3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proline dipeptidase
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
4R60A 1WL9A 2BWSA 4ZWPA 1WBQA 5FCFA 4FKCA 1W2MA 4RGZ1 4S2TP 3L24A 4S00A 3PEBA 2BWXA 3O5VA 2BWVA 3RVAA 5CDVA 4S01A 1CHMA 2ZSGA 3CTZA 3BIPA 1WL6A 2BWYA 3BITA 3IG4A 1PV9A 1KP0A 5FCHA 3PN9A 3BIQA 4S2RP 1JAWA 4RZYA 2BHCA 1WN1A 4ZNGA 5CIKA 1M35A 2V3ZA 3QOCA 2BH3A 4B28A 2BHAA 2V3XA 4EGEA 4ZWUA 2HOWA 1WY2A 2IW2A 2V3YA 1A16A 3I7MA 2BHDA 1N51A 5E5BA 5CE6A 1W7VA 3L7GA 3IL0A 5CNXA 4ZWOA 2BHBA 3OOOA 3CB5A 2OKNA 5CDLA 4PV4A 3Q6DA 3OVKA 2BWUA 4RZZA 2BWTA 5E2CA 4QR8A 1WLRA 5CDEA 2BN7A 3CB6A 2BWWA
chains in the Genus database with same CATH superfamily
4R60A 1WL9A 2BWSA 4ZWPA 1WBQA 5FCFA 4FKCA 1W2MA 4RGZ1 4S2TP 3L24A 4S00A 3PEBA 2BWXA 3O5VA 2BWVA 3RVAA 5CDVA 4S01A 1CHMA 2ZSGA 3CTZA 3BIPA 1WL6A 2BWYA 3BITA 3IG4A 1PV9A 1KP0A 5FCHA 3PN9A 3BIQA 4S2RP 1JAWA 4RZYA 2BHCA 1WN1A 4ZNGA 5CIKA 1M35A 2V3ZA 3QOCA 2BH3A 4B28A 2BHAA 2V3XA 4EGEA 4ZWUA 2HOWA 1WY2A 2IW2A 2V3YA 1A16A 3I7MA 2BHDA 1N51A 5E5BA 5CE6A 1W7VA 3L7GA 3IL0A 5CNXA 4ZWOA 2BHBA 3OOOA 3CB5A 2OKNA 5CDLA 4PV4A 3Q6DA 3OVKA 2BWUA 4RZZA 2BWTA 5E2CA 4QR8A 1WLRA 5CDEA 2BN7A 3CB6A 2BWWA
chains in the Genus database with same CATH topology
4R60A 1WL9A 2BWSA 4ZWPA 1WBQA 5FCFA 4FKCA 1W2MA 4RGZ1 4S2TP 3L24A 4S00A 3PEBA 2BWXA 3O5VA 2BWVA 3RVAA 5CDVA 4S01A 1CHMA 2ZSGA 3CTZA 3BIPA 1WL6A 2BWYA 3BITA 3IG4A 1PV9A 1KP0A 5FCHA 3PN9A 3BIQA 4S2RP 1JAWA 4RZYA 2BHCA 1WN1A 4ZNGA 5CIKA 1M35A 2V3ZA 3QOCA 2BH3A 4B28A 2BHAA 2V3XA 4EGEA 4ZWUA 2HOWA 1WY2A 2IW2A 2V3YA 1A16A 3I7MA 2BHDA 1N51A 5E5BA 5CE6A 1W7VA 3L7GA 3IL0A 5CNXA 4ZWOA 2BHBA 3OOOA 3CB5A 2OKNA 5CDLA 4PV4A 3Q6DA 3OVKA 2BWUA 4RZZA 2BWTA 5E2CA 4QR8A 1WLRA 5CDEA 2BN7A 3CB6A 2BWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  1WL9 A;  2BWS A;  4ZWP A;  1WBQ A;  5FCF A;  4FKC A;  1W2M A;  4RGZ 1;  4S2T P;  3L24 A;  4S00 A;  3PEB A;  2BWX A;  3O5V A;  2BWV A;  3RVA A;  5CDV A;  4S01 A;  1CHM A;  2ZSG A;  3CTZ A;  3BIP A;  1WL6 A;  2BWY A;  3BIT A;  3IG4 A;  1PV9 A;  1KP0 A;  5FCH A;  3PN9 A;  3BIQ A;  4S2R P;  1JAW A;  4RZY A;  2BHC A;  1WN1 A;  4ZNG A;  5CIK A;  1M35 A;  2V3Z A;  3QOC A;  2BH3 A;  4B28 A;  2BHA A;  2V3X A;  4EGE A;  4ZWU A;  2HOW A;  1WY2 A;  2IW2 A;  2V3Y A;  1A16 A;  3I7M A;  2BHD A;  1N51 A;  5E5B A;  5CE6 A;  1W7V A;  3L7G A;  3IL0 A;  5CNX A;  4ZWO A;  2BHB A;  3OOO A;  3CB5 A;  2OKN A;  5CDL A;  4PV4 A;  3Q6D A;  3OVK A;  2BWU A;  4RZZ A;  2BWT A;  5E2C A;  4QR8 A;  1WLR A;  5CDE A;  2BN7 A;  3CB6 A;  2BWW A; 
#chains in the Genus database with same CATH topology
 4R60 A;  1WL9 A;  2BWS A;  4ZWP A;  1WBQ A;  5FCF A;  4FKC A;  1W2M A;  4RGZ 1;  4S2T P;  3L24 A;  4S00 A;  3PEB A;  2BWX A;  3O5V A;  2BWV A;  3RVA A;  5CDV A;  4S01 A;  1CHM A;  2ZSG A;  3CTZ A;  3BIP A;  1WL6 A;  2BWY A;  3BIT A;  3IG4 A;  1PV9 A;  1KP0 A;  5FCH A;  3PN9 A;  3BIQ A;  4S2R P;  1JAW A;  4RZY A;  2BHC A;  1WN1 A;  4ZNG A;  5CIK A;  1M35 A;  2V3Z A;  3QOC A;  2BH3 A;  4B28 A;  2BHA A;  2V3X A;  4EGE A;  4ZWU A;  2HOW A;  1WY2 A;  2IW2 A;  2V3Y A;  1A16 A;  3I7M A;  2BHD A;  1N51 A;  5E5B A;  5CE6 A;  1W7V A;  3L7G A;  3IL0 A;  5CNX A;  4ZWO A;  2BHB A;  3OOO A;  3CB5 A;  2OKN A;  5CDL A;  4PV4 A;  3Q6D A;  3OVK A;  2BWU A;  4RZZ A;  2BWT A;  5E2C A;  4QR8 A;  1WLR A;  5CDE A;  2BN7 A;  3CB6 A;  2BWW A; 
#chains in the Genus database with same CATH homology
 4R60 A;  1WL9 A;  2BWS A;  4ZWP A;  1WBQ A;  5FCF A;  4FKC A;  1W2M A;  4RGZ 1;  4S2T P;  3L24 A;  4S00 A;  3PEB A;  2BWX A;  3O5V A;  2BWV A;  3RVA A;  5CDV A;  4S01 A;  1CHM A;  2ZSG A;  3CTZ A;  3BIP A;  1WL6 A;  2BWY A;  3BIT A;  3IG4 A;  1PV9 A;  1KP0 A;  5FCH A;  3PN9 A;  3BIQ A;  4S2R P;  1JAW A;  4RZY A;  2BHC A;  1WN1 A;  4ZNG A;  5CIK A;  1M35 A;  2V3Z A;  3QOC A;  2BH3 A;  4B28 A;  2BHA A;  2V3X A;  4EGE A;  4ZWU A;  2HOW A;  1WY2 A;  2IW2 A;  2V3Y A;  1A16 A;  3I7M A;  2BHD A;  1N51 A;  5E5B A;  5CE6 A;  1W7V A;  3L7G A;  3IL0 A;  5CNX A;  4ZWO A;  2BHB A;  3OOO A;  3CB5 A;  2OKN A;  5CDL A;  4PV4 A;  3Q6D A;  3OVK A;  2BWU A;  4RZZ A;  2BWT A;  5E2C A;  4QR8 A;  1WLR A;  5CDE A;  2BN7 A;  3CB6 A;  2BWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...