3I7MA

N-terminal domain of xaa-pro dipeptidase from lactobacillus brevis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
TKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPIERVLALVVFPDQDPFIFAPALEVEVIKETGWQFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEKGQLQVARMEALAAQFSAPSFDLDITSFIEHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis.
rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
molecule keywords Xaa-Pro dipeptidase
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3i7mA00
2ZSGA 3CB6A 5FCHA 3BIPA 3CB5A 4EGEA 4S2TP 1W7VA 1WN1A 2BHDA 3O5VA 4RZYA 4FKCA 5CNXA 2BWUA 5CDVA 4S01A 3IG4A 3PEBA 2BWYA 2V3XA 5CIKA 3BITA 2BWTA 3RVAA 3L7GA 4ZWPA 4B28A 4R60A 4QR8A 3OOOA 5E5BA 2HOWA 2BHCA 1PV9A 5CDLA 1CHMA 5FCFA 1JAWA 1WL9A 2V3YA 3QOCA 1N51A 5CDEA 1WL6A 3CTZA 5E2CA 2BHBA 1A16A 3I7MA 4ZWOA 4PV4A 1WBQA 4ZNGA 1WLRA 3PN9A 2BWWA 2OKNA 3BIQA 2BN7A 3OVKA 1KP0A 4S00A 2V3ZA 4RZZA 1WY2A 2BWVA 2BWXA 1M35A 4RGZ1 4ZWUA 2BWSA 2BH3A 3L24A 3Q6DA 3IL0A 1W2MA 2IW2A 2BHAA 5CE6A 4S2RP
chains in the Genus database with same CATH superfamily
2ZSGA 3CB6A 5FCHA 3BIPA 3CB5A 4EGEA 4S2TP 1W7VA 1WN1A 2BHDA 3O5VA 4RZYA 4FKCA 5CNXA 2BWUA 5CDVA 4S01A 3IG4A 3PEBA 2BWYA 2V3XA 5CIKA 3BITA 2BWTA 3RVAA 3L7GA 4ZWPA 4B28A 4R60A 4QR8A 3OOOA 5E5BA 2HOWA 2BHCA 1PV9A 5CDLA 1CHMA 5FCFA 1JAWA 1WL9A 2V3YA 3QOCA 1N51A 5CDEA 1WL6A 3CTZA 5E2CA 2BHBA 1A16A 3I7MA 4ZWOA 4PV4A 1WBQA 4ZNGA 1WLRA 3PN9A 2BWWA 2OKNA 3BIQA 2BN7A 3OVKA 1KP0A 4S00A 2V3ZA 4RZZA 1WY2A 2BWVA 2BWXA 1M35A 4RGZ1 4ZWUA 2BWSA 2BH3A 3L24A 3Q6DA 3IL0A 1W2MA 2IW2A 2BHAA 5CE6A 4S2RP
chains in the Genus database with same CATH topology
2ZSGA 3CB6A 5FCHA 3BIPA 3CB5A 4EGEA 4S2TP 1W7VA 1WN1A 2BHDA 3O5VA 4RZYA 4FKCA 5CNXA 2BWUA 5CDVA 4S01A 3IG4A 3PEBA 2BWYA 2V3XA 5CIKA 3BITA 2BWTA 3RVAA 3L7GA 4ZWPA 4B28A 4R60A 4QR8A 3OOOA 5E5BA 2HOWA 2BHCA 1PV9A 5CDLA 1CHMA 5FCFA 1JAWA 1WL9A 2V3YA 3QOCA 1N51A 5CDEA 1WL6A 3CTZA 5E2CA 2BHBA 1A16A 3I7MA 4ZWOA 4PV4A 1WBQA 4ZNGA 1WLRA 3PN9A 2BWWA 2OKNA 3BIQA 2BN7A 3OVKA 1KP0A 4S00A 2V3ZA 4RZZA 1WY2A 2BWVA 2BWXA 1M35A 4RGZ1 4ZWUA 2BWSA 2BH3A 3L24A 3Q6DA 3IL0A 1W2MA 2IW2A 2BHAA 5CE6A 4S2RP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  3CB6 A;  5FCH A;  3BIP A;  3CB5 A;  4EGE A;  4S2T P;  1W7V A;  1WN1 A;  2BHD A;  3O5V A;  4RZY A;  4FKC A;  5CNX A;  2BWU A;  5CDV A;  4S01 A;  3IG4 A;  3PEB A;  2BWY A;  2V3X A;  5CIK A;  3BIT A;  2BWT A;  3RVA A;  3L7G A;  4ZWP A;  4B28 A;  4R60 A;  4QR8 A;  3OOO A;  5E5B A;  2HOW A;  2BHC A;  1PV9 A;  5CDL A;  1CHM A;  5FCF A;  1JAW A;  1WL9 A;  2V3Y A;  3QOC A;  1N51 A;  5CDE A;  1WL6 A;  3CTZ A;  5E2C A;  2BHB A;  1A16 A;  3I7M A;  4ZWO A;  4PV4 A;  1WBQ A;  4ZNG A;  1WLR A;  3PN9 A;  2BWW A;  2OKN A;  3BIQ A;  2BN7 A;  3OVK A;  1KP0 A;  4S00 A;  2V3Z A;  4RZZ A;  1WY2 A;  2BWV A;  2BWX A;  1M35 A;  4RGZ 1;  4ZWU A;  2BWS A;  2BH3 A;  3L24 A;  3Q6D A;  3IL0 A;  1W2M A;  2IW2 A;  2BHA A;  5CE6 A;  4S2R P; 
#chains in the Genus database with same CATH topology
 2ZSG A;  3CB6 A;  5FCH A;  3BIP A;  3CB5 A;  4EGE A;  4S2T P;  1W7V A;  1WN1 A;  2BHD A;  3O5V A;  4RZY A;  4FKC A;  5CNX A;  2BWU A;  5CDV A;  4S01 A;  3IG4 A;  3PEB A;  2BWY A;  2V3X A;  5CIK A;  3BIT A;  2BWT A;  3RVA A;  3L7G A;  4ZWP A;  4B28 A;  4R60 A;  4QR8 A;  3OOO A;  5E5B A;  2HOW A;  2BHC A;  1PV9 A;  5CDL A;  1CHM A;  5FCF A;  1JAW A;  1WL9 A;  2V3Y A;  3QOC A;  1N51 A;  5CDE A;  1WL6 A;  3CTZ A;  5E2C A;  2BHB A;  1A16 A;  3I7M A;  4ZWO A;  4PV4 A;  1WBQ A;  4ZNG A;  1WLR A;  3PN9 A;  2BWW A;  2OKN A;  3BIQ A;  2BN7 A;  3OVK A;  1KP0 A;  4S00 A;  2V3Z A;  4RZZ A;  1WY2 A;  2BWV A;  2BWX A;  1M35 A;  4RGZ 1;  4ZWU A;  2BWS A;  2BH3 A;  3L24 A;  3Q6D A;  3IL0 A;  1W2M A;  2IW2 A;  2BHA A;  5CE6 A;  4S2R P; 
#chains in the Genus database with same CATH homology
 2ZSG A;  3CB6 A;  5FCH A;  3BIP A;  3CB5 A;  4EGE A;  4S2T P;  1W7V A;  1WN1 A;  2BHD A;  3O5V A;  4RZY A;  4FKC A;  5CNX A;  2BWU A;  5CDV A;  4S01 A;  3IG4 A;  3PEB A;  2BWY A;  2V3X A;  5CIK A;  3BIT A;  2BWT A;  3RVA A;  3L7G A;  4ZWP A;  4B28 A;  4R60 A;  4QR8 A;  3OOO A;  5E5B A;  2HOW A;  2BHC A;  1PV9 A;  5CDL A;  1CHM A;  5FCF A;  1JAW A;  1WL9 A;  2V3Y A;  3QOC A;  1N51 A;  5CDE A;  1WL6 A;  3CTZ A;  5E2C A;  2BHB A;  1A16 A;  3I7M A;  4ZWO A;  4PV4 A;  1WBQ A;  4ZNG A;  1WLR A;  3PN9 A;  2BWW A;  2OKN A;  3BIQ A;  2BN7 A;  3OVK A;  1KP0 A;  4S00 A;  2V3Z A;  4RZZ A;  1WY2 A;  2BWV A;  2BWX A;  1M35 A;  4RGZ 1;  4ZWU A;  2BWS A;  2BH3 A;  3L24 A;  3Q6D A;  3IL0 A;  1W2M A;  2IW2 A;  2BHA A;  5CE6 A;  4S2R P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...