1W7VA

Znmg substituted aminopeptidase p from e. coli
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w7vA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w7vA02
3QOCA 1C22A 3L7GA 4U6CA 1YVMA 4FUKA 2BWYA 4ZWOA 2GG0A 2P99A 2Q94A 4U6WA 3FM3A 1KP0A 2OKNA 2V3YA 5CDLA 4IKSA 2EVMA 2BH3A 4U70A 4U6JA 3S6BA 1R5GA 2DFIA 2GU5A 2V6CA 5FCFA 4RZZA 2Q96A 2GZ5A 4IPAA 5JFRA 2BWWA 2EA4A 3PN9A 2NQ7A 5E5BA 1R5HA 1JAWA 4FLJA 1PV9A 5CIKA 1XNZA 4S01A 5D6EA 4RGZ1 4IF7A 1M35A 4U69A 2G6PA 4B28A 2GU7A 1N51A 1WY2A 2OAZA 3MATA 4ZWPA 2GG2A 1WLRA 2EVCA 1XGSA 1YW9A 3IG4A 2GU6A 4IKRA 4OOKA 4Z7MA 5FCHA 2GG8A 2BWTA 1WKMA 3IU9A 2GU4A 3BIPA 4EGEA 2GGBA 2ZSGA 2BHBA 4IKUA 2Q93A 1WBQA 2GA2A 4ZWUA 3O5VA 5CDVA 4U75A 2Q8KA 3D27A 4A6WA 2NQ6A 2EA2A 5CDEA 4S2RP 1WL9A 1YW7A 1BOAA 1O0XA 3I7MA 5CE6A 1BN5A 1C23A 1XGOA 1YJ3A 3IU7A 2GG5A 4FLIA 3RVAA 4U1BA 2BWVA 4QR8A 4A6VA 1WL6A 3OOOA 4FLKA 3PEBA 2B3LA 3TB5A 2IW2A 4U6EA 1C27A 4PV4A 1XGNA 2BHDA 3PKAA 2MATA 4PNCA 1QXWA 3PKDA 4U71A 1KQ0A 1A16A 2BHCA 1MATA 5JI6A 5JHUA 3Q6DA 2Q95A 1CHMA 3CB6A 3PKCA 4IDYA 2GG3A 2B3KA 4R60A 4S00A 1KQ9A 2GG9A 1C21A 4IECA 1C24A 3L24A 4HXXA 3BITA 4U6ZA 2HOWA 3CTZA 5D6FA 1W2MA 2BHAA 3IL0A 3IU8A 4FKCA 3MR1A 3RORA 1B6AA 4S2TP 2GG7A 3FMQA 5CNXA 4IU6A 4FO7A 3FMRA 4IKTA 4U73A 2V3ZA 2ADUA 3MX6A 1QZYA 4ZNGA 1Y1NA 3TAVA 4U76A 2B3HA 2GGCA 4RZYA 4FLLA 1W7VA 3OVKA 2BWSA 3PKBA 2V3XA 2P98A 1XGMA 1B59A 5CLSA 2BN7A 3BIQA 2BWXA 2GTXA 3PKEA 2BWUA 3CB5A 1QXZA 1QXYA 2P9AA 4FO8A 5E2CA 4JUQA 4KM3A 1R58A 1YW8A 4MATA 2BB7A 2EVOA 2Q92A 1WN1A
chains in the Genus database with same CATH superfamily
3QOCA 1C22A 3L7GA 4U6CA 1YVMA 4FUKA 2BWYA 4ZWOA 2GG0A 2P99A 2Q94A 4U6WA 3FM3A 1KP0A 2OKNA 2V3YA 5CDLA 4IKSA 2EVMA 2BH3A 4U70A 4U6JA 3S6BA 1R5GA 2DFIA 2GU5A 2V6CA 5FCFA 4RZZA 2Q96A 2GZ5A 4IPAA 5JFRA 2BWWA 2EA4A 3PN9A 2NQ7A 5E5BA 1R5HA 1JAWA 4FLJA 1PV9A 5CIKA 1XNZA 4S01A 5D6EA 4RGZ1 4IF7A 1M35A 4U69A 2G6PA 4B28A 2GU7A 1N51A 1WY2A 2OAZA 3MATA 4ZWPA 2GG2A 1WLRA 2EVCA 1XGSA 1YW9A 3IG4A 2GU6A 4IKRA 4OOKA 4Z7MA 5FCHA 2GG8A 2BWTA 1WKMA 3IU9A 2GU4A 3BIPA 4EGEA 2GGBA 2ZSGA 2BHBA 4IKUA 2Q93A 1WBQA 2GA2A 4ZWUA 3O5VA 5CDVA 4U75A 2Q8KA 3D27A 4A6WA 2NQ6A 2EA2A 5CDEA 4S2RP 1WL9A 1YW7A 1BOAA 1O0XA 3I7MA 5CE6A 1BN5A 1C23A 1XGOA 1YJ3A 3IU7A 2GG5A 4FLIA 3RVAA 4U1BA 2BWVA 4QR8A 4A6VA 1WL6A 3OOOA 4FLKA 3PEBA 2B3LA 3TB5A 2IW2A 4U6EA 1C27A 4PV4A 1XGNA 2BHDA 3PKAA 2MATA 4PNCA 1QXWA 3PKDA 4U71A 1KQ0A 1A16A 2BHCA 1MATA 5JI6A 5JHUA 3Q6DA 2Q95A 1CHMA 3CB6A 3PKCA 4IDYA 2GG3A 2B3KA 4R60A 4S00A 1KQ9A 2GG9A 1C21A 4IECA 1C24A 3L24A 4HXXA 3BITA 4U6ZA 2HOWA 3CTZA 5D6FA 1W2MA 2BHAA 3IL0A 3IU8A 4FKCA 3MR1A 3RORA 1B6AA 4S2TP 2GG7A 3FMQA 5CNXA 4IU6A 4FO7A 3FMRA 4IKTA 4U73A 2V3ZA 2ADUA 3MX6A 1QZYA 4ZNGA 1Y1NA 3TAVA 4U76A 2B3HA 2GGCA 4RZYA 4FLLA 1W7VA 3OVKA 2BWSA 3PKBA 2V3XA 2P98A 1XGMA 1B59A 5CLSA 2BN7A 3BIQA 2BWXA 2GTXA 3PKEA 2BWUA 3CB5A 1QXZA 1QXYA 2P9AA 4FO8A 5E2CA 4JUQA 4KM3A 1R58A 1YW8A 4MATA 2BB7A 2EVOA 2Q92A 1WN1A
chains in the Genus database with same CATH topology
3QOCA 1C22A 3L7GA 4U6CA 1YVMA 4FUKA 2BWYA 4ZWOA 2GG0A 2P99A 2Q94A 4U6WA 3FM3A 1KP0A 2OKNA 2V3YA 5CDLA 4IKSA 2EVMA 2BH3A 4U70A 4U6JA 3S6BA 1R5GA 2DFIA 2GU5A 2V6CA 5FCFA 4RZZA 2Q96A 2GZ5A 4IPAA 5JFRA 2BWWA 2EA4A 3PN9A 2NQ7A 5E5BA 1R5HA 1JAWA 4FLJA 1PV9A 5CIKA 1XNZA 4S01A 5D6EA 4RGZ1 4IF7A 1M35A 4U69A 2G6PA 4B28A 2GU7A 1N51A 1WY2A 2OAZA 3MATA 4ZWPA 2GG2A 1WLRA 2EVCA 1XGSA 1YW9A 3IG4A 2GU6A 4IKRA 4OOKA 4Z7MA 5FCHA 2GG8A 2BWTA 1WKMA 3IU9A 2GU4A 3BIPA 4EGEA 2GGBA 2ZSGA 2BHBA 4IKUA 2Q93A 1WBQA 2GA2A 4ZWUA 3O5VA 5CDVA 4U75A 2Q8KA 3D27A 4A6WA 2NQ6A 2EA2A 5CDEA 4S2RP 1WL9A 1YW7A 1BOAA 1O0XA 3I7MA 5CE6A 1BN5A 1C23A 1XGOA 1YJ3A 3IU7A 2GG5A 4FLIA 3RVAA 4U1BA 2BWVA 4QR8A 4A6VA 1WL6A 3OOOA 4FLKA 3PEBA 2B3LA 3TB5A 2IW2A 4U6EA 1C27A 4PV4A 1XGNA 2BHDA 3PKAA 2MATA 4PNCA 1QXWA 3PKDA 4U71A 1KQ0A 1A16A 2BHCA 1MATA 5JI6A 5JHUA 3Q6DA 2Q95A 1CHMA 3CB6A 3PKCA 4IDYA 2GG3A 2B3KA 4R60A 4S00A 1KQ9A 2GG9A 1C21A 4IECA 1C24A 3L24A 4HXXA 3BITA 4U6ZA 2HOWA 3CTZA 5D6FA 1W2MA 2BHAA 3IL0A 3IU8A 4FKCA 3MR1A 3RORA 1B6AA 4S2TP 2GG7A 3FMQA 5CNXA 4IU6A 4FO7A 3FMRA 4IKTA 4U73A 2V3ZA 2ADUA 3MX6A 1QZYA 4ZNGA 1Y1NA 3TAVA 4U76A 2B3HA 2GGCA 4RZYA 4FLLA 1W7VA 3OVKA 2BWSA 3PKBA 2V3XA 2P98A 1XGMA 1B59A 5CLSA 2BN7A 3BIQA 2BWXA 2GTXA 3PKEA 2BWUA 3CB5A 1QXZA 1QXYA 2P9AA 4FO8A 5E2CA 4JUQA 4KM3A 1R58A 1YW8A 4MATA 2BB7A 2EVOA 2Q92A 1WN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOC A;  1C22 A;  3L7G A;  4U6C A;  1YVM A;  4FUK A;  2BWY A;  4ZWO A;  2GG0 A;  2P99 A;  2Q94 A;  4U6W A;  3FM3 A;  1KP0 A;  2OKN A;  2V3Y A;  5CDL A;  4IKS A;  2EVM A;  2BH3 A;  4U70 A;  4U6J A;  3S6B A;  1R5G A;  2DFI A;  2GU5 A;  2V6C A;  5FCF A;  4RZZ A;  2Q96 A;  2GZ5 A;  4IPA A;  5JFR A;  2BWW A;  2EA4 A;  3PN9 A;  2NQ7 A;  5E5B A;  1R5H A;  1JAW A;  4FLJ A;  1PV9 A;  5CIK A;  1XNZ A;  4S01 A;  5D6E A;  4RGZ 1;  4IF7 A;  1M35 A;  4U69 A;  2G6P A;  4B28 A;  2GU7 A;  1N51 A;  1WY2 A;  2OAZ A;  3MAT A;  4ZWP A;  2GG2 A;  1WLR A;  2EVC A;  1XGS A;  1YW9 A;  3IG4 A;  2GU6 A;  4IKR A;  4OOK A;  4Z7M A;  5FCH A;  2GG8 A;  2BWT A;  1WKM A;  3IU9 A;  2GU4 A;  3BIP A;  4EGE A;  2GGB A;  2ZSG A;  2BHB A;  4IKU A;  2Q93 A;  1WBQ A;  2GA2 A;  4ZWU A;  3O5V A;  5CDV A;  4U75 A;  2Q8K A;  3D27 A;  4A6W A;  2NQ6 A;  2EA2 A;  5CDE A;  4S2R P;  1WL9 A;  1YW7 A;  1BOA A;  1O0X A;  3I7M A;  5CE6 A;  1BN5 A;  1C23 A;  1XGO A;  1YJ3 A;  3IU7 A;  2GG5 A;  4FLI A;  3RVA A;  4U1B A;  2BWV A;  4QR8 A;  4A6V A;  1WL6 A;  3OOO A;  4FLK A;  3PEB A;  2B3L A;  3TB5 A;  2IW2 A;  4U6E A;  1C27 A;  4PV4 A;  1XGN A;  2BHD A;  3PKA A;  2MAT A;  4PNC A;  1QXW A;  3PKD A;  4U71 A;  1KQ0 A;  1A16 A;  2BHC A;  1MAT A;  5JI6 A;  5JHU A;  3Q6D A;  2Q95 A;  1CHM A;  3CB6 A;  3PKC A;  4IDY A;  2GG3 A;  2B3K A;  4R60 A;  4S00 A;  1KQ9 A;  2GG9 A;  1C21 A;  4IEC A;  1C24 A;  3L24 A;  4HXX A;  3BIT A;  4U6Z A;  2HOW A;  3CTZ A;  5D6F A;  1W2M A;  2BHA A;  3IL0 A;  3IU8 A;  4FKC A;  3MR1 A;  3ROR A;  1B6A A;  4S2T P;  2GG7 A;  3FMQ A;  5CNX A;  4IU6 A;  4FO7 A;  3FMR A;  4IKT A;  4U73 A;  2V3Z A;  2ADU A;  3MX6 A;  1QZY A;  4ZNG A;  1Y1N A;  3TAV A;  4U76 A;  2B3H A;  2GGC A;  4RZY A;  4FLL A;  1W7V A;  3OVK A;  2BWS A;  3PKB A;  2V3X A;  2P98 A;  1XGM A;  1B59 A;  5CLS A;  2BN7 A;  3BIQ A;  2BWX A;  2GTX A;  3PKE A;  2BWU A;  3CB5 A;  1QXZ A;  1QXY A;  2P9A A;  4FO8 A;  5E2C A;  4JUQ A;  4KM3 A;  1R58 A;  1YW8 A;  4MAT A;  2BB7 A;  2EVO A;  2Q92 A;  1WN1 A; 
#chains in the Genus database with same CATH topology
 3QOC A;  1C22 A;  3L7G A;  4U6C A;  1YVM A;  4FUK A;  2BWY A;  4ZWO A;  2GG0 A;  2P99 A;  2Q94 A;  4U6W A;  3FM3 A;  1KP0 A;  2OKN A;  2V3Y A;  5CDL A;  4IKS A;  2EVM A;  2BH3 A;  4U70 A;  4U6J A;  3S6B A;  1R5G A;  2DFI A;  2GU5 A;  2V6C A;  5FCF A;  4RZZ A;  2Q96 A;  2GZ5 A;  4IPA A;  5JFR A;  2BWW A;  2EA4 A;  3PN9 A;  2NQ7 A;  5E5B A;  1R5H A;  1JAW A;  4FLJ A;  1PV9 A;  5CIK A;  1XNZ A;  4S01 A;  5D6E A;  4RGZ 1;  4IF7 A;  1M35 A;  4U69 A;  2G6P A;  4B28 A;  2GU7 A;  1N51 A;  1WY2 A;  2OAZ A;  3MAT A;  4ZWP A;  2GG2 A;  1WLR A;  2EVC A;  1XGS A;  1YW9 A;  3IG4 A;  2GU6 A;  4IKR A;  4OOK A;  4Z7M A;  5FCH A;  2GG8 A;  2BWT A;  1WKM A;  3IU9 A;  2GU4 A;  3BIP A;  4EGE A;  2GGB A;  2ZSG A;  2BHB A;  4IKU A;  2Q93 A;  1WBQ A;  2GA2 A;  4ZWU A;  3O5V A;  5CDV A;  4U75 A;  2Q8K A;  3D27 A;  4A6W A;  2NQ6 A;  2EA2 A;  5CDE A;  4S2R P;  1WL9 A;  1YW7 A;  1BOA A;  1O0X A;  3I7M A;  5CE6 A;  1BN5 A;  1C23 A;  1XGO A;  1YJ3 A;  3IU7 A;  2GG5 A;  4FLI A;  3RVA A;  4U1B A;  2BWV A;  4QR8 A;  4A6V A;  1WL6 A;  3OOO A;  4FLK A;  3PEB A;  2B3L A;  3TB5 A;  2IW2 A;  4U6E A;  1C27 A;  4PV4 A;  1XGN A;  2BHD A;  3PKA A;  2MAT A;  4PNC A;  1QXW A;  3PKD A;  4U71 A;  1KQ0 A;  1A16 A;  2BHC A;  1MAT A;  5JI6 A;  5JHU A;  3Q6D A;  2Q95 A;  1CHM A;  3CB6 A;  3PKC A;  4IDY A;  2GG3 A;  2B3K A;  4R60 A;  4S00 A;  1KQ9 A;  2GG9 A;  1C21 A;  4IEC A;  1C24 A;  3L24 A;  4HXX A;  3BIT A;  4U6Z A;  2HOW A;  3CTZ A;  5D6F A;  1W2M A;  2BHA A;  3IL0 A;  3IU8 A;  4FKC A;  3MR1 A;  3ROR A;  1B6A A;  4S2T P;  2GG7 A;  3FMQ A;  5CNX A;  4IU6 A;  4FO7 A;  3FMR A;  4IKT A;  4U73 A;  2V3Z A;  2ADU A;  3MX6 A;  1QZY A;  4ZNG A;  1Y1N A;  3TAV A;  4U76 A;  2B3H A;  2GGC A;  4RZY A;  4FLL A;  1W7V A;  3OVK A;  2BWS A;  3PKB A;  2V3X A;  2P98 A;  1XGM A;  1B59 A;  5CLS A;  2BN7 A;  3BIQ A;  2BWX A;  2GTX A;  3PKE A;  2BWU A;  3CB5 A;  1QXZ A;  1QXY A;  2P9A A;  4FO8 A;  5E2C A;  4JUQ A;  4KM3 A;  1R58 A;  1YW8 A;  4MAT A;  2BB7 A;  2EVO A;  2Q92 A;  1WN1 A; 
#chains in the Genus database with same CATH homology
 3QOC A;  1C22 A;  3L7G A;  4U6C A;  1YVM A;  4FUK A;  2BWY A;  4ZWO A;  2GG0 A;  2P99 A;  2Q94 A;  4U6W A;  3FM3 A;  1KP0 A;  2OKN A;  2V3Y A;  5CDL A;  4IKS A;  2EVM A;  2BH3 A;  4U70 A;  4U6J A;  3S6B A;  1R5G A;  2DFI A;  2GU5 A;  2V6C A;  5FCF A;  4RZZ A;  2Q96 A;  2GZ5 A;  4IPA A;  5JFR A;  2BWW A;  2EA4 A;  3PN9 A;  2NQ7 A;  5E5B A;  1R5H A;  1JAW A;  4FLJ A;  1PV9 A;  5CIK A;  1XNZ A;  4S01 A;  5D6E A;  4RGZ 1;  4IF7 A;  1M35 A;  4U69 A;  2G6P A;  4B28 A;  2GU7 A;  1N51 A;  1WY2 A;  2OAZ A;  3MAT A;  4ZWP A;  2GG2 A;  1WLR A;  2EVC A;  1XGS A;  1YW9 A;  3IG4 A;  2GU6 A;  4IKR A;  4OOK A;  4Z7M A;  5FCH A;  2GG8 A;  2BWT A;  1WKM A;  3IU9 A;  2GU4 A;  3BIP A;  4EGE A;  2GGB A;  2ZSG A;  2BHB A;  4IKU A;  2Q93 A;  1WBQ A;  2GA2 A;  4ZWU A;  3O5V A;  5CDV A;  4U75 A;  2Q8K A;  3D27 A;  4A6W A;  2NQ6 A;  2EA2 A;  5CDE A;  4S2R P;  1WL9 A;  1YW7 A;  1BOA A;  1O0X A;  3I7M A;  5CE6 A;  1BN5 A;  1C23 A;  1XGO A;  1YJ3 A;  3IU7 A;  2GG5 A;  4FLI A;  3RVA A;  4U1B A;  2BWV A;  4QR8 A;  4A6V A;  1WL6 A;  3OOO A;  4FLK A;  3PEB A;  2B3L A;  3TB5 A;  2IW2 A;  4U6E A;  1C27 A;  4PV4 A;  1XGN A;  2BHD A;  3PKA A;  2MAT A;  4PNC A;  1QXW A;  3PKD A;  4U71 A;  1KQ0 A;  1A16 A;  2BHC A;  1MAT A;  5JI6 A;  5JHU A;  3Q6D A;  2Q95 A;  1CHM A;  3CB6 A;  3PKC A;  4IDY A;  2GG3 A;  2B3K A;  4R60 A;  4S00 A;  1KQ9 A;  2GG9 A;  1C21 A;  4IEC A;  1C24 A;  3L24 A;  4HXX A;  3BIT A;  4U6Z A;  2HOW A;  3CTZ A;  5D6F A;  1W2M A;  2BHA A;  3IL0 A;  3IU8 A;  4FKC A;  3MR1 A;  3ROR A;  1B6A A;  4S2T P;  2GG7 A;  3FMQ A;  5CNX A;  4IU6 A;  4FO7 A;  3FMR A;  4IKT A;  4U73 A;  2V3Z A;  2ADU A;  3MX6 A;  1QZY A;  4ZNG A;  1Y1N A;  3TAV A;  4U76 A;  2B3H A;  2GGC A;  4RZY A;  4FLL A;  1W7V A;  3OVK A;  2BWS A;  3PKB A;  2V3X A;  2P98 A;  1XGM A;  1B59 A;  5CLS A;  2BN7 A;  3BIQ A;  2BWX A;  2GTX A;  3PKE A;  2BWU A;  3CB5 A;  1QXZ A;  1QXY A;  2P9A A;  4FO8 A;  5E2C A;  4JUQ A;  4KM3 A;  1R58 A;  1YW8 A;  4MAT A;  2BB7 A;  2EVO A;  2Q92 A;  1WN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...