3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
b'AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
4QR8A 5FCHA 1M35A 3O5VA 2BWUA 4S2RP 4RGZ1 5E5BA 5FCFA 3PN9A 2BWYA 1WLRA 2ZSGA 2BHAA 2BWVA 5E2CA 2IW2A 2BHBA 2BWSA 2V3ZA 4ZWOA 3BIQA 4ZWPA 2BH3A 4B28A 4PV4A 1CHMA 4S2TP 2BHCA 4RZYA 1KP0A 1PV9A 4ZWUA 1WBQA 3IL0A 3OOOA 1WY2A 3BIPA 3QOCA 2BWXA 1WN1A 5CDVA 1W7VA 5CDEA 3BITA 2HOWA 4FKCA 4S00A 2BWWA 4EGEA 1W2MA 1N51A 2V3XA 3IG4A 2BWTA 2V3YA 4S01A 1JAWA 5CE6A 1A16A 2BN7A 3I7MA 1WL6A 3PEBA 1WL9A 3L24A 3OVKA 3Q6DA 3L7GA 5CNXA 2BHDA 3CB6A 3CTZA 5CDLA 3CB5A 4R60A 5CIKA 4RZZA 2OKNA 4ZNGA 3RVAA
chains in the Genus database with same CATH superfamily
4QR8A 5FCHA 1M35A 3O5VA 2BWUA 4S2RP 4RGZ1 5E5BA 5FCFA 3PN9A 2BWYA 1WLRA 2ZSGA 2BHAA 2BWVA 5E2CA 2IW2A 2BHBA 2BWSA 2V3ZA 4ZWOA 3BIQA 4ZWPA 2BH3A 4B28A 4PV4A 1CHMA 4S2TP 2BHCA 4RZYA 1KP0A 1PV9A 4ZWUA 1WBQA 3IL0A 3OOOA 1WY2A 3BIPA 3QOCA 2BWXA 1WN1A 5CDVA 1W7VA 5CDEA 3BITA 2HOWA 4FKCA 4S00A 2BWWA 4EGEA 1W2MA 1N51A 2V3XA 3IG4A 2BWTA 2V3YA 4S01A 1JAWA 5CE6A 1A16A 2BN7A 3I7MA 1WL6A 3PEBA 1WL9A 3L24A 3OVKA 3Q6DA 3L7GA 5CNXA 2BHDA 3CB6A 3CTZA 5CDLA 3CB5A 4R60A 5CIKA 4RZZA 2OKNA 4ZNGA 3RVAA
chains in the Genus database with same CATH topology
4QR8A 5FCHA 1M35A 3O5VA 2BWUA 4S2RP 4RGZ1 5E5BA 5FCFA 3PN9A 2BWYA 1WLRA 2ZSGA 2BHAA 2BWVA 5E2CA 2IW2A 2BHBA 2BWSA 2V3ZA 4ZWOA 3BIQA 4ZWPA 2BH3A 4B28A 4PV4A 1CHMA 4S2TP 2BHCA 4RZYA 1KP0A 1PV9A 4ZWUA 1WBQA 3IL0A 3OOOA 1WY2A 3BIPA 3QOCA 2BWXA 1WN1A 5CDVA 1W7VA 5CDEA 3BITA 2HOWA 4FKCA 4S00A 2BWWA 4EGEA 1W2MA 1N51A 2V3XA 3IG4A 2BWTA 2V3YA 4S01A 1JAWA 5CE6A 1A16A 2BN7A 3I7MA 1WL6A 3PEBA 1WL9A 3L24A 3OVKA 3Q6DA 3L7GA 5CNXA 2BHDA 3CB6A 3CTZA 5CDLA 3CB5A 4R60A 5CIKA 4RZZA 2OKNA 4ZNGA 3RVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR8 A;  5FCH A;  1M35 A;  3O5V A;  2BWU A;  4S2R P;  4RGZ 1;  5E5B A;  5FCF A;  3PN9 A;  2BWY A;  1WLR A;  2ZSG A;  2BHA A;  2BWV A;  5E2C A;  2IW2 A;  2BHB A;  2BWS A;  2V3Z A;  4ZWO A;  3BIQ A;  4ZWP A;  2BH3 A;  4B28 A;  4PV4 A;  1CHM A;  4S2T P;  2BHC A;  4RZY A;  1KP0 A;  1PV9 A;  4ZWU A;  1WBQ A;  3IL0 A;  3OOO A;  1WY2 A;  3BIP A;  3QOC A;  2BWX A;  1WN1 A;  5CDV A;  1W7V A;  5CDE A;  3BIT A;  2HOW A;  4FKC A;  4S00 A;  2BWW A;  4EGE A;  1W2M A;  1N51 A;  2V3X A;  3IG4 A;  2BWT A;  2V3Y A;  4S01 A;  1JAW A;  5CE6 A;  1A16 A;  2BN7 A;  3I7M A;  1WL6 A;  3PEB A;  1WL9 A;  3L24 A;  3OVK A;  3Q6D A;  3L7G A;  5CNX A;  2BHD A;  3CB6 A;  3CTZ A;  5CDL A;  3CB5 A;  4R60 A;  5CIK A;  4RZZ A;  2OKN A;  4ZNG A;  3RVA A; 
#chains in the Genus database with same CATH topology
 4QR8 A;  5FCH A;  1M35 A;  3O5V A;  2BWU A;  4S2R P;  4RGZ 1;  5E5B A;  5FCF A;  3PN9 A;  2BWY A;  1WLR A;  2ZSG A;  2BHA A;  2BWV A;  5E2C A;  2IW2 A;  2BHB A;  2BWS A;  2V3Z A;  4ZWO A;  3BIQ A;  4ZWP A;  2BH3 A;  4B28 A;  4PV4 A;  1CHM A;  4S2T P;  2BHC A;  4RZY A;  1KP0 A;  1PV9 A;  4ZWU A;  1WBQ A;  3IL0 A;  3OOO A;  1WY2 A;  3BIP A;  3QOC A;  2BWX A;  1WN1 A;  5CDV A;  1W7V A;  5CDE A;  3BIT A;  2HOW A;  4FKC A;  4S00 A;  2BWW A;  4EGE A;  1W2M A;  1N51 A;  2V3X A;  3IG4 A;  2BWT A;  2V3Y A;  4S01 A;  1JAW A;  5CE6 A;  1A16 A;  2BN7 A;  3I7M A;  1WL6 A;  3PEB A;  1WL9 A;  3L24 A;  3OVK A;  3Q6D A;  3L7G A;  5CNX A;  2BHD A;  3CB6 A;  3CTZ A;  5CDL A;  3CB5 A;  4R60 A;  5CIK A;  4RZZ A;  2OKN A;  4ZNG A;  3RVA A; 
#chains in the Genus database with same CATH homology
 4QR8 A;  5FCH A;  1M35 A;  3O5V A;  2BWU A;  4S2R P;  4RGZ 1;  5E5B A;  5FCF A;  3PN9 A;  2BWY A;  1WLR A;  2ZSG A;  2BHA A;  2BWV A;  5E2C A;  2IW2 A;  2BHB A;  2BWS A;  2V3Z A;  4ZWO A;  3BIQ A;  4ZWP A;  2BH3 A;  4B28 A;  4PV4 A;  1CHM A;  4S2T P;  2BHC A;  4RZY A;  1KP0 A;  1PV9 A;  4ZWU A;  1WBQ A;  3IL0 A;  3OOO A;  1WY2 A;  3BIP A;  3QOC A;  2BWX A;  1WN1 A;  5CDV A;  1W7V A;  5CDE A;  3BIT A;  2HOW A;  4FKC A;  4S00 A;  2BWW A;  4EGE A;  1W2M A;  1N51 A;  2V3X A;  3IG4 A;  2BWT A;  2V3Y A;  4S01 A;  1JAW A;  5CE6 A;  1A16 A;  2BN7 A;  3I7M A;  1WL6 A;  3PEB A;  1WL9 A;  3L24 A;  3OVK A;  3Q6D A;  3L7G A;  5CNX A;  2BHD A;  3CB6 A;  3CTZ A;  5CDL A;  3CB5 A;  4R60 A;  5CIK A;  4RZZ A;  2OKN A;  4ZNG A;  3RVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...