1A29 A;  3PAL A;  1QX7 A;  1NX3 A;  4EUL A;  2F2O A;  4I2Y A;  2LLS A;  5DPJ A;  5D7F A;  1HUY A;  5DPI A;  3A8R A;  1ZGO A;  4DIR A;  4OQW A;  3D10 A;  2P4M A;  3CB9 A;  1N0Y A;  2P6B B;  3D75 A;  4W74 A;  1AK8 A;  4GNK B;  3B6X A;  3GJ1 A;  3NSL A;  4DXP A;  1YRU B;  1XVJ A;  4I5J A;  1DEL A;  5DQB A;  1LS8 A;  2BEC A;  2KSP A;  5H87 A;  2PXS A;  2WSN A;  1GL4 A;  2FOT A;  4Q9W A;  3SSH A;  4XOW A;  4W6O A;  1H4B A;  4DXN A;  3OX6 A;  1H4U A;  5HL1 A;  1C4F A;  2LCP A;  4MZK A;  3EVP A;  2QEO A;  2V53 A;  1S6I A;  2Y0G A;  5KU1 A;  1MHO A;  2WHU A;  4P5O E;  3PJB A;  3VK1 A;  2QLI A;  1KK8 B;  1IJ5 A;  1OZO A;  2WCE A;  2PSR A;  2LAP A;  1KYR A;  2BKH B;  4PFE A;  2QLE A;  4HVF A;  2LM5 A;  1RRX A;  3ST3 A;  4WRI A;  4ZIN A;  3BJH A;  1DJH A;  3DQF A;  1J7Q A;  1XYD A;  5DTX A;  4W6P A;  1JC2 A;  1QYO A;  3GB3 A;  2EHB A;  1KWO B;  2QLH A;  5J2O A;  2EGD A;  1DGU A;  2LAN A;  3SVU A;  3D77 A;  2QLG A;  2COL B;  3RLZ A;  2HQZ A;  4HE4 A;  3DVK A;  3RM1 A;  1Q4C A;  1DF0 B;  2QZ0 A;  5AER A;  1KSM A;  2JQ6 A;  2D8N A;  4CLN A;  2WOS A;  3O78 A;  1ODB A;  2DUF A;  3H1R A;  1GJY A;  4CFR A;  3GK2 A;  1SCM C;  3O4Y A;  4M2O A;  1GM0 A;  1OXF A;  3WLC A;  3EK8 A;  5HKW A;  3DQM A;  2O24 A;  3MGF A;  3NF0 A;  4N3D A;  1RMM A;  1CDP A;  5HYD A;  4GPL B;  2K2F A;  3DXL A;  1Y1X A;  3SG2 A;  4BDU A;  3FE6 A;  1ZFS A;  3WHU B;  1V1G A;  3EK4 A;  4ORN A;  4H3M A;  4KPI A;  3ADF A;  2MLE C;  4MN0 A;  2ZN8 A;  5EXB A;  1UP5 A;  3LL8 B;  2KAY A;  2LUC A;  1SR6 B;  3SVB A;  1RK9 A;  1Q73 A;  1ZAC A;  1TCO B;  1UWO A;  5F9G A;  3SG4 A;  3AKB A;  4KGE A;  3ICB A;  1DJX A;  4YRU A;  4MBE A;  2LVK A;  1SL7 A;  4W6K A;  1RMO A;  2MHH A;  3VRN A;  3GK1 A;  1KSO A;  3DQH A;  2L50 A;  1YHG A;  1KQM B;  1YVH A;  1KYP A;  2V4E C;  3GEX A;  2A50 B;  3CBE A;  1NCY A;  5T3I A;  3N7H A;  4IK1 A;  3M22 A;  3VIC A;  1DVI A;  2HQ8 A;  4PAL A;  3IQO A;  3O77 A;  2JUL A;  1WLM A;  5B8I B;  4NQG A;  2GX2 A;  1S6C A;  2BE6 A;  4ZF5 A;  1U5I B;  4TZG A;  4KGF A;  2QLG B;  3E3R A;  4W7D A;  4KYN A;  4OJ0 A;  4HSZ A;  2ZO7 A;  3DQC A;  1JWD A;  1BOC A;  3FWC A;  2L4I A;  1F4O A;  3CZ1 A;  1CTR A;  1S36 A;  1KFX S;  2MRD A;  1WRZ A;  3KPX A;  2G6X A;  5HBD A;  1HCJ A;  4OCI A;  2HQK A;  4PHJ A;  1K93 D;  2YGU A;  4ZB1 A;  5AFP A;  2PRU A;  2LVI A;  2WCJ A;  3VRQ A;  3SIA A;  4R6D A;  1C3Y A;  3DVJ A;  1OQP A;  4A4B A;  1B7T Z;  1WLZ A;  1RJV A;  1NIW A;  1EMM A;  4XVP A;  1C7V A;  4BY5 A;  2F3Z A;  3E5W A;  3P28 A;  2ICR A;  1QLS A;  2BTJ A;  1TTX A;  2DUG A;  1K9P A;  2NCP A;  3OP0 A;  2GX0 A;  2SCP A;  2HRS A;  2L0P A;  2H8Q A;  3B88 A;  2ZND A;  5LTQ A;  2HET A;  4KW4 A;  3D78 A;  3DVM A;  2LNK A;  3OB1 B;  3ST4 A;  1IQ5 A;  4XYN A;  4OV2 A;  2HFC A;  1F09 A;  4L9M A;  2KPH A;  3S0B A;  3G9A A;  1R2U A;  4WQ3 A;  3V2L A;  3DF0 B;  2H61 A;  2K8M B;  3CFF A;  5I94 A;  3CD9 A;  2CNP A;  5HGE A;  2PAL A;  3CR2 A;  4JRB A;  1NUB A;  3BXB A;  5J3X A;  2I18 A;  1S5G Z;  2VZX A;  5D3O A;  1L2O B;  1BR1 B;  1SBJ A;  1XFZ O;  2HPW A;  5HLV A;  2WCH A;  1CM4 A;  4YGD B;  4L12 A;  2QEH A;  3I5I C;  3FS7 A;  2E30 A;  1QYF A;  1JFK A;  3W1D A;  4EN1 A;  2G16 B;  5AQB B;  3OGO A;  4GES B;  4HQC A;  2OPO A;  4DXQ A;  3I5H C;  2BAP A;  4RTC A;  2LLU A;  3B86 A;  1YUR A;  1PRW A;  3NXA A;  1F4Q A;  3OGN A;  1B8R A;  1F71 A;  1Q80 A;  2BCA A;  4C0J A;  1TNP A;  2JXL A;  3K21 A;  3CR5 X;  3H4S E;  1LA3 A;  1QAT A;  4M2Q A;  4JWQ A;  2O29 A;  4Q7R A;  1TNQ A;  2QAC A;  4CPV A;  3EVV A;  3BOW A;  5EB7 A;  3CTN A;  3DQE A;  4KF4 A;  1TNW A;  3BXK A;  4J8A A;  2F33 A;  2L2E A;  3RWA A;  2ZO6 A;  3L4L A;  2WC6 A;  4C0L A;  3I5G B;  3ED8 A;  4LJB A;  2H9W A;  5BPJ A;  2B3P A;  2M8U A;  4P76 A;  3D74 A;  2A47 A;  5HLO A;  5FVF A;  4DKN A;  4N5X A;  4UPG A;  4W6G A;  3TUY B;  3OX5 A;  2KOT A;  2OTE A;  2PQL A;  1OMV A;  2PXW A;  3WCK A;  4INX A;  5ER4 X;  3LF3 A;  4DXO A;  5FVI A;  1YVL A;  1UHJ A;  1BF5 A;  1Z4H A;  4KF5 A;  2WIS A;  3PJ5 A;  1P28 A;  1CDL A;  4F0Z B;  1OXE A;  5EXC I;  4OHS A;  4DXI A;  3NED A;  4W6D A;  2FCD A;  4Q9X A;  5K89 A;  5CSI A;  1TWO A;  3DQ6 A;  1IQ3 A;  3NSO A;  2OKY A;  2KYC A;  4Q04 A;  4Z4M A;  2L51 A;  1MR8 A;  2WCB A;  1EMF A;  2MA2 A;  1SCV A;  2DDD A;  1MQ1 A;  2A4J A;  2G6Y A;  5AAN A;  2EMN A;  2WCM A;  3BUM B;  1TCF A;  5DPH A;  4KA9 A;  3DQJ A;  4MZJ A;  5BQL A;  2O5G A;  4PE0 A;  3FE8 A;  4HRH A;  5IBW A;  2OTG B;  1B1G A;  1TRF A;  5HZS A;  2V4E A;  3LVC A;  4ZFS A;  1XA5 A;  2NCO A;  2JT0 A;  2LP2 A;  4Q7U A;  3DPZ A;  4W7R A;  1LXF C;  5HZO A;  4ORB B;  2WCL A;  1NX0 A;  3TS5 C;  1KFU L;  2K7B A;  5H88 A;  1SL9 A;  2F3Y A;  1J1D A;  1X02 A;  4JPZ B;  2SAS A;  4ZF4 A;  1Q4E A;  2QRF A;  5CSJ A;  1XFR A;  2JRF A;  3SG3 A;  2BL0 B;  4GGF A;  2OTB A;  4MEW A;  3ZUL A;  2CBL A;  2DUH A;  2FWQ A;  3OB2 B;  3PFV A;  3U0K A;  3TMR A;  1EML A;  4XJK A;  4R6B A;  5GQQ C;  4U2V A;  2OS8 C;  2GGM A;  3UG0 A;  3NT9 A;  3BFA A;  4W6U A;  4IK9 A;  3LS3 A;  2VRG A;  3NT3 A;  3HCM A;  3VRR A;  3A4U B;  5JJG A;  2GW3 A;  3AAJ A;  2CXJ A;  1H6R A;  1AHR A;  5BTT B;  3S0D A;  2YE1 A;  2H5Q A;  4NDD A;  1ZGP A;  1BFP A;  5DKR A;  2ZKM X;  5EJU A;  4ANJ A;  4JFG A;  2VAD A;  3CFA A;  3MSE B;  3ST2 A;  4L1I A;  4PE7 A;  1SK6 D;  3O4X A;  4IK8 A;  1OOI X;  2B1U A;  1RFJ A;  2LLT A;  4LW5 A;  4JD9 A;  1MOV A;  3CDN A;  3GK4 X;  1YJF A;  1UHN A;  2Z6X A;  2LMT A;  4W6N A;  2I94 A;  4KW8 A;  5FYX A;  3EVU A;  1SR6 C;  2CCM A;  1J7O A;  1MOU A;  4YGA A;  5DTL A;  3SSP A;  2QPT A;  2KLD A;  1RMP A;  1UHK A;  4IZN A;  1PUL A;  3CZT X;  3E5T A;  1ZUX A;  2ISD A;  1K2H A;  5HZU A;  2PAS A;  4I5K A;  2ZFD A;  4EDS A;  1U5I A;  1PVA A;  1Z1P A;  4P1Q A;  5CSF A;  2LE9 B;  1DC1 A;  3I5F C;  2OGR A;  1TUZ A;  1ALV A;  3VHT B;  2MAZ A;  3TDU A;  3CR4 X;  4USL A;  1GGX A;  3D73 A;  2WC5 A;  2BCX A;  1YZW A;  2KFH A;  1OMR A;  2LHL A;  4HRE E;  1PSR A;  1OOJ A;  3SG7 A;  4L13 A;  3DVE A;  3WHT B;  3I5F B;  2LVV A;  1KP5 A;  2QU1 A;  5CSN A;  2F8P A;  1W9Z A;  1M45 A;  2LC5 A;  1EMG A;  1KCY A;  1UUS A;  5DU0 A;  3CFH A;  1ZMZ A;  3LLE A;  1CB1 A;  2ZRT A;  1NWD A;  2MJW B;  3DQ8 A;  3EVR A;  1TUJ A;  2VVJ A;  4OY4 A;  5LTP A;  3PJI A;  1SL8 A;  2BCB A;  1SY9 A;  2EC6 C;  3TDZ A;  1A2X A;  2GTE A;  4Z4K A;  1QJT A;  3DQO A;  4QJ3 B;  2A56 B;  4W6J A;  3UNW A;  1IH0 A;  1G8I A;  3OBV A;  3ZUJ A;  4PDZ A;  2AWL A;  1M46 A;  2ZN9 A;  1ZGQ A;  5LTR A;  1MXE A;  3IR8 A;  2KGB C;  1XAE A;  3KHE A;  2A54 B;  2Q91 A;  3GJ2 A;  3DZT A;  3D76 A;  4ZIO A;  1W7T A;  2HF5 A;  1SRA A;  1BU3 A;  2O60 A;  2BBN A;  4J88 A;  2YDZ A;  1EL4 A;  1KK8 C;  1QLK A;  3I5H B;  1QWV A;  1DEK A;  3DQA A;  2YE0 A;  1PVB A;  3SJS A;  1EMK A;  1W7I B;  4ZBL A;  1B4C A;  3CLN A;  5DKN A;  4YGE B;  1C7W A;  3R72 A;  1SKT A;  3KCT A;  5LK4 A;  1CLM A;  4GGF C;  5KTY A;  2KDH A;  2IS9 A;  4PPL A;  1CMF A;  2QEV A;  2H5R A;  1SW8 A;  1FW4 A;  2L4H A;  4W73 A;  2AHA A;  3SV5 A;  1CDM A;  2KLE A;  1LA0 A;  4CID A;  2WND A;  3GL4 A;  1YHI A;  4IL1 A;  1UHH A;  2GGZ A;  1DTL A;  3DQU A;  1SCM B;  1W7U A;  1IKU A;  3LK0 A;  2GV5 A;  2IB6 A;  4ZF3 A;  4PCW A;  4OZD A;  4W7X A;  3BOW B;  2JPT A;  3AI5 A;  3OSQ A;  3KO0 A;  4DCK A;  3NEZ A;  1NCX A;  3QME A;  3LA1 A;  3S0F A;  4I5N B;  2JZI A;  4QJ5 B;  2FZU A;  4DS7 A;  1SPY A;  2A53 B;  1Q4D A;  4XOV A;  3W1C A;  2E6W A;  2H5P A;  1A4P A;  1REC A;  2CTN A;  1EH2 A;  2BBM A;  2KNE A;  5HW9 A;  4P2Y B;  2PMY A;  5JOL A;  2RGI A;  1ZUZ A;  2L5X B;  2KI4 C;  1K9U A;  2AWJ A;  1QIV A;  2EMD A;  3U8P A;  4U8D A;  2HGD A;  3U0N A;  1G33 A;  1Y0V H;  5ER5 A;  3DQI A;  2KI6 D;  3SS4 A;  4TNC A;  4W7E A;  5DRF A;  3SVO A;  1OE9 B;  1MUX A;  1J55 A;  2G6E A;  1FBV A;  3U8C A;  2AWM A;  5PAL A;  3BUX B;  2BNX A;  1V1F A;  3M0W A;  4DKM A;  1Y1U A;  3SVR A;  2Y1N A;  2K7O A;  1YJ2 A;  4E68 A;  4GOB A;  3DQ2 A;  2L98 A;  1EMA A;  3E5V A;  3KF9 A;  2AAO A;  1YTZ C;  4AS8 A;  3DQ4 A;  4FQT A;  1F0B A;  3R1V A;  4OR9 B;  4W6R A;  1IWQ A;  1OW4 A;  1ZOT B;  3KEV A;  2WCK A;  1CNP A;  1RRO A;  2L5Y A;  1B8L A;  1SYM A;  2H8V A;  1B9A A;  3SSL A;  1DJZ A;  1BG1 A;  2G2B A;  1F55 A;  2EC6 B;  3CGA A;  3P8U A;  4F7F A;  1QXT A;  4PHK A;  2JC2 A;  2KQ6 A;  3U0L A;  1NCZ A;  1GGW A;  2LUX A;  2ERB A;  3SSY A;  2C9I A;  1WDC C;  1RWY A;  2OJK A;  1Q4A A;  1WRL A;  1YUT A;  2M0R A;  3SRY A;  5FI6 A;  3DPX A;  3AKO A;  4KAG A;  4LJD C;  1NSH A;  1QY3 A;  1K9K A;  2JT3 A;  1NX1 A;  1OOF A;  3DQ5 A;  1KFU S;  3ZNI A;  1N65 A;  4IK5 A;  3WLD A;  4GF6 B;  1QAS A;  2WC8 A;  4YGC B;  3NSK A;  2Y1M A;  2G2S B;  5EL2 A;  4ORA B;  1JC1 A;  4W6F A;  3DQD A;  3DQL A;  2FL1 A;  1KQV A;  2M29 A;  2VVI A;  1T14 A;  1BJF A;  3RWT A;  3M24 A;  1TOP A;  5CPV A;  3Q8I A;  1J1E A;  1DF0 A;  3D0Y A;  4XL5 A;  1XK4 C;  1DGV A;  1QIW A;  3GOF A;  2C9J A;  1MWN A;  4J89 A;  3OSR A;  1C3Z A;  2JTT A;  4GAO A;  1Y6W A;  3RZS A;  2Z6Z A;  3TUY C;  3SST A;  1N2D A;  1JFJ A;  3NGV A;  2M49 B;  1IG5 A;  2KFG A;  4YBH B;  1ALW A;  5AXI A;  2FCE A;  4A4C A;  2KBI A;  1YR5 A;  1WDC B;  3DQ7 A;  3DQ3 A;  2VAE A;  4OGS A;  1QXP A;  2VVH A;  1NP8 A;  1F70 A;  2KI4 B;  2G9B A;  2LHI A;  4IJ7 A;  2G3D B;  2AUC A;  2H2K A;  2JXC A;  1TN4 A;  2Q57 A;  3A8S A;  4MRX A;  1F54 A;  4W6S A;  2HQW A;  2QDI A;  1TNX A;  4ORC B;  2DDC A;  1Z1Q A;  4H3L A;  4R1E A;  3LK1 A;  3U0M A;  1MXL C;  1EXR A;  2I7A A;  4ZCV A;  5FHV A;  1MYW A;  3FWB A;  3QRX A;  4W72 A;  5EB6 A;  4XGY A;  4W7A A;  3O6B A;  3PAT A;  2JAD A;  4GFT A;  2EMO A;  1QVI Y;  1KK7 Z;  2WOR A;  1JBZ A;  5KTG A;  4MZL A;  1EMB A;  4GGN A;  3SVN A;  3L4A A;  2LV7 A;  4NWS A;  4B5Y A;  4W6A A;  1NPQ A;  1Z2C B;  2POX A;  1Y1A A;  2Z6Y A;  2BE4 A;  3DYE A;  1XFW O;  4ZCU A;  1K8U A;  4JF9 A;  2KAV A;  1S5G Y;  3SS3 A;  1GFL A;  5F6T A;  4PPJ A;  2Z1O A;  1PAL A;  2IB5 A;  3D0Y B;  1QX5 B;  4W6C A;  4EMQ A;  3B7A A;  1BT6 A;  1BOD A;  3PLF B;  3JTD B;  3AAK A;  1YFP A;  1XFY O;  5I8N A;  3CGL A;  5BTT A;  4YGB B;  1CFC A;  3SIB A;  2WCF A;  2QT2 A;  1XSS A;  2FJY A;  2I2R E;  1L2O C;  2JT8 A;  4INW A;  2AWK A;  1OZS A;  3K1E A;  4PT1 A;  1UIS A;  2LMV A;  2NZ0 A;  1IIO A;  2M7N A;  1WRK A;  1SNL A;  4MSP A;  1QYQ A;  2M1U A;  3SSK A;  3SSV A;  2FJU B;  1DMO A;  5DIC A;  1YUU A;  2JPO A;  3DQN A;  3U8A A;  3PN7 C;  3DY9 A;  3DQ1 A;  1JF0 A;  4AOM A;  2HJO A;  3BXA A;  2K2A A;  4N1G A;  1DT7 B;  4AR7 A;  3ZTF A;  3BQ3 A;  1S6Z A;  2IOV A;  2JNX A;  2K7D A;  3BFH A;  4HQ9 A;  2A48 A;  1NX2 A;  3ST0 A;  3F45 A;  3WXA A;  3WNX B;  5HZT A;  1J7R A;  4JEO A;  3LSA A;  5HKY A;  1CLL A;  1XFV O;  1JC0 A;  3TS5 B;  4NDB A;  3C1V A;  2LVJ A;  2JWW A;  5G08 A;  1XK4 A;  5DQM A;  4W6T A;  4W7F A;  1FI5 A;  3JVT C;  3TDI A;  3IQQ A;  1RTP 1;  2ZRS A;  2ARL A;  1QS7 A;  5AEQ A;  1GQM A;  4RYS A;  4ETO A;  5DRG A;  1JF2 A;  1D1O A;  3BXC A;  3ZWH A;  2M1K B;  4DUQ A;  5I2O A;  2KBM A;  2DD9 A;  2K0J A;  2DD7 A;  2ZNE A;  4N1F A;  1LVC D;  1MF8 B;  2OKW A;  1AVS A;  1G7K A;  4PHM A;  1Q4B A;  1EMC A;  3HX4 A;  1XA9 A;  1S26 D;  4JGE A;  2Q4U A;  3CD1 A;  1K96 A;  3PJ7 A;  4HQ8 A;  3LVA A;  1DJG A;  1K94 A;  1IJ6 A;  2RH7 A;  4AQI A;  4RYW A;  5H89 A;  1LKJ A;  1KFX L;  1H8B A;  3S0E A;  2O2B A;  1BLQ A;  2IE2 A;  4C0K A;  1QX2 A;  1GGZ A;  1CFF A;  1IGV A;  4LQT A;  4W6B A;  5DKQ A;  4W69 A;  3SS0 A;  2KGR A;  1M63 B;  2OS8 B;  4B30 A;  1FI6 A;  4MVF A;  5TNC A;  2G3O A;  4EDO A;  2P70 A;  4DXM A;  2NXQ A;  1UHI A;  1M31 A;  3PSR A;  3DQ9 A;  5HKZ A;  4W7C A;  4AQJ A;  2OTG C;  1KQM C;  1YHH A;  1S6J A;  1W7J B;  2JNF A;  3S0G A;  3SVC A;  2NLN A;  4H48 A;  1R6P A;  3OHM B;  3EKJ A;  4UTS A;  2G5Z B;  3BUN B;  2B3Q A;  2MLF C;  2Q6P A;  3PM8 A;  5BT0 A;  1A75 A;  1EME A;  1CLB A; 
#chains in the Genus database with same CATH homology
 1YRT B;  1YUS A;  1K95 A;  3K1K A;  1JBA A;  4MRY A;  2F2P A;  2KHN A;  4OKH A;  1AP4 A;  3JTD C;  2Y4Q A;  4PE4 A;  3AI4 A;  5DPG A;  5EHU A;  5DTY A;  3SVS A;  5KSZ A;  1OMD A;  2JU0 A;  1K90 D;  4KW9 A;  3CWG A;  1NYA A;  2M97 A;  1AJ4 A;  4W6M A;  1HQV A;  1YX8 A;  1F8H A;  4GBA A;  2ZMU A;  2H6V A;  3DD4 A;  3LCP C;  1KYS A;  5I2L A;  1JUO A;  1A75 B;  2JOJ A;  3DF0 A;  3DPW A;  4JC2 A;  1WY9 A;  3SG5 A;  1C07 A;  3EK7 A;  2KFF A;  1B8C A;  1QV0 A;  4I5L B;  2GW4 B;  2WUR A;  3SVD A;  4WQ2 A;  2TN4 A;  1XQM A;  4YI9 A;  2H61 C;  2HPS A;  2M9G A;  2A46 A;  2DUI A;  4LQU A;  4H3N A;  1AUI B;  3TZ1 A;  2M3W A;  2KI6 C;  3VGO A;  1M39 A;  1CFD A;  3I19 A;  4LJD A;  5FVG A;  1EG4 A;  4OVN F;  3SVE A;  1PSB A;  1OSA A;  5I2Q A;  5DY6 A;  1XFX O;  4PE1 A;  1QTX A;  1EJ3 A;  1J7P A;  1CFP A;  3BYA A;  4XJK B;  3TMT A;  4D1E A;  3H1O A;  4W6I A;  4MLW A;  2AH8 A;  2MBX A;  4PPK A;  4Q7T A;  1XFU O;  4GUK A;  1KWO C;  1VRK A;  2BL0 C;  1B9C A;  4DRW A;  1EG3 A;  2HCG A;  4PHN A;  1CM1 A;  1DJI A;  1JBY A;  3VRO A;  1W7S A;  4W6L A;  2WIQ A;  2JTZ A;  1AJ5 A;  3KCS A;  1HT9 A;  2M7L A;  3LF4 B;  1XO5 A;  1B47 A;  3FIA A;  3JVT B;  4BY4 A;  1KK7 Y;  2KAX A;  4FTG A;  1DJW A;  1BR4 B;  2BKI B;  3ZUF A;  3IP2 A;  3BUW B;  1FPW A;  2HGY A;  4M2P A;  1E8A A;  1TIZ A;  3CS1 A;  1SMG A;  2LMU A;  1LIN A;  4H47 A;  5EBJ A;  4W77 A;  4HRG A;  1QVI Z;  3DQK A;  1B7T Y;  4YI8 A;  2LP3 A;  2WHT A;  2PVB A;  1YX7 A;  1PK0 D;  2R2I A;  4W76 A;  2H5O A;  2WHS A;  3PIB A;  1IRJ A;  3PN7 B;  1G4Y R;  4QJ4 B;  2K61 A;  1CMG A;  4W75 A;  2AMI A;  1DJY A;  1L7Z A;  4JQ0 D;  3LVD A;  4ICB A;  3VRP A;  3EKH A;  1QV1 A;  2ZMW A;  4W6H A;  1CDN A;  5D69 A;  4IK4 A;  2KQY A;  2DUE A;  2WSO A;  3S05 A;  3I5I B;  2YFP A;  1BMO A;  3SG6 A;  3UFZ A;  3BUO B;  2V4E B;  3O2P A;  4FQO A;  4KEX A;  1CV7 A;  1FF1 A;  4CFQ A;  4TZA A;  4NDC A;  3V3D A;  3NSI A;  1S1E A;  2CT9 A;  4IK3 A;  3IF7 A;  3BX9 A;  5DTZ A;  1CKK A;  2K7C A;  1XMZ A;  2Y5I A;  1OXD A;  3AKA A;  3VHT A;  1JSA A;  4KF5 C;  1S3P A;  3I5G C;  2KYF A;  4LJC A;  5EXU A;  1A03 A;  4B30 B;  1RM9 A;  2DOQ A;  1UUR A;  2A52 B;  1A29 A;  3PAL A;  1QX7 A;  1NX3 A;  4EUL A;  2F2O A;  4I2Y A;  2LLS A;  5DPJ A;  5D7F A;  1HUY A;  5DPI A;  3A8R A;  1ZGO A;  4DIR A;  4OQW A;  3D10 A;  2P4M A;  3CB9 A;  1N0Y A;  2P6B B;  4W74 A;  1AK8 A;  4GNK B;  3GJ1 A;  3NSL A;  4DXP A;  1YRU B;  1XVJ A;  4I5J A;  5DQB A;  2BEC A;  2KSP A;  5H87 A;  2PXS A;  2WSN A;  1GL4 A;  2FOT A;  4Q9W A;  3SSH A;  4XOW A;  4W6O A;  1H4B A;  4DXN A;  3OX6 A;  1H4U A;  1C4F A;  2LCP A;  4MZK A;  3EVP A;  2V53 A;  1S6I A;  2Y0G A;  5KU1 A;  1MHO A;  2WHU A;  4P5O E;  3PJB A;  3VK1 A;  2QLI A;  1KK8 B;  1IJ5 A;  1OZO A;  2WCE A;  2PSR A;  2LAP A;  1KYR A;  2BKH B;  4PFE A;  2QLE A;  4HVF A;  2LM5 A;  1RRX A;  3ST3 A;  4WRI A;  4ZIN A;  1DJH A;  3DQF A;  1J7Q A;  1XYD A;  5DTX A;  4W6P A;  1JC2 A;  1QYO A;  3GB3 A;  2EHB A;  1KWO B;  2QLH A;  5J2O A;  2EGD A;  1DGU A;  2LAN A;  3SVU A;  2QLG A;  2COL B;  3RLZ A;  2HQZ A;  4HE4 A;  3DVK A;  3RM1 A;  1Q4C A;  1DF0 B;  2QZ0 A;  5AER A;  1KSM A;  2JQ6 A;  2D8N A;  4CLN A;  2WOS A;  3O78 A;  1ODB A;  2DUF A;  3H1R A;  1GJY A;  4CFR A;  3GK2 A;  1SCM C;  3O4Y A;  4M2O A;  1OXF A;  3WLC A;  3EK8 A;  5HKW A;  3DQM A;  2O24 A;  3MGF A;  3NF0 A;  4N3D A;  1RMM A;  1CDP A;  5HYD A;  4GPL B;  2K2F A;  1Y1X A;  3SG2 A;  4BDU A;  1ZFS A;  3WHU B;  1V1G A;  3EK4 A;  4ORN A;  4H3M A;  4KPI A;  3ADF A;  2MLE C;  4MN0 A;  2ZN8 A;  5EXB A;  1UP5 A;  3LL8 B;  2KAY A;  2LUC A;  1SR6 B;  3SVB A;  1RK9 A;  1Q73 A;  1ZAC A;  1TCO B;  1UWO A;  5F9G A;  3SG4 A;  3AKB A;  4KGE A;  3ICB A;  1DJX A;  4YRU A;  4MBE A;  2LVK A;  1SL7 A;  4W6K A;  1RMO A;  2MHH A;  3VRN A;  3GK1 A;  1KSO A;  3DQH A;  2L50 A;  1YHG A;  1KQM B;  1YVH A;  1KYP A;  2V4E C;  3GEX A;  2A50 B;  3CBE A;  1NCY A;  5T3I A;  4IK1 A;  3M22 A;  3VIC A;  1DVI A;  2HQ8 A;  4PAL A;  3IQO A;  3O77 A;  2JUL A;  1WLM A;  5B8I B;  4NQG A;  2GX2 A;  1S6C A;  2BE6 A;  4ZF5 A;  1U5I B;  4TZG A;  4KGF A;  2QLG B;  3E3R A;  4W7D A;  4OJ0 A;  4HSZ A;  2ZO7 A;  3DQC A;  1JWD A;  1BOC A;  3FWC A;  2L4I A;  1F4O A;  1CTR A;  1S36 A;  1KFX S;  2MRD A;  1WRZ A;  3KPX A;  2G6X A;  5HBD A;  1HCJ A;  4OCI A;  2HQK A;  4PHJ A;  1K93 D;  4ZB1 A;  5AFP A;  2PRU A;  2LVI A;  3VRQ A;  3SIA A;  4R6D A;  3DVJ A;  1OQP A;  4A4B A;  1B7T Z;  1WLZ A;  1RJV A;  1NIW A;  1EMM A;  4XVP A;  1C7V A;  4BY5 A;  2F3Z A;  3E5W A;  3P28 A;  2ICR A;  1QLS A;  2BTJ A;  1TTX A;  2DUG A;  1K9P A;  2NCP A;  3OP0 A;  2GX0 A;  2SCP A;  2HRS A;  2L0P A;  2H8Q A;  2ZND A;  5LTQ A;  2HET A;  4KW4 A;  3DVM A;  2LNK A;  3OB1 B;  3ST4 A;  1IQ5 A;  4XYN A;  4OV2 A;  2HFC A;  1F09 A;  4L9M A;  3G9A A;  1R2U A;  4WQ3 A;  3DF0 B;  2H61 A;  2K8M B;  3CFF A;  3CD9 A;  2CNP A;  5HGE A;  2PAL A;  3CR2 A;  4JRB A;  1NUB A;  3BXB A;  5J3X A;  2I18 A;  1S5G Z;  2VZX A;  1L2O B;  1BR1 B;  1SBJ A;  1XFZ O;  2HPW A;  5HLV A;  1CM4 A;  4YGD B;  4L12 A;  3I5I C;  3FS7 A;  2E30 A;  1QYF A;  1JFK A;  3W1D A;  4EN1 A;  2G16 B;  5AQB B;  3OGO A;  4GES B;  4HQC A;  2OPO A;  4DXQ A;  3I5H C;  4RTC A;  2LLU A;  1YUR A;  1PRW A;  3NXA A;  1F4Q A;  1B8R A;  1F71 A;  1Q80 A;  2BCA A;  4C0J A;  1TNP A;  2JXL A;  3K21 A;  3CR5 X;  3H4S E;  1LA3 A;  1QAT A;  4M2Q A;  4JWQ A;  2O29 A;  4Q7R A;  1TNQ A;  2QAC A;  4CPV A;  3EVV A;  3BOW A;  5EB7 A;  3CTN A;  3DQE A;  4KF4 A;  1TNW A;  3BXK A;  4J8A A;  2F33 A;  2L2E A;  3RWA A;  2ZO6 A;  4C0L A;  3I5G B;  3ED8 A;  4LJB A;  2H9W A;  5BPJ A;  2B3P A;  2M8U A;  4P76 A;  2A47 A;  5HLO A;  5FVF A;  4DKN A;  4N5X A;  4UPG A;  4W6G A;  3TUY B;  3OX5 A;  2KOT A;  2OTE A;  1OMV A;  2PXW A;  3WCK A;  5ER4 X;  3LF3 A;  4DXO A;  5FVI A;  1YVL A;  1UHJ A;  1BF5 A;  4KF5 A;  2WIS A;  3PJ5 A;  1CDL A;  4F0Z B;  1OXE A;  5EXC I;  4OHS A;  4DXI A;  3NED A;  4W6D A;  2FCD A;  4Q9X A;  5K89 A;  5CSI A;  3DQ6 A;  1IQ3 A;  3NSO A;  2OKY A;  2KYC A;  4Q04 A;  4Z4M A;  2L51 A;  1MR8 A;  2WCB A;  1EMF A;  2MA2 A;  1SCV A;  2DDD A;  1MQ1 A;  2A4J A;  2G6Y A;  5AAN A;  2EMN A;  3BUM B;  1TCF A;  5DPH A;  4KA9 A;  3DQJ A;  4MZJ A;  5BQL A;  2O5G A;  4PE0 A;  4HRH A;  5IBW A;  2OTG B;  1B1G A;  1TRF A;  5HZS A;  2V4E A;  3LVC A;  4ZFS A;  1XA5 A;  2NCO A;  2JT0 A;  2LP2 A;  4Q7U A;  3DPZ A;  4W7R A;  1LXF C;  5HZO A;  4ORB B;  1NX0 A;  3TS5 C;  1KFU L;  2K7B A;  5H88 A;  1SL9 A;  2F3Y A;  1J1D A;  1X02 A;  4JPZ B;  2SAS A;  4ZF4 A;  1Q4E A;  2QRF A;  5CSJ A;  2JRF A;  3SG3 A;  2BL0 B;  4GGF A;  2OTB A;  4MEW A;  3ZUL A;  2CBL A;  2DUH A;  2FWQ A;  3OB2 B;  3PFV A;  3U0K A;  3TMR A;  1EML A;  4XJK A;  4R6B A;  5GQQ C;  4U2V A;  2OS8 C;  2GGM A;  3UG0 A;  3NT9 A;  4W6U A;  4IK9 A;  3LS3 A;  2VRG A;  3NT3 A;  3HCM A;  3VRR A;  3A4U B;  5JJG A;  2GW3 A;  3AAJ A;  2CXJ A;  1H6R A;  1AHR A;  5BTT B;  2YE1 A;  2H5Q A;  4NDD A;  1ZGP A;  1BFP A;  5DKR A;  2ZKM X;  5EJU A;  4ANJ A;  4JFG A;  2VAD A;  3CFA A;  3MSE B;  3ST2 A;  4L1I A;  4PE7 A;  1SK6 D;  4IK8 A;  2B1U A;  1RFJ A;  2LLT A;  4LW5 A;  1MOV A;  3GK4 X;  1YJF A;  1UHN A;  2Z6X A;  2LMT A;  4W6N A;  2I94 A;  4KW8 A;  5FYX A;  3EVU A;  1SR6 C;  2CCM A;  1J7O A;  1MOU A;  4YGA A;  5DTL A;  3SSP A;  2QPT A;  1RMP A;  1UHK A;  4IZN A;  1PUL A;  3CZT X;  3E5T A;  1ZUX A;  2ISD A;  1K2H A;  5HZU A;  2PAS A;  4I5K A;  2ZFD A;  4EDS A;  1U5I A;  1PVA A;  1Z1P A;  4P1Q A;  5CSF A;  2LE9 B;  3I5F C;  2OGR A;  1ALV A;  3VHT B;  2MAZ A;  3TDU A;  3CR4 X;  4USL A;  1GGX A;  2BCX A;  1YZW A;  2KFH A;  1OMR A;  2LHL A;  4HRE E;  1PSR A;  1OOJ A;  3SG7 A;  4L13 A;  3DVE A;  3WHT B;  3I5F B;  2LVV A;  1KP5 A;  2QU1 A;  5CSN A;  2F8P A;  1M45 A;  2LC5 A;  1EMG A;  1KCY A;  1UUS A;  5DU0 A;  3CFH A;  1ZMZ A;  3LLE A;  1CB1 A;  2ZRT A;  1NWD A;  2MJW B;  3DQ8 A;  3EVR A;  2VVJ A;  4OY4 A;  5LTP A;  1SL8 A;  2BCB A;  1SY9 A;  2EC6 C;  3TDZ A;  1A2X A;  4Z4K A;  1QJT A;  3DQO A;  4QJ3 B;  2A56 B;  4W6J A;  1IH0 A;  1G8I A;  3ZUJ A;  4PDZ A;  2AWL A;  1M46 A;  2ZN9 A;  1ZGQ A;  5LTR A;  1MXE A;  3IR8 A;  2KGB C;  1XAE A;  3KHE A;  2A54 B;  2Q91 A;  3GJ2 A;  4ZIO A;  1W7T A;  2HF5 A;  1SRA A;  1BU3 A;  2O60 A;  2BBN A;  4J88 A;  2YDZ A;  1EL4 A;  1KK8 C;  1QLK A;  3I5H B;  3DQA A;  2YE0 A;  1PVB A;  3SJS A;  1EMK A;  1W7I B;  4ZBL A;  1B4C A;  3CLN A;  5DKN A;  4YGE B;  1C7W A;  1SKT A;  3KCT A;  5LK4 A;  1CLM A;  4GGF C;  5KTY A;  2KDH A;  2IS9 A;  4PPL A;  1CMF A;  2H5R A;  1SW8 A;  1FW4 A;  2L4H A;  4W73 A;  2AHA A;  3SV5 A;  1CDM A;  1LA0 A;  4CID A;  2WND A;  3GL4 A;  1YHI A;  4IL1 A;  1UHH A;  2GGZ A;  1DTL A;  3DQU A;  1SCM B;  1W7U A;  1IKU A;  3LK0 A;  2GV5 A;  2IB6 A;  4ZF3 A;  4PCW A;  4W7X A;  3BOW B;  2JPT A;  3AI5 A;  3OSQ A;  3KO0 A;  4DCK A;  3NEZ A;  1NCX A;  3LA1 A;  4I5N B;  2JZI A;  4QJ5 B;  2FZU A;  4DS7 A;  1SPY A;  2A53 B;  1Q4D A;  4XOV A;  3W1C A;  2E6W A;  2H5P A;  1A4P A;  1REC A;  2CTN A;  1EH2 A;  2BBM A;  2KNE A;  5HW9 A;  4P2Y B;  2PMY A;  5JOL A;  2RGI A;  1ZUZ A;  2L5X B;  2KI4 C;  1K9U A;  2AWJ A;  1QIV A;  2EMD A;  3U8P A;  4U8D A;  2HGD A;  3U0N A;  1G33 A;  1Y0V H;  5ER5 A;  3DQI A;  2KI6 D;  4TNC A;  4W7E A;  5DRF A;  3SVO A;  1OE9 B;  1MUX A;  1J55 A;  2G6E A;  1FBV A;  3U8C A;  2AWM A;  5PAL A;  3BUX B;  1V1F A;  3M0W A;  4DKM A;  1Y1U A;  3SVR A;  2Y1N A;  2K7O A;  1YJ2 A;  4E68 A;  4GOB A;  3DQ2 A;  2L98 A;  1EMA A;  3E5V A;  3KF9 A;  2AAO A;  1YTZ C;  4AS8 A;  3DQ4 A;  1F0B A;  4OR9 B;  4W6R A;  1IWQ A;  1ZOT B;  3KEV A;  1CNP A;  1RRO A;  1B8L A;  1SYM A;  1B9A A;  3SSL A;  1DJZ A;  1BG1 A;  2G2B A;  1F55 A;  2EC6 B;  3CGA A;  3P8U A;  1QXT A;  4PHK A;  2JC2 A;  2KQ6 A;  3U0L A;  1NCZ A;  1GGW A;  2LUX A;  3SSY A;  2C9I A;  1WDC C;  1RWY A;  2OJK A;  1Q4A A;  1WRL A;  1YUT A;  2M0R A;  3SRY A;  3DPX A;  3AKO A;  4KAG A;  4LJD C;  1NSH A;  1QY3 A;  1K9K A;  2JT3 A;  1NX1 A;  3DQ5 A;  1KFU S;  3ZNI A;  1N65 A;  4IK5 A;  3WLD A;  4GF6 B;  1QAS A;  2WC8 A;  4YGC B;  3NSK A;  2Y1M A;  2G2S B;  4ORA B;  1JC1 A;  4W6F A;  3DQD A;  3DQL A;  2FL1 A;  1KQV A;  2M29 A;  2VVI A;  1BJF A;  3RWT A;  3M24 A;  1TOP A;  5CPV A;  1J1E A;  1DF0 A;  3D0Y A;  4XL5 A;  1XK4 C;  1DGV A;  1QIW A;  3GOF A;  2C9J A;  1MWN A;  4J89 A;  3OSR A;  2JTT A;  4GAO A;  1Y6W A;  2Z6Z A;  3TUY C;  3SST A;  1N2D A;  1JFJ A;  2M49 B;  1IG5 A;  2KFG A;  4YBH B;  1ALW A;  5AXI A;  2FCE A;  4A4C A;  2KBI A;  1YR5 A;  1WDC B;  3DQ7 A;  3DQ3 A;  2VAE A;  4OGS A;  1QXP A;  2VVH A;  1NP8 A;  1F70 A;  2KI4 B;  2G9B A;  2LHI A;  2G3D B;  2AUC A;  2H2K A;  2JXC A;  1TN4 A;  2Q57 A;  3A8S A;  4MRX A;  1F54 A;  4W6S A;  2HQW A;  1TNX A;  4ORC B;  2DDC A;  1Z1Q A;  4H3L A;  4R1E A;  3LK1 A;  3U0M A;  1MXL C;  1EXR A;  2I7A A;  4ZCV A;  5FHV A;  1MYW A;  3FWB A;  3QRX A;  4W72 A;  5EB6 A;  4XGY A;  4W7A A;  3O6B A;  3PAT A;  2JAD A;  4GFT A;  2EMO A;  1QVI Y;  1KK7 Z;  2WOR A;  1JBZ A;  5KTG A;  4MZL A;  1EMB A;  4GGN A;  3SVN A;  2LV7 A;  4NWS A;  4B5Y A;  4W6A A;  1NPQ A;  2POX A;  1Y1A A;  2Z6Y A;  2BE4 A;  1XFW O;  4ZCU A;  1K8U A;  4JF9 A;  2KAV A;  1S5G Y;  1GFL A;  5F6T A;  4PPJ A;  2Z1O A;  1PAL A;  2IB5 A;  3D0Y B;  1QX5 B;  4W6C A;  4EMQ A;  1BT6 A;  1BOD A;  3PLF B;  3JTD B;  3AAK A;  1YFP A;  1XFY O;  5I8N A;  3CGL A;  5BTT A;  4YGB B;  1CFC A;  3SIB A;  2WCF A;  2QT2 A;  1XSS A;  2I2R E;  1L2O C;  2JT8 A;  2AWK A;  1OZS A;  1UIS A;  2LMV A;  2NZ0 A;  2M7N A;  1WRK A;  1SNL A;  4MSP A;  1QYQ A;  2M1U A;  3SSK A;  3SSV A;  2FJU B;  1DMO A;  1YUU A;  3DQN A;  3U8A A;  3PN7 C;  3DQ1 A;  1JF0 A;  4AOM A;  2HJO A;  3BXA A;  2K2A A;  4N1G A;  1DT7 B;  4AR7 A;  3ZTF A;  3BQ3 A;  1S6Z A;  2IOV A;  2JNX A;  2K7D A;  4HQ9 A;  2A48 A;  1NX2 A;  3ST0 A;  3F45 A;  3WXA A;  3WNX B;  5HZT A;  1J7R A;  4JEO A;  3LSA A;  5HKY A;  1CLL A;  1XFV O;  1JC0 A;  3TS5 B;  4NDB A;  3C1V A;  2LVJ A;  2JWW A;  5G08 A;  1XK4 A;  5DQM A;  4W6T A;  4W7F A;  1FI5 A;  3JVT C;  3TDI A;  3IQQ A;  1RTP 1;  2ZRS A;  2ARL A;  1QS7 A;  5AEQ A;  1GQM A;  4RYS A;  4ETO A;  5DRG A;  1JF2 A;  1D1O A;  3BXC A;  3ZWH A;  2M1K B;  4DUQ A;  5I2O A;  2KBM A;  2DD9 A;  2K0J A;  2DD7 A;  2ZNE A;  4N1F A;  1LVC D;  1MF8 B;  2OKW A;  1AVS A;  1G7K A;  4PHM A;  1Q4B A;  1EMC A;  3HX4 A;  1XA9 A;  1S26 D;  4JGE A;  2Q4U A;  3CD1 A;  1K96 A;  3PJ7 A;  4HQ8 A;  3LVA A;  1DJG A;  1K94 A;  1IJ6 A;  2RH7 A;  4AQI A;  4RYW A;  5H89 A;  1LKJ A;  1KFX L;  1H8B A;  2O2B A;  1BLQ A;  2IE2 A;  4C0K A;  1QX2 A;  1GGZ A;  1CFF A;  1IGV A;  4LQT A;  4W6B A;  5DKQ A;  4W69 A;  3SS0 A;  2KGR A;  1M63 B;  2OS8 B;  4B30 A;  1FI6 A;  4MVF A;  5TNC A;  2G3O A;  4EDO A;  4DXM A;  2NXQ A;  1UHI A;  1M31 A;  3PSR A;  3DQ9 A;  5HKZ A;  4W7C A;  4AQJ A;  2OTG C;  1KQM C;  1YHH A;  1S6J A;  1W7J B;  2JNF A;  3SVC A;  2NLN A;  4H48 A;  1R6P A;  3OHM B;  3EKJ A;  2G5Z B;  4UTS A;  3BUN B;  2B3Q A;  2MLF C;  2Q6P A;  3PM8 A;  5BT0 A;  1A75 A;  1EME A;  1CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...