3I7MA

N-terminal domain of xaa-pro dipeptidase from lactobacillus brevis.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
TKLEQIQQWTAQHHASMTYLSNPKTIEYLTGFGSDPIERVLALVVFPDQDPFIFAPALEVEVIKETGWQFPVIGYLDHENPWAMIADQVKQRHVNPEHVAIEKGQLQVARMEALAAQFSAPSFDLDITSFIEHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title X-ray crystal structure of N-terminal domain of Xaa-Pro dipeptidase from Lactobacillus brevis.
rcsb
source organism Lactobacillus brevis
molecule tags Hydrolase
total genus 39
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3i7mA00
3Q6DA 4S2RP 1WLRA 2BHBA 2BWSA 4ZWPA 3RVAA 4S01A 1PV9A 2BWTA 4PV4A 3IG4A 1WL6A 2BN7A 1WBQA 5E5BA 5E2CA 4RZZA 4ZWOA 5FCFA 2IW2A 5CDVA 5CE6A 5CDLA 3L24A 4ZWUA 5CIKA 4R60A 4RGZ1 3OOOA 1JAWA 3O5VA 4ZNGA 1KP0A 2BHAA 4RZYA 3OVKA 4S00A 2HOWA 3PEBA 3PN9A 3L7GA 3CTZA 3QOCA 2BWXA 1W7VA 3BITA 1CHMA 2BWVA 1M35A 4EGEA 2ZSGA 2BWWA 3CB5A 4S2TP 3BIQA 3I7MA 5CDEA 2BHDA 2BWUA 2BH3A 4QR8A 4B28A 5FCHA 2BWYA 1A16A 1WY2A 4FKCA 2BHCA 3CB6A 2OKNA 3BIPA 3IL0A 1WN1A 2V3ZA 1W2MA 5CNXA 1N51A 2V3XA 1WL9A 2V3YA
chains in the Genus database with same CATH superfamily
3Q6DA 4S2RP 1WLRA 2BHBA 2BWSA 4ZWPA 3RVAA 4S01A 1PV9A 2BWTA 4PV4A 3IG4A 1WL6A 2BN7A 1WBQA 5E5BA 5E2CA 4RZZA 4ZWOA 5FCFA 2IW2A 5CDVA 5CE6A 5CDLA 3L24A 4ZWUA 5CIKA 4R60A 4RGZ1 3OOOA 1JAWA 3O5VA 4ZNGA 1KP0A 2BHAA 4RZYA 3OVKA 4S00A 2HOWA 3PEBA 3PN9A 3L7GA 3CTZA 3QOCA 2BWXA 1W7VA 3BITA 1CHMA 2BWVA 1M35A 4EGEA 2ZSGA 2BWWA 3CB5A 4S2TP 3BIQA 3I7MA 5CDEA 2BHDA 2BWUA 2BH3A 4QR8A 4B28A 5FCHA 2BWYA 1A16A 1WY2A 4FKCA 2BHCA 3CB6A 2OKNA 3BIPA 3IL0A 1WN1A 2V3ZA 1W2MA 5CNXA 1N51A 2V3XA 1WL9A 2V3YA
chains in the Genus database with same CATH topology
3Q6DA 4S2RP 1WLRA 2BHBA 2BWSA 4ZWPA 3RVAA 4S01A 1PV9A 2BWTA 4PV4A 3IG4A 1WL6A 2BN7A 1WBQA 5E5BA 5E2CA 4RZZA 4ZWOA 5FCFA 2IW2A 5CDVA 5CE6A 5CDLA 3L24A 4ZWUA 5CIKA 4R60A 4RGZ1 3OOOA 1JAWA 3O5VA 4ZNGA 1KP0A 2BHAA 4RZYA 3OVKA 4S00A 2HOWA 3PEBA 3PN9A 3L7GA 3CTZA 3QOCA 2BWXA 1W7VA 3BITA 1CHMA 2BWVA 1M35A 4EGEA 2ZSGA 2BWWA 3CB5A 4S2TP 3BIQA 3I7MA 5CDEA 2BHDA 2BWUA 2BH3A 4QR8A 4B28A 5FCHA 2BWYA 1A16A 1WY2A 4FKCA 2BHCA 3CB6A 2OKNA 3BIPA 3IL0A 1WN1A 2V3ZA 1W2MA 5CNXA 1N51A 2V3XA 1WL9A 2V3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6D A;  4S2R P;  1WLR A;  2BHB A;  2BWS A;  4ZWP A;  3RVA A;  4S01 A;  1PV9 A;  2BWT A;  4PV4 A;  3IG4 A;  1WL6 A;  2BN7 A;  1WBQ A;  5E5B A;  5E2C A;  4RZZ A;  4ZWO A;  5FCF A;  2IW2 A;  5CDV A;  5CE6 A;  5CDL A;  3L24 A;  4ZWU A;  5CIK A;  4R60 A;  4RGZ 1;  3OOO A;  1JAW A;  3O5V A;  4ZNG A;  1KP0 A;  2BHA A;  4RZY A;  3OVK A;  4S00 A;  2HOW A;  3PEB A;  3PN9 A;  3L7G A;  3CTZ A;  3QOC A;  2BWX A;  1W7V A;  3BIT A;  1CHM A;  2BWV A;  1M35 A;  4EGE A;  2ZSG A;  2BWW A;  3CB5 A;  4S2T P;  3BIQ A;  3I7M A;  5CDE A;  2BHD A;  2BWU A;  2BH3 A;  4QR8 A;  4B28 A;  5FCH A;  2BWY A;  1A16 A;  1WY2 A;  4FKC A;  2BHC A;  3CB6 A;  2OKN A;  3BIP A;  3IL0 A;  1WN1 A;  2V3Z A;  1W2M A;  5CNX A;  1N51 A;  2V3X A;  1WL9 A;  2V3Y A; 
#chains in the Genus database with same CATH topology
 3Q6D A;  4S2R P;  1WLR A;  2BHB A;  2BWS A;  4ZWP A;  3RVA A;  4S01 A;  1PV9 A;  2BWT A;  4PV4 A;  3IG4 A;  1WL6 A;  2BN7 A;  1WBQ A;  5E5B A;  5E2C A;  4RZZ A;  4ZWO A;  5FCF A;  2IW2 A;  5CDV A;  5CE6 A;  5CDL A;  3L24 A;  4ZWU A;  5CIK A;  4R60 A;  4RGZ 1;  3OOO A;  1JAW A;  3O5V A;  4ZNG A;  1KP0 A;  2BHA A;  4RZY A;  3OVK A;  4S00 A;  2HOW A;  3PEB A;  3PN9 A;  3L7G A;  3CTZ A;  3QOC A;  2BWX A;  1W7V A;  3BIT A;  1CHM A;  2BWV A;  1M35 A;  4EGE A;  2ZSG A;  2BWW A;  3CB5 A;  4S2T P;  3BIQ A;  3I7M A;  5CDE A;  2BHD A;  2BWU A;  2BH3 A;  4QR8 A;  4B28 A;  5FCH A;  2BWY A;  1A16 A;  1WY2 A;  4FKC A;  2BHC A;  3CB6 A;  2OKN A;  3BIP A;  3IL0 A;  1WN1 A;  2V3Z A;  1W2M A;  5CNX A;  1N51 A;  2V3X A;  1WL9 A;  2V3Y A; 
#chains in the Genus database with same CATH homology
 3Q6D A;  4S2R P;  1WLR A;  2BHB A;  2BWS A;  4ZWP A;  3RVA A;  4S01 A;  1PV9 A;  2BWT A;  4PV4 A;  3IG4 A;  1WL6 A;  2BN7 A;  1WBQ A;  5E5B A;  5E2C A;  4RZZ A;  4ZWO A;  5FCF A;  2IW2 A;  5CDV A;  5CE6 A;  5CDL A;  3L24 A;  4ZWU A;  5CIK A;  4R60 A;  4RGZ 1;  3OOO A;  1JAW A;  3O5V A;  4ZNG A;  1KP0 A;  2BHA A;  4RZY A;  3OVK A;  4S00 A;  2HOW A;  3PEB A;  3PN9 A;  3L7G A;  3CTZ A;  3QOC A;  2BWX A;  1W7V A;  3BIT A;  1CHM A;  2BWV A;  1M35 A;  4EGE A;  2ZSG A;  2BWW A;  3CB5 A;  4S2T P;  3BIQ A;  3I7M A;  5CDE A;  2BHD A;  2BWU A;  2BH3 A;  4QR8 A;  4B28 A;  5FCH A;  2BWY A;  1A16 A;  1WY2 A;  4FKC A;  2BHC A;  3CB6 A;  2OKN A;  3BIP A;  3IL0 A;  1WN1 A;  2V3Z A;  1W2M A;  5CNX A;  1N51 A;  2V3X A;  1WL9 A;  2V3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...