1W7VA

Znmg substituted aminopeptidase p from e. coli
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w7vA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w7vA02
4FLIA 3IU8A 2BHDA 2V3XA 2NQ7A 3D27A 5CLSA 1C27A 1MATA 2GU7A 3PKAA 3BITA 4IF7A 2OKNA 2OAZA 4RZYA 3IG4A 1WL9A 2GG2A 4KM3A 4MATA 1C23A 3PKCA 1QXWA 1C22A 4HXXA 2IW2A 2GGBA 3MR1A 1WBQA 4ZWUA 4U70A 4PV4A 2V3YA 2V6CA 2GTXA 4JUQA 4S00A 1QXYA 4EGEA 2BHCA 3OOOA 4ZNGA 4U1BA 1BN5A 1YW8A 2HOWA 1B59A 4IPAA 5CNXA 1WKMA 1KQ0A 2B3HA 2GZ5A 1XGOA 4PNCA 2GU6A 2V3ZA 1PV9A 2BWWA 3CTZA 4QR8A 4U6EA 2EA2A 3IL0A 2BHBA 1YJ3A 2ADUA 2EVCA 4B28A 1W7VA 3CB5A 2GG3A 2GGCA 4U71A 5D6EA 4FKCA 3PEBA 1XGSA 1YW9A 5CDVA 1WLRA 4IU6A 2BWYA 3FM3A 1A16A 2Q94A 3MX6A 1QXZA 2B3KA 2Q95A 4U76A 3FMQA 5E5BA 4U6ZA 4FLJA 4S2RP 2GU4A 2GG9A 4IKSA 2Q96A 2Q8KA 3I7MA 2GG7A 2BWSA 1N51A 4IDYA 4IECA 2BWTA 2Q92A 1WY2A 1C24A 4U6JA 3L7GA 4ZWPA 1BOAA 2G6PA 1WN1A 1R58A 1XGMA 5D6FA 5CDEA 2GG5A 3O5VA 2BWXA 2P99A 2BWVA 4RZZA 2ZSGA 4FO7A 4IKTA 4OOKA 2BWUA 4RGZ1 3IU9A 4FUKA 4A6WA 3Q6DA 2BB7A 4IKRA 4ZWOA 4U73A 1Y1NA 3PKEA 4FLKA 3CB6A 3TAVA 1XNZA 3PKDA 3OVKA 3RVAA 2P9AA 1YVMA 4S2TP 1R5GA 2GU5A 1W2MA 1JAWA 1R5HA 3PKBA 2BHAA 1M35A 4IKUA 2BN7A 1QZYA 1C21A 3MATA 3L24A 3BIPA 5CIKA 1B6AA 2GG8A 2GG0A 4A6VA 1KQ9A 1XGNA 1KP0A 5FCHA 2EA4A 4FO8A 2DFIA 2MATA 4U69A 4U75A 3IU7A 2BH3A 4R60A 4Z7MA 4S01A 5CE6A 2GA2A 3QOCA 1O0XA 5JI6A 2EVOA 5JHUA 5E2CA 2Q93A 1CHMA 2EVMA 1YW7A 3BIQA 2P98A 4U6WA 3TB5A 2NQ6A 4FLLA 3FMRA 4U6CA 3PN9A 3RORA 5CDLA 2B3LA 5JFRA 3S6BA 5FCFA 1WL6A
chains in the Genus database with same CATH superfamily
4FLIA 3IU8A 2BHDA 2V3XA 2NQ7A 3D27A 5CLSA 1C27A 1MATA 2GU7A 3PKAA 3BITA 4IF7A 2OKNA 2OAZA 4RZYA 3IG4A 1WL9A 2GG2A 4KM3A 4MATA 1C23A 3PKCA 1QXWA 1C22A 4HXXA 2IW2A 2GGBA 3MR1A 1WBQA 4ZWUA 4U70A 4PV4A 2V3YA 2V6CA 2GTXA 4JUQA 4S00A 1QXYA 4EGEA 2BHCA 3OOOA 4ZNGA 4U1BA 1BN5A 1YW8A 2HOWA 1B59A 4IPAA 5CNXA 1WKMA 1KQ0A 2B3HA 2GZ5A 1XGOA 4PNCA 2GU6A 2V3ZA 1PV9A 2BWWA 3CTZA 4QR8A 4U6EA 2EA2A 3IL0A 2BHBA 1YJ3A 2ADUA 2EVCA 4B28A 1W7VA 3CB5A 2GG3A 2GGCA 4U71A 5D6EA 4FKCA 3PEBA 1XGSA 1YW9A 5CDVA 1WLRA 4IU6A 2BWYA 3FM3A 1A16A 2Q94A 3MX6A 1QXZA 2B3KA 2Q95A 4U76A 3FMQA 5E5BA 4U6ZA 4FLJA 4S2RP 2GU4A 2GG9A 4IKSA 2Q96A 2Q8KA 3I7MA 2GG7A 2BWSA 1N51A 4IDYA 4IECA 2BWTA 2Q92A 1WY2A 1C24A 4U6JA 3L7GA 4ZWPA 1BOAA 2G6PA 1WN1A 1R58A 1XGMA 5D6FA 5CDEA 2GG5A 3O5VA 2BWXA 2P99A 2BWVA 4RZZA 2ZSGA 4FO7A 4IKTA 4OOKA 2BWUA 4RGZ1 3IU9A 4FUKA 4A6WA 3Q6DA 2BB7A 4IKRA 4ZWOA 4U73A 1Y1NA 3PKEA 4FLKA 3CB6A 3TAVA 1XNZA 3PKDA 3OVKA 3RVAA 2P9AA 1YVMA 4S2TP 1R5GA 2GU5A 1W2MA 1JAWA 1R5HA 3PKBA 2BHAA 1M35A 4IKUA 2BN7A 1QZYA 1C21A 3MATA 3L24A 3BIPA 5CIKA 1B6AA 2GG8A 2GG0A 4A6VA 1KQ9A 1XGNA 1KP0A 5FCHA 2EA4A 4FO8A 2DFIA 2MATA 4U69A 4U75A 3IU7A 2BH3A 4R60A 4Z7MA 4S01A 5CE6A 2GA2A 3QOCA 1O0XA 5JI6A 2EVOA 5JHUA 5E2CA 2Q93A 1CHMA 2EVMA 1YW7A 3BIQA 2P98A 4U6WA 3TB5A 2NQ6A 4FLLA 3FMRA 4U6CA 3PN9A 3RORA 5CDLA 2B3LA 5JFRA 3S6BA 5FCFA 1WL6A
chains in the Genus database with same CATH topology
4FLIA 3IU8A 2BHDA 2V3XA 2NQ7A 3D27A 5CLSA 1C27A 1MATA 2GU7A 3PKAA 3BITA 4IF7A 2OKNA 2OAZA 4RZYA 3IG4A 1WL9A 2GG2A 4KM3A 4MATA 1C23A 3PKCA 1QXWA 1C22A 4HXXA 2IW2A 2GGBA 3MR1A 1WBQA 4ZWUA 4U70A 4PV4A 2V3YA 2V6CA 2GTXA 4JUQA 4S00A 1QXYA 4EGEA 2BHCA 3OOOA 4ZNGA 4U1BA 1BN5A 1YW8A 2HOWA 1B59A 4IPAA 5CNXA 1WKMA 1KQ0A 2B3HA 2GZ5A 1XGOA 4PNCA 2GU6A 2V3ZA 1PV9A 2BWWA 3CTZA 4QR8A 4U6EA 2EA2A 3IL0A 2BHBA 1YJ3A 2ADUA 2EVCA 4B28A 1W7VA 3CB5A 2GG3A 2GGCA 4U71A 5D6EA 4FKCA 3PEBA 1XGSA 1YW9A 5CDVA 1WLRA 4IU6A 2BWYA 3FM3A 1A16A 2Q94A 3MX6A 1QXZA 2B3KA 2Q95A 4U76A 3FMQA 5E5BA 4U6ZA 4FLJA 4S2RP 2GU4A 2GG9A 4IKSA 2Q96A 2Q8KA 3I7MA 2GG7A 2BWSA 1N51A 4IDYA 4IECA 2BWTA 2Q92A 1WY2A 1C24A 4U6JA 3L7GA 4ZWPA 1BOAA 2G6PA 1WN1A 1R58A 1XGMA 5D6FA 5CDEA 2GG5A 3O5VA 2BWXA 2P99A 2BWVA 4RZZA 2ZSGA 4FO7A 4IKTA 4OOKA 2BWUA 4RGZ1 3IU9A 4FUKA 4A6WA 3Q6DA 2BB7A 4IKRA 4ZWOA 4U73A 1Y1NA 3PKEA 4FLKA 3CB6A 3TAVA 1XNZA 3PKDA 3OVKA 3RVAA 2P9AA 1YVMA 4S2TP 1R5GA 2GU5A 1W2MA 1JAWA 1R5HA 3PKBA 2BHAA 1M35A 4IKUA 2BN7A 1QZYA 1C21A 3MATA 3L24A 3BIPA 5CIKA 1B6AA 2GG8A 2GG0A 4A6VA 1KQ9A 1XGNA 1KP0A 5FCHA 2EA4A 4FO8A 2DFIA 2MATA 4U69A 4U75A 3IU7A 2BH3A 4R60A 4Z7MA 4S01A 5CE6A 2GA2A 3QOCA 1O0XA 5JI6A 2EVOA 5JHUA 5E2CA 2Q93A 1CHMA 2EVMA 1YW7A 3BIQA 2P98A 4U6WA 3TB5A 2NQ6A 4FLLA 3FMRA 4U6CA 3PN9A 3RORA 5CDLA 2B3LA 5JFRA 3S6BA 5FCFA 1WL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLI A;  3IU8 A;  2BHD A;  2V3X A;  2NQ7 A;  3D27 A;  5CLS A;  1C27 A;  1MAT A;  2GU7 A;  3PKA A;  3BIT A;  4IF7 A;  2OKN A;  2OAZ A;  4RZY A;  3IG4 A;  1WL9 A;  2GG2 A;  4KM3 A;  4MAT A;  1C23 A;  3PKC A;  1QXW A;  1C22 A;  4HXX A;  2IW2 A;  2GGB A;  3MR1 A;  1WBQ A;  4ZWU A;  4U70 A;  4PV4 A;  2V3Y A;  2V6C A;  2GTX A;  4JUQ A;  4S00 A;  1QXY A;  4EGE A;  2BHC A;  3OOO A;  4ZNG A;  4U1B A;  1BN5 A;  1YW8 A;  2HOW A;  1B59 A;  4IPA A;  5CNX A;  1WKM A;  1KQ0 A;  2B3H A;  2GZ5 A;  1XGO A;  4PNC A;  2GU6 A;  2V3Z A;  1PV9 A;  2BWW A;  3CTZ A;  4QR8 A;  4U6E A;  2EA2 A;  3IL0 A;  2BHB A;  1YJ3 A;  2ADU A;  2EVC A;  4B28 A;  1W7V A;  3CB5 A;  2GG3 A;  2GGC A;  4U71 A;  5D6E A;  4FKC A;  3PEB A;  1XGS A;  1YW9 A;  5CDV A;  1WLR A;  4IU6 A;  2BWY A;  3FM3 A;  1A16 A;  2Q94 A;  3MX6 A;  1QXZ A;  2B3K A;  2Q95 A;  4U76 A;  3FMQ A;  5E5B A;  4U6Z A;  4FLJ A;  4S2R P;  2GU4 A;  2GG9 A;  4IKS A;  2Q96 A;  2Q8K A;  3I7M A;  2GG7 A;  2BWS A;  1N51 A;  4IDY A;  4IEC A;  2BWT A;  2Q92 A;  1WY2 A;  1C24 A;  4U6J A;  3L7G A;  4ZWP A;  1BOA A;  2G6P A;  1WN1 A;  1R58 A;  1XGM A;  5D6F A;  5CDE A;  2GG5 A;  3O5V A;  2BWX A;  2P99 A;  2BWV A;  4RZZ A;  2ZSG A;  4FO7 A;  4IKT A;  4OOK A;  2BWU A;  4RGZ 1;  3IU9 A;  4FUK A;  4A6W A;  3Q6D A;  2BB7 A;  4IKR A;  4ZWO A;  4U73 A;  1Y1N A;  3PKE A;  4FLK A;  3CB6 A;  3TAV A;  1XNZ A;  3PKD A;  3OVK A;  3RVA A;  2P9A A;  1YVM A;  4S2T P;  1R5G A;  2GU5 A;  1W2M A;  1JAW A;  1R5H A;  3PKB A;  2BHA A;  1M35 A;  4IKU A;  2BN7 A;  1QZY A;  1C21 A;  3MAT A;  3L24 A;  3BIP A;  5CIK A;  1B6A A;  2GG8 A;  2GG0 A;  4A6V A;  1KQ9 A;  1XGN A;  1KP0 A;  5FCH A;  2EA4 A;  4FO8 A;  2DFI A;  2MAT A;  4U69 A;  4U75 A;  3IU7 A;  2BH3 A;  4R60 A;  4Z7M A;  4S01 A;  5CE6 A;  2GA2 A;  3QOC A;  1O0X A;  5JI6 A;  2EVO A;  5JHU A;  5E2C A;  2Q93 A;  1CHM A;  2EVM A;  1YW7 A;  3BIQ A;  2P98 A;  4U6W A;  3TB5 A;  2NQ6 A;  4FLL A;  3FMR A;  4U6C A;  3PN9 A;  3ROR A;  5CDL A;  2B3L A;  5JFR A;  3S6B A;  5FCF A;  1WL6 A; 
#chains in the Genus database with same CATH topology
 4FLI A;  3IU8 A;  2BHD A;  2V3X A;  2NQ7 A;  3D27 A;  5CLS A;  1C27 A;  1MAT A;  2GU7 A;  3PKA A;  3BIT A;  4IF7 A;  2OKN A;  2OAZ A;  4RZY A;  3IG4 A;  1WL9 A;  2GG2 A;  4KM3 A;  4MAT A;  1C23 A;  3PKC A;  1QXW A;  1C22 A;  4HXX A;  2IW2 A;  2GGB A;  3MR1 A;  1WBQ A;  4ZWU A;  4U70 A;  4PV4 A;  2V3Y A;  2V6C A;  2GTX A;  4JUQ A;  4S00 A;  1QXY A;  4EGE A;  2BHC A;  3OOO A;  4ZNG A;  4U1B A;  1BN5 A;  1YW8 A;  2HOW A;  1B59 A;  4IPA A;  5CNX A;  1WKM A;  1KQ0 A;  2B3H A;  2GZ5 A;  1XGO A;  4PNC A;  2GU6 A;  2V3Z A;  1PV9 A;  2BWW A;  3CTZ A;  4QR8 A;  4U6E A;  2EA2 A;  3IL0 A;  2BHB A;  1YJ3 A;  2ADU A;  2EVC A;  4B28 A;  1W7V A;  3CB5 A;  2GG3 A;  2GGC A;  4U71 A;  5D6E A;  4FKC A;  3PEB A;  1XGS A;  1YW9 A;  5CDV A;  1WLR A;  4IU6 A;  2BWY A;  3FM3 A;  1A16 A;  2Q94 A;  3MX6 A;  1QXZ A;  2B3K A;  2Q95 A;  4U76 A;  3FMQ A;  5E5B A;  4U6Z A;  4FLJ A;  4S2R P;  2GU4 A;  2GG9 A;  4IKS A;  2Q96 A;  2Q8K A;  3I7M A;  2GG7 A;  2BWS A;  1N51 A;  4IDY A;  4IEC A;  2BWT A;  2Q92 A;  1WY2 A;  1C24 A;  4U6J A;  3L7G A;  4ZWP A;  1BOA A;  2G6P A;  1WN1 A;  1R58 A;  1XGM A;  5D6F A;  5CDE A;  2GG5 A;  3O5V A;  2BWX A;  2P99 A;  2BWV A;  4RZZ A;  2ZSG A;  4FO7 A;  4IKT A;  4OOK A;  2BWU A;  4RGZ 1;  3IU9 A;  4FUK A;  4A6W A;  3Q6D A;  2BB7 A;  4IKR A;  4ZWO A;  4U73 A;  1Y1N A;  3PKE A;  4FLK A;  3CB6 A;  3TAV A;  1XNZ A;  3PKD A;  3OVK A;  3RVA A;  2P9A A;  1YVM A;  4S2T P;  1R5G A;  2GU5 A;  1W2M A;  1JAW A;  1R5H A;  3PKB A;  2BHA A;  1M35 A;  4IKU A;  2BN7 A;  1QZY A;  1C21 A;  3MAT A;  3L24 A;  3BIP A;  5CIK A;  1B6A A;  2GG8 A;  2GG0 A;  4A6V A;  1KQ9 A;  1XGN A;  1KP0 A;  5FCH A;  2EA4 A;  4FO8 A;  2DFI A;  2MAT A;  4U69 A;  4U75 A;  3IU7 A;  2BH3 A;  4R60 A;  4Z7M A;  4S01 A;  5CE6 A;  2GA2 A;  3QOC A;  1O0X A;  5JI6 A;  2EVO A;  5JHU A;  5E2C A;  2Q93 A;  1CHM A;  2EVM A;  1YW7 A;  3BIQ A;  2P98 A;  4U6W A;  3TB5 A;  2NQ6 A;  4FLL A;  3FMR A;  4U6C A;  3PN9 A;  3ROR A;  5CDL A;  2B3L A;  5JFR A;  3S6B A;  5FCF A;  1WL6 A; 
#chains in the Genus database with same CATH homology
 4FLI A;  3IU8 A;  2BHD A;  2V3X A;  2NQ7 A;  3D27 A;  5CLS A;  1C27 A;  1MAT A;  2GU7 A;  3PKA A;  3BIT A;  4IF7 A;  2OKN A;  2OAZ A;  4RZY A;  3IG4 A;  1WL9 A;  2GG2 A;  4KM3 A;  4MAT A;  1C23 A;  3PKC A;  1QXW A;  1C22 A;  4HXX A;  2IW2 A;  2GGB A;  3MR1 A;  1WBQ A;  4ZWU A;  4U70 A;  4PV4 A;  2V3Y A;  2V6C A;  2GTX A;  4JUQ A;  4S00 A;  1QXY A;  4EGE A;  2BHC A;  3OOO A;  4ZNG A;  4U1B A;  1BN5 A;  1YW8 A;  2HOW A;  1B59 A;  4IPA A;  5CNX A;  1WKM A;  1KQ0 A;  2B3H A;  2GZ5 A;  1XGO A;  4PNC A;  2GU6 A;  2V3Z A;  1PV9 A;  2BWW A;  3CTZ A;  4QR8 A;  4U6E A;  2EA2 A;  3IL0 A;  2BHB A;  1YJ3 A;  2ADU A;  2EVC A;  4B28 A;  1W7V A;  3CB5 A;  2GG3 A;  2GGC A;  4U71 A;  5D6E A;  4FKC A;  3PEB A;  1XGS A;  1YW9 A;  5CDV A;  1WLR A;  4IU6 A;  2BWY A;  3FM3 A;  1A16 A;  2Q94 A;  3MX6 A;  1QXZ A;  2B3K A;  2Q95 A;  4U76 A;  3FMQ A;  5E5B A;  4U6Z A;  4FLJ A;  4S2R P;  2GU4 A;  2GG9 A;  4IKS A;  2Q96 A;  2Q8K A;  3I7M A;  2GG7 A;  2BWS A;  1N51 A;  4IDY A;  4IEC A;  2BWT A;  2Q92 A;  1WY2 A;  1C24 A;  4U6J A;  3L7G A;  4ZWP A;  1BOA A;  2G6P A;  1WN1 A;  1R58 A;  1XGM A;  5D6F A;  5CDE A;  2GG5 A;  3O5V A;  2BWX A;  2P99 A;  2BWV A;  4RZZ A;  2ZSG A;  4FO7 A;  4IKT A;  4OOK A;  2BWU A;  4RGZ 1;  3IU9 A;  4FUK A;  4A6W A;  3Q6D A;  2BB7 A;  4IKR A;  4ZWO A;  4U73 A;  1Y1N A;  3PKE A;  4FLK A;  3CB6 A;  3TAV A;  1XNZ A;  3PKD A;  3OVK A;  3RVA A;  2P9A A;  1YVM A;  4S2T P;  1R5G A;  2GU5 A;  1W2M A;  1JAW A;  1R5H A;  3PKB A;  2BHA A;  1M35 A;  4IKU A;  2BN7 A;  1QZY A;  1C21 A;  3MAT A;  3L24 A;  3BIP A;  5CIK A;  1B6A A;  2GG8 A;  2GG0 A;  4A6V A;  1KQ9 A;  1XGN A;  1KP0 A;  5FCH A;  2EA4 A;  4FO8 A;  2DFI A;  2MAT A;  4U69 A;  4U75 A;  3IU7 A;  2BH3 A;  4R60 A;  4Z7M A;  4S01 A;  5CE6 A;  2GA2 A;  3QOC A;  1O0X A;  5JI6 A;  2EVO A;  5JHU A;  5E2C A;  2Q93 A;  1CHM A;  2EVM A;  1YW7 A;  3BIQ A;  2P98 A;  4U6W A;  3TB5 A;  2NQ6 A;  4FLL A;  3FMR A;  4U6C A;  3PN9 A;  3ROR A;  5CDL A;  2B3L A;  5JFR A;  3S6B A;  5FCF A;  1WL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...