3I7MA

N-terminal domain of xaa-pro dipeptidase from lactobacillus brevis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
TKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPIERVLALVVFPDQDPFIFAPALEVEVIKETGWQFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEKGQLQVARMEALAAQFSAPSFDLDITSFIEHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis.
rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3i7mA00
3BITA 2BWWA 5E5BA 4S2TP 5CDEA 2BWUA 5CDLA 3L24A 1M35A 2BHBA 5CNXA 2BN7A 5CIKA 3QOCA 3BIPA 3PEBA 3OVKA 1WL9A 2BWVA 2BWYA 1A16A 2BHAA 3Q6DA 5FCFA 2V3XA 4PV4A 2BHCA 4RGZ1 2BHDA 4B28A 4S2RP 4ZWUA 1WLRA 3IG4A 5E2CA 5CDVA 2OKNA 2V3ZA 3BIQA 1W2MA 1N51A 2HOWA 3I7MA 1CHMA 5CE6A 4ZWPA 4QR8A 3O5VA 4R60A 4S00A 4RZYA 4FKCA 3CB6A 4EGEA 5FCHA 3IL0A 1WN1A 4S01A 1WL6A 1KP0A 4RZZA 4ZWOA 1W7VA 1WY2A 2BWSA 1WBQA 1JAWA 2BH3A 2BWTA 3PN9A 3OOOA 2IW2A 3CTZA 2BWXA 3CB5A 2ZSGA 1PV9A 3RVAA 4ZNGA 3L7GA 2V3YA
chains in the Genus database with same CATH superfamily
3BITA 2BWWA 5E5BA 4S2TP 5CDEA 2BWUA 5CDLA 3L24A 1M35A 2BHBA 5CNXA 2BN7A 5CIKA 3QOCA 3BIPA 3PEBA 3OVKA 1WL9A 2BWVA 2BWYA 1A16A 2BHAA 3Q6DA 5FCFA 2V3XA 4PV4A 2BHCA 4RGZ1 2BHDA 4B28A 4S2RP 4ZWUA 1WLRA 3IG4A 5E2CA 5CDVA 2OKNA 2V3ZA 3BIQA 1W2MA 1N51A 2HOWA 3I7MA 1CHMA 5CE6A 4ZWPA 4QR8A 3O5VA 4R60A 4S00A 4RZYA 4FKCA 3CB6A 4EGEA 5FCHA 3IL0A 1WN1A 4S01A 1WL6A 1KP0A 4RZZA 4ZWOA 1W7VA 1WY2A 2BWSA 1WBQA 1JAWA 2BH3A 2BWTA 3PN9A 3OOOA 2IW2A 3CTZA 2BWXA 3CB5A 2ZSGA 1PV9A 3RVAA 4ZNGA 3L7GA 2V3YA
chains in the Genus database with same CATH topology
3BITA 2BWWA 5E5BA 4S2TP 5CDEA 2BWUA 5CDLA 3L24A 1M35A 2BHBA 5CNXA 2BN7A 5CIKA 3QOCA 3BIPA 3PEBA 3OVKA 1WL9A 2BWVA 2BWYA 1A16A 2BHAA 3Q6DA 5FCFA 2V3XA 4PV4A 2BHCA 4RGZ1 2BHDA 4B28A 4S2RP 4ZWUA 1WLRA 3IG4A 5E2CA 5CDVA 2OKNA 2V3ZA 3BIQA 1W2MA 1N51A 2HOWA 3I7MA 1CHMA 5CE6A 4ZWPA 4QR8A 3O5VA 4R60A 4S00A 4RZYA 4FKCA 3CB6A 4EGEA 5FCHA 3IL0A 1WN1A 4S01A 1WL6A 1KP0A 4RZZA 4ZWOA 1W7VA 1WY2A 2BWSA 1WBQA 1JAWA 2BH3A 2BWTA 3PN9A 3OOOA 2IW2A 3CTZA 2BWXA 3CB5A 2ZSGA 1PV9A 3RVAA 4ZNGA 3L7GA 2V3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIT A;  2BWW A;  5E5B A;  4S2T P;  5CDE A;  2BWU A;  5CDL A;  3L24 A;  1M35 A;  2BHB A;  5CNX A;  2BN7 A;  5CIK A;  3QOC A;  3BIP A;  3PEB A;  3OVK A;  1WL9 A;  2BWV A;  2BWY A;  1A16 A;  2BHA A;  3Q6D A;  5FCF A;  2V3X A;  4PV4 A;  2BHC A;  4RGZ 1;  2BHD A;  4B28 A;  4S2R P;  4ZWU A;  1WLR A;  3IG4 A;  5E2C A;  5CDV A;  2OKN A;  2V3Z A;  3BIQ A;  1W2M A;  1N51 A;  2HOW A;  3I7M A;  1CHM A;  5CE6 A;  4ZWP A;  4QR8 A;  3O5V A;  4R60 A;  4S00 A;  4RZY A;  4FKC A;  3CB6 A;  4EGE A;  5FCH A;  3IL0 A;  1WN1 A;  4S01 A;  1WL6 A;  1KP0 A;  4RZZ A;  4ZWO A;  1W7V A;  1WY2 A;  2BWS A;  1WBQ A;  1JAW A;  2BH3 A;  2BWT A;  3PN9 A;  3OOO A;  2IW2 A;  3CTZ A;  2BWX A;  3CB5 A;  2ZSG A;  1PV9 A;  3RVA A;  4ZNG A;  3L7G A;  2V3Y A; 
#chains in the Genus database with same CATH topology
 3BIT A;  2BWW A;  5E5B A;  4S2T P;  5CDE A;  2BWU A;  5CDL A;  3L24 A;  1M35 A;  2BHB A;  5CNX A;  2BN7 A;  5CIK A;  3QOC A;  3BIP A;  3PEB A;  3OVK A;  1WL9 A;  2BWV A;  2BWY A;  1A16 A;  2BHA A;  3Q6D A;  5FCF A;  2V3X A;  4PV4 A;  2BHC A;  4RGZ 1;  2BHD A;  4B28 A;  4S2R P;  4ZWU A;  1WLR A;  3IG4 A;  5E2C A;  5CDV A;  2OKN A;  2V3Z A;  3BIQ A;  1W2M A;  1N51 A;  2HOW A;  3I7M A;  1CHM A;  5CE6 A;  4ZWP A;  4QR8 A;  3O5V A;  4R60 A;  4S00 A;  4RZY A;  4FKC A;  3CB6 A;  4EGE A;  5FCH A;  3IL0 A;  1WN1 A;  4S01 A;  1WL6 A;  1KP0 A;  4RZZ A;  4ZWO A;  1W7V A;  1WY2 A;  2BWS A;  1WBQ A;  1JAW A;  2BH3 A;  2BWT A;  3PN9 A;  3OOO A;  2IW2 A;  3CTZ A;  2BWX A;  3CB5 A;  2ZSG A;  1PV9 A;  3RVA A;  4ZNG A;  3L7G A;  2V3Y A; 
#chains in the Genus database with same CATH homology
 3BIT A;  2BWW A;  5E5B A;  4S2T P;  5CDE A;  2BWU A;  5CDL A;  3L24 A;  1M35 A;  2BHB A;  5CNX A;  2BN7 A;  5CIK A;  3QOC A;  3BIP A;  3PEB A;  3OVK A;  1WL9 A;  2BWV A;  2BWY A;  1A16 A;  2BHA A;  3Q6D A;  5FCF A;  2V3X A;  4PV4 A;  2BHC A;  4RGZ 1;  2BHD A;  4B28 A;  4S2R P;  4ZWU A;  1WLR A;  3IG4 A;  5E2C A;  5CDV A;  2OKN A;  2V3Z A;  3BIQ A;  1W2M A;  1N51 A;  2HOW A;  3I7M A;  1CHM A;  5CE6 A;  4ZWP A;  4QR8 A;  3O5V A;  4R60 A;  4S00 A;  4RZY A;  4FKC A;  3CB6 A;  4EGE A;  5FCH A;  3IL0 A;  1WN1 A;  4S01 A;  1WL6 A;  1KP0 A;  4RZZ A;  4ZWO A;  1W7V A;  1WY2 A;  2BWS A;  1WBQ A;  1JAW A;  2BH3 A;  2BWT A;  3PN9 A;  3OOO A;  2IW2 A;  3CTZ A;  2BWX A;  3CB5 A;  2ZSG A;  1PV9 A;  3RVA A;  4ZNG A;  3L7G A;  2V3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...