3I7MA

N-terminal domain of xaa-pro dipeptidase from lactobacillus brevis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
TKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPIERVLALVVFPDQDPFIFAPALEVEVIKETGWQFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEKGQLQVARMEALAAQFSAPSFDLDITSFIEHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-Pro dipeptidase
publication title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis.
rcsb
source organism Lactobacillus brevis
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3i7mA00
3CB5A 2BWUA 3BIQA 4S01A 4S00A 4RZZA 3IG4A 2V3YA 1JAWA 5CDLA 5CDEA 1WBQA 3PEBA 4QR8A 1WL9A 2BHCA 1WN1A 3BIPA 2BHDA 1PV9A 5CNXA 3OOOA 4FKCA 2HOWA 3IL0A 2BWXA 4ZWUA 2IW2A 5CDVA 3Q6DA 1M35A 4PV4A 4RZYA 2BWVA 3QOCA 1WL6A 2BWSA 1KP0A 2BWTA 2BHBA 2BWYA 1WY2A 1N51A 3PN9A 4S2TP 5E5BA 2ZSGA 2BN7A 3CB6A 5CE6A 4ZWOA 2V3ZA 2BHAA 3L7GA 4EGEA 1A16A 5FCHA 3CTZA 4B28A 1W2MA 3O5VA 5FCFA 4S2RP 3RVAA 1W7VA 2BH3A 4ZWPA 4RGZ1 3OVKA 4ZNGA 5E2CA 3BITA 2OKNA 2BWWA 1WLRA 3L24A 5CIKA 2V3XA 3I7MA 1CHMA 4R60A
chains in the Genus database with same CATH superfamily
3CB5A 2BWUA 3BIQA 4S01A 4S00A 4RZZA 3IG4A 2V3YA 1JAWA 5CDLA 5CDEA 1WBQA 3PEBA 4QR8A 1WL9A 2BHCA 1WN1A 3BIPA 2BHDA 1PV9A 5CNXA 3OOOA 4FKCA 2HOWA 3IL0A 2BWXA 4ZWUA 2IW2A 5CDVA 3Q6DA 1M35A 4PV4A 4RZYA 2BWVA 3QOCA 1WL6A 2BWSA 1KP0A 2BWTA 2BHBA 2BWYA 1WY2A 1N51A 3PN9A 4S2TP 5E5BA 2ZSGA 2BN7A 3CB6A 5CE6A 4ZWOA 2V3ZA 2BHAA 3L7GA 4EGEA 1A16A 5FCHA 3CTZA 4B28A 1W2MA 3O5VA 5FCFA 4S2RP 3RVAA 1W7VA 2BH3A 4ZWPA 4RGZ1 3OVKA 4ZNGA 5E2CA 3BITA 2OKNA 2BWWA 1WLRA 3L24A 5CIKA 2V3XA 3I7MA 1CHMA 4R60A
chains in the Genus database with same CATH topology
3CB5A 2BWUA 3BIQA 4S01A 4S00A 4RZZA 3IG4A 2V3YA 1JAWA 5CDLA 5CDEA 1WBQA 3PEBA 4QR8A 1WL9A 2BHCA 1WN1A 3BIPA 2BHDA 1PV9A 5CNXA 3OOOA 4FKCA 2HOWA 3IL0A 2BWXA 4ZWUA 2IW2A 5CDVA 3Q6DA 1M35A 4PV4A 4RZYA 2BWVA 3QOCA 1WL6A 2BWSA 1KP0A 2BWTA 2BHBA 2BWYA 1WY2A 1N51A 3PN9A 4S2TP 5E5BA 2ZSGA 2BN7A 3CB6A 5CE6A 4ZWOA 2V3ZA 2BHAA 3L7GA 4EGEA 1A16A 5FCHA 3CTZA 4B28A 1W2MA 3O5VA 5FCFA 4S2RP 3RVAA 1W7VA 2BH3A 4ZWPA 4RGZ1 3OVKA 4ZNGA 5E2CA 3BITA 2OKNA 2BWWA 1WLRA 3L24A 5CIKA 2V3XA 3I7MA 1CHMA 4R60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB5 A;  2BWU A;  3BIQ A;  4S01 A;  4S00 A;  4RZZ A;  3IG4 A;  2V3Y A;  1JAW A;  5CDL A;  5CDE A;  1WBQ A;  3PEB A;  4QR8 A;  1WL9 A;  2BHC A;  1WN1 A;  3BIP A;  2BHD A;  1PV9 A;  5CNX A;  3OOO A;  4FKC A;  2HOW A;  3IL0 A;  2BWX A;  4ZWU A;  2IW2 A;  5CDV A;  3Q6D A;  1M35 A;  4PV4 A;  4RZY A;  2BWV A;  3QOC A;  1WL6 A;  2BWS A;  1KP0 A;  2BWT A;  2BHB A;  2BWY A;  1WY2 A;  1N51 A;  3PN9 A;  4S2T P;  5E5B A;  2ZSG A;  2BN7 A;  3CB6 A;  5CE6 A;  4ZWO A;  2V3Z A;  2BHA A;  3L7G A;  4EGE A;  1A16 A;  5FCH A;  3CTZ A;  4B28 A;  1W2M A;  3O5V A;  5FCF A;  4S2R P;  3RVA A;  1W7V A;  2BH3 A;  4ZWP A;  4RGZ 1;  3OVK A;  4ZNG A;  5E2C A;  3BIT A;  2OKN A;  2BWW A;  1WLR A;  3L24 A;  5CIK A;  2V3X A;  3I7M A;  1CHM A;  4R60 A; 
#chains in the Genus database with same CATH topology
 3CB5 A;  2BWU A;  3BIQ A;  4S01 A;  4S00 A;  4RZZ A;  3IG4 A;  2V3Y A;  1JAW A;  5CDL A;  5CDE A;  1WBQ A;  3PEB A;  4QR8 A;  1WL9 A;  2BHC A;  1WN1 A;  3BIP A;  2BHD A;  1PV9 A;  5CNX A;  3OOO A;  4FKC A;  2HOW A;  3IL0 A;  2BWX A;  4ZWU A;  2IW2 A;  5CDV A;  3Q6D A;  1M35 A;  4PV4 A;  4RZY A;  2BWV A;  3QOC A;  1WL6 A;  2BWS A;  1KP0 A;  2BWT A;  2BHB A;  2BWY A;  1WY2 A;  1N51 A;  3PN9 A;  4S2T P;  5E5B A;  2ZSG A;  2BN7 A;  3CB6 A;  5CE6 A;  4ZWO A;  2V3Z A;  2BHA A;  3L7G A;  4EGE A;  1A16 A;  5FCH A;  3CTZ A;  4B28 A;  1W2M A;  3O5V A;  5FCF A;  4S2R P;  3RVA A;  1W7V A;  2BH3 A;  4ZWP A;  4RGZ 1;  3OVK A;  4ZNG A;  5E2C A;  3BIT A;  2OKN A;  2BWW A;  1WLR A;  3L24 A;  5CIK A;  2V3X A;  3I7M A;  1CHM A;  4R60 A; 
#chains in the Genus database with same CATH homology
 3CB5 A;  2BWU A;  3BIQ A;  4S01 A;  4S00 A;  4RZZ A;  3IG4 A;  2V3Y A;  1JAW A;  5CDL A;  5CDE A;  1WBQ A;  3PEB A;  4QR8 A;  1WL9 A;  2BHC A;  1WN1 A;  3BIP A;  2BHD A;  1PV9 A;  5CNX A;  3OOO A;  4FKC A;  2HOW A;  3IL0 A;  2BWX A;  4ZWU A;  2IW2 A;  5CDV A;  3Q6D A;  1M35 A;  4PV4 A;  4RZY A;  2BWV A;  3QOC A;  1WL6 A;  2BWS A;  1KP0 A;  2BWT A;  2BHB A;  2BWY A;  1WY2 A;  1N51 A;  3PN9 A;  4S2T P;  5E5B A;  2ZSG A;  2BN7 A;  3CB6 A;  5CE6 A;  4ZWO A;  2V3Z A;  2BHA A;  3L7G A;  4EGE A;  1A16 A;  5FCH A;  3CTZ A;  4B28 A;  1W2M A;  3O5V A;  5FCF A;  4S2R P;  3RVA A;  1W7V A;  2BH3 A;  4ZWP A;  4RGZ 1;  3OVK A;  4ZNG A;  5E2C A;  3BIT A;  2OKN A;  2BWW A;  1WLR A;  3L24 A;  5CIK A;  2V3X A;  3I7M A;  1CHM A;  4R60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...