3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
4RGZ1 2HOWA 2V3XA 2BHBA 4S2RP 4S00A 1WL9A 2BWWA 2V3ZA 3CB6A 4FKCA 1WBQA 3CB5A 2BWTA 1M35A 4RZYA 1A16A 1WL6A 4R60A 2BHCA 1WN1A 4EGEA 2BHAA 2BWYA 1JAWA 3OVKA 5CDVA 1N51A 5CE6A 4B28A 3I7MA 3BITA 4ZWOA 4S01A 5CIKA 1PV9A 2BH3A 2BWVA 3BIQA 1CHMA 5CDEA 3O5VA 3IL0A 2OKNA 2IW2A 2BWXA 1W7VA 2V3YA 3QOCA 3Q6DA 1WLRA 4ZNGA 3L24A 2BHDA 3PEBA 5CDLA 5E5BA 4RZZA 1KP0A 3L7GA 2BN7A 5CNXA 5FCFA 3RVAA 1WY2A 3CTZA 4PV4A 3IG4A 4ZWPA 5FCHA 2BWUA 2ZSGA 4S2TP 3BIPA 3OOOA 2BWSA 4QR8A 4ZWUA 1W2MA 5E2CA 3PN9A
chains in the Genus database with same CATH superfamily
4RGZ1 2HOWA 2V3XA 2BHBA 4S2RP 4S00A 1WL9A 2BWWA 2V3ZA 3CB6A 4FKCA 1WBQA 3CB5A 2BWTA 1M35A 4RZYA 1A16A 1WL6A 4R60A 2BHCA 1WN1A 4EGEA 2BHAA 2BWYA 1JAWA 3OVKA 5CDVA 1N51A 5CE6A 4B28A 3I7MA 3BITA 4ZWOA 4S01A 5CIKA 1PV9A 2BH3A 2BWVA 3BIQA 1CHMA 5CDEA 3O5VA 3IL0A 2OKNA 2IW2A 2BWXA 1W7VA 2V3YA 3QOCA 3Q6DA 1WLRA 4ZNGA 3L24A 2BHDA 3PEBA 5CDLA 5E5BA 4RZZA 1KP0A 3L7GA 2BN7A 5CNXA 5FCFA 3RVAA 1WY2A 3CTZA 4PV4A 3IG4A 4ZWPA 5FCHA 2BWUA 2ZSGA 4S2TP 3BIPA 3OOOA 2BWSA 4QR8A 4ZWUA 1W2MA 5E2CA 3PN9A
chains in the Genus database with same CATH topology
4RGZ1 2HOWA 2V3XA 2BHBA 4S2RP 4S00A 1WL9A 2BWWA 2V3ZA 3CB6A 4FKCA 1WBQA 3CB5A 2BWTA 1M35A 4RZYA 1A16A 1WL6A 4R60A 2BHCA 1WN1A 4EGEA 2BHAA 2BWYA 1JAWA 3OVKA 5CDVA 1N51A 5CE6A 4B28A 3I7MA 3BITA 4ZWOA 4S01A 5CIKA 1PV9A 2BH3A 2BWVA 3BIQA 1CHMA 5CDEA 3O5VA 3IL0A 2OKNA 2IW2A 2BWXA 1W7VA 2V3YA 3QOCA 3Q6DA 1WLRA 4ZNGA 3L24A 2BHDA 3PEBA 5CDLA 5E5BA 4RZZA 1KP0A 3L7GA 2BN7A 5CNXA 5FCFA 3RVAA 1WY2A 3CTZA 4PV4A 3IG4A 4ZWPA 5FCHA 2BWUA 2ZSGA 4S2TP 3BIPA 3OOOA 2BWSA 4QR8A 4ZWUA 1W2MA 5E2CA 3PN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGZ 1;  2HOW A;  2V3X A;  2BHB A;  4S2R P;  4S00 A;  1WL9 A;  2BWW A;  2V3Z A;  3CB6 A;  4FKC A;  1WBQ A;  3CB5 A;  2BWT A;  1M35 A;  4RZY A;  1A16 A;  1WL6 A;  4R60 A;  2BHC A;  1WN1 A;  4EGE A;  2BHA A;  2BWY A;  1JAW A;  3OVK A;  5CDV A;  1N51 A;  5CE6 A;  4B28 A;  3I7M A;  3BIT A;  4ZWO A;  4S01 A;  5CIK A;  1PV9 A;  2BH3 A;  2BWV A;  3BIQ A;  1CHM A;  5CDE A;  3O5V A;  3IL0 A;  2OKN A;  2IW2 A;  2BWX A;  1W7V A;  2V3Y A;  3QOC A;  3Q6D A;  1WLR A;  4ZNG A;  3L24 A;  2BHD A;  3PEB A;  5CDL A;  5E5B A;  4RZZ A;  1KP0 A;  3L7G A;  2BN7 A;  5CNX A;  5FCF A;  3RVA A;  1WY2 A;  3CTZ A;  4PV4 A;  3IG4 A;  4ZWP A;  5FCH A;  2BWU A;  2ZSG A;  4S2T P;  3BIP A;  3OOO A;  2BWS A;  4QR8 A;  4ZWU A;  1W2M A;  5E2C A;  3PN9 A; 
#chains in the Genus database with same CATH topology
 4RGZ 1;  2HOW A;  2V3X A;  2BHB A;  4S2R P;  4S00 A;  1WL9 A;  2BWW A;  2V3Z A;  3CB6 A;  4FKC A;  1WBQ A;  3CB5 A;  2BWT A;  1M35 A;  4RZY A;  1A16 A;  1WL6 A;  4R60 A;  2BHC A;  1WN1 A;  4EGE A;  2BHA A;  2BWY A;  1JAW A;  3OVK A;  5CDV A;  1N51 A;  5CE6 A;  4B28 A;  3I7M A;  3BIT A;  4ZWO A;  4S01 A;  5CIK A;  1PV9 A;  2BH3 A;  2BWV A;  3BIQ A;  1CHM A;  5CDE A;  3O5V A;  3IL0 A;  2OKN A;  2IW2 A;  2BWX A;  1W7V A;  2V3Y A;  3QOC A;  3Q6D A;  1WLR A;  4ZNG A;  3L24 A;  2BHD A;  3PEB A;  5CDL A;  5E5B A;  4RZZ A;  1KP0 A;  3L7G A;  2BN7 A;  5CNX A;  5FCF A;  3RVA A;  1WY2 A;  3CTZ A;  4PV4 A;  3IG4 A;  4ZWP A;  5FCH A;  2BWU A;  2ZSG A;  4S2T P;  3BIP A;  3OOO A;  2BWS A;  4QR8 A;  4ZWU A;  1W2M A;  5E2C A;  3PN9 A; 
#chains in the Genus database with same CATH homology
 4RGZ 1;  2HOW A;  2V3X A;  2BHB A;  4S2R P;  4S00 A;  1WL9 A;  2BWW A;  2V3Z A;  3CB6 A;  4FKC A;  1WBQ A;  3CB5 A;  2BWT A;  1M35 A;  4RZY A;  1A16 A;  1WL6 A;  4R60 A;  2BHC A;  1WN1 A;  4EGE A;  2BHA A;  2BWY A;  1JAW A;  3OVK A;  5CDV A;  1N51 A;  5CE6 A;  4B28 A;  3I7M A;  3BIT A;  4ZWO A;  4S01 A;  5CIK A;  1PV9 A;  2BH3 A;  2BWV A;  3BIQ A;  1CHM A;  5CDE A;  3O5V A;  3IL0 A;  2OKN A;  2IW2 A;  2BWX A;  1W7V A;  2V3Y A;  3QOC A;  3Q6D A;  1WLR A;  4ZNG A;  3L24 A;  2BHD A;  3PEB A;  5CDL A;  5E5B A;  4RZZ A;  1KP0 A;  3L7G A;  2BN7 A;  5CNX A;  5FCF A;  3RVA A;  1WY2 A;  3CTZ A;  4PV4 A;  3IG4 A;  4ZWP A;  5FCH A;  2BWU A;  2ZSG A;  4S2T P;  3BIP A;  3OOO A;  2BWS A;  4QR8 A;  4ZWU A;  1W2M A;  5E2C A;  3PN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...