3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
2BWTA 1PV9A 2BHCA 5FCFA 3L24A 5E2CA 4S2TP 2BHDA 2BWYA 3O5VA 4ZWUA 2BWSA 2V3ZA 1WY2A 1WLRA 1WL9A 4RGZ1 3CTZA 4RZYA 2HOWA 1N51A 2BHBA 3OOOA 4ZNGA 1WBQA 2BWWA 3PN9A 2BHAA 4PV4A 5E5BA 4S01A 5FCHA 3PEBA 3BIQA 3BITA 3IG4A 4R60A 2V3XA 5CDVA 5CDEA 2BWUA 1WN1A 3OVKA 3Q6DA 1KP0A 1M35A 3CB5A 4FKCA 2V3YA 4ZWOA 4S2RP 4ZWPA 2BWXA 2BH3A 5CDLA 2IW2A 3IL0A 4QR8A 3CB6A 4S00A 5CIKA 1A16A 1CHMA 1W2MA 1W7VA 2BWVA 3QOCA 4B28A 2BN7A 3L7GA 5CE6A 1WL6A 5CNXA 1JAWA 4EGEA 3I7MA 2OKNA 2ZSGA 3RVAA 3BIPA 4RZZA
chains in the Genus database with same CATH superfamily
2BWTA 1PV9A 2BHCA 5FCFA 3L24A 5E2CA 4S2TP 2BHDA 2BWYA 3O5VA 4ZWUA 2BWSA 2V3ZA 1WY2A 1WLRA 1WL9A 4RGZ1 3CTZA 4RZYA 2HOWA 1N51A 2BHBA 3OOOA 4ZNGA 1WBQA 2BWWA 3PN9A 2BHAA 4PV4A 5E5BA 4S01A 5FCHA 3PEBA 3BIQA 3BITA 3IG4A 4R60A 2V3XA 5CDVA 5CDEA 2BWUA 1WN1A 3OVKA 3Q6DA 1KP0A 1M35A 3CB5A 4FKCA 2V3YA 4ZWOA 4S2RP 4ZWPA 2BWXA 2BH3A 5CDLA 2IW2A 3IL0A 4QR8A 3CB6A 4S00A 5CIKA 1A16A 1CHMA 1W2MA 1W7VA 2BWVA 3QOCA 4B28A 2BN7A 3L7GA 5CE6A 1WL6A 5CNXA 1JAWA 4EGEA 3I7MA 2OKNA 2ZSGA 3RVAA 3BIPA 4RZZA
chains in the Genus database with same CATH topology
2BWTA 1PV9A 2BHCA 5FCFA 3L24A 5E2CA 4S2TP 2BHDA 2BWYA 3O5VA 4ZWUA 2BWSA 2V3ZA 1WY2A 1WLRA 1WL9A 4RGZ1 3CTZA 4RZYA 2HOWA 1N51A 2BHBA 3OOOA 4ZNGA 1WBQA 2BWWA 3PN9A 2BHAA 4PV4A 5E5BA 4S01A 5FCHA 3PEBA 3BIQA 3BITA 3IG4A 4R60A 2V3XA 5CDVA 5CDEA 2BWUA 1WN1A 3OVKA 3Q6DA 1KP0A 1M35A 3CB5A 4FKCA 2V3YA 4ZWOA 4S2RP 4ZWPA 2BWXA 2BH3A 5CDLA 2IW2A 3IL0A 4QR8A 3CB6A 4S00A 5CIKA 1A16A 1CHMA 1W2MA 1W7VA 2BWVA 3QOCA 4B28A 2BN7A 3L7GA 5CE6A 1WL6A 5CNXA 1JAWA 4EGEA 3I7MA 2OKNA 2ZSGA 3RVAA 3BIPA 4RZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWT A;  1PV9 A;  2BHC A;  5FCF A;  3L24 A;  5E2C A;  4S2T P;  2BHD A;  2BWY A;  3O5V A;  4ZWU A;  2BWS A;  2V3Z A;  1WY2 A;  1WLR A;  1WL9 A;  4RGZ 1;  3CTZ A;  4RZY A;  2HOW A;  1N51 A;  2BHB A;  3OOO A;  4ZNG A;  1WBQ A;  2BWW A;  3PN9 A;  2BHA A;  4PV4 A;  5E5B A;  4S01 A;  5FCH A;  3PEB A;  3BIQ A;  3BIT A;  3IG4 A;  4R60 A;  2V3X A;  5CDV A;  5CDE A;  2BWU A;  1WN1 A;  3OVK A;  3Q6D A;  1KP0 A;  1M35 A;  3CB5 A;  4FKC A;  2V3Y A;  4ZWO A;  4S2R P;  4ZWP A;  2BWX A;  2BH3 A;  5CDL A;  2IW2 A;  3IL0 A;  4QR8 A;  3CB6 A;  4S00 A;  5CIK A;  1A16 A;  1CHM A;  1W2M A;  1W7V A;  2BWV A;  3QOC A;  4B28 A;  2BN7 A;  3L7G A;  5CE6 A;  1WL6 A;  5CNX A;  1JAW A;  4EGE A;  3I7M A;  2OKN A;  2ZSG A;  3RVA A;  3BIP A;  4RZZ A; 
#chains in the Genus database with same CATH topology
 2BWT A;  1PV9 A;  2BHC A;  5FCF A;  3L24 A;  5E2C A;  4S2T P;  2BHD A;  2BWY A;  3O5V A;  4ZWU A;  2BWS A;  2V3Z A;  1WY2 A;  1WLR A;  1WL9 A;  4RGZ 1;  3CTZ A;  4RZY A;  2HOW A;  1N51 A;  2BHB A;  3OOO A;  4ZNG A;  1WBQ A;  2BWW A;  3PN9 A;  2BHA A;  4PV4 A;  5E5B A;  4S01 A;  5FCH A;  3PEB A;  3BIQ A;  3BIT A;  3IG4 A;  4R60 A;  2V3X A;  5CDV A;  5CDE A;  2BWU A;  1WN1 A;  3OVK A;  3Q6D A;  1KP0 A;  1M35 A;  3CB5 A;  4FKC A;  2V3Y A;  4ZWO A;  4S2R P;  4ZWP A;  2BWX A;  2BH3 A;  5CDL A;  2IW2 A;  3IL0 A;  4QR8 A;  3CB6 A;  4S00 A;  5CIK A;  1A16 A;  1CHM A;  1W2M A;  1W7V A;  2BWV A;  3QOC A;  4B28 A;  2BN7 A;  3L7G A;  5CE6 A;  1WL6 A;  5CNX A;  1JAW A;  4EGE A;  3I7M A;  2OKN A;  2ZSG A;  3RVA A;  3BIP A;  4RZZ A; 
#chains in the Genus database with same CATH homology
 2BWT A;  1PV9 A;  2BHC A;  5FCF A;  3L24 A;  5E2C A;  4S2T P;  2BHD A;  2BWY A;  3O5V A;  4ZWU A;  2BWS A;  2V3Z A;  1WY2 A;  1WLR A;  1WL9 A;  4RGZ 1;  3CTZ A;  4RZY A;  2HOW A;  1N51 A;  2BHB A;  3OOO A;  4ZNG A;  1WBQ A;  2BWW A;  3PN9 A;  2BHA A;  4PV4 A;  5E5B A;  4S01 A;  5FCH A;  3PEB A;  3BIQ A;  3BIT A;  3IG4 A;  4R60 A;  2V3X A;  5CDV A;  5CDE A;  2BWU A;  1WN1 A;  3OVK A;  3Q6D A;  1KP0 A;  1M35 A;  3CB5 A;  4FKC A;  2V3Y A;  4ZWO A;  4S2R P;  4ZWP A;  2BWX A;  2BH3 A;  5CDL A;  2IW2 A;  3IL0 A;  4QR8 A;  3CB6 A;  4S00 A;  5CIK A;  1A16 A;  1CHM A;  1W2M A;  1W7V A;  2BWV A;  3QOC A;  4B28 A;  2BN7 A;  3L7G A;  5CE6 A;  1WL6 A;  5CNX A;  1JAW A;  4EGE A;  3I7M A;  2OKN A;  2ZSG A;  3RVA A;  3BIP A;  4RZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...