3OOOA

The structure of a proline dipeptidase from streptococcus agalactiae 2603v
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
AMSKLNRIRHHLHSVQAELAVFSDPVTVNYLTGFFCDPHERQMFLFVYEDRDPILFVPALEVSRAKQSVPFPVFGYIDSENPWQKIASNLPSFSVSKVLAEFDNLNVTKFQGLQTVFDGHFENLTPYIQNMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title The structure of a proline dipeptidase from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae
molecule tags Hydrolase
total genus 42
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3oooA00
2ZSGA 2BHDA 3RVAA 1W2MA 3CB6A 3OOOA 1M35A 4S2RP 2OKNA 3QOCA 5E2CA 5CE6A 3I7MA 2BN7A 3L7GA 2BWYA 2V3ZA 3CTZA 3PN9A 2HOWA 3CB5A 2BWSA 4ZNGA 2BHBA 1WLRA 4R60A 1WBQA 4RZZA 2V3YA 4RZYA 5CNXA 3Q6DA 1WL9A 2BWXA 2BWVA 5CIKA 1JAWA 1A16A 1N51A 2BHCA 5FCHA 1WY2A 4S2TP 2BWTA 4S01A 5CDLA 4S00A 1CHMA 3O5VA 4ZWUA 4ZWPA 4ZWOA 5CDVA 1WL6A 4B28A 4PV4A 3OVKA 5FCFA 3IG4A 2BWUA 1W7VA 2V3XA 1WN1A 4RGZ1 3BIQA 3L24A 3BITA 1KP0A 3BIPA 3PEBA 2BH3A 4QR8A 2BHAA 2IW2A 5E5BA 1PV9A 4EGEA 3IL0A 4FKCA 5CDEA 2BWWA
chains in the Genus database with same CATH superfamily
2ZSGA 2BHDA 3RVAA 1W2MA 3CB6A 3OOOA 1M35A 4S2RP 2OKNA 3QOCA 5E2CA 5CE6A 3I7MA 2BN7A 3L7GA 2BWYA 2V3ZA 3CTZA 3PN9A 2HOWA 3CB5A 2BWSA 4ZNGA 2BHBA 1WLRA 4R60A 1WBQA 4RZZA 2V3YA 4RZYA 5CNXA 3Q6DA 1WL9A 2BWXA 2BWVA 5CIKA 1JAWA 1A16A 1N51A 2BHCA 5FCHA 1WY2A 4S2TP 2BWTA 4S01A 5CDLA 4S00A 1CHMA 3O5VA 4ZWUA 4ZWPA 4ZWOA 5CDVA 1WL6A 4B28A 4PV4A 3OVKA 5FCFA 3IG4A 2BWUA 1W7VA 2V3XA 1WN1A 4RGZ1 3BIQA 3L24A 3BITA 1KP0A 3BIPA 3PEBA 2BH3A 4QR8A 2BHAA 2IW2A 5E5BA 1PV9A 4EGEA 3IL0A 4FKCA 5CDEA 2BWWA
chains in the Genus database with same CATH topology
2ZSGA 2BHDA 3RVAA 1W2MA 3CB6A 3OOOA 1M35A 4S2RP 2OKNA 3QOCA 5E2CA 5CE6A 3I7MA 2BN7A 3L7GA 2BWYA 2V3ZA 3CTZA 3PN9A 2HOWA 3CB5A 2BWSA 4ZNGA 2BHBA 1WLRA 4R60A 1WBQA 4RZZA 2V3YA 4RZYA 5CNXA 3Q6DA 1WL9A 2BWXA 2BWVA 5CIKA 1JAWA 1A16A 1N51A 2BHCA 5FCHA 1WY2A 4S2TP 2BWTA 4S01A 5CDLA 4S00A 1CHMA 3O5VA 4ZWUA 4ZWPA 4ZWOA 5CDVA 1WL6A 4B28A 4PV4A 3OVKA 5FCFA 3IG4A 2BWUA 1W7VA 2V3XA 1WN1A 4RGZ1 3BIQA 3L24A 3BITA 1KP0A 3BIPA 3PEBA 2BH3A 4QR8A 2BHAA 2IW2A 5E5BA 1PV9A 4EGEA 3IL0A 4FKCA 5CDEA 2BWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  2BHD A;  3RVA A;  1W2M A;  3CB6 A;  3OOO A;  1M35 A;  4S2R P;  2OKN A;  3QOC A;  5E2C A;  5CE6 A;  3I7M A;  2BN7 A;  3L7G A;  2BWY A;  2V3Z A;  3CTZ A;  3PN9 A;  2HOW A;  3CB5 A;  2BWS A;  4ZNG A;  2BHB A;  1WLR A;  4R60 A;  1WBQ A;  4RZZ A;  2V3Y A;  4RZY A;  5CNX A;  3Q6D A;  1WL9 A;  2BWX A;  2BWV A;  5CIK A;  1JAW A;  1A16 A;  1N51 A;  2BHC A;  5FCH A;  1WY2 A;  4S2T P;  2BWT A;  4S01 A;  5CDL A;  4S00 A;  1CHM A;  3O5V A;  4ZWU A;  4ZWP A;  4ZWO A;  5CDV A;  1WL6 A;  4B28 A;  4PV4 A;  3OVK A;  5FCF A;  3IG4 A;  2BWU A;  1W7V A;  2V3X A;  1WN1 A;  4RGZ 1;  3BIQ A;  3L24 A;  3BIT A;  1KP0 A;  3BIP A;  3PEB A;  2BH3 A;  4QR8 A;  2BHA A;  2IW2 A;  5E5B A;  1PV9 A;  4EGE A;  3IL0 A;  4FKC A;  5CDE A;  2BWW A; 
#chains in the Genus database with same CATH topology
 2ZSG A;  2BHD A;  3RVA A;  1W2M A;  3CB6 A;  3OOO A;  1M35 A;  4S2R P;  2OKN A;  3QOC A;  5E2C A;  5CE6 A;  3I7M A;  2BN7 A;  3L7G A;  2BWY A;  2V3Z A;  3CTZ A;  3PN9 A;  2HOW A;  3CB5 A;  2BWS A;  4ZNG A;  2BHB A;  1WLR A;  4R60 A;  1WBQ A;  4RZZ A;  2V3Y A;  4RZY A;  5CNX A;  3Q6D A;  1WL9 A;  2BWX A;  2BWV A;  5CIK A;  1JAW A;  1A16 A;  1N51 A;  2BHC A;  5FCH A;  1WY2 A;  4S2T P;  2BWT A;  4S01 A;  5CDL A;  4S00 A;  1CHM A;  3O5V A;  4ZWU A;  4ZWP A;  4ZWO A;  5CDV A;  1WL6 A;  4B28 A;  4PV4 A;  3OVK A;  5FCF A;  3IG4 A;  2BWU A;  1W7V A;  2V3X A;  1WN1 A;  4RGZ 1;  3BIQ A;  3L24 A;  3BIT A;  1KP0 A;  3BIP A;  3PEB A;  2BH3 A;  4QR8 A;  2BHA A;  2IW2 A;  5E5B A;  1PV9 A;  4EGE A;  3IL0 A;  4FKC A;  5CDE A;  2BWW A; 
#chains in the Genus database with same CATH homology
 2ZSG A;  2BHD A;  3RVA A;  1W2M A;  3CB6 A;  3OOO A;  1M35 A;  4S2R P;  2OKN A;  3QOC A;  5E2C A;  5CE6 A;  3I7M A;  2BN7 A;  3L7G A;  2BWY A;  2V3Z A;  3CTZ A;  3PN9 A;  2HOW A;  3CB5 A;  2BWS A;  4ZNG A;  2BHB A;  1WLR A;  4R60 A;  1WBQ A;  4RZZ A;  2V3Y A;  4RZY A;  5CNX A;  3Q6D A;  1WL9 A;  2BWX A;  2BWV A;  5CIK A;  1JAW A;  1A16 A;  1N51 A;  2BHC A;  5FCH A;  1WY2 A;  4S2T P;  2BWT A;  4S01 A;  5CDL A;  4S00 A;  1CHM A;  3O5V A;  4ZWU A;  4ZWP A;  4ZWO A;  5CDV A;  1WL6 A;  4B28 A;  4PV4 A;  3OVK A;  5FCF A;  3IG4 A;  2BWU A;  1W7V A;  2V3X A;  1WN1 A;  4RGZ 1;  3BIQ A;  3L24 A;  3BIT A;  1KP0 A;  3BIP A;  3PEB A;  2BH3 A;  4QR8 A;  2BHA A;  2IW2 A;  5E5B A;  1PV9 A;  4EGE A;  3IL0 A;  4FKC A;  5CDE A;  2BWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...