1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
1JAWA 1WBQA 3MATA 2GG2A 3IU9A 5JI6A 1QXYA 2GG3A 2GG7A 2GTXA 5D6EA 1XGSA 3O5VA 2GU4A 1QZYA 2Q8KA 1KQ9A 4ZWOA 2GZ5A 2IW2A 1YVMA 2EA4A 2EVOA 1WL6A 4IKUA 4OOKA 2HOWA 1O0XA 4U69A 2GA2A 2V3ZA 3RORA 3TAVA 5D6FA 2OAZA 1C22A 5CE6A 1MATA 5FCFA 1BN5A 3PKDA 2B3HA 2GG5A 1YW7A 3BIPA 2ADUA 2GG0A 3PN9A 4U6CA 4U75A 4IKSA 2GGBA 1WY2A 5CDLA 4U70A 3TB5A 2BWTA 1KP0A 3Q6DA 3MX6A 4A6WA 1QXZA 2BWWA 3CTZA 2NQ6A 4FLJA 5CLSA 4FO8A 1QXWA 3FMRA 4IECA 1B6AA 4IU6A 4IF7A 5CDEA 2P99A 4Z7MA 1WN1A 1M35A 3PEBA 2BH3A 4RGZ1 1C21A 4PV4A 1YW8A 2GG8A 3PKBA 4IKRA 2BB7A 4PNCA 2BWUA 3CB6A 3QOCA 5E2CA 2EVMA 4U6JA 4ZNGA 2V3XA 4ZWPA 4U6WA 2P9AA 1Y1NA 3PKEA 2GU7A 2BWYA 3RVAA 5CIKA 3IU8A 3MR1A 2Q96A 2B3LA 4EGEA 1WKMA 4S00A 4ZWUA 4R60A 1YJ3A 2GU6A 5CNXA 1BOAA 4KM3A 3PKCA 4U6EA 3FMQA 2B3KA 1C27A 4IKTA 2BN7A 1W7VA 4FLKA 1N51A 3IL0A 3OVKA 3I7MA 4U76A 4JUQA 4FUKA 4U73A 4RZYA 3CB5A 1XGNA 2BHDA 4QR8A 4HXXA 2G6PA 2BHAA 4MATA 2BWSA 2BHCA 3L7GA 1C23A 5E5BA 3BITA 1R5HA 1XGOA 2P98A 3D27A 2Q94A 2ZSGA 4IDYA 4B28A 2V6CA 4S2TP 2BHBA 3FM3A 2V3YA 1PV9A 1CHMA 2BWVA 5CDVA 4A6VA 4FKCA 2GU5A 5JHUA 1A16A 3BIQA 1WLRA 4IPAA 1B59A 4U6ZA 3IG4A 1YW9A 4FO7A 4S2RP 1C24A 2Q95A 4U71A 4S01A 1R5GA 1WL9A 2Q92A 4FLIA 2Q93A 5FCHA 2GG9A 2OKNA 3L24A 2GGCA 1KQ0A 4FLLA 1XNZA 2DFIA 4RZZA 1XGMA 4U1BA 1R58A 2EA2A 2BWXA 3S6BA 5JFRA 2MATA 3PKAA 2NQ7A 2EVCA 1W2MA 3OOOA 3IU7A
chains in the Genus database with same CATH superfamily
1JAWA 1WBQA 3MATA 2GG2A 3IU9A 5JI6A 1QXYA 2GG3A 2GG7A 2GTXA 5D6EA 1XGSA 3O5VA 2GU4A 1QZYA 2Q8KA 1KQ9A 4ZWOA 2GZ5A 2IW2A 1YVMA 2EA4A 2EVOA 1WL6A 4IKUA 4OOKA 2HOWA 1O0XA 4U69A 2GA2A 2V3ZA 3RORA 3TAVA 5D6FA 2OAZA 1C22A 5CE6A 1MATA 5FCFA 1BN5A 3PKDA 2B3HA 2GG5A 1YW7A 3BIPA 2ADUA 2GG0A 3PN9A 4U6CA 4U75A 4IKSA 2GGBA 1WY2A 5CDLA 4U70A 3TB5A 2BWTA 1KP0A 3Q6DA 3MX6A 4A6WA 1QXZA 2BWWA 3CTZA 2NQ6A 4FLJA 5CLSA 4FO8A 1QXWA 3FMRA 4IECA 1B6AA 4IU6A 4IF7A 5CDEA 2P99A 4Z7MA 1WN1A 1M35A 3PEBA 2BH3A 4RGZ1 1C21A 4PV4A 1YW8A 2GG8A 3PKBA 4IKRA 2BB7A 4PNCA 2BWUA 3CB6A 3QOCA 5E2CA 2EVMA 4U6JA 4ZNGA 2V3XA 4ZWPA 4U6WA 2P9AA 1Y1NA 3PKEA 2GU7A 2BWYA 3RVAA 5CIKA 3IU8A 3MR1A 2Q96A 2B3LA 4EGEA 1WKMA 4S00A 4ZWUA 4R60A 1YJ3A 2GU6A 5CNXA 1BOAA 4KM3A 3PKCA 4U6EA 3FMQA 2B3KA 1C27A 4IKTA 2BN7A 1W7VA 4FLKA 1N51A 3IL0A 3OVKA 3I7MA 4U76A 4JUQA 4FUKA 4U73A 4RZYA 3CB5A 1XGNA 2BHDA 4QR8A 4HXXA 2G6PA 2BHAA 4MATA 2BWSA 2BHCA 3L7GA 1C23A 5E5BA 3BITA 1R5HA 1XGOA 2P98A 3D27A 2Q94A 2ZSGA 4IDYA 4B28A 2V6CA 4S2TP 2BHBA 3FM3A 2V3YA 1PV9A 1CHMA 2BWVA 5CDVA 4A6VA 4FKCA 2GU5A 5JHUA 1A16A 3BIQA 1WLRA 4IPAA 1B59A 4U6ZA 3IG4A 1YW9A 4FO7A 4S2RP 1C24A 2Q95A 4U71A 4S01A 1R5GA 1WL9A 2Q92A 4FLIA 2Q93A 5FCHA 2GG9A 2OKNA 3L24A 2GGCA 1KQ0A 4FLLA 1XNZA 2DFIA 4RZZA 1XGMA 4U1BA 1R58A 2EA2A 2BWXA 3S6BA 5JFRA 2MATA 3PKAA 2NQ7A 2EVCA 1W2MA 3OOOA 3IU7A
chains in the Genus database with same CATH topology
1JAWA 1WBQA 3MATA 2GG2A 3IU9A 5JI6A 1QXYA 2GG3A 2GG7A 2GTXA 5D6EA 1XGSA 3O5VA 2GU4A 1QZYA 2Q8KA 1KQ9A 4ZWOA 2GZ5A 2IW2A 1YVMA 2EA4A 2EVOA 1WL6A 4IKUA 4OOKA 2HOWA 1O0XA 4U69A 2GA2A 2V3ZA 3RORA 3TAVA 5D6FA 2OAZA 1C22A 5CE6A 1MATA 5FCFA 1BN5A 3PKDA 2B3HA 2GG5A 1YW7A 3BIPA 2ADUA 2GG0A 3PN9A 4U6CA 4U75A 4IKSA 2GGBA 1WY2A 5CDLA 4U70A 3TB5A 2BWTA 1KP0A 3Q6DA 3MX6A 4A6WA 1QXZA 2BWWA 3CTZA 2NQ6A 4FLJA 5CLSA 4FO8A 1QXWA 3FMRA 4IECA 1B6AA 4IU6A 4IF7A 5CDEA 2P99A 4Z7MA 1WN1A 1M35A 3PEBA 2BH3A 4RGZ1 1C21A 4PV4A 1YW8A 2GG8A 3PKBA 4IKRA 2BB7A 4PNCA 2BWUA 3CB6A 3QOCA 5E2CA 2EVMA 4U6JA 4ZNGA 2V3XA 4ZWPA 4U6WA 2P9AA 1Y1NA 3PKEA 2GU7A 2BWYA 3RVAA 5CIKA 3IU8A 3MR1A 2Q96A 2B3LA 4EGEA 1WKMA 4S00A 4ZWUA 4R60A 1YJ3A 2GU6A 5CNXA 1BOAA 4KM3A 3PKCA 4U6EA 3FMQA 2B3KA 1C27A 4IKTA 2BN7A 1W7VA 4FLKA 1N51A 3IL0A 3OVKA 3I7MA 4U76A 4JUQA 4FUKA 4U73A 4RZYA 3CB5A 1XGNA 2BHDA 4QR8A 4HXXA 2G6PA 2BHAA 4MATA 2BWSA 2BHCA 3L7GA 1C23A 5E5BA 3BITA 1R5HA 1XGOA 2P98A 3D27A 2Q94A 2ZSGA 4IDYA 4B28A 2V6CA 4S2TP 2BHBA 3FM3A 2V3YA 1PV9A 1CHMA 2BWVA 5CDVA 4A6VA 4FKCA 2GU5A 5JHUA 1A16A 3BIQA 1WLRA 4IPAA 1B59A 4U6ZA 3IG4A 1YW9A 4FO7A 4S2RP 1C24A 2Q95A 4U71A 4S01A 1R5GA 1WL9A 2Q92A 4FLIA 2Q93A 5FCHA 2GG9A 2OKNA 3L24A 2GGCA 1KQ0A 4FLLA 1XNZA 2DFIA 4RZZA 1XGMA 4U1BA 1R58A 2EA2A 2BWXA 3S6BA 5JFRA 2MATA 3PKAA 2NQ7A 2EVCA 1W2MA 3OOOA 3IU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAW A;  1WBQ A;  3MAT A;  2GG2 A;  3IU9 A;  5JI6 A;  1QXY A;  2GG3 A;  2GG7 A;  2GTX A;  5D6E A;  1XGS A;  3O5V A;  2GU4 A;  1QZY A;  2Q8K A;  1KQ9 A;  4ZWO A;  2GZ5 A;  2IW2 A;  1YVM A;  2EA4 A;  2EVO A;  1WL6 A;  4IKU A;  4OOK A;  2HOW A;  1O0X A;  4U69 A;  2GA2 A;  2V3Z A;  3ROR A;  3TAV A;  5D6F A;  2OAZ A;  1C22 A;  5CE6 A;  1MAT A;  5FCF A;  1BN5 A;  3PKD A;  2B3H A;  2GG5 A;  1YW7 A;  3BIP A;  2ADU A;  2GG0 A;  3PN9 A;  4U6C A;  4U75 A;  4IKS A;  2GGB A;  1WY2 A;  5CDL A;  4U70 A;  3TB5 A;  2BWT A;  1KP0 A;  3Q6D A;  3MX6 A;  4A6W A;  1QXZ A;  2BWW A;  3CTZ A;  2NQ6 A;  4FLJ A;  5CLS A;  4FO8 A;  1QXW A;  3FMR A;  4IEC A;  1B6A A;  4IU6 A;  4IF7 A;  5CDE A;  2P99 A;  4Z7M A;  1WN1 A;  1M35 A;  3PEB A;  2BH3 A;  4RGZ 1;  1C21 A;  4PV4 A;  1YW8 A;  2GG8 A;  3PKB A;  4IKR A;  2BB7 A;  4PNC A;  2BWU A;  3CB6 A;  3QOC A;  5E2C A;  2EVM A;  4U6J A;  4ZNG A;  2V3X A;  4ZWP A;  4U6W A;  2P9A A;  1Y1N A;  3PKE A;  2GU7 A;  2BWY A;  3RVA A;  5CIK A;  3IU8 A;  3MR1 A;  2Q96 A;  2B3L A;  4EGE A;  1WKM A;  4S00 A;  4ZWU A;  4R60 A;  1YJ3 A;  2GU6 A;  5CNX A;  1BOA A;  4KM3 A;  3PKC A;  4U6E A;  3FMQ A;  2B3K A;  1C27 A;  4IKT A;  2BN7 A;  1W7V A;  4FLK A;  1N51 A;  3IL0 A;  3OVK A;  3I7M A;  4U76 A;  4JUQ A;  4FUK A;  4U73 A;  4RZY A;  3CB5 A;  1XGN A;  2BHD A;  4QR8 A;  4HXX A;  2G6P A;  2BHA A;  4MAT A;  2BWS A;  2BHC A;  3L7G A;  1C23 A;  5E5B A;  3BIT A;  1R5H A;  1XGO A;  2P98 A;  3D27 A;  2Q94 A;  2ZSG A;  4IDY A;  4B28 A;  2V6C A;  4S2T P;  2BHB A;  3FM3 A;  2V3Y A;  1PV9 A;  1CHM A;  2BWV A;  5CDV A;  4A6V A;  4FKC A;  2GU5 A;  5JHU A;  1A16 A;  3BIQ A;  1WLR A;  4IPA A;  1B59 A;  4U6Z A;  3IG4 A;  1YW9 A;  4FO7 A;  4S2R P;  1C24 A;  2Q95 A;  4U71 A;  4S01 A;  1R5G A;  1WL9 A;  2Q92 A;  4FLI A;  2Q93 A;  5FCH A;  2GG9 A;  2OKN A;  3L24 A;  2GGC A;  1KQ0 A;  4FLL A;  1XNZ A;  2DFI A;  4RZZ A;  1XGM A;  4U1B A;  1R58 A;  2EA2 A;  2BWX A;  3S6B A;  5JFR A;  2MAT A;  3PKA A;  2NQ7 A;  2EVC A;  1W2M A;  3OOO A;  3IU7 A; 
#chains in the Genus database with same CATH topology
 1JAW A;  1WBQ A;  3MAT A;  2GG2 A;  3IU9 A;  5JI6 A;  1QXY A;  2GG3 A;  2GG7 A;  2GTX A;  5D6E A;  1XGS A;  3O5V A;  2GU4 A;  1QZY A;  2Q8K A;  1KQ9 A;  4ZWO A;  2GZ5 A;  2IW2 A;  1YVM A;  2EA4 A;  2EVO A;  1WL6 A;  4IKU A;  4OOK A;  2HOW A;  1O0X A;  4U69 A;  2GA2 A;  2V3Z A;  3ROR A;  3TAV A;  5D6F A;  2OAZ A;  1C22 A;  5CE6 A;  1MAT A;  5FCF A;  1BN5 A;  3PKD A;  2B3H A;  2GG5 A;  1YW7 A;  3BIP A;  2ADU A;  2GG0 A;  3PN9 A;  4U6C A;  4U75 A;  4IKS A;  2GGB A;  1WY2 A;  5CDL A;  4U70 A;  3TB5 A;  2BWT A;  1KP0 A;  3Q6D A;  3MX6 A;  4A6W A;  1QXZ A;  2BWW A;  3CTZ A;  2NQ6 A;  4FLJ A;  5CLS A;  4FO8 A;  1QXW A;  3FMR A;  4IEC A;  1B6A A;  4IU6 A;  4IF7 A;  5CDE A;  2P99 A;  4Z7M A;  1WN1 A;  1M35 A;  3PEB A;  2BH3 A;  4RGZ 1;  1C21 A;  4PV4 A;  1YW8 A;  2GG8 A;  3PKB A;  4IKR A;  2BB7 A;  4PNC A;  2BWU A;  3CB6 A;  3QOC A;  5E2C A;  2EVM A;  4U6J A;  4ZNG A;  2V3X A;  4ZWP A;  4U6W A;  2P9A A;  1Y1N A;  3PKE A;  2GU7 A;  2BWY A;  3RVA A;  5CIK A;  3IU8 A;  3MR1 A;  2Q96 A;  2B3L A;  4EGE A;  1WKM A;  4S00 A;  4ZWU A;  4R60 A;  1YJ3 A;  2GU6 A;  5CNX A;  1BOA A;  4KM3 A;  3PKC A;  4U6E A;  3FMQ A;  2B3K A;  1C27 A;  4IKT A;  2BN7 A;  1W7V A;  4FLK A;  1N51 A;  3IL0 A;  3OVK A;  3I7M A;  4U76 A;  4JUQ A;  4FUK A;  4U73 A;  4RZY A;  3CB5 A;  1XGN A;  2BHD A;  4QR8 A;  4HXX A;  2G6P A;  2BHA A;  4MAT A;  2BWS A;  2BHC A;  3L7G A;  1C23 A;  5E5B A;  3BIT A;  1R5H A;  1XGO A;  2P98 A;  3D27 A;  2Q94 A;  2ZSG A;  4IDY A;  4B28 A;  2V6C A;  4S2T P;  2BHB A;  3FM3 A;  2V3Y A;  1PV9 A;  1CHM A;  2BWV A;  5CDV A;  4A6V A;  4FKC A;  2GU5 A;  5JHU A;  1A16 A;  3BIQ A;  1WLR A;  4IPA A;  1B59 A;  4U6Z A;  3IG4 A;  1YW9 A;  4FO7 A;  4S2R P;  1C24 A;  2Q95 A;  4U71 A;  4S01 A;  1R5G A;  1WL9 A;  2Q92 A;  4FLI A;  2Q93 A;  5FCH A;  2GG9 A;  2OKN A;  3L24 A;  2GGC A;  1KQ0 A;  4FLL A;  1XNZ A;  2DFI A;  4RZZ A;  1XGM A;  4U1B A;  1R58 A;  2EA2 A;  2BWX A;  3S6B A;  5JFR A;  2MAT A;  3PKA A;  2NQ7 A;  2EVC A;  1W2M A;  3OOO A;  3IU7 A; 
#chains in the Genus database with same CATH homology
 1JAW A;  1WBQ A;  3MAT A;  2GG2 A;  3IU9 A;  5JI6 A;  1QXY A;  2GG3 A;  2GG7 A;  2GTX A;  5D6E A;  1XGS A;  3O5V A;  2GU4 A;  1QZY A;  2Q8K A;  1KQ9 A;  4ZWO A;  2GZ5 A;  2IW2 A;  1YVM A;  2EA4 A;  2EVO A;  1WL6 A;  4IKU A;  4OOK A;  2HOW A;  1O0X A;  4U69 A;  2GA2 A;  2V3Z A;  3ROR A;  3TAV A;  5D6F A;  2OAZ A;  1C22 A;  5CE6 A;  1MAT A;  5FCF A;  1BN5 A;  3PKD A;  2B3H A;  2GG5 A;  1YW7 A;  3BIP A;  2ADU A;  2GG0 A;  3PN9 A;  4U6C A;  4U75 A;  4IKS A;  2GGB A;  1WY2 A;  5CDL A;  4U70 A;  3TB5 A;  2BWT A;  1KP0 A;  3Q6D A;  3MX6 A;  4A6W A;  1QXZ A;  2BWW A;  3CTZ A;  2NQ6 A;  4FLJ A;  5CLS A;  4FO8 A;  1QXW A;  3FMR A;  4IEC A;  1B6A A;  4IU6 A;  4IF7 A;  5CDE A;  2P99 A;  4Z7M A;  1WN1 A;  1M35 A;  3PEB A;  2BH3 A;  4RGZ 1;  1C21 A;  4PV4 A;  1YW8 A;  2GG8 A;  3PKB A;  4IKR A;  2BB7 A;  4PNC A;  2BWU A;  3CB6 A;  3QOC A;  5E2C A;  2EVM A;  4U6J A;  4ZNG A;  2V3X A;  4ZWP A;  4U6W A;  2P9A A;  1Y1N A;  3PKE A;  2GU7 A;  2BWY A;  3RVA A;  5CIK A;  3IU8 A;  3MR1 A;  2Q96 A;  2B3L A;  4EGE A;  1WKM A;  4S00 A;  4ZWU A;  4R60 A;  1YJ3 A;  2GU6 A;  5CNX A;  1BOA A;  4KM3 A;  3PKC A;  4U6E A;  3FMQ A;  2B3K A;  1C27 A;  4IKT A;  2BN7 A;  1W7V A;  4FLK A;  1N51 A;  3IL0 A;  3OVK A;  3I7M A;  4U76 A;  4JUQ A;  4FUK A;  4U73 A;  4RZY A;  3CB5 A;  1XGN A;  2BHD A;  4QR8 A;  4HXX A;  2G6P A;  2BHA A;  4MAT A;  2BWS A;  2BHC A;  3L7G A;  1C23 A;  5E5B A;  3BIT A;  1R5H A;  1XGO A;  2P98 A;  3D27 A;  2Q94 A;  2ZSG A;  4IDY A;  4B28 A;  2V6C A;  4S2T P;  2BHB A;  3FM3 A;  2V3Y A;  1PV9 A;  1CHM A;  2BWV A;  5CDV A;  4A6V A;  4FKC A;  2GU5 A;  5JHU A;  1A16 A;  3BIQ A;  1WLR A;  4IPA A;  1B59 A;  4U6Z A;  3IG4 A;  1YW9 A;  4FO7 A;  4S2R P;  1C24 A;  2Q95 A;  4U71 A;  4S01 A;  1R5G A;  1WL9 A;  2Q92 A;  4FLI A;  2Q93 A;  5FCH A;  2GG9 A;  2OKN A;  3L24 A;  2GGC A;  1KQ0 A;  4FLL A;  1XNZ A;  2DFI A;  4RZZ A;  1XGM A;  4U1B A;  1R58 A;  2EA2 A;  2BWX A;  3S6B A;  5JFR A;  2MAT A;  3PKA A;  2NQ7 A;  2EVC A;  1W2M A;  3OOO A;  3IU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...