1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
4RGZ1 1XGNA 3PKBA 4U69A 1XGMA 4ZWPA 4U6CA 4IPAA 2GGCA 1N51A 4FLJA 2IW2A 2GA2A 3BIPA 2P98A 4U6JA 1WKMA 1WLRA 2BWYA 1XNZA 3L24A 4U76A 2GG8A 2BWVA 5CLSA 2Q94A 1XGOA 2EVCA 1PV9A 1YW8A 5D6EA 3MX6A 5FCHA 3PKAA 4ZWUA 1MATA 2GG0A 1R5HA 2BWWA 4FUKA 4MATA 2GG3A 1KQ0A 2Q8KA 2BWXA 2EA4A 4U71A 1WBQA 1C22A 1YVMA 3OOOA 1BN5A 1C24A 3I7MA 1YJ3A 2GG7A 2GU4A 4IECA 1R5GA 4U1BA 1WN1A 4FLIA 2EVMA 5CNXA 2GG2A 1KQ9A 3L7GA 2NQ6A 3PKEA 4PNCA 4R60A 5JI6A 1QXYA 2BN7A 1XGSA 1WY2A 1CHMA 2EVOA 4A6VA 2V3ZA 5CDVA 4IDYA 5CIKA 2EA2A 3Q6DA 1W7VA 4FLKA 2BWUA 2GG9A 3MR1A 1KP0A 3BITA 4OOKA 2BHDA 3MATA 1QZYA 2Q96A 5CDLA 2OAZA 3TAVA 4QR8A 5D6FA 3IL0A 3PN9A 4IKSA 4Z7MA 4IU6A 3CTZA 2BB7A 4IF7A 4U6EA 4FKCA 4FO7A 1B6AA 2GU7A 4S2TP 3IU9A 1B59A 1QXZA 4U6ZA 1BOAA 2NQ7A 1M35A 2BWTA 2P99A 4HXXA 2B3LA 2V3YA 4PV4A 1Y1NA 4A6WA 2HOWA 4S2RP 3PKDA 4JUQA 2BHBA 1YW7A 3D27A 4RZYA 4RZZA 5JFRA 3FM3A 4FO8A 1C27A 3CB6A 3FMRA 4IKRA 1A16A 3PKCA 3BIQA 5CDEA 4U6WA 4IKTA 2GZ5A 3O5VA 2Q95A 4ZWOA 2GU6A 3QOCA 3S6BA 5E2CA 1YW9A 2B3HA 3TB5A 2Q92A 4U70A 1R58A 3IG4A 2BHAA 3RVAA 5JHUA 2G6PA 2GG5A 2GGBA 2DFIA 1O0XA 4U75A 2ZSGA 4FLLA 2V3XA 2GU5A 1WL9A 1C23A 3IU7A 2OKNA 4IKUA 2BHCA 2V6CA 4EGEA 2GTXA 2MATA 2Q93A 5FCFA 3RORA 1JAWA 2BWSA 4B28A 2B3KA 3FMQA 3PEBA 3IU8A 4ZNGA 2ADUA 3CB5A 4U73A 4KM3A 1C21A 1QXWA 5CE6A 4S00A 1W2MA 4S01A 3OVKA 2P9AA 2BH3A 1WL6A 5E5BA
chains in the Genus database with same CATH superfamily
4RGZ1 1XGNA 3PKBA 4U69A 1XGMA 4ZWPA 4U6CA 4IPAA 2GGCA 1N51A 4FLJA 2IW2A 2GA2A 3BIPA 2P98A 4U6JA 1WKMA 1WLRA 2BWYA 1XNZA 3L24A 4U76A 2GG8A 2BWVA 5CLSA 2Q94A 1XGOA 2EVCA 1PV9A 1YW8A 5D6EA 3MX6A 5FCHA 3PKAA 4ZWUA 1MATA 2GG0A 1R5HA 2BWWA 4FUKA 4MATA 2GG3A 1KQ0A 2Q8KA 2BWXA 2EA4A 4U71A 1WBQA 1C22A 1YVMA 3OOOA 1BN5A 1C24A 3I7MA 1YJ3A 2GG7A 2GU4A 4IECA 1R5GA 4U1BA 1WN1A 4FLIA 2EVMA 5CNXA 2GG2A 1KQ9A 3L7GA 2NQ6A 3PKEA 4PNCA 4R60A 5JI6A 1QXYA 2BN7A 1XGSA 1WY2A 1CHMA 2EVOA 4A6VA 2V3ZA 5CDVA 4IDYA 5CIKA 2EA2A 3Q6DA 1W7VA 4FLKA 2BWUA 2GG9A 3MR1A 1KP0A 3BITA 4OOKA 2BHDA 3MATA 1QZYA 2Q96A 5CDLA 2OAZA 3TAVA 4QR8A 5D6FA 3IL0A 3PN9A 4IKSA 4Z7MA 4IU6A 3CTZA 2BB7A 4IF7A 4U6EA 4FKCA 4FO7A 1B6AA 2GU7A 4S2TP 3IU9A 1B59A 1QXZA 4U6ZA 1BOAA 2NQ7A 1M35A 2BWTA 2P99A 4HXXA 2B3LA 2V3YA 4PV4A 1Y1NA 4A6WA 2HOWA 4S2RP 3PKDA 4JUQA 2BHBA 1YW7A 3D27A 4RZYA 4RZZA 5JFRA 3FM3A 4FO8A 1C27A 3CB6A 3FMRA 4IKRA 1A16A 3PKCA 3BIQA 5CDEA 4U6WA 4IKTA 2GZ5A 3O5VA 2Q95A 4ZWOA 2GU6A 3QOCA 3S6BA 5E2CA 1YW9A 2B3HA 3TB5A 2Q92A 4U70A 1R58A 3IG4A 2BHAA 3RVAA 5JHUA 2G6PA 2GG5A 2GGBA 2DFIA 1O0XA 4U75A 2ZSGA 4FLLA 2V3XA 2GU5A 1WL9A 1C23A 3IU7A 2OKNA 4IKUA 2BHCA 2V6CA 4EGEA 2GTXA 2MATA 2Q93A 5FCFA 3RORA 1JAWA 2BWSA 4B28A 2B3KA 3FMQA 3PEBA 3IU8A 4ZNGA 2ADUA 3CB5A 4U73A 4KM3A 1C21A 1QXWA 5CE6A 4S00A 1W2MA 4S01A 3OVKA 2P9AA 2BH3A 1WL6A 5E5BA
chains in the Genus database with same CATH topology
4RGZ1 1XGNA 3PKBA 4U69A 1XGMA 4ZWPA 4U6CA 4IPAA 2GGCA 1N51A 4FLJA 2IW2A 2GA2A 3BIPA 2P98A 4U6JA 1WKMA 1WLRA 2BWYA 1XNZA 3L24A 4U76A 2GG8A 2BWVA 5CLSA 2Q94A 1XGOA 2EVCA 1PV9A 1YW8A 5D6EA 3MX6A 5FCHA 3PKAA 4ZWUA 1MATA 2GG0A 1R5HA 2BWWA 4FUKA 4MATA 2GG3A 1KQ0A 2Q8KA 2BWXA 2EA4A 4U71A 1WBQA 1C22A 1YVMA 3OOOA 1BN5A 1C24A 3I7MA 1YJ3A 2GG7A 2GU4A 4IECA 1R5GA 4U1BA 1WN1A 4FLIA 2EVMA 5CNXA 2GG2A 1KQ9A 3L7GA 2NQ6A 3PKEA 4PNCA 4R60A 5JI6A 1QXYA 2BN7A 1XGSA 1WY2A 1CHMA 2EVOA 4A6VA 2V3ZA 5CDVA 4IDYA 5CIKA 2EA2A 3Q6DA 1W7VA 4FLKA 2BWUA 2GG9A 3MR1A 1KP0A 3BITA 4OOKA 2BHDA 3MATA 1QZYA 2Q96A 5CDLA 2OAZA 3TAVA 4QR8A 5D6FA 3IL0A 3PN9A 4IKSA 4Z7MA 4IU6A 3CTZA 2BB7A 4IF7A 4U6EA 4FKCA 4FO7A 1B6AA 2GU7A 4S2TP 3IU9A 1B59A 1QXZA 4U6ZA 1BOAA 2NQ7A 1M35A 2BWTA 2P99A 4HXXA 2B3LA 2V3YA 4PV4A 1Y1NA 4A6WA 2HOWA 4S2RP 3PKDA 4JUQA 2BHBA 1YW7A 3D27A 4RZYA 4RZZA 5JFRA 3FM3A 4FO8A 1C27A 3CB6A 3FMRA 4IKRA 1A16A 3PKCA 3BIQA 5CDEA 4U6WA 4IKTA 2GZ5A 3O5VA 2Q95A 4ZWOA 2GU6A 3QOCA 3S6BA 5E2CA 1YW9A 2B3HA 3TB5A 2Q92A 4U70A 1R58A 3IG4A 2BHAA 3RVAA 5JHUA 2G6PA 2GG5A 2GGBA 2DFIA 1O0XA 4U75A 2ZSGA 4FLLA 2V3XA 2GU5A 1WL9A 1C23A 3IU7A 2OKNA 4IKUA 2BHCA 2V6CA 4EGEA 2GTXA 2MATA 2Q93A 5FCFA 3RORA 1JAWA 2BWSA 4B28A 2B3KA 3FMQA 3PEBA 3IU8A 4ZNGA 2ADUA 3CB5A 4U73A 4KM3A 1C21A 1QXWA 5CE6A 4S00A 1W2MA 4S01A 3OVKA 2P9AA 2BH3A 1WL6A 5E5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGZ 1;  1XGN A;  3PKB A;  4U69 A;  1XGM A;  4ZWP A;  4U6C A;  4IPA A;  2GGC A;  1N51 A;  4FLJ A;  2IW2 A;  2GA2 A;  3BIP A;  2P98 A;  4U6J A;  1WKM A;  1WLR A;  2BWY A;  1XNZ A;  3L24 A;  4U76 A;  2GG8 A;  2BWV A;  5CLS A;  2Q94 A;  1XGO A;  2EVC A;  1PV9 A;  1YW8 A;  5D6E A;  3MX6 A;  5FCH A;  3PKA A;  4ZWU A;  1MAT A;  2GG0 A;  1R5H A;  2BWW A;  4FUK A;  4MAT A;  2GG3 A;  1KQ0 A;  2Q8K A;  2BWX A;  2EA4 A;  4U71 A;  1WBQ A;  1C22 A;  1YVM A;  3OOO A;  1BN5 A;  1C24 A;  3I7M A;  1YJ3 A;  2GG7 A;  2GU4 A;  4IEC A;  1R5G A;  4U1B A;  1WN1 A;  4FLI A;  2EVM A;  5CNX A;  2GG2 A;  1KQ9 A;  3L7G A;  2NQ6 A;  3PKE A;  4PNC A;  4R60 A;  5JI6 A;  1QXY A;  2BN7 A;  1XGS A;  1WY2 A;  1CHM A;  2EVO A;  4A6V A;  2V3Z A;  5CDV A;  4IDY A;  5CIK A;  2EA2 A;  3Q6D A;  1W7V A;  4FLK A;  2BWU A;  2GG9 A;  3MR1 A;  1KP0 A;  3BIT A;  4OOK A;  2BHD A;  3MAT A;  1QZY A;  2Q96 A;  5CDL A;  2OAZ A;  3TAV A;  4QR8 A;  5D6F A;  3IL0 A;  3PN9 A;  4IKS A;  4Z7M A;  4IU6 A;  3CTZ A;  2BB7 A;  4IF7 A;  4U6E A;  4FKC A;  4FO7 A;  1B6A A;  2GU7 A;  4S2T P;  3IU9 A;  1B59 A;  1QXZ A;  4U6Z A;  1BOA A;  2NQ7 A;  1M35 A;  2BWT A;  2P99 A;  4HXX A;  2B3L A;  2V3Y A;  4PV4 A;  1Y1N A;  4A6W A;  2HOW A;  4S2R P;  3PKD A;  4JUQ A;  2BHB A;  1YW7 A;  3D27 A;  4RZY A;  4RZZ A;  5JFR A;  3FM3 A;  4FO8 A;  1C27 A;  3CB6 A;  3FMR A;  4IKR A;  1A16 A;  3PKC A;  3BIQ A;  5CDE A;  4U6W A;  4IKT A;  2GZ5 A;  3O5V A;  2Q95 A;  4ZWO A;  2GU6 A;  3QOC A;  3S6B A;  5E2C A;  1YW9 A;  2B3H A;  3TB5 A;  2Q92 A;  4U70 A;  1R58 A;  3IG4 A;  2BHA A;  3RVA A;  5JHU A;  2G6P A;  2GG5 A;  2GGB A;  2DFI A;  1O0X A;  4U75 A;  2ZSG A;  4FLL A;  2V3X A;  2GU5 A;  1WL9 A;  1C23 A;  3IU7 A;  2OKN A;  4IKU A;  2BHC A;  2V6C A;  4EGE A;  2GTX A;  2MAT A;  2Q93 A;  5FCF A;  3ROR A;  1JAW A;  2BWS A;  4B28 A;  2B3K A;  3FMQ A;  3PEB A;  3IU8 A;  4ZNG A;  2ADU A;  3CB5 A;  4U73 A;  4KM3 A;  1C21 A;  1QXW A;  5CE6 A;  4S00 A;  1W2M A;  4S01 A;  3OVK A;  2P9A A;  2BH3 A;  1WL6 A;  5E5B A; 
#chains in the Genus database with same CATH topology
 4RGZ 1;  1XGN A;  3PKB A;  4U69 A;  1XGM A;  4ZWP A;  4U6C A;  4IPA A;  2GGC A;  1N51 A;  4FLJ A;  2IW2 A;  2GA2 A;  3BIP A;  2P98 A;  4U6J A;  1WKM A;  1WLR A;  2BWY A;  1XNZ A;  3L24 A;  4U76 A;  2GG8 A;  2BWV A;  5CLS A;  2Q94 A;  1XGO A;  2EVC A;  1PV9 A;  1YW8 A;  5D6E A;  3MX6 A;  5FCH A;  3PKA A;  4ZWU A;  1MAT A;  2GG0 A;  1R5H A;  2BWW A;  4FUK A;  4MAT A;  2GG3 A;  1KQ0 A;  2Q8K A;  2BWX A;  2EA4 A;  4U71 A;  1WBQ A;  1C22 A;  1YVM A;  3OOO A;  1BN5 A;  1C24 A;  3I7M A;  1YJ3 A;  2GG7 A;  2GU4 A;  4IEC A;  1R5G A;  4U1B A;  1WN1 A;  4FLI A;  2EVM A;  5CNX A;  2GG2 A;  1KQ9 A;  3L7G A;  2NQ6 A;  3PKE A;  4PNC A;  4R60 A;  5JI6 A;  1QXY A;  2BN7 A;  1XGS A;  1WY2 A;  1CHM A;  2EVO A;  4A6V A;  2V3Z A;  5CDV A;  4IDY A;  5CIK A;  2EA2 A;  3Q6D A;  1W7V A;  4FLK A;  2BWU A;  2GG9 A;  3MR1 A;  1KP0 A;  3BIT A;  4OOK A;  2BHD A;  3MAT A;  1QZY A;  2Q96 A;  5CDL A;  2OAZ A;  3TAV A;  4QR8 A;  5D6F A;  3IL0 A;  3PN9 A;  4IKS A;  4Z7M A;  4IU6 A;  3CTZ A;  2BB7 A;  4IF7 A;  4U6E A;  4FKC A;  4FO7 A;  1B6A A;  2GU7 A;  4S2T P;  3IU9 A;  1B59 A;  1QXZ A;  4U6Z A;  1BOA A;  2NQ7 A;  1M35 A;  2BWT A;  2P99 A;  4HXX A;  2B3L A;  2V3Y A;  4PV4 A;  1Y1N A;  4A6W A;  2HOW A;  4S2R P;  3PKD A;  4JUQ A;  2BHB A;  1YW7 A;  3D27 A;  4RZY A;  4RZZ A;  5JFR A;  3FM3 A;  4FO8 A;  1C27 A;  3CB6 A;  3FMR A;  4IKR A;  1A16 A;  3PKC A;  3BIQ A;  5CDE A;  4U6W A;  4IKT A;  2GZ5 A;  3O5V A;  2Q95 A;  4ZWO A;  2GU6 A;  3QOC A;  3S6B A;  5E2C A;  1YW9 A;  2B3H A;  3TB5 A;  2Q92 A;  4U70 A;  1R58 A;  3IG4 A;  2BHA A;  3RVA A;  5JHU A;  2G6P A;  2GG5 A;  2GGB A;  2DFI A;  1O0X A;  4U75 A;  2ZSG A;  4FLL A;  2V3X A;  2GU5 A;  1WL9 A;  1C23 A;  3IU7 A;  2OKN A;  4IKU A;  2BHC A;  2V6C A;  4EGE A;  2GTX A;  2MAT A;  2Q93 A;  5FCF A;  3ROR A;  1JAW A;  2BWS A;  4B28 A;  2B3K A;  3FMQ A;  3PEB A;  3IU8 A;  4ZNG A;  2ADU A;  3CB5 A;  4U73 A;  4KM3 A;  1C21 A;  1QXW A;  5CE6 A;  4S00 A;  1W2M A;  4S01 A;  3OVK A;  2P9A A;  2BH3 A;  1WL6 A;  5E5B A; 
#chains in the Genus database with same CATH homology
 4RGZ 1;  1XGN A;  3PKB A;  4U69 A;  1XGM A;  4ZWP A;  4U6C A;  4IPA A;  2GGC A;  1N51 A;  4FLJ A;  2IW2 A;  2GA2 A;  3BIP A;  2P98 A;  4U6J A;  1WKM A;  1WLR A;  2BWY A;  1XNZ A;  3L24 A;  4U76 A;  2GG8 A;  2BWV A;  5CLS A;  2Q94 A;  1XGO A;  2EVC A;  1PV9 A;  1YW8 A;  5D6E A;  3MX6 A;  5FCH A;  3PKA A;  4ZWU A;  1MAT A;  2GG0 A;  1R5H A;  2BWW A;  4FUK A;  4MAT A;  2GG3 A;  1KQ0 A;  2Q8K A;  2BWX A;  2EA4 A;  4U71 A;  1WBQ A;  1C22 A;  1YVM A;  3OOO A;  1BN5 A;  1C24 A;  3I7M A;  1YJ3 A;  2GG7 A;  2GU4 A;  4IEC A;  1R5G A;  4U1B A;  1WN1 A;  4FLI A;  2EVM A;  5CNX A;  2GG2 A;  1KQ9 A;  3L7G A;  2NQ6 A;  3PKE A;  4PNC A;  4R60 A;  5JI6 A;  1QXY A;  2BN7 A;  1XGS A;  1WY2 A;  1CHM A;  2EVO A;  4A6V A;  2V3Z A;  5CDV A;  4IDY A;  5CIK A;  2EA2 A;  3Q6D A;  1W7V A;  4FLK A;  2BWU A;  2GG9 A;  3MR1 A;  1KP0 A;  3BIT A;  4OOK A;  2BHD A;  3MAT A;  1QZY A;  2Q96 A;  5CDL A;  2OAZ A;  3TAV A;  4QR8 A;  5D6F A;  3IL0 A;  3PN9 A;  4IKS A;  4Z7M A;  4IU6 A;  3CTZ A;  2BB7 A;  4IF7 A;  4U6E A;  4FKC A;  4FO7 A;  1B6A A;  2GU7 A;  4S2T P;  3IU9 A;  1B59 A;  1QXZ A;  4U6Z A;  1BOA A;  2NQ7 A;  1M35 A;  2BWT A;  2P99 A;  4HXX A;  2B3L A;  2V3Y A;  4PV4 A;  1Y1N A;  4A6W A;  2HOW A;  4S2R P;  3PKD A;  4JUQ A;  2BHB A;  1YW7 A;  3D27 A;  4RZY A;  4RZZ A;  5JFR A;  3FM3 A;  4FO8 A;  1C27 A;  3CB6 A;  3FMR A;  4IKR A;  1A16 A;  3PKC A;  3BIQ A;  5CDE A;  4U6W A;  4IKT A;  2GZ5 A;  3O5V A;  2Q95 A;  4ZWO A;  2GU6 A;  3QOC A;  3S6B A;  5E2C A;  1YW9 A;  2B3H A;  3TB5 A;  2Q92 A;  4U70 A;  1R58 A;  3IG4 A;  2BHA A;  3RVA A;  5JHU A;  2G6P A;  2GG5 A;  2GGB A;  2DFI A;  1O0X A;  4U75 A;  2ZSG A;  4FLL A;  2V3X A;  2GU5 A;  1WL9 A;  1C23 A;  3IU7 A;  2OKN A;  4IKU A;  2BHC A;  2V6C A;  4EGE A;  2GTX A;  2MAT A;  2Q93 A;  5FCF A;  3ROR A;  1JAW A;  2BWS A;  4B28 A;  2B3K A;  3FMQ A;  3PEB A;  3IU8 A;  4ZNG A;  2ADU A;  3CB5 A;  4U73 A;  4KM3 A;  1C21 A;  1QXW A;  5CE6 A;  4S00 A;  1W2M A;  4S01 A;  3OVK A;  2P9A A;  2BH3 A;  1WL6 A;  5E5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...