1W7VA

Znmg substituted aminopeptidase p from e. coli
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 158
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w7vA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w7vA02
3IG4A 4U6CA 1C22A 3MATA 2BH3A 2GG2A 4FLJA 5E5BA 1BOAA 3PKAA 3PKEA 2BHCA 3L24A 2ADUA 4U73A 4S00A 2EA4A 3FMQA 2GG9A 1W7VA 2Q95A 1Y1NA 4S01A 2BHBA 1WN1A 1A16A 4U1BA 3BIPA 5CDLA 4U6ZA 4FLKA 4IF7A 2BWUA 3OOOA 4RZYA 2EA2A 4IKUA 3OVKA 3O5VA 4A6VA 1YJ3A 1B6AA 1WLRA 3I7MA 2B3LA 3IU9A 3CTZA 4QR8A 2P98A 1PV9A 4IU6A 2B3KA 3PKDA 2P99A 5CIKA 2BWXA 2GA2A 2V3XA 5FCFA 1R58A 5E2CA 5CDVA 1XNZA 1YW9A 4ZWPA 3MR1A 1XGNA 2BN7A 1WL6A 3BITA 4IKSA 2MATA 2IW2A 2GU4A 4RGZ1 1XGMA 2GTXA 3IU7A 2BHAA 4KM3A 2GG7A 2BHDA 1KP0A 1WL9A 3BIQA 4A6WA 3RVAA 3QOCA 2GG0A 4MATA 1B59A 4IKRA 1N51A 2G6PA 4OOKA 2Q93A 4ZWOA 2B3HA 5FCHA 3CB5A 4U70A 2BWSA 1YW8A 1R5HA 2Q92A 1WY2A 1YW7A 2BB7A 2Q8KA 1WKMA 4U75A 5D6FA 1W2MA 4FLIA 4U76A 1O0XA 1YVMA 2ZSGA 2BWTA 5CLSA 1MATA 4RZZA 3L7GA 5JI6A 1C21A 4HXXA 2BWVA 2V6CA 2GG8A 1XGOA 2BWYA 2EVOA 3IL0A 2BWWA 3Q6DA 3D27A 4EGEA 3PN9A 4U6WA 1QXWA 2GG3A 3CB6A 5CE6A 4S2TP 1JAWA 1KQ0A 2Q94A 4R60A 4FO8A 4IKTA 4FKCA 1R5GA 3FM3A 4IECA 2Q96A 1C27A 4PV4A 2NQ6A 4ZNGA 2GG5A 1QZYA 3S6BA 2V3YA 4B28A 4FO7A 2OAZA 3PKBA 3PEBA 3TB5A 4FLLA 1KQ9A 4FUKA 4U6EA 3PKCA 5D6EA 4Z7MA 2GGCA 2GGBA 2GU6A 1XGSA 5JHUA 5CDEA 1WBQA 2EVMA 3TAVA 4U71A 2P9AA 1QXZA 4IPAA 5JFRA 4U69A 2HOWA 2GZ5A 2NQ7A 1M35A 2DFIA 3FMRA 1CHMA 1C24A 1BN5A 2V3ZA 4U6JA 2OKNA 2GU5A 4ZWUA 4JUQA 4S2RP 2EVCA 5CNXA 3RORA 1C23A 3IU8A 2GU7A 4IDYA 1QXYA 3MX6A 4PNCA
chains in the Genus database with same CATH superfamily
3IG4A 4U6CA 1C22A 3MATA 2BH3A 2GG2A 4FLJA 5E5BA 1BOAA 3PKAA 3PKEA 2BHCA 3L24A 2ADUA 4U73A 4S00A 2EA4A 3FMQA 2GG9A 1W7VA 2Q95A 1Y1NA 4S01A 2BHBA 1WN1A 1A16A 4U1BA 3BIPA 5CDLA 4U6ZA 4FLKA 4IF7A 2BWUA 3OOOA 4RZYA 2EA2A 4IKUA 3OVKA 3O5VA 4A6VA 1YJ3A 1B6AA 1WLRA 3I7MA 2B3LA 3IU9A 3CTZA 4QR8A 2P98A 1PV9A 4IU6A 2B3KA 3PKDA 2P99A 5CIKA 2BWXA 2GA2A 2V3XA 5FCFA 1R58A 5E2CA 5CDVA 1XNZA 1YW9A 4ZWPA 3MR1A 1XGNA 2BN7A 1WL6A 3BITA 4IKSA 2MATA 2IW2A 2GU4A 4RGZ1 1XGMA 2GTXA 3IU7A 2BHAA 4KM3A 2GG7A 2BHDA 1KP0A 1WL9A 3BIQA 4A6WA 3RVAA 3QOCA 2GG0A 4MATA 1B59A 4IKRA 1N51A 2G6PA 4OOKA 2Q93A 4ZWOA 2B3HA 5FCHA 3CB5A 4U70A 2BWSA 1YW8A 1R5HA 2Q92A 1WY2A 1YW7A 2BB7A 2Q8KA 1WKMA 4U75A 5D6FA 1W2MA 4FLIA 4U76A 1O0XA 1YVMA 2ZSGA 2BWTA 5CLSA 1MATA 4RZZA 3L7GA 5JI6A 1C21A 4HXXA 2BWVA 2V6CA 2GG8A 1XGOA 2BWYA 2EVOA 3IL0A 2BWWA 3Q6DA 3D27A 4EGEA 3PN9A 4U6WA 1QXWA 2GG3A 3CB6A 5CE6A 4S2TP 1JAWA 1KQ0A 2Q94A 4R60A 4FO8A 4IKTA 4FKCA 1R5GA 3FM3A 4IECA 2Q96A 1C27A 4PV4A 2NQ6A 4ZNGA 2GG5A 1QZYA 3S6BA 2V3YA 4B28A 4FO7A 2OAZA 3PKBA 3PEBA 3TB5A 4FLLA 1KQ9A 4FUKA 4U6EA 3PKCA 5D6EA 4Z7MA 2GGCA 2GGBA 2GU6A 1XGSA 5JHUA 5CDEA 1WBQA 2EVMA 3TAVA 4U71A 2P9AA 1QXZA 4IPAA 5JFRA 4U69A 2HOWA 2GZ5A 2NQ7A 1M35A 2DFIA 3FMRA 1CHMA 1C24A 1BN5A 2V3ZA 4U6JA 2OKNA 2GU5A 4ZWUA 4JUQA 4S2RP 2EVCA 5CNXA 3RORA 1C23A 3IU8A 2GU7A 4IDYA 1QXYA 3MX6A 4PNCA
chains in the Genus database with same CATH topology
3IG4A 4U6CA 1C22A 3MATA 2BH3A 2GG2A 4FLJA 5E5BA 1BOAA 3PKAA 3PKEA 2BHCA 3L24A 2ADUA 4U73A 4S00A 2EA4A 3FMQA 2GG9A 1W7VA 2Q95A 1Y1NA 4S01A 2BHBA 1WN1A 1A16A 4U1BA 3BIPA 5CDLA 4U6ZA 4FLKA 4IF7A 2BWUA 3OOOA 4RZYA 2EA2A 4IKUA 3OVKA 3O5VA 4A6VA 1YJ3A 1B6AA 1WLRA 3I7MA 2B3LA 3IU9A 3CTZA 4QR8A 2P98A 1PV9A 4IU6A 2B3KA 3PKDA 2P99A 5CIKA 2BWXA 2GA2A 2V3XA 5FCFA 1R58A 5E2CA 5CDVA 1XNZA 1YW9A 4ZWPA 3MR1A 1XGNA 2BN7A 1WL6A 3BITA 4IKSA 2MATA 2IW2A 2GU4A 4RGZ1 1XGMA 2GTXA 3IU7A 2BHAA 4KM3A 2GG7A 2BHDA 1KP0A 1WL9A 3BIQA 4A6WA 3RVAA 3QOCA 2GG0A 4MATA 1B59A 4IKRA 1N51A 2G6PA 4OOKA 2Q93A 4ZWOA 2B3HA 5FCHA 3CB5A 4U70A 2BWSA 1YW8A 1R5HA 2Q92A 1WY2A 1YW7A 2BB7A 2Q8KA 1WKMA 4U75A 5D6FA 1W2MA 4FLIA 4U76A 1O0XA 1YVMA 2ZSGA 2BWTA 5CLSA 1MATA 4RZZA 3L7GA 5JI6A 1C21A 4HXXA 2BWVA 2V6CA 2GG8A 1XGOA 2BWYA 2EVOA 3IL0A 2BWWA 3Q6DA 3D27A 4EGEA 3PN9A 4U6WA 1QXWA 2GG3A 3CB6A 5CE6A 4S2TP 1JAWA 1KQ0A 2Q94A 4R60A 4FO8A 4IKTA 4FKCA 1R5GA 3FM3A 4IECA 2Q96A 1C27A 4PV4A 2NQ6A 4ZNGA 2GG5A 1QZYA 3S6BA 2V3YA 4B28A 4FO7A 2OAZA 3PKBA 3PEBA 3TB5A 4FLLA 1KQ9A 4FUKA 4U6EA 3PKCA 5D6EA 4Z7MA 2GGCA 2GGBA 2GU6A 1XGSA 5JHUA 5CDEA 1WBQA 2EVMA 3TAVA 4U71A 2P9AA 1QXZA 4IPAA 5JFRA 4U69A 2HOWA 2GZ5A 2NQ7A 1M35A 2DFIA 3FMRA 1CHMA 1C24A 1BN5A 2V3ZA 4U6JA 2OKNA 2GU5A 4ZWUA 4JUQA 4S2RP 2EVCA 5CNXA 3RORA 1C23A 3IU8A 2GU7A 4IDYA 1QXYA 3MX6A 4PNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG4 A;  4U6C A;  1C22 A;  3MAT A;  2BH3 A;  2GG2 A;  4FLJ A;  5E5B A;  1BOA A;  3PKA A;  3PKE A;  2BHC A;  3L24 A;  2ADU A;  4U73 A;  4S00 A;  2EA4 A;  3FMQ A;  2GG9 A;  1W7V A;  2Q95 A;  1Y1N A;  4S01 A;  2BHB A;  1WN1 A;  1A16 A;  4U1B A;  3BIP A;  5CDL A;  4U6Z A;  4FLK A;  4IF7 A;  2BWU A;  3OOO A;  4RZY A;  2EA2 A;  4IKU A;  3OVK A;  3O5V A;  4A6V A;  1YJ3 A;  1B6A A;  1WLR A;  3I7M A;  2B3L A;  3IU9 A;  3CTZ A;  4QR8 A;  2P98 A;  1PV9 A;  4IU6 A;  2B3K A;  3PKD A;  2P99 A;  5CIK A;  2BWX A;  2GA2 A;  2V3X A;  5FCF A;  1R58 A;  5E2C A;  5CDV A;  1XNZ A;  1YW9 A;  4ZWP A;  3MR1 A;  1XGN A;  2BN7 A;  1WL6 A;  3BIT A;  4IKS A;  2MAT A;  2IW2 A;  2GU4 A;  4RGZ 1;  1XGM A;  2GTX A;  3IU7 A;  2BHA A;  4KM3 A;  2GG7 A;  2BHD A;  1KP0 A;  1WL9 A;  3BIQ A;  4A6W A;  3RVA A;  3QOC A;  2GG0 A;  4MAT A;  1B59 A;  4IKR A;  1N51 A;  2G6P A;  4OOK A;  2Q93 A;  4ZWO A;  2B3H A;  5FCH A;  3CB5 A;  4U70 A;  2BWS A;  1YW8 A;  1R5H A;  2Q92 A;  1WY2 A;  1YW7 A;  2BB7 A;  2Q8K A;  1WKM A;  4U75 A;  5D6F A;  1W2M A;  4FLI A;  4U76 A;  1O0X A;  1YVM A;  2ZSG A;  2BWT A;  5CLS A;  1MAT A;  4RZZ A;  3L7G A;  5JI6 A;  1C21 A;  4HXX A;  2BWV A;  2V6C A;  2GG8 A;  1XGO A;  2BWY A;  2EVO A;  3IL0 A;  2BWW A;  3Q6D A;  3D27 A;  4EGE A;  3PN9 A;  4U6W A;  1QXW A;  2GG3 A;  3CB6 A;  5CE6 A;  4S2T P;  1JAW A;  1KQ0 A;  2Q94 A;  4R60 A;  4FO8 A;  4IKT A;  4FKC A;  1R5G A;  3FM3 A;  4IEC A;  2Q96 A;  1C27 A;  4PV4 A;  2NQ6 A;  4ZNG A;  2GG5 A;  1QZY A;  3S6B A;  2V3Y A;  4B28 A;  4FO7 A;  2OAZ A;  3PKB A;  3PEB A;  3TB5 A;  4FLL A;  1KQ9 A;  4FUK A;  4U6E A;  3PKC A;  5D6E A;  4Z7M A;  2GGC A;  2GGB A;  2GU6 A;  1XGS A;  5JHU A;  5CDE A;  1WBQ A;  2EVM A;  3TAV A;  4U71 A;  2P9A A;  1QXZ A;  4IPA A;  5JFR A;  4U69 A;  2HOW A;  2GZ5 A;  2NQ7 A;  1M35 A;  2DFI A;  3FMR A;  1CHM A;  1C24 A;  1BN5 A;  2V3Z A;  4U6J A;  2OKN A;  2GU5 A;  4ZWU A;  4JUQ A;  4S2R P;  2EVC A;  5CNX A;  3ROR A;  1C23 A;  3IU8 A;  2GU7 A;  4IDY A;  1QXY A;  3MX6 A;  4PNC A; 
#chains in the Genus database with same CATH topology
 3IG4 A;  4U6C A;  1C22 A;  3MAT A;  2BH3 A;  2GG2 A;  4FLJ A;  5E5B A;  1BOA A;  3PKA A;  3PKE A;  2BHC A;  3L24 A;  2ADU A;  4U73 A;  4S00 A;  2EA4 A;  3FMQ A;  2GG9 A;  1W7V A;  2Q95 A;  1Y1N A;  4S01 A;  2BHB A;  1WN1 A;  1A16 A;  4U1B A;  3BIP A;  5CDL A;  4U6Z A;  4FLK A;  4IF7 A;  2BWU A;  3OOO A;  4RZY A;  2EA2 A;  4IKU A;  3OVK A;  3O5V A;  4A6V A;  1YJ3 A;  1B6A A;  1WLR A;  3I7M A;  2B3L A;  3IU9 A;  3CTZ A;  4QR8 A;  2P98 A;  1PV9 A;  4IU6 A;  2B3K A;  3PKD A;  2P99 A;  5CIK A;  2BWX A;  2GA2 A;  2V3X A;  5FCF A;  1R58 A;  5E2C A;  5CDV A;  1XNZ A;  1YW9 A;  4ZWP A;  3MR1 A;  1XGN A;  2BN7 A;  1WL6 A;  3BIT A;  4IKS A;  2MAT A;  2IW2 A;  2GU4 A;  4RGZ 1;  1XGM A;  2GTX A;  3IU7 A;  2BHA A;  4KM3 A;  2GG7 A;  2BHD A;  1KP0 A;  1WL9 A;  3BIQ A;  4A6W A;  3RVA A;  3QOC A;  2GG0 A;  4MAT A;  1B59 A;  4IKR A;  1N51 A;  2G6P A;  4OOK A;  2Q93 A;  4ZWO A;  2B3H A;  5FCH A;  3CB5 A;  4U70 A;  2BWS A;  1YW8 A;  1R5H A;  2Q92 A;  1WY2 A;  1YW7 A;  2BB7 A;  2Q8K A;  1WKM A;  4U75 A;  5D6F A;  1W2M A;  4FLI A;  4U76 A;  1O0X A;  1YVM A;  2ZSG A;  2BWT A;  5CLS A;  1MAT A;  4RZZ A;  3L7G A;  5JI6 A;  1C21 A;  4HXX A;  2BWV A;  2V6C A;  2GG8 A;  1XGO A;  2BWY A;  2EVO A;  3IL0 A;  2BWW A;  3Q6D A;  3D27 A;  4EGE A;  3PN9 A;  4U6W A;  1QXW A;  2GG3 A;  3CB6 A;  5CE6 A;  4S2T P;  1JAW A;  1KQ0 A;  2Q94 A;  4R60 A;  4FO8 A;  4IKT A;  4FKC A;  1R5G A;  3FM3 A;  4IEC A;  2Q96 A;  1C27 A;  4PV4 A;  2NQ6 A;  4ZNG A;  2GG5 A;  1QZY A;  3S6B A;  2V3Y A;  4B28 A;  4FO7 A;  2OAZ A;  3PKB A;  3PEB A;  3TB5 A;  4FLL A;  1KQ9 A;  4FUK A;  4U6E A;  3PKC A;  5D6E A;  4Z7M A;  2GGC A;  2GGB A;  2GU6 A;  1XGS A;  5JHU A;  5CDE A;  1WBQ A;  2EVM A;  3TAV A;  4U71 A;  2P9A A;  1QXZ A;  4IPA A;  5JFR A;  4U69 A;  2HOW A;  2GZ5 A;  2NQ7 A;  1M35 A;  2DFI A;  3FMR A;  1CHM A;  1C24 A;  1BN5 A;  2V3Z A;  4U6J A;  2OKN A;  2GU5 A;  4ZWU A;  4JUQ A;  4S2R P;  2EVC A;  5CNX A;  3ROR A;  1C23 A;  3IU8 A;  2GU7 A;  4IDY A;  1QXY A;  3MX6 A;  4PNC A; 
#chains in the Genus database with same CATH homology
 3IG4 A;  4U6C A;  1C22 A;  3MAT A;  2BH3 A;  2GG2 A;  4FLJ A;  5E5B A;  1BOA A;  3PKA A;  3PKE A;  2BHC A;  3L24 A;  2ADU A;  4U73 A;  4S00 A;  2EA4 A;  3FMQ A;  2GG9 A;  1W7V A;  2Q95 A;  1Y1N A;  4S01 A;  2BHB A;  1WN1 A;  1A16 A;  4U1B A;  3BIP A;  5CDL A;  4U6Z A;  4FLK A;  4IF7 A;  2BWU A;  3OOO A;  4RZY A;  2EA2 A;  4IKU A;  3OVK A;  3O5V A;  4A6V A;  1YJ3 A;  1B6A A;  1WLR A;  3I7M A;  2B3L A;  3IU9 A;  3CTZ A;  4QR8 A;  2P98 A;  1PV9 A;  4IU6 A;  2B3K A;  3PKD A;  2P99 A;  5CIK A;  2BWX A;  2GA2 A;  2V3X A;  5FCF A;  1R58 A;  5E2C A;  5CDV A;  1XNZ A;  1YW9 A;  4ZWP A;  3MR1 A;  1XGN A;  2BN7 A;  1WL6 A;  3BIT A;  4IKS A;  2MAT A;  2IW2 A;  2GU4 A;  4RGZ 1;  1XGM A;  2GTX A;  3IU7 A;  2BHA A;  4KM3 A;  2GG7 A;  2BHD A;  1KP0 A;  1WL9 A;  3BIQ A;  4A6W A;  3RVA A;  3QOC A;  2GG0 A;  4MAT A;  1B59 A;  4IKR A;  1N51 A;  2G6P A;  4OOK A;  2Q93 A;  4ZWO A;  2B3H A;  5FCH A;  3CB5 A;  4U70 A;  2BWS A;  1YW8 A;  1R5H A;  2Q92 A;  1WY2 A;  1YW7 A;  2BB7 A;  2Q8K A;  1WKM A;  4U75 A;  5D6F A;  1W2M A;  4FLI A;  4U76 A;  1O0X A;  1YVM A;  2ZSG A;  2BWT A;  5CLS A;  1MAT A;  4RZZ A;  3L7G A;  5JI6 A;  1C21 A;  4HXX A;  2BWV A;  2V6C A;  2GG8 A;  1XGO A;  2BWY A;  2EVO A;  3IL0 A;  2BWW A;  3Q6D A;  3D27 A;  4EGE A;  3PN9 A;  4U6W A;  1QXW A;  2GG3 A;  3CB6 A;  5CE6 A;  4S2T P;  1JAW A;  1KQ0 A;  2Q94 A;  4R60 A;  4FO8 A;  4IKT A;  4FKC A;  1R5G A;  3FM3 A;  4IEC A;  2Q96 A;  1C27 A;  4PV4 A;  2NQ6 A;  4ZNG A;  2GG5 A;  1QZY A;  3S6B A;  2V3Y A;  4B28 A;  4FO7 A;  2OAZ A;  3PKB A;  3PEB A;  3TB5 A;  4FLL A;  1KQ9 A;  4FUK A;  4U6E A;  3PKC A;  5D6E A;  4Z7M A;  2GGC A;  2GGB A;  2GU6 A;  1XGS A;  5JHU A;  5CDE A;  1WBQ A;  2EVM A;  3TAV A;  4U71 A;  2P9A A;  1QXZ A;  4IPA A;  5JFR A;  4U69 A;  2HOW A;  2GZ5 A;  2NQ7 A;  1M35 A;  2DFI A;  3FMR A;  1CHM A;  1C24 A;  1BN5 A;  2V3Z A;  4U6J A;  2OKN A;  2GU5 A;  4ZWU A;  4JUQ A;  4S2R P;  2EVC A;  5CNX A;  3ROR A;  1C23 A;  3IU8 A;  2GU7 A;  4IDY A;  1QXY A;  3MX6 A;  4PNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...