3I7MA

N-terminal domain of xaa-pro dipeptidase from lactobacillus brevis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
b'TKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPIERVLALVVFPDQDPFIFAPALEVEVIKETGWQFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEKGQLQVARMEALAAQFSAPSFDLDITSFIEHM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis.
rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3i7mA00
3OOOA 4ZWPA 4S2RP 4RZYA 3I7MA 3L7GA 4QR8A 3BIPA 1WL9A 1WN1A 3CB5A 2V3XA 3BITA 4RZZA 1M35A 1CHMA 5CE6A 3PEBA 2OKNA 1KP0A 2V3ZA 1WL6A 1A16A 3O5VA 4ZWUA 4RGZ1 2V3YA 4B28A 2BHBA 2BWSA 5CDLA 2BN7A 3IL0A 3Q6DA 4ZNGA 1WBQA 4EGEA 1WLRA 5CDVA 5FCHA 3IG4A 1W2MA 2BWYA 4S00A 3OVKA 2BHDA 2ZSGA 4R60A 4PV4A 5CNXA 2BWUA 3L24A 3QOCA 5CDEA 2HOWA 4ZWOA 5CIKA 5E2CA 2BH3A 2IW2A 3BIQA 3PN9A 4S01A 2BWVA 2BHCA 1N51A 1WY2A 4FKCA 5FCFA 3RVAA 1JAWA 2BWTA 3CB6A 4S2TP 2BHAA 2BWWA 2BWXA 1PV9A 1W7VA 3CTZA 5E5BA
chains in the Genus database with same CATH superfamily
3OOOA 4ZWPA 4S2RP 4RZYA 3I7MA 3L7GA 4QR8A 3BIPA 1WL9A 1WN1A 3CB5A 2V3XA 3BITA 4RZZA 1M35A 1CHMA 5CE6A 3PEBA 2OKNA 1KP0A 2V3ZA 1WL6A 1A16A 3O5VA 4ZWUA 4RGZ1 2V3YA 4B28A 2BHBA 2BWSA 5CDLA 2BN7A 3IL0A 3Q6DA 4ZNGA 1WBQA 4EGEA 1WLRA 5CDVA 5FCHA 3IG4A 1W2MA 2BWYA 4S00A 3OVKA 2BHDA 2ZSGA 4R60A 4PV4A 5CNXA 2BWUA 3L24A 3QOCA 5CDEA 2HOWA 4ZWOA 5CIKA 5E2CA 2BH3A 2IW2A 3BIQA 3PN9A 4S01A 2BWVA 2BHCA 1N51A 1WY2A 4FKCA 5FCFA 3RVAA 1JAWA 2BWTA 3CB6A 4S2TP 2BHAA 2BWWA 2BWXA 1PV9A 1W7VA 3CTZA 5E5BA
chains in the Genus database with same CATH topology
3OOOA 4ZWPA 4S2RP 4RZYA 3I7MA 3L7GA 4QR8A 3BIPA 1WL9A 1WN1A 3CB5A 2V3XA 3BITA 4RZZA 1M35A 1CHMA 5CE6A 3PEBA 2OKNA 1KP0A 2V3ZA 1WL6A 1A16A 3O5VA 4ZWUA 4RGZ1 2V3YA 4B28A 2BHBA 2BWSA 5CDLA 2BN7A 3IL0A 3Q6DA 4ZNGA 1WBQA 4EGEA 1WLRA 5CDVA 5FCHA 3IG4A 1W2MA 2BWYA 4S00A 3OVKA 2BHDA 2ZSGA 4R60A 4PV4A 5CNXA 2BWUA 3L24A 3QOCA 5CDEA 2HOWA 4ZWOA 5CIKA 5E2CA 2BH3A 2IW2A 3BIQA 3PN9A 4S01A 2BWVA 2BHCA 1N51A 1WY2A 4FKCA 5FCFA 3RVAA 1JAWA 2BWTA 3CB6A 4S2TP 2BHAA 2BWWA 2BWXA 1PV9A 1W7VA 3CTZA 5E5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOO A;  4ZWP A;  4S2R P;  4RZY A;  3I7M A;  3L7G A;  4QR8 A;  3BIP A;  1WL9 A;  1WN1 A;  3CB5 A;  2V3X A;  3BIT A;  4RZZ A;  1M35 A;  1CHM A;  5CE6 A;  3PEB A;  2OKN A;  1KP0 A;  2V3Z A;  1WL6 A;  1A16 A;  3O5V A;  4ZWU A;  4RGZ 1;  2V3Y A;  4B28 A;  2BHB A;  2BWS A;  5CDL A;  2BN7 A;  3IL0 A;  3Q6D A;  4ZNG A;  1WBQ A;  4EGE A;  1WLR A;  5CDV A;  5FCH A;  3IG4 A;  1W2M A;  2BWY A;  4S00 A;  3OVK A;  2BHD A;  2ZSG A;  4R60 A;  4PV4 A;  5CNX A;  2BWU A;  3L24 A;  3QOC A;  5CDE A;  2HOW A;  4ZWO A;  5CIK A;  5E2C A;  2BH3 A;  2IW2 A;  3BIQ A;  3PN9 A;  4S01 A;  2BWV A;  2BHC A;  1N51 A;  1WY2 A;  4FKC A;  5FCF A;  3RVA A;  1JAW A;  2BWT A;  3CB6 A;  4S2T P;  2BHA A;  2BWW A;  2BWX A;  1PV9 A;  1W7V A;  3CTZ A;  5E5B A; 
#chains in the Genus database with same CATH topology
 3OOO A;  4ZWP A;  4S2R P;  4RZY A;  3I7M A;  3L7G A;  4QR8 A;  3BIP A;  1WL9 A;  1WN1 A;  3CB5 A;  2V3X A;  3BIT A;  4RZZ A;  1M35 A;  1CHM A;  5CE6 A;  3PEB A;  2OKN A;  1KP0 A;  2V3Z A;  1WL6 A;  1A16 A;  3O5V A;  4ZWU A;  4RGZ 1;  2V3Y A;  4B28 A;  2BHB A;  2BWS A;  5CDL A;  2BN7 A;  3IL0 A;  3Q6D A;  4ZNG A;  1WBQ A;  4EGE A;  1WLR A;  5CDV A;  5FCH A;  3IG4 A;  1W2M A;  2BWY A;  4S00 A;  3OVK A;  2BHD A;  2ZSG A;  4R60 A;  4PV4 A;  5CNX A;  2BWU A;  3L24 A;  3QOC A;  5CDE A;  2HOW A;  4ZWO A;  5CIK A;  5E2C A;  2BH3 A;  2IW2 A;  3BIQ A;  3PN9 A;  4S01 A;  2BWV A;  2BHC A;  1N51 A;  1WY2 A;  4FKC A;  5FCF A;  3RVA A;  1JAW A;  2BWT A;  3CB6 A;  4S2T P;  2BHA A;  2BWW A;  2BWX A;  1PV9 A;  1W7V A;  3CTZ A;  5E5B A; 
#chains in the Genus database with same CATH homology
 3OOO A;  4ZWP A;  4S2R P;  4RZY A;  3I7M A;  3L7G A;  4QR8 A;  3BIP A;  1WL9 A;  1WN1 A;  3CB5 A;  2V3X A;  3BIT A;  4RZZ A;  1M35 A;  1CHM A;  5CE6 A;  3PEB A;  2OKN A;  1KP0 A;  2V3Z A;  1WL6 A;  1A16 A;  3O5V A;  4ZWU A;  4RGZ 1;  2V3Y A;  4B28 A;  2BHB A;  2BWS A;  5CDL A;  2BN7 A;  3IL0 A;  3Q6D A;  4ZNG A;  1WBQ A;  4EGE A;  1WLR A;  5CDV A;  5FCH A;  3IG4 A;  1W2M A;  2BWY A;  4S00 A;  3OVK A;  2BHD A;  2ZSG A;  4R60 A;  4PV4 A;  5CNX A;  2BWU A;  3L24 A;  3QOC A;  5CDE A;  2HOW A;  4ZWO A;  5CIK A;  5E2C A;  2BH3 A;  2IW2 A;  3BIQ A;  3PN9 A;  4S01 A;  2BWV A;  2BHC A;  1N51 A;  1WY2 A;  4FKC A;  5FCF A;  3RVA A;  1JAW A;  2BWT A;  3CB6 A;  4S2T P;  2BHA A;  2BWW A;  2BWX A;  1PV9 A;  1W7V A;  3CTZ A;  5E5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...