1W7VA

Znmg substituted aminopeptidase p from e. coli
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w7vA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w7vA02
3MX6A 2BHDA 4U6EA 4U69A 5JI6A 5D6FA 1XGOA 2V3ZA 3OOOA 3TB5A 2P98A 1B59A 2V3XA 3L24A 5FCFA 4S2RP 1YVMA 2EVCA 2GG8A 1QXZA 2P99A 4B28A 3IU9A 4U6CA 1YJ3A 2GU7A 2BWVA 3FMRA 4Z7MA 5CNXA 2BWXA 3MATA 5E2CA 1KQ9A 3PEBA 2EA4A 1C23A 3IU8A 1BN5A 2BWTA 4RZZA 4IPAA 4OOKA 1XNZA 4S01A 2GG0A 3D27A 1B6AA 2GG7A 4PNCA 1WLRA 4QR8A 5CIKA 1XGSA 3FM3A 3RORA 2GU6A 2BH3A 2GG5A 4FO7A 2G6PA 2B3LA 3L7GA 3O5VA 1WKMA 3BIQA 2ADUA 2GGBA 2BHCA 3PKEA 3PN9A 3TAVA 2GU5A 1QXYA 2GU4A 2GZ5A 4FKCA 3MR1A 4FLIA 3RVAA 1R5GA 2OKNA 3CTZA 1WL9A 3OVKA 2BB7A 4ZWPA 4HXXA 4EGEA 2EVMA 4S00A 5E5BA 3BIPA 4A6WA 1BOAA 2HOWA 5CDVA 2EA2A 4U76A 1W7VA 1CHMA 3IL0A 4IKTA 5CE6A 3Q6DA 2GA2A 5JFRA 1WBQA 4IKUA 5CDEA 2Q92A 4U1BA 4ZNGA 1WN1A 2BN7A 1C24A 3FMQA 2Q8KA 3PKBA 5FCHA 5CDLA 1Y1NA 1KQ0A 2Q94A 4U70A 1C27A 4U73A 2Q95A 4ZWOA 2Q96A 3QOCA 2GG3A 1R58A 3PKCA 4RGZ1 2B3HA 2NQ6A 3PKAA 4IECA 4JUQA 4IKSA 3BITA 4RZYA 4U6ZA 1PV9A 4MATA 2GG9A 2Q93A 2OAZA 4FUKA 5CLSA 2ZSGA 1C22A 2BWWA 1MATA 4U6WA 1KP0A 1WL6A 1YW7A 2EVOA 3IU7A 4FLLA 5D6EA 3S6BA 2NQ7A 1W2MA 3IG4A 1XGNA 1YW8A 1M35A 4ZWUA 4U6JA 2DFIA 3PKDA 2MATA 1R5HA 4IKRA 4IU6A 1C21A 2IW2A 4IDYA 2BWSA 4FLKA 4IF7A 1JAWA 1XGMA 3CB5A 1N51A 2B3KA 2BWYA 3CB6A 4S2TP 2P9AA 1A16A 4R60A 3I7MA 2BWUA 4U75A 1QZYA 1QXWA 4U71A 1O0XA 2GTXA 1YW9A 4KM3A 2BHBA 2BHAA 2V3YA 2V6CA 4FO8A 1WY2A 2GG2A 4A6VA 4FLJA 5JHUA 4PV4A 2GGCA
chains in the Genus database with same CATH superfamily
3MX6A 2BHDA 4U6EA 4U69A 5JI6A 5D6FA 1XGOA 2V3ZA 3OOOA 3TB5A 2P98A 1B59A 2V3XA 3L24A 5FCFA 4S2RP 1YVMA 2EVCA 2GG8A 1QXZA 2P99A 4B28A 3IU9A 4U6CA 1YJ3A 2GU7A 2BWVA 3FMRA 4Z7MA 5CNXA 2BWXA 3MATA 5E2CA 1KQ9A 3PEBA 2EA4A 1C23A 3IU8A 1BN5A 2BWTA 4RZZA 4IPAA 4OOKA 1XNZA 4S01A 2GG0A 3D27A 1B6AA 2GG7A 4PNCA 1WLRA 4QR8A 5CIKA 1XGSA 3FM3A 3RORA 2GU6A 2BH3A 2GG5A 4FO7A 2G6PA 2B3LA 3L7GA 3O5VA 1WKMA 3BIQA 2ADUA 2GGBA 2BHCA 3PKEA 3PN9A 3TAVA 2GU5A 1QXYA 2GU4A 2GZ5A 4FKCA 3MR1A 4FLIA 3RVAA 1R5GA 2OKNA 3CTZA 1WL9A 3OVKA 2BB7A 4ZWPA 4HXXA 4EGEA 2EVMA 4S00A 5E5BA 3BIPA 4A6WA 1BOAA 2HOWA 5CDVA 2EA2A 4U76A 1W7VA 1CHMA 3IL0A 4IKTA 5CE6A 3Q6DA 2GA2A 5JFRA 1WBQA 4IKUA 5CDEA 2Q92A 4U1BA 4ZNGA 1WN1A 2BN7A 1C24A 3FMQA 2Q8KA 3PKBA 5FCHA 5CDLA 1Y1NA 1KQ0A 2Q94A 4U70A 1C27A 4U73A 2Q95A 4ZWOA 2Q96A 3QOCA 2GG3A 1R58A 3PKCA 4RGZ1 2B3HA 2NQ6A 3PKAA 4IECA 4JUQA 4IKSA 3BITA 4RZYA 4U6ZA 1PV9A 4MATA 2GG9A 2Q93A 2OAZA 4FUKA 5CLSA 2ZSGA 1C22A 2BWWA 1MATA 4U6WA 1KP0A 1WL6A 1YW7A 2EVOA 3IU7A 4FLLA 5D6EA 3S6BA 2NQ7A 1W2MA 3IG4A 1XGNA 1YW8A 1M35A 4ZWUA 4U6JA 2DFIA 3PKDA 2MATA 1R5HA 4IKRA 4IU6A 1C21A 2IW2A 4IDYA 2BWSA 4FLKA 4IF7A 1JAWA 1XGMA 3CB5A 1N51A 2B3KA 2BWYA 3CB6A 4S2TP 2P9AA 1A16A 4R60A 3I7MA 2BWUA 4U75A 1QZYA 1QXWA 4U71A 1O0XA 2GTXA 1YW9A 4KM3A 2BHBA 2BHAA 2V3YA 2V6CA 4FO8A 1WY2A 2GG2A 4A6VA 4FLJA 5JHUA 4PV4A 2GGCA
chains in the Genus database with same CATH topology
3MX6A 2BHDA 4U6EA 4U69A 5JI6A 5D6FA 1XGOA 2V3ZA 3OOOA 3TB5A 2P98A 1B59A 2V3XA 3L24A 5FCFA 4S2RP 1YVMA 2EVCA 2GG8A 1QXZA 2P99A 4B28A 3IU9A 4U6CA 1YJ3A 2GU7A 2BWVA 3FMRA 4Z7MA 5CNXA 2BWXA 3MATA 5E2CA 1KQ9A 3PEBA 2EA4A 1C23A 3IU8A 1BN5A 2BWTA 4RZZA 4IPAA 4OOKA 1XNZA 4S01A 2GG0A 3D27A 1B6AA 2GG7A 4PNCA 1WLRA 4QR8A 5CIKA 1XGSA 3FM3A 3RORA 2GU6A 2BH3A 2GG5A 4FO7A 2G6PA 2B3LA 3L7GA 3O5VA 1WKMA 3BIQA 2ADUA 2GGBA 2BHCA 3PKEA 3PN9A 3TAVA 2GU5A 1QXYA 2GU4A 2GZ5A 4FKCA 3MR1A 4FLIA 3RVAA 1R5GA 2OKNA 3CTZA 1WL9A 3OVKA 2BB7A 4ZWPA 4HXXA 4EGEA 2EVMA 4S00A 5E5BA 3BIPA 4A6WA 1BOAA 2HOWA 5CDVA 2EA2A 4U76A 1W7VA 1CHMA 3IL0A 4IKTA 5CE6A 3Q6DA 2GA2A 5JFRA 1WBQA 4IKUA 5CDEA 2Q92A 4U1BA 4ZNGA 1WN1A 2BN7A 1C24A 3FMQA 2Q8KA 3PKBA 5FCHA 5CDLA 1Y1NA 1KQ0A 2Q94A 4U70A 1C27A 4U73A 2Q95A 4ZWOA 2Q96A 3QOCA 2GG3A 1R58A 3PKCA 4RGZ1 2B3HA 2NQ6A 3PKAA 4IECA 4JUQA 4IKSA 3BITA 4RZYA 4U6ZA 1PV9A 4MATA 2GG9A 2Q93A 2OAZA 4FUKA 5CLSA 2ZSGA 1C22A 2BWWA 1MATA 4U6WA 1KP0A 1WL6A 1YW7A 2EVOA 3IU7A 4FLLA 5D6EA 3S6BA 2NQ7A 1W2MA 3IG4A 1XGNA 1YW8A 1M35A 4ZWUA 4U6JA 2DFIA 3PKDA 2MATA 1R5HA 4IKRA 4IU6A 1C21A 2IW2A 4IDYA 2BWSA 4FLKA 4IF7A 1JAWA 1XGMA 3CB5A 1N51A 2B3KA 2BWYA 3CB6A 4S2TP 2P9AA 1A16A 4R60A 3I7MA 2BWUA 4U75A 1QZYA 1QXWA 4U71A 1O0XA 2GTXA 1YW9A 4KM3A 2BHBA 2BHAA 2V3YA 2V6CA 4FO8A 1WY2A 2GG2A 4A6VA 4FLJA 5JHUA 4PV4A 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX6 A;  2BHD A;  4U6E A;  4U69 A;  5JI6 A;  5D6F A;  1XGO A;  2V3Z A;  3OOO A;  3TB5 A;  2P98 A;  1B59 A;  2V3X A;  3L24 A;  5FCF A;  4S2R P;  1YVM A;  2EVC A;  2GG8 A;  1QXZ A;  2P99 A;  4B28 A;  3IU9 A;  4U6C A;  1YJ3 A;  2GU7 A;  2BWV A;  3FMR A;  4Z7M A;  5CNX A;  2BWX A;  3MAT A;  5E2C A;  1KQ9 A;  3PEB A;  2EA4 A;  1C23 A;  3IU8 A;  1BN5 A;  2BWT A;  4RZZ A;  4IPA A;  4OOK A;  1XNZ A;  4S01 A;  2GG0 A;  3D27 A;  1B6A A;  2GG7 A;  4PNC A;  1WLR A;  4QR8 A;  5CIK A;  1XGS A;  3FM3 A;  3ROR A;  2GU6 A;  2BH3 A;  2GG5 A;  4FO7 A;  2G6P A;  2B3L A;  3L7G A;  3O5V A;  1WKM A;  3BIQ A;  2ADU A;  2GGB A;  2BHC A;  3PKE A;  3PN9 A;  3TAV A;  2GU5 A;  1QXY A;  2GU4 A;  2GZ5 A;  4FKC A;  3MR1 A;  4FLI A;  3RVA A;  1R5G A;  2OKN A;  3CTZ A;  1WL9 A;  3OVK A;  2BB7 A;  4ZWP A;  4HXX A;  4EGE A;  2EVM A;  4S00 A;  5E5B A;  3BIP A;  4A6W A;  1BOA A;  2HOW A;  5CDV A;  2EA2 A;  4U76 A;  1W7V A;  1CHM A;  3IL0 A;  4IKT A;  5CE6 A;  3Q6D A;  2GA2 A;  5JFR A;  1WBQ A;  4IKU A;  5CDE A;  2Q92 A;  4U1B A;  4ZNG A;  1WN1 A;  2BN7 A;  1C24 A;  3FMQ A;  2Q8K A;  3PKB A;  5FCH A;  5CDL A;  1Y1N A;  1KQ0 A;  2Q94 A;  4U70 A;  1C27 A;  4U73 A;  2Q95 A;  4ZWO A;  2Q96 A;  3QOC A;  2GG3 A;  1R58 A;  3PKC A;  4RGZ 1;  2B3H A;  2NQ6 A;  3PKA A;  4IEC A;  4JUQ A;  4IKS A;  3BIT A;  4RZY A;  4U6Z A;  1PV9 A;  4MAT A;  2GG9 A;  2Q93 A;  2OAZ A;  4FUK A;  5CLS A;  2ZSG A;  1C22 A;  2BWW A;  1MAT A;  4U6W A;  1KP0 A;  1WL6 A;  1YW7 A;  2EVO A;  3IU7 A;  4FLL A;  5D6E A;  3S6B A;  2NQ7 A;  1W2M A;  3IG4 A;  1XGN A;  1YW8 A;  1M35 A;  4ZWU A;  4U6J A;  2DFI A;  3PKD A;  2MAT A;  1R5H A;  4IKR A;  4IU6 A;  1C21 A;  2IW2 A;  4IDY A;  2BWS A;  4FLK A;  4IF7 A;  1JAW A;  1XGM A;  3CB5 A;  1N51 A;  2B3K A;  2BWY A;  3CB6 A;  4S2T P;  2P9A A;  1A16 A;  4R60 A;  3I7M A;  2BWU A;  4U75 A;  1QZY A;  1QXW A;  4U71 A;  1O0X A;  2GTX A;  1YW9 A;  4KM3 A;  2BHB A;  2BHA A;  2V3Y A;  2V6C A;  4FO8 A;  1WY2 A;  2GG2 A;  4A6V A;  4FLJ A;  5JHU A;  4PV4 A;  2GGC A; 
#chains in the Genus database with same CATH topology
 3MX6 A;  2BHD A;  4U6E A;  4U69 A;  5JI6 A;  5D6F A;  1XGO A;  2V3Z A;  3OOO A;  3TB5 A;  2P98 A;  1B59 A;  2V3X A;  3L24 A;  5FCF A;  4S2R P;  1YVM A;  2EVC A;  2GG8 A;  1QXZ A;  2P99 A;  4B28 A;  3IU9 A;  4U6C A;  1YJ3 A;  2GU7 A;  2BWV A;  3FMR A;  4Z7M A;  5CNX A;  2BWX A;  3MAT A;  5E2C A;  1KQ9 A;  3PEB A;  2EA4 A;  1C23 A;  3IU8 A;  1BN5 A;  2BWT A;  4RZZ A;  4IPA A;  4OOK A;  1XNZ A;  4S01 A;  2GG0 A;  3D27 A;  1B6A A;  2GG7 A;  4PNC A;  1WLR A;  4QR8 A;  5CIK A;  1XGS A;  3FM3 A;  3ROR A;  2GU6 A;  2BH3 A;  2GG5 A;  4FO7 A;  2G6P A;  2B3L A;  3L7G A;  3O5V A;  1WKM A;  3BIQ A;  2ADU A;  2GGB A;  2BHC A;  3PKE A;  3PN9 A;  3TAV A;  2GU5 A;  1QXY A;  2GU4 A;  2GZ5 A;  4FKC A;  3MR1 A;  4FLI A;  3RVA A;  1R5G A;  2OKN A;  3CTZ A;  1WL9 A;  3OVK A;  2BB7 A;  4ZWP A;  4HXX A;  4EGE A;  2EVM A;  4S00 A;  5E5B A;  3BIP A;  4A6W A;  1BOA A;  2HOW A;  5CDV A;  2EA2 A;  4U76 A;  1W7V A;  1CHM A;  3IL0 A;  4IKT A;  5CE6 A;  3Q6D A;  2GA2 A;  5JFR A;  1WBQ A;  4IKU A;  5CDE A;  2Q92 A;  4U1B A;  4ZNG A;  1WN1 A;  2BN7 A;  1C24 A;  3FMQ A;  2Q8K A;  3PKB A;  5FCH A;  5CDL A;  1Y1N A;  1KQ0 A;  2Q94 A;  4U70 A;  1C27 A;  4U73 A;  2Q95 A;  4ZWO A;  2Q96 A;  3QOC A;  2GG3 A;  1R58 A;  3PKC A;  4RGZ 1;  2B3H A;  2NQ6 A;  3PKA A;  4IEC A;  4JUQ A;  4IKS A;  3BIT A;  4RZY A;  4U6Z A;  1PV9 A;  4MAT A;  2GG9 A;  2Q93 A;  2OAZ A;  4FUK A;  5CLS A;  2ZSG A;  1C22 A;  2BWW A;  1MAT A;  4U6W A;  1KP0 A;  1WL6 A;  1YW7 A;  2EVO A;  3IU7 A;  4FLL A;  5D6E A;  3S6B A;  2NQ7 A;  1W2M A;  3IG4 A;  1XGN A;  1YW8 A;  1M35 A;  4ZWU A;  4U6J A;  2DFI A;  3PKD A;  2MAT A;  1R5H A;  4IKR A;  4IU6 A;  1C21 A;  2IW2 A;  4IDY A;  2BWS A;  4FLK A;  4IF7 A;  1JAW A;  1XGM A;  3CB5 A;  1N51 A;  2B3K A;  2BWY A;  3CB6 A;  4S2T P;  2P9A A;  1A16 A;  4R60 A;  3I7M A;  2BWU A;  4U75 A;  1QZY A;  1QXW A;  4U71 A;  1O0X A;  2GTX A;  1YW9 A;  4KM3 A;  2BHB A;  2BHA A;  2V3Y A;  2V6C A;  4FO8 A;  1WY2 A;  2GG2 A;  4A6V A;  4FLJ A;  5JHU A;  4PV4 A;  2GGC A; 
#chains in the Genus database with same CATH homology
 3MX6 A;  2BHD A;  4U6E A;  4U69 A;  5JI6 A;  5D6F A;  1XGO A;  2V3Z A;  3OOO A;  3TB5 A;  2P98 A;  1B59 A;  2V3X A;  3L24 A;  5FCF A;  4S2R P;  1YVM A;  2EVC A;  2GG8 A;  1QXZ A;  2P99 A;  4B28 A;  3IU9 A;  4U6C A;  1YJ3 A;  2GU7 A;  2BWV A;  3FMR A;  4Z7M A;  5CNX A;  2BWX A;  3MAT A;  5E2C A;  1KQ9 A;  3PEB A;  2EA4 A;  1C23 A;  3IU8 A;  1BN5 A;  2BWT A;  4RZZ A;  4IPA A;  4OOK A;  1XNZ A;  4S01 A;  2GG0 A;  3D27 A;  1B6A A;  2GG7 A;  4PNC A;  1WLR A;  4QR8 A;  5CIK A;  1XGS A;  3FM3 A;  3ROR A;  2GU6 A;  2BH3 A;  2GG5 A;  4FO7 A;  2G6P A;  2B3L A;  3L7G A;  3O5V A;  1WKM A;  3BIQ A;  2ADU A;  2GGB A;  2BHC A;  3PKE A;  3PN9 A;  3TAV A;  2GU5 A;  1QXY A;  2GU4 A;  2GZ5 A;  4FKC A;  3MR1 A;  4FLI A;  3RVA A;  1R5G A;  2OKN A;  3CTZ A;  1WL9 A;  3OVK A;  2BB7 A;  4ZWP A;  4HXX A;  4EGE A;  2EVM A;  4S00 A;  5E5B A;  3BIP A;  4A6W A;  1BOA A;  2HOW A;  5CDV A;  2EA2 A;  4U76 A;  1W7V A;  1CHM A;  3IL0 A;  4IKT A;  5CE6 A;  3Q6D A;  2GA2 A;  5JFR A;  1WBQ A;  4IKU A;  5CDE A;  2Q92 A;  4U1B A;  4ZNG A;  1WN1 A;  2BN7 A;  1C24 A;  3FMQ A;  2Q8K A;  3PKB A;  5FCH A;  5CDL A;  1Y1N A;  1KQ0 A;  2Q94 A;  4U70 A;  1C27 A;  4U73 A;  2Q95 A;  4ZWO A;  2Q96 A;  3QOC A;  2GG3 A;  1R58 A;  3PKC A;  4RGZ 1;  2B3H A;  2NQ6 A;  3PKA A;  4IEC A;  4JUQ A;  4IKS A;  3BIT A;  4RZY A;  4U6Z A;  1PV9 A;  4MAT A;  2GG9 A;  2Q93 A;  2OAZ A;  4FUK A;  5CLS A;  2ZSG A;  1C22 A;  2BWW A;  1MAT A;  4U6W A;  1KP0 A;  1WL6 A;  1YW7 A;  2EVO A;  3IU7 A;  4FLL A;  5D6E A;  3S6B A;  2NQ7 A;  1W2M A;  3IG4 A;  1XGN A;  1YW8 A;  1M35 A;  4ZWU A;  4U6J A;  2DFI A;  3PKD A;  2MAT A;  1R5H A;  4IKR A;  4IU6 A;  1C21 A;  2IW2 A;  4IDY A;  2BWS A;  4FLK A;  4IF7 A;  1JAW A;  1XGM A;  3CB5 A;  1N51 A;  2B3K A;  2BWY A;  3CB6 A;  4S2T P;  2P9A A;  1A16 A;  4R60 A;  3I7M A;  2BWU A;  4U75 A;  1QZY A;  1QXW A;  4U71 A;  1O0X A;  2GTX A;  1YW9 A;  4KM3 A;  2BHB A;  2BHA A;  2V3Y A;  2V6C A;  4FO8 A;  1WY2 A;  2GG2 A;  4A6V A;  4FLJ A;  5JHU A;  4PV4 A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...