1W7VA

Znmg substituted aminopeptidase p from e. coli
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 158
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w7vA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w7vA02
1N51A 1M35A 1W2MA 4RZYA 2EA4A 2BWYA 1C22A 2EA2A 1WBQA 3BIPA 2GG8A 4U6CA 4U70A 3FM3A 2BHCA 3CB6A 3BIQA 4ZWOA 1YW8A 4S00A 1KP0A 3PEBA 2BHBA 4U69A 2GTXA 3RVAA 2GA2A 2BWTA 3L24A 1CHMA 2HOWA 2ZSGA 2B3HA 2GU7A 5CE6A 2Q96A 1C21A 2DFIA 3IL0A 2GGCA 4U6JA 5CLSA 2GGBA 4RZZA 1BOAA 4FLLA 3PKAA 3MATA 5CDLA 1KQ0A 2BH3A 2Q94A 2BWSA 4U76A 4U73A 3L7GA 1C24A 4HXXA 2BWVA 4FLIA 4U6EA 4JUQA 2V3ZA 2GG5A 1WL9A 5CDVA 4IDYA 1XGSA 5JI6A 4PV4A 4FKCA 3S6BA 1XGOA 3OOOA 1WY2A 1A16A 2ADUA 3IU9A 4FUKA 5E5BA 4OOKA 4S2RP 2GG2A 2BHAA 2GU5A 5CIKA 1R5GA 2BHDA 1BN5A 2BB7A 1C23A 1XGMA 5FCFA 4ZWUA 2GG0A 4IKSA 4U71A 4U6WA 3RORA 1PV9A 1XNZA 1KQ9A 2P9AA 3PKCA 4IU6A 2BWXA 1WN1A 5FCHA 3OVKA 3D27A 4ZWPA 4U75A 1YW7A 4FLKA 2BN7A 3CB5A 3Q6DA 1YJ3A 1B6AA 5CDEA 4S2TP 2V3XA 2P98A 3PN9A 4IECA 2G6PA 4IKTA 2V6CA 3PKDA 3O5VA 2NQ7A 3MR1A 4A6VA 2EVCA 2Q92A 1XGNA 3TB5A 2V3YA 4IKRA 2IW2A 4U1BA 4U6ZA 3TAVA 2GU4A 4B28A 4Z7MA 2B3LA 2GG9A 4A6WA 1WL6A 4ZNGA 2GZ5A 5JHUA 1JAWA 1YVMA 3MX6A 3PKBA 4FLJA 3FMRA 2GU6A 4IPAA 5CNXA 2B3KA 1QXWA 3IU8A 2EVOA 2P99A 3IG4A 5JFRA 4MATA 1WLRA 1B59A 2NQ6A 1YW9A 3I7MA 4FO8A 1WKMA 2OAZA 4KM3A 2Q8KA 4RGZ1 2MATA 4S01A 4EGEA 1C27A 2GG3A 2BWWA 5D6EA 3QOCA 2GG7A 1QXZA 1O0XA 1QXYA 1W7VA 1R58A 2OKNA 2Q95A 1QZYA 2Q93A 4IKUA 4PNCA 5E2CA 5D6FA 3CTZA 4FO7A 3IU7A 1R5HA 1MATA 4IF7A 3BITA 3FMQA 2EVMA 3PKEA 1Y1NA 4R60A 2BWUA 4QR8A
chains in the Genus database with same CATH superfamily
1N51A 1M35A 1W2MA 4RZYA 2EA4A 2BWYA 1C22A 2EA2A 1WBQA 3BIPA 2GG8A 4U6CA 4U70A 3FM3A 2BHCA 3CB6A 3BIQA 4ZWOA 1YW8A 4S00A 1KP0A 3PEBA 2BHBA 4U69A 2GTXA 3RVAA 2GA2A 2BWTA 3L24A 1CHMA 2HOWA 2ZSGA 2B3HA 2GU7A 5CE6A 2Q96A 1C21A 2DFIA 3IL0A 2GGCA 4U6JA 5CLSA 2GGBA 4RZZA 1BOAA 4FLLA 3PKAA 3MATA 5CDLA 1KQ0A 2BH3A 2Q94A 2BWSA 4U76A 4U73A 3L7GA 1C24A 4HXXA 2BWVA 4FLIA 4U6EA 4JUQA 2V3ZA 2GG5A 1WL9A 5CDVA 4IDYA 1XGSA 5JI6A 4PV4A 4FKCA 3S6BA 1XGOA 3OOOA 1WY2A 1A16A 2ADUA 3IU9A 4FUKA 5E5BA 4OOKA 4S2RP 2GG2A 2BHAA 2GU5A 5CIKA 1R5GA 2BHDA 1BN5A 2BB7A 1C23A 1XGMA 5FCFA 4ZWUA 2GG0A 4IKSA 4U71A 4U6WA 3RORA 1PV9A 1XNZA 1KQ9A 2P9AA 3PKCA 4IU6A 2BWXA 1WN1A 5FCHA 3OVKA 3D27A 4ZWPA 4U75A 1YW7A 4FLKA 2BN7A 3CB5A 3Q6DA 1YJ3A 1B6AA 5CDEA 4S2TP 2V3XA 2P98A 3PN9A 4IECA 2G6PA 4IKTA 2V6CA 3PKDA 3O5VA 2NQ7A 3MR1A 4A6VA 2EVCA 2Q92A 1XGNA 3TB5A 2V3YA 4IKRA 2IW2A 4U1BA 4U6ZA 3TAVA 2GU4A 4B28A 4Z7MA 2B3LA 2GG9A 4A6WA 1WL6A 4ZNGA 2GZ5A 5JHUA 1JAWA 1YVMA 3MX6A 3PKBA 4FLJA 3FMRA 2GU6A 4IPAA 5CNXA 2B3KA 1QXWA 3IU8A 2EVOA 2P99A 3IG4A 5JFRA 4MATA 1WLRA 1B59A 2NQ6A 1YW9A 3I7MA 4FO8A 1WKMA 2OAZA 4KM3A 2Q8KA 4RGZ1 2MATA 4S01A 4EGEA 1C27A 2GG3A 2BWWA 5D6EA 3QOCA 2GG7A 1QXZA 1O0XA 1QXYA 1W7VA 1R58A 2OKNA 2Q95A 1QZYA 2Q93A 4IKUA 4PNCA 5E2CA 5D6FA 3CTZA 4FO7A 3IU7A 1R5HA 1MATA 4IF7A 3BITA 3FMQA 2EVMA 3PKEA 1Y1NA 4R60A 2BWUA 4QR8A
chains in the Genus database with same CATH topology
1N51A 1M35A 1W2MA 4RZYA 2EA4A 2BWYA 1C22A 2EA2A 1WBQA 3BIPA 2GG8A 4U6CA 4U70A 3FM3A 2BHCA 3CB6A 3BIQA 4ZWOA 1YW8A 4S00A 1KP0A 3PEBA 2BHBA 4U69A 2GTXA 3RVAA 2GA2A 2BWTA 3L24A 1CHMA 2HOWA 2ZSGA 2B3HA 2GU7A 5CE6A 2Q96A 1C21A 2DFIA 3IL0A 2GGCA 4U6JA 5CLSA 2GGBA 4RZZA 1BOAA 4FLLA 3PKAA 3MATA 5CDLA 1KQ0A 2BH3A 2Q94A 2BWSA 4U76A 4U73A 3L7GA 1C24A 4HXXA 2BWVA 4FLIA 4U6EA 4JUQA 2V3ZA 2GG5A 1WL9A 5CDVA 4IDYA 1XGSA 5JI6A 4PV4A 4FKCA 3S6BA 1XGOA 3OOOA 1WY2A 1A16A 2ADUA 3IU9A 4FUKA 5E5BA 4OOKA 4S2RP 2GG2A 2BHAA 2GU5A 5CIKA 1R5GA 2BHDA 1BN5A 2BB7A 1C23A 1XGMA 5FCFA 4ZWUA 2GG0A 4IKSA 4U71A 4U6WA 3RORA 1PV9A 1XNZA 1KQ9A 2P9AA 3PKCA 4IU6A 2BWXA 1WN1A 5FCHA 3OVKA 3D27A 4ZWPA 4U75A 1YW7A 4FLKA 2BN7A 3CB5A 3Q6DA 1YJ3A 1B6AA 5CDEA 4S2TP 2V3XA 2P98A 3PN9A 4IECA 2G6PA 4IKTA 2V6CA 3PKDA 3O5VA 2NQ7A 3MR1A 4A6VA 2EVCA 2Q92A 1XGNA 3TB5A 2V3YA 4IKRA 2IW2A 4U1BA 4U6ZA 3TAVA 2GU4A 4B28A 4Z7MA 2B3LA 2GG9A 4A6WA 1WL6A 4ZNGA 2GZ5A 5JHUA 1JAWA 1YVMA 3MX6A 3PKBA 4FLJA 3FMRA 2GU6A 4IPAA 5CNXA 2B3KA 1QXWA 3IU8A 2EVOA 2P99A 3IG4A 5JFRA 4MATA 1WLRA 1B59A 2NQ6A 1YW9A 3I7MA 4FO8A 1WKMA 2OAZA 4KM3A 2Q8KA 4RGZ1 2MATA 4S01A 4EGEA 1C27A 2GG3A 2BWWA 5D6EA 3QOCA 2GG7A 1QXZA 1O0XA 1QXYA 1W7VA 1R58A 2OKNA 2Q95A 1QZYA 2Q93A 4IKUA 4PNCA 5E2CA 5D6FA 3CTZA 4FO7A 3IU7A 1R5HA 1MATA 4IF7A 3BITA 3FMQA 2EVMA 3PKEA 1Y1NA 4R60A 2BWUA 4QR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N51 A;  1M35 A;  1W2M A;  4RZY A;  2EA4 A;  2BWY A;  1C22 A;  2EA2 A;  1WBQ A;  3BIP A;  2GG8 A;  4U6C A;  4U70 A;  3FM3 A;  2BHC A;  3CB6 A;  3BIQ A;  4ZWO A;  1YW8 A;  4S00 A;  1KP0 A;  3PEB A;  2BHB A;  4U69 A;  2GTX A;  3RVA A;  2GA2 A;  2BWT A;  3L24 A;  1CHM A;  2HOW A;  2ZSG A;  2B3H A;  2GU7 A;  5CE6 A;  2Q96 A;  1C21 A;  2DFI A;  3IL0 A;  2GGC A;  4U6J A;  5CLS A;  2GGB A;  4RZZ A;  1BOA A;  4FLL A;  3PKA A;  3MAT A;  5CDL A;  1KQ0 A;  2BH3 A;  2Q94 A;  2BWS A;  4U76 A;  4U73 A;  3L7G A;  1C24 A;  4HXX A;  2BWV A;  4FLI A;  4U6E A;  4JUQ A;  2V3Z A;  2GG5 A;  1WL9 A;  5CDV A;  4IDY A;  1XGS A;  5JI6 A;  4PV4 A;  4FKC A;  3S6B A;  1XGO A;  3OOO A;  1WY2 A;  1A16 A;  2ADU A;  3IU9 A;  4FUK A;  5E5B A;  4OOK A;  4S2R P;  2GG2 A;  2BHA A;  2GU5 A;  5CIK A;  1R5G A;  2BHD A;  1BN5 A;  2BB7 A;  1C23 A;  1XGM A;  5FCF A;  4ZWU A;  2GG0 A;  4IKS A;  4U71 A;  4U6W A;  3ROR A;  1PV9 A;  1XNZ A;  1KQ9 A;  2P9A A;  3PKC A;  4IU6 A;  2BWX A;  1WN1 A;  5FCH A;  3OVK A;  3D27 A;  4ZWP A;  4U75 A;  1YW7 A;  4FLK A;  2BN7 A;  3CB5 A;  3Q6D A;  1YJ3 A;  1B6A A;  5CDE A;  4S2T P;  2V3X A;  2P98 A;  3PN9 A;  4IEC A;  2G6P A;  4IKT A;  2V6C A;  3PKD A;  3O5V A;  2NQ7 A;  3MR1 A;  4A6V A;  2EVC A;  2Q92 A;  1XGN A;  3TB5 A;  2V3Y A;  4IKR A;  2IW2 A;  4U1B A;  4U6Z A;  3TAV A;  2GU4 A;  4B28 A;  4Z7M A;  2B3L A;  2GG9 A;  4A6W A;  1WL6 A;  4ZNG A;  2GZ5 A;  5JHU A;  1JAW A;  1YVM A;  3MX6 A;  3PKB A;  4FLJ A;  3FMR A;  2GU6 A;  4IPA A;  5CNX A;  2B3K A;  1QXW A;  3IU8 A;  2EVO A;  2P99 A;  3IG4 A;  5JFR A;  4MAT A;  1WLR A;  1B59 A;  2NQ6 A;  1YW9 A;  3I7M A;  4FO8 A;  1WKM A;  2OAZ A;  4KM3 A;  2Q8K A;  4RGZ 1;  2MAT A;  4S01 A;  4EGE A;  1C27 A;  2GG3 A;  2BWW A;  5D6E A;  3QOC A;  2GG7 A;  1QXZ A;  1O0X A;  1QXY A;  1W7V A;  1R58 A;  2OKN A;  2Q95 A;  1QZY A;  2Q93 A;  4IKU A;  4PNC A;  5E2C A;  5D6F A;  3CTZ A;  4FO7 A;  3IU7 A;  1R5H A;  1MAT A;  4IF7 A;  3BIT A;  3FMQ A;  2EVM A;  3PKE A;  1Y1N A;  4R60 A;  2BWU A;  4QR8 A; 
#chains in the Genus database with same CATH topology
 1N51 A;  1M35 A;  1W2M A;  4RZY A;  2EA4 A;  2BWY A;  1C22 A;  2EA2 A;  1WBQ A;  3BIP A;  2GG8 A;  4U6C A;  4U70 A;  3FM3 A;  2BHC A;  3CB6 A;  3BIQ A;  4ZWO A;  1YW8 A;  4S00 A;  1KP0 A;  3PEB A;  2BHB A;  4U69 A;  2GTX A;  3RVA A;  2GA2 A;  2BWT A;  3L24 A;  1CHM A;  2HOW A;  2ZSG A;  2B3H A;  2GU7 A;  5CE6 A;  2Q96 A;  1C21 A;  2DFI A;  3IL0 A;  2GGC A;  4U6J A;  5CLS A;  2GGB A;  4RZZ A;  1BOA A;  4FLL A;  3PKA A;  3MAT A;  5CDL A;  1KQ0 A;  2BH3 A;  2Q94 A;  2BWS A;  4U76 A;  4U73 A;  3L7G A;  1C24 A;  4HXX A;  2BWV A;  4FLI A;  4U6E A;  4JUQ A;  2V3Z A;  2GG5 A;  1WL9 A;  5CDV A;  4IDY A;  1XGS A;  5JI6 A;  4PV4 A;  4FKC A;  3S6B A;  1XGO A;  3OOO A;  1WY2 A;  1A16 A;  2ADU A;  3IU9 A;  4FUK A;  5E5B A;  4OOK A;  4S2R P;  2GG2 A;  2BHA A;  2GU5 A;  5CIK A;  1R5G A;  2BHD A;  1BN5 A;  2BB7 A;  1C23 A;  1XGM A;  5FCF A;  4ZWU A;  2GG0 A;  4IKS A;  4U71 A;  4U6W A;  3ROR A;  1PV9 A;  1XNZ A;  1KQ9 A;  2P9A A;  3PKC A;  4IU6 A;  2BWX A;  1WN1 A;  5FCH A;  3OVK A;  3D27 A;  4ZWP A;  4U75 A;  1YW7 A;  4FLK A;  2BN7 A;  3CB5 A;  3Q6D A;  1YJ3 A;  1B6A A;  5CDE A;  4S2T P;  2V3X A;  2P98 A;  3PN9 A;  4IEC A;  2G6P A;  4IKT A;  2V6C A;  3PKD A;  3O5V A;  2NQ7 A;  3MR1 A;  4A6V A;  2EVC A;  2Q92 A;  1XGN A;  3TB5 A;  2V3Y A;  4IKR A;  2IW2 A;  4U1B A;  4U6Z A;  3TAV A;  2GU4 A;  4B28 A;  4Z7M A;  2B3L A;  2GG9 A;  4A6W A;  1WL6 A;  4ZNG A;  2GZ5 A;  5JHU A;  1JAW A;  1YVM A;  3MX6 A;  3PKB A;  4FLJ A;  3FMR A;  2GU6 A;  4IPA A;  5CNX A;  2B3K A;  1QXW A;  3IU8 A;  2EVO A;  2P99 A;  3IG4 A;  5JFR A;  4MAT A;  1WLR A;  1B59 A;  2NQ6 A;  1YW9 A;  3I7M A;  4FO8 A;  1WKM A;  2OAZ A;  4KM3 A;  2Q8K A;  4RGZ 1;  2MAT A;  4S01 A;  4EGE A;  1C27 A;  2GG3 A;  2BWW A;  5D6E A;  3QOC A;  2GG7 A;  1QXZ A;  1O0X A;  1QXY A;  1W7V A;  1R58 A;  2OKN A;  2Q95 A;  1QZY A;  2Q93 A;  4IKU A;  4PNC A;  5E2C A;  5D6F A;  3CTZ A;  4FO7 A;  3IU7 A;  1R5H A;  1MAT A;  4IF7 A;  3BIT A;  3FMQ A;  2EVM A;  3PKE A;  1Y1N A;  4R60 A;  2BWU A;  4QR8 A; 
#chains in the Genus database with same CATH homology
 1N51 A;  1M35 A;  1W2M A;  4RZY A;  2EA4 A;  2BWY A;  1C22 A;  2EA2 A;  1WBQ A;  3BIP A;  2GG8 A;  4U6C A;  4U70 A;  3FM3 A;  2BHC A;  3CB6 A;  3BIQ A;  4ZWO A;  1YW8 A;  4S00 A;  1KP0 A;  3PEB A;  2BHB A;  4U69 A;  2GTX A;  3RVA A;  2GA2 A;  2BWT A;  3L24 A;  1CHM A;  2HOW A;  2ZSG A;  2B3H A;  2GU7 A;  5CE6 A;  2Q96 A;  1C21 A;  2DFI A;  3IL0 A;  2GGC A;  4U6J A;  5CLS A;  2GGB A;  4RZZ A;  1BOA A;  4FLL A;  3PKA A;  3MAT A;  5CDL A;  1KQ0 A;  2BH3 A;  2Q94 A;  2BWS A;  4U76 A;  4U73 A;  3L7G A;  1C24 A;  4HXX A;  2BWV A;  4FLI A;  4U6E A;  4JUQ A;  2V3Z A;  2GG5 A;  1WL9 A;  5CDV A;  4IDY A;  1XGS A;  5JI6 A;  4PV4 A;  4FKC A;  3S6B A;  1XGO A;  3OOO A;  1WY2 A;  1A16 A;  2ADU A;  3IU9 A;  4FUK A;  5E5B A;  4OOK A;  4S2R P;  2GG2 A;  2BHA A;  2GU5 A;  5CIK A;  1R5G A;  2BHD A;  1BN5 A;  2BB7 A;  1C23 A;  1XGM A;  5FCF A;  4ZWU A;  2GG0 A;  4IKS A;  4U71 A;  4U6W A;  3ROR A;  1PV9 A;  1XNZ A;  1KQ9 A;  2P9A A;  3PKC A;  4IU6 A;  2BWX A;  1WN1 A;  5FCH A;  3OVK A;  3D27 A;  4ZWP A;  4U75 A;  1YW7 A;  4FLK A;  2BN7 A;  3CB5 A;  3Q6D A;  1YJ3 A;  1B6A A;  5CDE A;  4S2T P;  2V3X A;  2P98 A;  3PN9 A;  4IEC A;  2G6P A;  4IKT A;  2V6C A;  3PKD A;  3O5V A;  2NQ7 A;  3MR1 A;  4A6V A;  2EVC A;  2Q92 A;  1XGN A;  3TB5 A;  2V3Y A;  4IKR A;  2IW2 A;  4U1B A;  4U6Z A;  3TAV A;  2GU4 A;  4B28 A;  4Z7M A;  2B3L A;  2GG9 A;  4A6W A;  1WL6 A;  4ZNG A;  2GZ5 A;  5JHU A;  1JAW A;  1YVM A;  3MX6 A;  3PKB A;  4FLJ A;  3FMR A;  2GU6 A;  4IPA A;  5CNX A;  2B3K A;  1QXW A;  3IU8 A;  2EVO A;  2P99 A;  3IG4 A;  5JFR A;  4MAT A;  1WLR A;  1B59 A;  2NQ6 A;  1YW9 A;  3I7M A;  4FO8 A;  1WKM A;  2OAZ A;  4KM3 A;  2Q8K A;  4RGZ 1;  2MAT A;  4S01 A;  4EGE A;  1C27 A;  2GG3 A;  2BWW A;  5D6E A;  3QOC A;  2GG7 A;  1QXZ A;  1O0X A;  1QXY A;  1W7V A;  1R58 A;  2OKN A;  2Q95 A;  1QZY A;  2Q93 A;  4IKU A;  4PNC A;  5E2C A;  5D6F A;  3CTZ A;  4FO7 A;  3IU7 A;  1R5H A;  1MAT A;  4IF7 A;  3BIT A;  3FMQ A;  2EVM A;  3PKE A;  1Y1N A;  4R60 A;  2BWU A;  4QR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...