3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
4RGZ1 1WL6A 2HOWA 3BIQA 3OOOA 4S2TP 5CIKA 5FCFA 3QOCA 4ZWOA 3RVAA 4EGEA 3BITA 2BN7A 2V3ZA 3PN9A 1N51A 3BIPA 5CDEA 3L7GA 2OKNA 4B28A 2V3XA 1A16A 4PV4A 1WY2A 2BWYA 5CDVA 1WL9A 2BHCA 5CDLA 1W7VA 1PV9A 4S00A 3OVKA 2BWXA 5CE6A 3L24A 2BWTA 1CHMA 1WBQA 3PEBA 4FKCA 2BWVA 5E2CA 2BWWA 3O5VA 2BWUA 1WLRA 4S2RP 2BHBA 5CNXA 4R60A 1JAWA 2BHAA 1M35A 3IG4A 3IL0A 2BH3A 2IW2A 4ZWUA 2BWSA 4ZWPA 5FCHA 3CB6A 1KP0A 4RZZA 2ZSGA 4ZNGA 1W2MA 2BHDA 3I7MA 3CB5A 5E5BA 4S01A 4QR8A 3Q6DA 1WN1A 2V3YA 3CTZA 4RZYA
chains in the Genus database with same CATH superfamily
4RGZ1 1WL6A 2HOWA 3BIQA 3OOOA 4S2TP 5CIKA 5FCFA 3QOCA 4ZWOA 3RVAA 4EGEA 3BITA 2BN7A 2V3ZA 3PN9A 1N51A 3BIPA 5CDEA 3L7GA 2OKNA 4B28A 2V3XA 1A16A 4PV4A 1WY2A 2BWYA 5CDVA 1WL9A 2BHCA 5CDLA 1W7VA 1PV9A 4S00A 3OVKA 2BWXA 5CE6A 3L24A 2BWTA 1CHMA 1WBQA 3PEBA 4FKCA 2BWVA 5E2CA 2BWWA 3O5VA 2BWUA 1WLRA 4S2RP 2BHBA 5CNXA 4R60A 1JAWA 2BHAA 1M35A 3IG4A 3IL0A 2BH3A 2IW2A 4ZWUA 2BWSA 4ZWPA 5FCHA 3CB6A 1KP0A 4RZZA 2ZSGA 4ZNGA 1W2MA 2BHDA 3I7MA 3CB5A 5E5BA 4S01A 4QR8A 3Q6DA 1WN1A 2V3YA 3CTZA 4RZYA
chains in the Genus database with same CATH topology
4RGZ1 1WL6A 2HOWA 3BIQA 3OOOA 4S2TP 5CIKA 5FCFA 3QOCA 4ZWOA 3RVAA 4EGEA 3BITA 2BN7A 2V3ZA 3PN9A 1N51A 3BIPA 5CDEA 3L7GA 2OKNA 4B28A 2V3XA 1A16A 4PV4A 1WY2A 2BWYA 5CDVA 1WL9A 2BHCA 5CDLA 1W7VA 1PV9A 4S00A 3OVKA 2BWXA 5CE6A 3L24A 2BWTA 1CHMA 1WBQA 3PEBA 4FKCA 2BWVA 5E2CA 2BWWA 3O5VA 2BWUA 1WLRA 4S2RP 2BHBA 5CNXA 4R60A 1JAWA 2BHAA 1M35A 3IG4A 3IL0A 2BH3A 2IW2A 4ZWUA 2BWSA 4ZWPA 5FCHA 3CB6A 1KP0A 4RZZA 2ZSGA 4ZNGA 1W2MA 2BHDA 3I7MA 3CB5A 5E5BA 4S01A 4QR8A 3Q6DA 1WN1A 2V3YA 3CTZA 4RZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGZ 1;  1WL6 A;  2HOW A;  3BIQ A;  3OOO A;  4S2T P;  5CIK A;  5FCF A;  3QOC A;  4ZWO A;  3RVA A;  4EGE A;  3BIT A;  2BN7 A;  2V3Z A;  3PN9 A;  1N51 A;  3BIP A;  5CDE A;  3L7G A;  2OKN A;  4B28 A;  2V3X A;  1A16 A;  4PV4 A;  1WY2 A;  2BWY A;  5CDV A;  1WL9 A;  2BHC A;  5CDL A;  1W7V A;  1PV9 A;  4S00 A;  3OVK A;  2BWX A;  5CE6 A;  3L24 A;  2BWT A;  1CHM A;  1WBQ A;  3PEB A;  4FKC A;  2BWV A;  5E2C A;  2BWW A;  3O5V A;  2BWU A;  1WLR A;  4S2R P;  2BHB A;  5CNX A;  4R60 A;  1JAW A;  2BHA A;  1M35 A;  3IG4 A;  3IL0 A;  2BH3 A;  2IW2 A;  4ZWU A;  2BWS A;  4ZWP A;  5FCH A;  3CB6 A;  1KP0 A;  4RZZ A;  2ZSG A;  4ZNG A;  1W2M A;  2BHD A;  3I7M A;  3CB5 A;  5E5B A;  4S01 A;  4QR8 A;  3Q6D A;  1WN1 A;  2V3Y A;  3CTZ A;  4RZY A; 
#chains in the Genus database with same CATH topology
 4RGZ 1;  1WL6 A;  2HOW A;  3BIQ A;  3OOO A;  4S2T P;  5CIK A;  5FCF A;  3QOC A;  4ZWO A;  3RVA A;  4EGE A;  3BIT A;  2BN7 A;  2V3Z A;  3PN9 A;  1N51 A;  3BIP A;  5CDE A;  3L7G A;  2OKN A;  4B28 A;  2V3X A;  1A16 A;  4PV4 A;  1WY2 A;  2BWY A;  5CDV A;  1WL9 A;  2BHC A;  5CDL A;  1W7V A;  1PV9 A;  4S00 A;  3OVK A;  2BWX A;  5CE6 A;  3L24 A;  2BWT A;  1CHM A;  1WBQ A;  3PEB A;  4FKC A;  2BWV A;  5E2C A;  2BWW A;  3O5V A;  2BWU A;  1WLR A;  4S2R P;  2BHB A;  5CNX A;  4R60 A;  1JAW A;  2BHA A;  1M35 A;  3IG4 A;  3IL0 A;  2BH3 A;  2IW2 A;  4ZWU A;  2BWS A;  4ZWP A;  5FCH A;  3CB6 A;  1KP0 A;  4RZZ A;  2ZSG A;  4ZNG A;  1W2M A;  2BHD A;  3I7M A;  3CB5 A;  5E5B A;  4S01 A;  4QR8 A;  3Q6D A;  1WN1 A;  2V3Y A;  3CTZ A;  4RZY A; 
#chains in the Genus database with same CATH homology
 4RGZ 1;  1WL6 A;  2HOW A;  3BIQ A;  3OOO A;  4S2T P;  5CIK A;  5FCF A;  3QOC A;  4ZWO A;  3RVA A;  4EGE A;  3BIT A;  2BN7 A;  2V3Z A;  3PN9 A;  1N51 A;  3BIP A;  5CDE A;  3L7G A;  2OKN A;  4B28 A;  2V3X A;  1A16 A;  4PV4 A;  1WY2 A;  2BWY A;  5CDV A;  1WL9 A;  2BHC A;  5CDL A;  1W7V A;  1PV9 A;  4S00 A;  3OVK A;  2BWX A;  5CE6 A;  3L24 A;  2BWT A;  1CHM A;  1WBQ A;  3PEB A;  4FKC A;  2BWV A;  5E2C A;  2BWW A;  3O5V A;  2BWU A;  1WLR A;  4S2R P;  2BHB A;  5CNX A;  4R60 A;  1JAW A;  2BHA A;  1M35 A;  3IG4 A;  3IL0 A;  2BH3 A;  2IW2 A;  4ZWU A;  2BWS A;  4ZWP A;  5FCH A;  3CB6 A;  1KP0 A;  4RZZ A;  2ZSG A;  4ZNG A;  1W2M A;  2BHD A;  3I7M A;  3CB5 A;  5E5B A;  4S01 A;  4QR8 A;  3Q6D A;  1WN1 A;  2V3Y A;  3CTZ A;  4RZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...