1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
3CB6A 4U75A 4IKSA 4PV4A 4RGZ1 2GU5A 4IDYA 4B28A 1Y1NA 5CE6A 1KQ0A 2BWXA 1YVMA 4Z7MA 2GGCA 1WKMA 1C27A 4FLJA 3TB5A 5CDLA 4FO7A 5CDEA 2IW2A 2GG7A 4U73A 2GTXA 3PKCA 4FUKA 5CDVA 4IECA 4IF7A 2BWUA 3CB5A 1BOAA 1W2MA 1C24A 2GG5A 4OOKA 4FLIA 5FCHA 1R5GA 3L7GA 3PN9A 3Q6DA 1C21A 1QXYA 1WL6A 4IKTA 2NQ7A 1WLRA 1QXWA 1C23A 2BWVA 2HOWA 3PKEA 4MATA 4RZYA 4ZWUA 2GZ5A 4FLLA 1PV9A 3PKBA 1YW8A 2BWSA 1C22A 1YJ3A 1WBQA 3TAVA 1XGNA 1B6AA 2ADUA 1B59A 1WL9A 2GU6A 4IU6A 4U6JA 3IU8A 1CHMA 2V3YA 5E5BA 2GG0A 3MR1A 1WY2A 4S01A 2BWTA 3CTZA 3BITA 3I7MA 5FCFA 1XGMA 2Q94A 2GG9A 2Q92A 4A6VA 2EA4A 5CNXA 2GGBA 3PKAA 2BWWA 2GU4A 4FLKA 1WN1A 1YW7A 4IKRA 4JUQA 2V3XA 3PKDA 1R5HA 4EGEA 2V6CA 4U6CA 2BWYA 2Q96A 3D27A 2GG2A 4U6WA 2BN7A 3FMRA 1XGSA 2P98A 2GU7A 3BIQA 2ZSGA 3OOOA 4R60A 3O5VA 1YW9A 3IU9A 3RVAA 5CIKA 1XNZA 2B3LA 2Q8KA 4S2RP 1QXZA 3FM3A 4RZZA 1R58A 2P9AA 3MATA 4U70A 4FKCA 4ZNGA 5E2CA 2DFIA 4U6ZA 2BHAA 2GA2A 3L24A 4IKUA 1M35A 3OVKA 2BHBA 2BB7A 2EVOA 4FO8A 1A16A 4ZWPA 5D6EA 3MX6A 3RORA 4QR8A 1O0XA 1KP0A 2BH3A 2NQ6A 5D6FA 1BN5A 5JFRA 3S6BA 5JI6A 2BHCA 2BHDA 1KQ9A 2Q93A 3PEBA 3IG4A 3IU7A 2GG3A 4U76A 2G6PA 4S2TP 2V3ZA 1QZYA 2B3KA 2EVCA 2EA2A 3IL0A 4KM3A 4HXXA 5CLSA 2OKNA 2MATA 1W7VA 4IPAA 4PNCA 4U69A 1JAWA 3FMQA 1MATA 2GG8A 3QOCA 4U71A 4S00A 2P99A 2Q95A 2EVMA 2OAZA 3BIPA 1N51A 4ZWOA 4U1BA 2B3HA 4U6EA 4A6WA 5JHUA 1XGOA
chains in the Genus database with same CATH superfamily
3CB6A 4U75A 4IKSA 4PV4A 4RGZ1 2GU5A 4IDYA 4B28A 1Y1NA 5CE6A 1KQ0A 2BWXA 1YVMA 4Z7MA 2GGCA 1WKMA 1C27A 4FLJA 3TB5A 5CDLA 4FO7A 5CDEA 2IW2A 2GG7A 4U73A 2GTXA 3PKCA 4FUKA 5CDVA 4IECA 4IF7A 2BWUA 3CB5A 1BOAA 1W2MA 1C24A 2GG5A 4OOKA 4FLIA 5FCHA 1R5GA 3L7GA 3PN9A 3Q6DA 1C21A 1QXYA 1WL6A 4IKTA 2NQ7A 1WLRA 1QXWA 1C23A 2BWVA 2HOWA 3PKEA 4MATA 4RZYA 4ZWUA 2GZ5A 4FLLA 1PV9A 3PKBA 1YW8A 2BWSA 1C22A 1YJ3A 1WBQA 3TAVA 1XGNA 1B6AA 2ADUA 1B59A 1WL9A 2GU6A 4IU6A 4U6JA 3IU8A 1CHMA 2V3YA 5E5BA 2GG0A 3MR1A 1WY2A 4S01A 2BWTA 3CTZA 3BITA 3I7MA 5FCFA 1XGMA 2Q94A 2GG9A 2Q92A 4A6VA 2EA4A 5CNXA 2GGBA 3PKAA 2BWWA 2GU4A 4FLKA 1WN1A 1YW7A 4IKRA 4JUQA 2V3XA 3PKDA 1R5HA 4EGEA 2V6CA 4U6CA 2BWYA 2Q96A 3D27A 2GG2A 4U6WA 2BN7A 3FMRA 1XGSA 2P98A 2GU7A 3BIQA 2ZSGA 3OOOA 4R60A 3O5VA 1YW9A 3IU9A 3RVAA 5CIKA 1XNZA 2B3LA 2Q8KA 4S2RP 1QXZA 3FM3A 4RZZA 1R58A 2P9AA 3MATA 4U70A 4FKCA 4ZNGA 5E2CA 2DFIA 4U6ZA 2BHAA 2GA2A 3L24A 4IKUA 1M35A 3OVKA 2BHBA 2BB7A 2EVOA 4FO8A 1A16A 4ZWPA 5D6EA 3MX6A 3RORA 4QR8A 1O0XA 1KP0A 2BH3A 2NQ6A 5D6FA 1BN5A 5JFRA 3S6BA 5JI6A 2BHCA 2BHDA 1KQ9A 2Q93A 3PEBA 3IG4A 3IU7A 2GG3A 4U76A 2G6PA 4S2TP 2V3ZA 1QZYA 2B3KA 2EVCA 2EA2A 3IL0A 4KM3A 4HXXA 5CLSA 2OKNA 2MATA 1W7VA 4IPAA 4PNCA 4U69A 1JAWA 3FMQA 1MATA 2GG8A 3QOCA 4U71A 4S00A 2P99A 2Q95A 2EVMA 2OAZA 3BIPA 1N51A 4ZWOA 4U1BA 2B3HA 4U6EA 4A6WA 5JHUA 1XGOA
chains in the Genus database with same CATH topology
3CB6A 4U75A 4IKSA 4PV4A 4RGZ1 2GU5A 4IDYA 4B28A 1Y1NA 5CE6A 1KQ0A 2BWXA 1YVMA 4Z7MA 2GGCA 1WKMA 1C27A 4FLJA 3TB5A 5CDLA 4FO7A 5CDEA 2IW2A 2GG7A 4U73A 2GTXA 3PKCA 4FUKA 5CDVA 4IECA 4IF7A 2BWUA 3CB5A 1BOAA 1W2MA 1C24A 2GG5A 4OOKA 4FLIA 5FCHA 1R5GA 3L7GA 3PN9A 3Q6DA 1C21A 1QXYA 1WL6A 4IKTA 2NQ7A 1WLRA 1QXWA 1C23A 2BWVA 2HOWA 3PKEA 4MATA 4RZYA 4ZWUA 2GZ5A 4FLLA 1PV9A 3PKBA 1YW8A 2BWSA 1C22A 1YJ3A 1WBQA 3TAVA 1XGNA 1B6AA 2ADUA 1B59A 1WL9A 2GU6A 4IU6A 4U6JA 3IU8A 1CHMA 2V3YA 5E5BA 2GG0A 3MR1A 1WY2A 4S01A 2BWTA 3CTZA 3BITA 3I7MA 5FCFA 1XGMA 2Q94A 2GG9A 2Q92A 4A6VA 2EA4A 5CNXA 2GGBA 3PKAA 2BWWA 2GU4A 4FLKA 1WN1A 1YW7A 4IKRA 4JUQA 2V3XA 3PKDA 1R5HA 4EGEA 2V6CA 4U6CA 2BWYA 2Q96A 3D27A 2GG2A 4U6WA 2BN7A 3FMRA 1XGSA 2P98A 2GU7A 3BIQA 2ZSGA 3OOOA 4R60A 3O5VA 1YW9A 3IU9A 3RVAA 5CIKA 1XNZA 2B3LA 2Q8KA 4S2RP 1QXZA 3FM3A 4RZZA 1R58A 2P9AA 3MATA 4U70A 4FKCA 4ZNGA 5E2CA 2DFIA 4U6ZA 2BHAA 2GA2A 3L24A 4IKUA 1M35A 3OVKA 2BHBA 2BB7A 2EVOA 4FO8A 1A16A 4ZWPA 5D6EA 3MX6A 3RORA 4QR8A 1O0XA 1KP0A 2BH3A 2NQ6A 5D6FA 1BN5A 5JFRA 3S6BA 5JI6A 2BHCA 2BHDA 1KQ9A 2Q93A 3PEBA 3IG4A 3IU7A 2GG3A 4U76A 2G6PA 4S2TP 2V3ZA 1QZYA 2B3KA 2EVCA 2EA2A 3IL0A 4KM3A 4HXXA 5CLSA 2OKNA 2MATA 1W7VA 4IPAA 4PNCA 4U69A 1JAWA 3FMQA 1MATA 2GG8A 3QOCA 4U71A 4S00A 2P99A 2Q95A 2EVMA 2OAZA 3BIPA 1N51A 4ZWOA 4U1BA 2B3HA 4U6EA 4A6WA 5JHUA 1XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB6 A;  4U75 A;  4IKS A;  4PV4 A;  4RGZ 1;  2GU5 A;  4IDY A;  4B28 A;  1Y1N A;  5CE6 A;  1KQ0 A;  2BWX A;  1YVM A;  4Z7M A;  2GGC A;  1WKM A;  1C27 A;  4FLJ A;  3TB5 A;  5CDL A;  4FO7 A;  5CDE A;  2IW2 A;  2GG7 A;  4U73 A;  2GTX A;  3PKC A;  4FUK A;  5CDV A;  4IEC A;  4IF7 A;  2BWU A;  3CB5 A;  1BOA A;  1W2M A;  1C24 A;  2GG5 A;  4OOK A;  4FLI A;  5FCH A;  1R5G A;  3L7G A;  3PN9 A;  3Q6D A;  1C21 A;  1QXY A;  1WL6 A;  4IKT A;  2NQ7 A;  1WLR A;  1QXW A;  1C23 A;  2BWV A;  2HOW A;  3PKE A;  4MAT A;  4RZY A;  4ZWU A;  2GZ5 A;  4FLL A;  1PV9 A;  3PKB A;  1YW8 A;  2BWS A;  1C22 A;  1YJ3 A;  1WBQ A;  3TAV A;  1XGN A;  1B6A A;  2ADU A;  1B59 A;  1WL9 A;  2GU6 A;  4IU6 A;  4U6J A;  3IU8 A;  1CHM A;  2V3Y A;  5E5B A;  2GG0 A;  3MR1 A;  1WY2 A;  4S01 A;  2BWT A;  3CTZ A;  3BIT A;  3I7M A;  5FCF A;  1XGM A;  2Q94 A;  2GG9 A;  2Q92 A;  4A6V A;  2EA4 A;  5CNX A;  2GGB A;  3PKA A;  2BWW A;  2GU4 A;  4FLK A;  1WN1 A;  1YW7 A;  4IKR A;  4JUQ A;  2V3X A;  3PKD A;  1R5H A;  4EGE A;  2V6C A;  4U6C A;  2BWY A;  2Q96 A;  3D27 A;  2GG2 A;  4U6W A;  2BN7 A;  3FMR A;  1XGS A;  2P98 A;  2GU7 A;  3BIQ A;  2ZSG A;  3OOO A;  4R60 A;  3O5V A;  1YW9 A;  3IU9 A;  3RVA A;  5CIK A;  1XNZ A;  2B3L A;  2Q8K A;  4S2R P;  1QXZ A;  3FM3 A;  4RZZ A;  1R58 A;  2P9A A;  3MAT A;  4U70 A;  4FKC A;  4ZNG A;  5E2C A;  2DFI A;  4U6Z A;  2BHA A;  2GA2 A;  3L24 A;  4IKU A;  1M35 A;  3OVK A;  2BHB A;  2BB7 A;  2EVO A;  4FO8 A;  1A16 A;  4ZWP A;  5D6E A;  3MX6 A;  3ROR A;  4QR8 A;  1O0X A;  1KP0 A;  2BH3 A;  2NQ6 A;  5D6F A;  1BN5 A;  5JFR A;  3S6B A;  5JI6 A;  2BHC A;  2BHD A;  1KQ9 A;  2Q93 A;  3PEB A;  3IG4 A;  3IU7 A;  2GG3 A;  4U76 A;  2G6P A;  4S2T P;  2V3Z A;  1QZY A;  2B3K A;  2EVC A;  2EA2 A;  3IL0 A;  4KM3 A;  4HXX A;  5CLS A;  2OKN A;  2MAT A;  1W7V A;  4IPA A;  4PNC A;  4U69 A;  1JAW A;  3FMQ A;  1MAT A;  2GG8 A;  3QOC A;  4U71 A;  4S00 A;  2P99 A;  2Q95 A;  2EVM A;  2OAZ A;  3BIP A;  1N51 A;  4ZWO A;  4U1B A;  2B3H A;  4U6E A;  4A6W A;  5JHU A;  1XGO A; 
#chains in the Genus database with same CATH topology
 3CB6 A;  4U75 A;  4IKS A;  4PV4 A;  4RGZ 1;  2GU5 A;  4IDY A;  4B28 A;  1Y1N A;  5CE6 A;  1KQ0 A;  2BWX A;  1YVM A;  4Z7M A;  2GGC A;  1WKM A;  1C27 A;  4FLJ A;  3TB5 A;  5CDL A;  4FO7 A;  5CDE A;  2IW2 A;  2GG7 A;  4U73 A;  2GTX A;  3PKC A;  4FUK A;  5CDV A;  4IEC A;  4IF7 A;  2BWU A;  3CB5 A;  1BOA A;  1W2M A;  1C24 A;  2GG5 A;  4OOK A;  4FLI A;  5FCH A;  1R5G A;  3L7G A;  3PN9 A;  3Q6D A;  1C21 A;  1QXY A;  1WL6 A;  4IKT A;  2NQ7 A;  1WLR A;  1QXW A;  1C23 A;  2BWV A;  2HOW A;  3PKE A;  4MAT A;  4RZY A;  4ZWU A;  2GZ5 A;  4FLL A;  1PV9 A;  3PKB A;  1YW8 A;  2BWS A;  1C22 A;  1YJ3 A;  1WBQ A;  3TAV A;  1XGN A;  1B6A A;  2ADU A;  1B59 A;  1WL9 A;  2GU6 A;  4IU6 A;  4U6J A;  3IU8 A;  1CHM A;  2V3Y A;  5E5B A;  2GG0 A;  3MR1 A;  1WY2 A;  4S01 A;  2BWT A;  3CTZ A;  3BIT A;  3I7M A;  5FCF A;  1XGM A;  2Q94 A;  2GG9 A;  2Q92 A;  4A6V A;  2EA4 A;  5CNX A;  2GGB A;  3PKA A;  2BWW A;  2GU4 A;  4FLK A;  1WN1 A;  1YW7 A;  4IKR A;  4JUQ A;  2V3X A;  3PKD A;  1R5H A;  4EGE A;  2V6C A;  4U6C A;  2BWY A;  2Q96 A;  3D27 A;  2GG2 A;  4U6W A;  2BN7 A;  3FMR A;  1XGS A;  2P98 A;  2GU7 A;  3BIQ A;  2ZSG A;  3OOO A;  4R60 A;  3O5V A;  1YW9 A;  3IU9 A;  3RVA A;  5CIK A;  1XNZ A;  2B3L A;  2Q8K A;  4S2R P;  1QXZ A;  3FM3 A;  4RZZ A;  1R58 A;  2P9A A;  3MAT A;  4U70 A;  4FKC A;  4ZNG A;  5E2C A;  2DFI A;  4U6Z A;  2BHA A;  2GA2 A;  3L24 A;  4IKU A;  1M35 A;  3OVK A;  2BHB A;  2BB7 A;  2EVO A;  4FO8 A;  1A16 A;  4ZWP A;  5D6E A;  3MX6 A;  3ROR A;  4QR8 A;  1O0X A;  1KP0 A;  2BH3 A;  2NQ6 A;  5D6F A;  1BN5 A;  5JFR A;  3S6B A;  5JI6 A;  2BHC A;  2BHD A;  1KQ9 A;  2Q93 A;  3PEB A;  3IG4 A;  3IU7 A;  2GG3 A;  4U76 A;  2G6P A;  4S2T P;  2V3Z A;  1QZY A;  2B3K A;  2EVC A;  2EA2 A;  3IL0 A;  4KM3 A;  4HXX A;  5CLS A;  2OKN A;  2MAT A;  1W7V A;  4IPA A;  4PNC A;  4U69 A;  1JAW A;  3FMQ A;  1MAT A;  2GG8 A;  3QOC A;  4U71 A;  4S00 A;  2P99 A;  2Q95 A;  2EVM A;  2OAZ A;  3BIP A;  1N51 A;  4ZWO A;  4U1B A;  2B3H A;  4U6E A;  4A6W A;  5JHU A;  1XGO A; 
#chains in the Genus database with same CATH homology
 3CB6 A;  4U75 A;  4IKS A;  4PV4 A;  4RGZ 1;  2GU5 A;  4IDY A;  4B28 A;  1Y1N A;  5CE6 A;  1KQ0 A;  2BWX A;  1YVM A;  4Z7M A;  2GGC A;  1WKM A;  1C27 A;  4FLJ A;  3TB5 A;  5CDL A;  4FO7 A;  5CDE A;  2IW2 A;  2GG7 A;  4U73 A;  2GTX A;  3PKC A;  4FUK A;  5CDV A;  4IEC A;  4IF7 A;  2BWU A;  3CB5 A;  1BOA A;  1W2M A;  1C24 A;  2GG5 A;  4OOK A;  4FLI A;  5FCH A;  1R5G A;  3L7G A;  3PN9 A;  3Q6D A;  1C21 A;  1QXY A;  1WL6 A;  4IKT A;  2NQ7 A;  1WLR A;  1QXW A;  1C23 A;  2BWV A;  2HOW A;  3PKE A;  4MAT A;  4RZY A;  4ZWU A;  2GZ5 A;  4FLL A;  1PV9 A;  3PKB A;  1YW8 A;  2BWS A;  1C22 A;  1YJ3 A;  1WBQ A;  3TAV A;  1XGN A;  1B6A A;  2ADU A;  1B59 A;  1WL9 A;  2GU6 A;  4IU6 A;  4U6J A;  3IU8 A;  1CHM A;  2V3Y A;  5E5B A;  2GG0 A;  3MR1 A;  1WY2 A;  4S01 A;  2BWT A;  3CTZ A;  3BIT A;  3I7M A;  5FCF A;  1XGM A;  2Q94 A;  2GG9 A;  2Q92 A;  4A6V A;  2EA4 A;  5CNX A;  2GGB A;  3PKA A;  2BWW A;  2GU4 A;  4FLK A;  1WN1 A;  1YW7 A;  4IKR A;  4JUQ A;  2V3X A;  3PKD A;  1R5H A;  4EGE A;  2V6C A;  4U6C A;  2BWY A;  2Q96 A;  3D27 A;  2GG2 A;  4U6W A;  2BN7 A;  3FMR A;  1XGS A;  2P98 A;  2GU7 A;  3BIQ A;  2ZSG A;  3OOO A;  4R60 A;  3O5V A;  1YW9 A;  3IU9 A;  3RVA A;  5CIK A;  1XNZ A;  2B3L A;  2Q8K A;  4S2R P;  1QXZ A;  3FM3 A;  4RZZ A;  1R58 A;  2P9A A;  3MAT A;  4U70 A;  4FKC A;  4ZNG A;  5E2C A;  2DFI A;  4U6Z A;  2BHA A;  2GA2 A;  3L24 A;  4IKU A;  1M35 A;  3OVK A;  2BHB A;  2BB7 A;  2EVO A;  4FO8 A;  1A16 A;  4ZWP A;  5D6E A;  3MX6 A;  3ROR A;  4QR8 A;  1O0X A;  1KP0 A;  2BH3 A;  2NQ6 A;  5D6F A;  1BN5 A;  5JFR A;  3S6B A;  5JI6 A;  2BHC A;  2BHD A;  1KQ9 A;  2Q93 A;  3PEB A;  3IG4 A;  3IU7 A;  2GG3 A;  4U76 A;  2G6P A;  4S2T P;  2V3Z A;  1QZY A;  2B3K A;  2EVC A;  2EA2 A;  3IL0 A;  4KM3 A;  4HXX A;  5CLS A;  2OKN A;  2MAT A;  1W7V A;  4IPA A;  4PNC A;  4U69 A;  1JAW A;  3FMQ A;  1MAT A;  2GG8 A;  3QOC A;  4U71 A;  4S00 A;  2P99 A;  2Q95 A;  2EVM A;  2OAZ A;  3BIP A;  1N51 A;  4ZWO A;  4U1B A;  2B3H A;  4U6E A;  4A6W A;  5JHU A;  1XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...