1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
4IECA 2Q94A 5CDVA 1WY2A 2V3ZA 5D6FA 2BWWA 2IW2A 2EVOA 3FMQA 3PKEA 4U6WA 3O5VA 4U75A 1A16A 3PKDA 2BN7A 4KM3A 3TB5A 3CB6A 5FCFA 3I7MA 1Y1NA 4ZWPA 4IKTA 3RVAA 4IKRA 1JAWA 3OVKA 1KQ9A 4U6CA 2V6CA 4RZZA 3PKAA 5JFRA 2BB7A 3TAVA 3FMRA 3OOOA 4S2TP 3IU9A 4OOKA 5JHUA 3IG4A 2BH3A 2GA2A 5CLSA 4U6JA 3RORA 1B59A 2P9AA 1KP0A 2P99A 3PEBA 4FLJA 2DFIA 1B6AA 3IL0A 1BN5A 2NQ6A 1C27A 1XNZA 2OKNA 2HOWA 1C21A 1YW7A 1W7VA 2BWYA 3PN9A 4EGEA 4U76A 4A6VA 4B28A 2G6PA 2ZSGA 2GG2A 1C24A 2NQ7A 5D6EA 2B3LA 5JI6A 2Q96A 3IU7A 4U6ZA 4IPAA 2GG8A 1XGNA 2GG9A 4RZYA 2V3XA 2EA2A 4IF7A 4U70A 4U73A 5E5BA 1R5GA 4FLIA 4ZNGA 1QXZA 5CIKA 1KQ0A 4FO8A 4IDYA 1WN1A 1R5HA 2BWTA 2GU6A 3BIPA 1YW8A 4S01A 2BHBA 3BIQA 3FM3A 1R58A 3D27A 2BWUA 4Z7MA 1W2MA 4U6EA 2GG3A 1WLRA 2B3HA 2EVMA 2GG7A 4PNCA 2B3KA 2OAZA 2Q92A 4FLLA 2GTXA 3PKCA 2GG5A 2BWVA 2GU4A 1XGSA 1N51A 4A6WA 4MATA 2BWSA 4FKCA 1BOAA 5CDEA 2GG0A 1YJ3A 5E2CA 2GGCA 2Q95A 4FO7A 2V3YA 3CTZA 4ZWUA 1YW9A 1WKMA 1WL6A 3PKBA 1CHMA 4QR8A 3MX6A 4FLKA 5CE6A 2MATA 4IU6A 1MATA 2GZ5A 1QZYA 3S6BA 3Q6DA 1O0XA 2BHAA 3CB5A 2BHCA 2ADUA 4HXXA 1WBQA 1QXYA 4IKSA 3L7GA 4R60A 4RGZ1 1QXWA 1M35A 2Q8KA 4ZWOA 5FCHA 1XGOA 3L24A 2Q93A 4JUQA 4U71A 2P98A 1YVMA 2EVCA 1PV9A 2GU7A 3MR1A 1C22A 2BHDA 4IKUA 5CNXA 2EA4A 3IU8A 4FUKA 4U69A 4S2RP 4S00A 3BITA 3MATA 2BWXA 5CDLA 1XGMA 2GGBA 2GU5A 4U1BA 1C23A 1WL9A 3QOCA 4PV4A
chains in the Genus database with same CATH superfamily
4IECA 2Q94A 5CDVA 1WY2A 2V3ZA 5D6FA 2BWWA 2IW2A 2EVOA 3FMQA 3PKEA 4U6WA 3O5VA 4U75A 1A16A 3PKDA 2BN7A 4KM3A 3TB5A 3CB6A 5FCFA 3I7MA 1Y1NA 4ZWPA 4IKTA 3RVAA 4IKRA 1JAWA 3OVKA 1KQ9A 4U6CA 2V6CA 4RZZA 3PKAA 5JFRA 2BB7A 3TAVA 3FMRA 3OOOA 4S2TP 3IU9A 4OOKA 5JHUA 3IG4A 2BH3A 2GA2A 5CLSA 4U6JA 3RORA 1B59A 2P9AA 1KP0A 2P99A 3PEBA 4FLJA 2DFIA 1B6AA 3IL0A 1BN5A 2NQ6A 1C27A 1XNZA 2OKNA 2HOWA 1C21A 1YW7A 1W7VA 2BWYA 3PN9A 4EGEA 4U76A 4A6VA 4B28A 2G6PA 2ZSGA 2GG2A 1C24A 2NQ7A 5D6EA 2B3LA 5JI6A 2Q96A 3IU7A 4U6ZA 4IPAA 2GG8A 1XGNA 2GG9A 4RZYA 2V3XA 2EA2A 4IF7A 4U70A 4U73A 5E5BA 1R5GA 4FLIA 4ZNGA 1QXZA 5CIKA 1KQ0A 4FO8A 4IDYA 1WN1A 1R5HA 2BWTA 2GU6A 3BIPA 1YW8A 4S01A 2BHBA 3BIQA 3FM3A 1R58A 3D27A 2BWUA 4Z7MA 1W2MA 4U6EA 2GG3A 1WLRA 2B3HA 2EVMA 2GG7A 4PNCA 2B3KA 2OAZA 2Q92A 4FLLA 2GTXA 3PKCA 2GG5A 2BWVA 2GU4A 1XGSA 1N51A 4A6WA 4MATA 2BWSA 4FKCA 1BOAA 5CDEA 2GG0A 1YJ3A 5E2CA 2GGCA 2Q95A 4FO7A 2V3YA 3CTZA 4ZWUA 1YW9A 1WKMA 1WL6A 3PKBA 1CHMA 4QR8A 3MX6A 4FLKA 5CE6A 2MATA 4IU6A 1MATA 2GZ5A 1QZYA 3S6BA 3Q6DA 1O0XA 2BHAA 3CB5A 2BHCA 2ADUA 4HXXA 1WBQA 1QXYA 4IKSA 3L7GA 4R60A 4RGZ1 1QXWA 1M35A 2Q8KA 4ZWOA 5FCHA 1XGOA 3L24A 2Q93A 4JUQA 4U71A 2P98A 1YVMA 2EVCA 1PV9A 2GU7A 3MR1A 1C22A 2BHDA 4IKUA 5CNXA 2EA4A 3IU8A 4FUKA 4U69A 4S2RP 4S00A 3BITA 3MATA 2BWXA 5CDLA 1XGMA 2GGBA 2GU5A 4U1BA 1C23A 1WL9A 3QOCA 4PV4A
chains in the Genus database with same CATH topology
4IECA 2Q94A 5CDVA 1WY2A 2V3ZA 5D6FA 2BWWA 2IW2A 2EVOA 3FMQA 3PKEA 4U6WA 3O5VA 4U75A 1A16A 3PKDA 2BN7A 4KM3A 3TB5A 3CB6A 5FCFA 3I7MA 1Y1NA 4ZWPA 4IKTA 3RVAA 4IKRA 1JAWA 3OVKA 1KQ9A 4U6CA 2V6CA 4RZZA 3PKAA 5JFRA 2BB7A 3TAVA 3FMRA 3OOOA 4S2TP 3IU9A 4OOKA 5JHUA 3IG4A 2BH3A 2GA2A 5CLSA 4U6JA 3RORA 1B59A 2P9AA 1KP0A 2P99A 3PEBA 4FLJA 2DFIA 1B6AA 3IL0A 1BN5A 2NQ6A 1C27A 1XNZA 2OKNA 2HOWA 1C21A 1YW7A 1W7VA 2BWYA 3PN9A 4EGEA 4U76A 4A6VA 4B28A 2G6PA 2ZSGA 2GG2A 1C24A 2NQ7A 5D6EA 2B3LA 5JI6A 2Q96A 3IU7A 4U6ZA 4IPAA 2GG8A 1XGNA 2GG9A 4RZYA 2V3XA 2EA2A 4IF7A 4U70A 4U73A 5E5BA 1R5GA 4FLIA 4ZNGA 1QXZA 5CIKA 1KQ0A 4FO8A 4IDYA 1WN1A 1R5HA 2BWTA 2GU6A 3BIPA 1YW8A 4S01A 2BHBA 3BIQA 3FM3A 1R58A 3D27A 2BWUA 4Z7MA 1W2MA 4U6EA 2GG3A 1WLRA 2B3HA 2EVMA 2GG7A 4PNCA 2B3KA 2OAZA 2Q92A 4FLLA 2GTXA 3PKCA 2GG5A 2BWVA 2GU4A 1XGSA 1N51A 4A6WA 4MATA 2BWSA 4FKCA 1BOAA 5CDEA 2GG0A 1YJ3A 5E2CA 2GGCA 2Q95A 4FO7A 2V3YA 3CTZA 4ZWUA 1YW9A 1WKMA 1WL6A 3PKBA 1CHMA 4QR8A 3MX6A 4FLKA 5CE6A 2MATA 4IU6A 1MATA 2GZ5A 1QZYA 3S6BA 3Q6DA 1O0XA 2BHAA 3CB5A 2BHCA 2ADUA 4HXXA 1WBQA 1QXYA 4IKSA 3L7GA 4R60A 4RGZ1 1QXWA 1M35A 2Q8KA 4ZWOA 5FCHA 1XGOA 3L24A 2Q93A 4JUQA 4U71A 2P98A 1YVMA 2EVCA 1PV9A 2GU7A 3MR1A 1C22A 2BHDA 4IKUA 5CNXA 2EA4A 3IU8A 4FUKA 4U69A 4S2RP 4S00A 3BITA 3MATA 2BWXA 5CDLA 1XGMA 2GGBA 2GU5A 4U1BA 1C23A 1WL9A 3QOCA 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEC A;  2Q94 A;  5CDV A;  1WY2 A;  2V3Z A;  5D6F A;  2BWW A;  2IW2 A;  2EVO A;  3FMQ A;  3PKE A;  4U6W A;  3O5V A;  4U75 A;  1A16 A;  3PKD A;  2BN7 A;  4KM3 A;  3TB5 A;  3CB6 A;  5FCF A;  3I7M A;  1Y1N A;  4ZWP A;  4IKT A;  3RVA A;  4IKR A;  1JAW A;  3OVK A;  1KQ9 A;  4U6C A;  2V6C A;  4RZZ A;  3PKA A;  5JFR A;  2BB7 A;  3TAV A;  3FMR A;  3OOO A;  4S2T P;  3IU9 A;  4OOK A;  5JHU A;  3IG4 A;  2BH3 A;  2GA2 A;  5CLS A;  4U6J A;  3ROR A;  1B59 A;  2P9A A;  1KP0 A;  2P99 A;  3PEB A;  4FLJ A;  2DFI A;  1B6A A;  3IL0 A;  1BN5 A;  2NQ6 A;  1C27 A;  1XNZ A;  2OKN A;  2HOW A;  1C21 A;  1YW7 A;  1W7V A;  2BWY A;  3PN9 A;  4EGE A;  4U76 A;  4A6V A;  4B28 A;  2G6P A;  2ZSG A;  2GG2 A;  1C24 A;  2NQ7 A;  5D6E A;  2B3L A;  5JI6 A;  2Q96 A;  3IU7 A;  4U6Z A;  4IPA A;  2GG8 A;  1XGN A;  2GG9 A;  4RZY A;  2V3X A;  2EA2 A;  4IF7 A;  4U70 A;  4U73 A;  5E5B A;  1R5G A;  4FLI A;  4ZNG A;  1QXZ A;  5CIK A;  1KQ0 A;  4FO8 A;  4IDY A;  1WN1 A;  1R5H A;  2BWT A;  2GU6 A;  3BIP A;  1YW8 A;  4S01 A;  2BHB A;  3BIQ A;  3FM3 A;  1R58 A;  3D27 A;  2BWU A;  4Z7M A;  1W2M A;  4U6E A;  2GG3 A;  1WLR A;  2B3H A;  2EVM A;  2GG7 A;  4PNC A;  2B3K A;  2OAZ A;  2Q92 A;  4FLL A;  2GTX A;  3PKC A;  2GG5 A;  2BWV A;  2GU4 A;  1XGS A;  1N51 A;  4A6W A;  4MAT A;  2BWS A;  4FKC A;  1BOA A;  5CDE A;  2GG0 A;  1YJ3 A;  5E2C A;  2GGC A;  2Q95 A;  4FO7 A;  2V3Y A;  3CTZ A;  4ZWU A;  1YW9 A;  1WKM A;  1WL6 A;  3PKB A;  1CHM A;  4QR8 A;  3MX6 A;  4FLK A;  5CE6 A;  2MAT A;  4IU6 A;  1MAT A;  2GZ5 A;  1QZY A;  3S6B A;  3Q6D A;  1O0X A;  2BHA A;  3CB5 A;  2BHC A;  2ADU A;  4HXX A;  1WBQ A;  1QXY A;  4IKS A;  3L7G A;  4R60 A;  4RGZ 1;  1QXW A;  1M35 A;  2Q8K A;  4ZWO A;  5FCH A;  1XGO A;  3L24 A;  2Q93 A;  4JUQ A;  4U71 A;  2P98 A;  1YVM A;  2EVC A;  1PV9 A;  2GU7 A;  3MR1 A;  1C22 A;  2BHD A;  4IKU A;  5CNX A;  2EA4 A;  3IU8 A;  4FUK A;  4U69 A;  4S2R P;  4S00 A;  3BIT A;  3MAT A;  2BWX A;  5CDL A;  1XGM A;  2GGB A;  2GU5 A;  4U1B A;  1C23 A;  1WL9 A;  3QOC A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 4IEC A;  2Q94 A;  5CDV A;  1WY2 A;  2V3Z A;  5D6F A;  2BWW A;  2IW2 A;  2EVO A;  3FMQ A;  3PKE A;  4U6W A;  3O5V A;  4U75 A;  1A16 A;  3PKD A;  2BN7 A;  4KM3 A;  3TB5 A;  3CB6 A;  5FCF A;  3I7M A;  1Y1N A;  4ZWP A;  4IKT A;  3RVA A;  4IKR A;  1JAW A;  3OVK A;  1KQ9 A;  4U6C A;  2V6C A;  4RZZ A;  3PKA A;  5JFR A;  2BB7 A;  3TAV A;  3FMR A;  3OOO A;  4S2T P;  3IU9 A;  4OOK A;  5JHU A;  3IG4 A;  2BH3 A;  2GA2 A;  5CLS A;  4U6J A;  3ROR A;  1B59 A;  2P9A A;  1KP0 A;  2P99 A;  3PEB A;  4FLJ A;  2DFI A;  1B6A A;  3IL0 A;  1BN5 A;  2NQ6 A;  1C27 A;  1XNZ A;  2OKN A;  2HOW A;  1C21 A;  1YW7 A;  1W7V A;  2BWY A;  3PN9 A;  4EGE A;  4U76 A;  4A6V A;  4B28 A;  2G6P A;  2ZSG A;  2GG2 A;  1C24 A;  2NQ7 A;  5D6E A;  2B3L A;  5JI6 A;  2Q96 A;  3IU7 A;  4U6Z A;  4IPA A;  2GG8 A;  1XGN A;  2GG9 A;  4RZY A;  2V3X A;  2EA2 A;  4IF7 A;  4U70 A;  4U73 A;  5E5B A;  1R5G A;  4FLI A;  4ZNG A;  1QXZ A;  5CIK A;  1KQ0 A;  4FO8 A;  4IDY A;  1WN1 A;  1R5H A;  2BWT A;  2GU6 A;  3BIP A;  1YW8 A;  4S01 A;  2BHB A;  3BIQ A;  3FM3 A;  1R58 A;  3D27 A;  2BWU A;  4Z7M A;  1W2M A;  4U6E A;  2GG3 A;  1WLR A;  2B3H A;  2EVM A;  2GG7 A;  4PNC A;  2B3K A;  2OAZ A;  2Q92 A;  4FLL A;  2GTX A;  3PKC A;  2GG5 A;  2BWV A;  2GU4 A;  1XGS A;  1N51 A;  4A6W A;  4MAT A;  2BWS A;  4FKC A;  1BOA A;  5CDE A;  2GG0 A;  1YJ3 A;  5E2C A;  2GGC A;  2Q95 A;  4FO7 A;  2V3Y A;  3CTZ A;  4ZWU A;  1YW9 A;  1WKM A;  1WL6 A;  3PKB A;  1CHM A;  4QR8 A;  3MX6 A;  4FLK A;  5CE6 A;  2MAT A;  4IU6 A;  1MAT A;  2GZ5 A;  1QZY A;  3S6B A;  3Q6D A;  1O0X A;  2BHA A;  3CB5 A;  2BHC A;  2ADU A;  4HXX A;  1WBQ A;  1QXY A;  4IKS A;  3L7G A;  4R60 A;  4RGZ 1;  1QXW A;  1M35 A;  2Q8K A;  4ZWO A;  5FCH A;  1XGO A;  3L24 A;  2Q93 A;  4JUQ A;  4U71 A;  2P98 A;  1YVM A;  2EVC A;  1PV9 A;  2GU7 A;  3MR1 A;  1C22 A;  2BHD A;  4IKU A;  5CNX A;  2EA4 A;  3IU8 A;  4FUK A;  4U69 A;  4S2R P;  4S00 A;  3BIT A;  3MAT A;  2BWX A;  5CDL A;  1XGM A;  2GGB A;  2GU5 A;  4U1B A;  1C23 A;  1WL9 A;  3QOC A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 4IEC A;  2Q94 A;  5CDV A;  1WY2 A;  2V3Z A;  5D6F A;  2BWW A;  2IW2 A;  2EVO A;  3FMQ A;  3PKE A;  4U6W A;  3O5V A;  4U75 A;  1A16 A;  3PKD A;  2BN7 A;  4KM3 A;  3TB5 A;  3CB6 A;  5FCF A;  3I7M A;  1Y1N A;  4ZWP A;  4IKT A;  3RVA A;  4IKR A;  1JAW A;  3OVK A;  1KQ9 A;  4U6C A;  2V6C A;  4RZZ A;  3PKA A;  5JFR A;  2BB7 A;  3TAV A;  3FMR A;  3OOO A;  4S2T P;  3IU9 A;  4OOK A;  5JHU A;  3IG4 A;  2BH3 A;  2GA2 A;  5CLS A;  4U6J A;  3ROR A;  1B59 A;  2P9A A;  1KP0 A;  2P99 A;  3PEB A;  4FLJ A;  2DFI A;  1B6A A;  3IL0 A;  1BN5 A;  2NQ6 A;  1C27 A;  1XNZ A;  2OKN A;  2HOW A;  1C21 A;  1YW7 A;  1W7V A;  2BWY A;  3PN9 A;  4EGE A;  4U76 A;  4A6V A;  4B28 A;  2G6P A;  2ZSG A;  2GG2 A;  1C24 A;  2NQ7 A;  5D6E A;  2B3L A;  5JI6 A;  2Q96 A;  3IU7 A;  4U6Z A;  4IPA A;  2GG8 A;  1XGN A;  2GG9 A;  4RZY A;  2V3X A;  2EA2 A;  4IF7 A;  4U70 A;  4U73 A;  5E5B A;  1R5G A;  4FLI A;  4ZNG A;  1QXZ A;  5CIK A;  1KQ0 A;  4FO8 A;  4IDY A;  1WN1 A;  1R5H A;  2BWT A;  2GU6 A;  3BIP A;  1YW8 A;  4S01 A;  2BHB A;  3BIQ A;  3FM3 A;  1R58 A;  3D27 A;  2BWU A;  4Z7M A;  1W2M A;  4U6E A;  2GG3 A;  1WLR A;  2B3H A;  2EVM A;  2GG7 A;  4PNC A;  2B3K A;  2OAZ A;  2Q92 A;  4FLL A;  2GTX A;  3PKC A;  2GG5 A;  2BWV A;  2GU4 A;  1XGS A;  1N51 A;  4A6W A;  4MAT A;  2BWS A;  4FKC A;  1BOA A;  5CDE A;  2GG0 A;  1YJ3 A;  5E2C A;  2GGC A;  2Q95 A;  4FO7 A;  2V3Y A;  3CTZ A;  4ZWU A;  1YW9 A;  1WKM A;  1WL6 A;  3PKB A;  1CHM A;  4QR8 A;  3MX6 A;  4FLK A;  5CE6 A;  2MAT A;  4IU6 A;  1MAT A;  2GZ5 A;  1QZY A;  3S6B A;  3Q6D A;  1O0X A;  2BHA A;  3CB5 A;  2BHC A;  2ADU A;  4HXX A;  1WBQ A;  1QXY A;  4IKS A;  3L7G A;  4R60 A;  4RGZ 1;  1QXW A;  1M35 A;  2Q8K A;  4ZWO A;  5FCH A;  1XGO A;  3L24 A;  2Q93 A;  4JUQ A;  4U71 A;  2P98 A;  1YVM A;  2EVC A;  1PV9 A;  2GU7 A;  3MR1 A;  1C22 A;  2BHD A;  4IKU A;  5CNX A;  2EA4 A;  3IU8 A;  4FUK A;  4U69 A;  4S2R P;  4S00 A;  3BIT A;  3MAT A;  2BWX A;  5CDL A;  1XGM A;  2GGB A;  2GU5 A;  4U1B A;  1C23 A;  1WL9 A;  3QOC A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...