1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
5CLSA 1W2MA 1C24A 1XGOA 3FM3A 3CTZA 1YW8A 4IKRA 3CB6A 1KQ0A 2EVMA 4U1BA 4U6EA 4FLIA 5CIKA 2BHBA 4ZWOA 5E2CA 2HOWA 5CDVA 1BOAA 3PEBA 3Q6DA 3PKBA 1R58A 4IPAA 4JUQA 3MR1A 3IG4A 1YW7A 2GU4A 2BH3A 2BWUA 4IECA 5JFRA 3FMQA 3L7GA 2BWTA 4U75A 2BHAA 3CB5A 2V3ZA 5E5BA 4U6WA 1YW9A 5FCFA 4R60A 1BN5A 2GU5A 2BWWA 2B3HA 2GG5A 2ADUA 2Q94A 4ZWPA 2BWYA 2GA2A 2GG7A 4IDYA 2OKNA 2B3LA 1WY2A 2GGBA 2Q93A 4FO7A 2V3XA 1B59A 1JAWA 2EA4A 3RORA 2ZSGA 3IU7A 1QXZA 4QR8A 4IU6A 1O0XA 1Y1NA 4U6CA 2EVOA 4U70A 1WL9A 2GG0A 4U6JA 1N51A 2Q92A 2GZ5A 4S01A 1XGMA 2V3YA 1YVMA 4IF7A 1CHMA 4S2TP 1R5GA 2NQ7A 4MATA 2BWVA 4FKCA 1C23A 3BIQA 2IW2A 3OOOA 4S00A 4A6WA 2P99A 4ZNGA 4IKUA 2G6PA 1QXWA 2BB7A 2Q8KA 3BIPA 3MATA 5JHUA 2P9AA 1WLRA 1B6AA 2BHDA 2NQ6A 1M35A 4KM3A 2GTXA 3FMRA 4ZWUA 1WKMA 4U6ZA 4FLKA 4PV4A 5CDLA 5D6EA 4HXXA 5CDEA 4FLLA 4U71A 5D6FA 3L24A 1XNZA 1R5HA 4FUKA 1W7VA 1WL6A 1WN1A 2B3KA 3QOCA 4IKSA 2GGCA 2GG8A 1QZYA 4Z7MA 3OVKA 3MX6A 2GG9A 5FCHA 2GG2A 1XGNA 3IU9A 5JI6A 3PKEA 4A6VA 3I7MA 1XGSA 4FLJA 2Q95A 3PKCA 2EVCA 2Q96A 4U73A 1WBQA 4S2RP 1C21A 2MATA 3IU8A 1C27A 2V6CA 3TAVA 2GG3A 1QXYA 4RZZA 2DFIA 5CE6A 2GU7A 5CNXA 4B28A 1KP0A 4RGZ1 4EGEA 3PKAA 1YJ3A 4FO8A 4U69A 4U76A 1A16A 3TB5A 2BWXA 1C22A 3IL0A 2BN7A 4RZYA 3RVAA 3S6BA 2BHCA 3PN9A 3BITA 2OAZA 2BWSA 1PV9A 3PKDA 1MATA 2EA2A 3D27A 1KQ9A 4IKTA 4OOKA 2GU6A 3O5VA 2P98A 4PNCA
chains in the Genus database with same CATH superfamily
5CLSA 1W2MA 1C24A 1XGOA 3FM3A 3CTZA 1YW8A 4IKRA 3CB6A 1KQ0A 2EVMA 4U1BA 4U6EA 4FLIA 5CIKA 2BHBA 4ZWOA 5E2CA 2HOWA 5CDVA 1BOAA 3PEBA 3Q6DA 3PKBA 1R58A 4IPAA 4JUQA 3MR1A 3IG4A 1YW7A 2GU4A 2BH3A 2BWUA 4IECA 5JFRA 3FMQA 3L7GA 2BWTA 4U75A 2BHAA 3CB5A 2V3ZA 5E5BA 4U6WA 1YW9A 5FCFA 4R60A 1BN5A 2GU5A 2BWWA 2B3HA 2GG5A 2ADUA 2Q94A 4ZWPA 2BWYA 2GA2A 2GG7A 4IDYA 2OKNA 2B3LA 1WY2A 2GGBA 2Q93A 4FO7A 2V3XA 1B59A 1JAWA 2EA4A 3RORA 2ZSGA 3IU7A 1QXZA 4QR8A 4IU6A 1O0XA 1Y1NA 4U6CA 2EVOA 4U70A 1WL9A 2GG0A 4U6JA 1N51A 2Q92A 2GZ5A 4S01A 1XGMA 2V3YA 1YVMA 4IF7A 1CHMA 4S2TP 1R5GA 2NQ7A 4MATA 2BWVA 4FKCA 1C23A 3BIQA 2IW2A 3OOOA 4S00A 4A6WA 2P99A 4ZNGA 4IKUA 2G6PA 1QXWA 2BB7A 2Q8KA 3BIPA 3MATA 5JHUA 2P9AA 1WLRA 1B6AA 2BHDA 2NQ6A 1M35A 4KM3A 2GTXA 3FMRA 4ZWUA 1WKMA 4U6ZA 4FLKA 4PV4A 5CDLA 5D6EA 4HXXA 5CDEA 4FLLA 4U71A 5D6FA 3L24A 1XNZA 1R5HA 4FUKA 1W7VA 1WL6A 1WN1A 2B3KA 3QOCA 4IKSA 2GGCA 2GG8A 1QZYA 4Z7MA 3OVKA 3MX6A 2GG9A 5FCHA 2GG2A 1XGNA 3IU9A 5JI6A 3PKEA 4A6VA 3I7MA 1XGSA 4FLJA 2Q95A 3PKCA 2EVCA 2Q96A 4U73A 1WBQA 4S2RP 1C21A 2MATA 3IU8A 1C27A 2V6CA 3TAVA 2GG3A 1QXYA 4RZZA 2DFIA 5CE6A 2GU7A 5CNXA 4B28A 1KP0A 4RGZ1 4EGEA 3PKAA 1YJ3A 4FO8A 4U69A 4U76A 1A16A 3TB5A 2BWXA 1C22A 3IL0A 2BN7A 4RZYA 3RVAA 3S6BA 2BHCA 3PN9A 3BITA 2OAZA 2BWSA 1PV9A 3PKDA 1MATA 2EA2A 3D27A 1KQ9A 4IKTA 4OOKA 2GU6A 3O5VA 2P98A 4PNCA
chains in the Genus database with same CATH topology
5CLSA 1W2MA 1C24A 1XGOA 3FM3A 3CTZA 1YW8A 4IKRA 3CB6A 1KQ0A 2EVMA 4U1BA 4U6EA 4FLIA 5CIKA 2BHBA 4ZWOA 5E2CA 2HOWA 5CDVA 1BOAA 3PEBA 3Q6DA 3PKBA 1R58A 4IPAA 4JUQA 3MR1A 3IG4A 1YW7A 2GU4A 2BH3A 2BWUA 4IECA 5JFRA 3FMQA 3L7GA 2BWTA 4U75A 2BHAA 3CB5A 2V3ZA 5E5BA 4U6WA 1YW9A 5FCFA 4R60A 1BN5A 2GU5A 2BWWA 2B3HA 2GG5A 2ADUA 2Q94A 4ZWPA 2BWYA 2GA2A 2GG7A 4IDYA 2OKNA 2B3LA 1WY2A 2GGBA 2Q93A 4FO7A 2V3XA 1B59A 1JAWA 2EA4A 3RORA 2ZSGA 3IU7A 1QXZA 4QR8A 4IU6A 1O0XA 1Y1NA 4U6CA 2EVOA 4U70A 1WL9A 2GG0A 4U6JA 1N51A 2Q92A 2GZ5A 4S01A 1XGMA 2V3YA 1YVMA 4IF7A 1CHMA 4S2TP 1R5GA 2NQ7A 4MATA 2BWVA 4FKCA 1C23A 3BIQA 2IW2A 3OOOA 4S00A 4A6WA 2P99A 4ZNGA 4IKUA 2G6PA 1QXWA 2BB7A 2Q8KA 3BIPA 3MATA 5JHUA 2P9AA 1WLRA 1B6AA 2BHDA 2NQ6A 1M35A 4KM3A 2GTXA 3FMRA 4ZWUA 1WKMA 4U6ZA 4FLKA 4PV4A 5CDLA 5D6EA 4HXXA 5CDEA 4FLLA 4U71A 5D6FA 3L24A 1XNZA 1R5HA 4FUKA 1W7VA 1WL6A 1WN1A 2B3KA 3QOCA 4IKSA 2GGCA 2GG8A 1QZYA 4Z7MA 3OVKA 3MX6A 2GG9A 5FCHA 2GG2A 1XGNA 3IU9A 5JI6A 3PKEA 4A6VA 3I7MA 1XGSA 4FLJA 2Q95A 3PKCA 2EVCA 2Q96A 4U73A 1WBQA 4S2RP 1C21A 2MATA 3IU8A 1C27A 2V6CA 3TAVA 2GG3A 1QXYA 4RZZA 2DFIA 5CE6A 2GU7A 5CNXA 4B28A 1KP0A 4RGZ1 4EGEA 3PKAA 1YJ3A 4FO8A 4U69A 4U76A 1A16A 3TB5A 2BWXA 1C22A 3IL0A 2BN7A 4RZYA 3RVAA 3S6BA 2BHCA 3PN9A 3BITA 2OAZA 2BWSA 1PV9A 3PKDA 1MATA 2EA2A 3D27A 1KQ9A 4IKTA 4OOKA 2GU6A 3O5VA 2P98A 4PNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLS A;  1W2M A;  1C24 A;  1XGO A;  3FM3 A;  3CTZ A;  1YW8 A;  4IKR A;  3CB6 A;  1KQ0 A;  2EVM A;  4U1B A;  4U6E A;  4FLI A;  5CIK A;  2BHB A;  4ZWO A;  5E2C A;  2HOW A;  5CDV A;  1BOA A;  3PEB A;  3Q6D A;  3PKB A;  1R58 A;  4IPA A;  4JUQ A;  3MR1 A;  3IG4 A;  1YW7 A;  2GU4 A;  2BH3 A;  2BWU A;  4IEC A;  5JFR A;  3FMQ A;  3L7G A;  2BWT A;  4U75 A;  2BHA A;  3CB5 A;  2V3Z A;  5E5B A;  4U6W A;  1YW9 A;  5FCF A;  4R60 A;  1BN5 A;  2GU5 A;  2BWW A;  2B3H A;  2GG5 A;  2ADU A;  2Q94 A;  4ZWP A;  2BWY A;  2GA2 A;  2GG7 A;  4IDY A;  2OKN A;  2B3L A;  1WY2 A;  2GGB A;  2Q93 A;  4FO7 A;  2V3X A;  1B59 A;  1JAW A;  2EA4 A;  3ROR A;  2ZSG A;  3IU7 A;  1QXZ A;  4QR8 A;  4IU6 A;  1O0X A;  1Y1N A;  4U6C A;  2EVO A;  4U70 A;  1WL9 A;  2GG0 A;  4U6J A;  1N51 A;  2Q92 A;  2GZ5 A;  4S01 A;  1XGM A;  2V3Y A;  1YVM A;  4IF7 A;  1CHM A;  4S2T P;  1R5G A;  2NQ7 A;  4MAT A;  2BWV A;  4FKC A;  1C23 A;  3BIQ A;  2IW2 A;  3OOO A;  4S00 A;  4A6W A;  2P99 A;  4ZNG A;  4IKU A;  2G6P A;  1QXW A;  2BB7 A;  2Q8K A;  3BIP A;  3MAT A;  5JHU A;  2P9A A;  1WLR A;  1B6A A;  2BHD A;  2NQ6 A;  1M35 A;  4KM3 A;  2GTX A;  3FMR A;  4ZWU A;  1WKM A;  4U6Z A;  4FLK A;  4PV4 A;  5CDL A;  5D6E A;  4HXX A;  5CDE A;  4FLL A;  4U71 A;  5D6F A;  3L24 A;  1XNZ A;  1R5H A;  4FUK A;  1W7V A;  1WL6 A;  1WN1 A;  2B3K A;  3QOC A;  4IKS A;  2GGC A;  2GG8 A;  1QZY A;  4Z7M A;  3OVK A;  3MX6 A;  2GG9 A;  5FCH A;  2GG2 A;  1XGN A;  3IU9 A;  5JI6 A;  3PKE A;  4A6V A;  3I7M A;  1XGS A;  4FLJ A;  2Q95 A;  3PKC A;  2EVC A;  2Q96 A;  4U73 A;  1WBQ A;  4S2R P;  1C21 A;  2MAT A;  3IU8 A;  1C27 A;  2V6C A;  3TAV A;  2GG3 A;  1QXY A;  4RZZ A;  2DFI A;  5CE6 A;  2GU7 A;  5CNX A;  4B28 A;  1KP0 A;  4RGZ 1;  4EGE A;  3PKA A;  1YJ3 A;  4FO8 A;  4U69 A;  4U76 A;  1A16 A;  3TB5 A;  2BWX A;  1C22 A;  3IL0 A;  2BN7 A;  4RZY A;  3RVA A;  3S6B A;  2BHC A;  3PN9 A;  3BIT A;  2OAZ A;  2BWS A;  1PV9 A;  3PKD A;  1MAT A;  2EA2 A;  3D27 A;  1KQ9 A;  4IKT A;  4OOK A;  2GU6 A;  3O5V A;  2P98 A;  4PNC A; 
#chains in the Genus database with same CATH topology
 5CLS A;  1W2M A;  1C24 A;  1XGO A;  3FM3 A;  3CTZ A;  1YW8 A;  4IKR A;  3CB6 A;  1KQ0 A;  2EVM A;  4U1B A;  4U6E A;  4FLI A;  5CIK A;  2BHB A;  4ZWO A;  5E2C A;  2HOW A;  5CDV A;  1BOA A;  3PEB A;  3Q6D A;  3PKB A;  1R58 A;  4IPA A;  4JUQ A;  3MR1 A;  3IG4 A;  1YW7 A;  2GU4 A;  2BH3 A;  2BWU A;  4IEC A;  5JFR A;  3FMQ A;  3L7G A;  2BWT A;  4U75 A;  2BHA A;  3CB5 A;  2V3Z A;  5E5B A;  4U6W A;  1YW9 A;  5FCF A;  4R60 A;  1BN5 A;  2GU5 A;  2BWW A;  2B3H A;  2GG5 A;  2ADU A;  2Q94 A;  4ZWP A;  2BWY A;  2GA2 A;  2GG7 A;  4IDY A;  2OKN A;  2B3L A;  1WY2 A;  2GGB A;  2Q93 A;  4FO7 A;  2V3X A;  1B59 A;  1JAW A;  2EA4 A;  3ROR A;  2ZSG A;  3IU7 A;  1QXZ A;  4QR8 A;  4IU6 A;  1O0X A;  1Y1N A;  4U6C A;  2EVO A;  4U70 A;  1WL9 A;  2GG0 A;  4U6J A;  1N51 A;  2Q92 A;  2GZ5 A;  4S01 A;  1XGM A;  2V3Y A;  1YVM A;  4IF7 A;  1CHM A;  4S2T P;  1R5G A;  2NQ7 A;  4MAT A;  2BWV A;  4FKC A;  1C23 A;  3BIQ A;  2IW2 A;  3OOO A;  4S00 A;  4A6W A;  2P99 A;  4ZNG A;  4IKU A;  2G6P A;  1QXW A;  2BB7 A;  2Q8K A;  3BIP A;  3MAT A;  5JHU A;  2P9A A;  1WLR A;  1B6A A;  2BHD A;  2NQ6 A;  1M35 A;  4KM3 A;  2GTX A;  3FMR A;  4ZWU A;  1WKM A;  4U6Z A;  4FLK A;  4PV4 A;  5CDL A;  5D6E A;  4HXX A;  5CDE A;  4FLL A;  4U71 A;  5D6F A;  3L24 A;  1XNZ A;  1R5H A;  4FUK A;  1W7V A;  1WL6 A;  1WN1 A;  2B3K A;  3QOC A;  4IKS A;  2GGC A;  2GG8 A;  1QZY A;  4Z7M A;  3OVK A;  3MX6 A;  2GG9 A;  5FCH A;  2GG2 A;  1XGN A;  3IU9 A;  5JI6 A;  3PKE A;  4A6V A;  3I7M A;  1XGS A;  4FLJ A;  2Q95 A;  3PKC A;  2EVC A;  2Q96 A;  4U73 A;  1WBQ A;  4S2R P;  1C21 A;  2MAT A;  3IU8 A;  1C27 A;  2V6C A;  3TAV A;  2GG3 A;  1QXY A;  4RZZ A;  2DFI A;  5CE6 A;  2GU7 A;  5CNX A;  4B28 A;  1KP0 A;  4RGZ 1;  4EGE A;  3PKA A;  1YJ3 A;  4FO8 A;  4U69 A;  4U76 A;  1A16 A;  3TB5 A;  2BWX A;  1C22 A;  3IL0 A;  2BN7 A;  4RZY A;  3RVA A;  3S6B A;  2BHC A;  3PN9 A;  3BIT A;  2OAZ A;  2BWS A;  1PV9 A;  3PKD A;  1MAT A;  2EA2 A;  3D27 A;  1KQ9 A;  4IKT A;  4OOK A;  2GU6 A;  3O5V A;  2P98 A;  4PNC A; 
#chains in the Genus database with same CATH homology
 5CLS A;  1W2M A;  1C24 A;  1XGO A;  3FM3 A;  3CTZ A;  1YW8 A;  4IKR A;  3CB6 A;  1KQ0 A;  2EVM A;  4U1B A;  4U6E A;  4FLI A;  5CIK A;  2BHB A;  4ZWO A;  5E2C A;  2HOW A;  5CDV A;  1BOA A;  3PEB A;  3Q6D A;  3PKB A;  1R58 A;  4IPA A;  4JUQ A;  3MR1 A;  3IG4 A;  1YW7 A;  2GU4 A;  2BH3 A;  2BWU A;  4IEC A;  5JFR A;  3FMQ A;  3L7G A;  2BWT A;  4U75 A;  2BHA A;  3CB5 A;  2V3Z A;  5E5B A;  4U6W A;  1YW9 A;  5FCF A;  4R60 A;  1BN5 A;  2GU5 A;  2BWW A;  2B3H A;  2GG5 A;  2ADU A;  2Q94 A;  4ZWP A;  2BWY A;  2GA2 A;  2GG7 A;  4IDY A;  2OKN A;  2B3L A;  1WY2 A;  2GGB A;  2Q93 A;  4FO7 A;  2V3X A;  1B59 A;  1JAW A;  2EA4 A;  3ROR A;  2ZSG A;  3IU7 A;  1QXZ A;  4QR8 A;  4IU6 A;  1O0X A;  1Y1N A;  4U6C A;  2EVO A;  4U70 A;  1WL9 A;  2GG0 A;  4U6J A;  1N51 A;  2Q92 A;  2GZ5 A;  4S01 A;  1XGM A;  2V3Y A;  1YVM A;  4IF7 A;  1CHM A;  4S2T P;  1R5G A;  2NQ7 A;  4MAT A;  2BWV A;  4FKC A;  1C23 A;  3BIQ A;  2IW2 A;  3OOO A;  4S00 A;  4A6W A;  2P99 A;  4ZNG A;  4IKU A;  2G6P A;  1QXW A;  2BB7 A;  2Q8K A;  3BIP A;  3MAT A;  5JHU A;  2P9A A;  1WLR A;  1B6A A;  2BHD A;  2NQ6 A;  1M35 A;  4KM3 A;  2GTX A;  3FMR A;  4ZWU A;  1WKM A;  4U6Z A;  4FLK A;  4PV4 A;  5CDL A;  5D6E A;  4HXX A;  5CDE A;  4FLL A;  4U71 A;  5D6F A;  3L24 A;  1XNZ A;  1R5H A;  4FUK A;  1W7V A;  1WL6 A;  1WN1 A;  2B3K A;  3QOC A;  4IKS A;  2GGC A;  2GG8 A;  1QZY A;  4Z7M A;  3OVK A;  3MX6 A;  2GG9 A;  5FCH A;  2GG2 A;  1XGN A;  3IU9 A;  5JI6 A;  3PKE A;  4A6V A;  3I7M A;  1XGS A;  4FLJ A;  2Q95 A;  3PKC A;  2EVC A;  2Q96 A;  4U73 A;  1WBQ A;  4S2R P;  1C21 A;  2MAT A;  3IU8 A;  1C27 A;  2V6C A;  3TAV A;  2GG3 A;  1QXY A;  4RZZ A;  2DFI A;  5CE6 A;  2GU7 A;  5CNX A;  4B28 A;  1KP0 A;  4RGZ 1;  4EGE A;  3PKA A;  1YJ3 A;  4FO8 A;  4U69 A;  4U76 A;  1A16 A;  3TB5 A;  2BWX A;  1C22 A;  3IL0 A;  2BN7 A;  4RZY A;  3RVA A;  3S6B A;  2BHC A;  3PN9 A;  3BIT A;  2OAZ A;  2BWS A;  1PV9 A;  3PKD A;  1MAT A;  2EA2 A;  3D27 A;  1KQ9 A;  4IKT A;  4OOK A;  2GU6 A;  3O5V A;  2P98 A;  4PNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...