1W2MA

Ca-substituted form of e. coli aminopeptidase p
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
439
structure length
438
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 155
structure length 438
sequence length 439
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1w2mA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1w2mA02
2GZ5A 2Q95A 1YJ3A 4IKUA 2BHBA 4FUKA 2GG3A 5CDEA 4U75A 1KQ9A 5CIKA 4FLLA 2BHDA 5CE6A 4PNCA 4JUQA 4U6ZA 1A16A 4IECA 2BWWA 2GG9A 2GG2A 4FLJA 1M35A 3BIQA 3Q6DA 5JFRA 4IPAA 1WL6A 1YW9A 3D27A 5FCHA 3PKCA 4S2RP 1N51A 4FO8A 1QXWA 2V3ZA 2EVCA 2P98A 5JHUA 4ZWOA 4U6JA 4FLKA 4U76A 2GG7A 4U6CA 3L7GA 2V6CA 2GGCA 4S01A 2GU5A 2P9AA 3FMRA 2Q93A 4Z7MA 1XGMA 3IG4A 1BN5A 5CDVA 5E2CA 4U69A 4A6VA 4IDYA 1MATA 3PN9A 5CDLA 2Q8KA 1W7VA 1WLRA 5FCFA 2B3LA 2OKNA 2OAZA 3MATA 4FKCA 2BWXA 4R60A 3BIPA 4RGZ1 2GU7A 3CTZA 4RZYA 5CLSA 3BITA 4IKTA 3PKDA 2GU4A 1YVMA 2BB7A 3IU7A 2BHCA 4KM3A 1O0XA 4IU6A 1C23A 1C27A 2NQ6A 4U70A 2GG8A 1XGSA 1C24A 4QR8A 2EA4A 1WKMA 2GA2A 2BN7A 4HXXA 3TAVA 1R5GA 2GTXA 3RVAA 1W2MA 4MATA 1R58A 3FM3A 2G6PA 2NQ7A 1CHMA 4RZZA 4OOKA 1WBQA 4ZNGA 2EVMA 1C22A 3S6BA 1XGOA 4ZWUA 2BHAA 3CB5A 4EGEA 2B3HA 2P99A 3IU9A 5JI6A 5D6EA 4U6EA 2BH3A 2EA2A 1WN1A 2BWYA 2V3YA 1QZYA 3FMQA 3PKEA 3RORA 4A6WA 4U6WA 2B3KA 4U71A 5E5BA 1YW7A 5CNXA 1YW8A 2ADUA 1QXYA 1Y1NA 1JAWA 3L24A 1QXZA 4B28A 4ZWPA 2Q96A 1KQ0A 3MR1A 1XNZA 2HOWA 4PV4A 3OVKA 3I7MA 4S2TP 2GU6A 1B59A 2BWSA 2MATA 2DFIA 2Q92A 1WL9A 2GGBA 2Q94A 1B6AA 2GG5A 2V3XA 3PKBA 4IF7A 3MX6A 2BWUA 1R5HA 1BOAA 2BWVA 1PV9A 1C21A 1XGNA 2GG0A 4S00A 2ZSGA 4IKRA 3PKAA 3IU8A 2BWTA 3CB6A 4U1BA 4FLIA 4U73A 2EVOA 3TB5A 1KP0A 3OOOA 3IL0A 3PEBA 5D6FA 1WY2A 2IW2A 4FO7A 3O5VA 4IKSA 3QOCA
chains in the Genus database with same CATH superfamily
2GZ5A 2Q95A 1YJ3A 4IKUA 2BHBA 4FUKA 2GG3A 5CDEA 4U75A 1KQ9A 5CIKA 4FLLA 2BHDA 5CE6A 4PNCA 4JUQA 4U6ZA 1A16A 4IECA 2BWWA 2GG9A 2GG2A 4FLJA 1M35A 3BIQA 3Q6DA 5JFRA 4IPAA 1WL6A 1YW9A 3D27A 5FCHA 3PKCA 4S2RP 1N51A 4FO8A 1QXWA 2V3ZA 2EVCA 2P98A 5JHUA 4ZWOA 4U6JA 4FLKA 4U76A 2GG7A 4U6CA 3L7GA 2V6CA 2GGCA 4S01A 2GU5A 2P9AA 3FMRA 2Q93A 4Z7MA 1XGMA 3IG4A 1BN5A 5CDVA 5E2CA 4U69A 4A6VA 4IDYA 1MATA 3PN9A 5CDLA 2Q8KA 1W7VA 1WLRA 5FCFA 2B3LA 2OKNA 2OAZA 3MATA 4FKCA 2BWXA 4R60A 3BIPA 4RGZ1 2GU7A 3CTZA 4RZYA 5CLSA 3BITA 4IKTA 3PKDA 2GU4A 1YVMA 2BB7A 3IU7A 2BHCA 4KM3A 1O0XA 4IU6A 1C23A 1C27A 2NQ6A 4U70A 2GG8A 1XGSA 1C24A 4QR8A 2EA4A 1WKMA 2GA2A 2BN7A 4HXXA 3TAVA 1R5GA 2GTXA 3RVAA 1W2MA 4MATA 1R58A 3FM3A 2G6PA 2NQ7A 1CHMA 4RZZA 4OOKA 1WBQA 4ZNGA 2EVMA 1C22A 3S6BA 1XGOA 4ZWUA 2BHAA 3CB5A 4EGEA 2B3HA 2P99A 3IU9A 5JI6A 5D6EA 4U6EA 2BH3A 2EA2A 1WN1A 2BWYA 2V3YA 1QZYA 3FMQA 3PKEA 3RORA 4A6WA 4U6WA 2B3KA 4U71A 5E5BA 1YW7A 5CNXA 1YW8A 2ADUA 1QXYA 1Y1NA 1JAWA 3L24A 1QXZA 4B28A 4ZWPA 2Q96A 1KQ0A 3MR1A 1XNZA 2HOWA 4PV4A 3OVKA 3I7MA 4S2TP 2GU6A 1B59A 2BWSA 2MATA 2DFIA 2Q92A 1WL9A 2GGBA 2Q94A 1B6AA 2GG5A 2V3XA 3PKBA 4IF7A 3MX6A 2BWUA 1R5HA 1BOAA 2BWVA 1PV9A 1C21A 1XGNA 2GG0A 4S00A 2ZSGA 4IKRA 3PKAA 3IU8A 2BWTA 3CB6A 4U1BA 4FLIA 4U73A 2EVOA 3TB5A 1KP0A 3OOOA 3IL0A 3PEBA 5D6FA 1WY2A 2IW2A 4FO7A 3O5VA 4IKSA 3QOCA
chains in the Genus database with same CATH topology
2GZ5A 2Q95A 1YJ3A 4IKUA 2BHBA 4FUKA 2GG3A 5CDEA 4U75A 1KQ9A 5CIKA 4FLLA 2BHDA 5CE6A 4PNCA 4JUQA 4U6ZA 1A16A 4IECA 2BWWA 2GG9A 2GG2A 4FLJA 1M35A 3BIQA 3Q6DA 5JFRA 4IPAA 1WL6A 1YW9A 3D27A 5FCHA 3PKCA 4S2RP 1N51A 4FO8A 1QXWA 2V3ZA 2EVCA 2P98A 5JHUA 4ZWOA 4U6JA 4FLKA 4U76A 2GG7A 4U6CA 3L7GA 2V6CA 2GGCA 4S01A 2GU5A 2P9AA 3FMRA 2Q93A 4Z7MA 1XGMA 3IG4A 1BN5A 5CDVA 5E2CA 4U69A 4A6VA 4IDYA 1MATA 3PN9A 5CDLA 2Q8KA 1W7VA 1WLRA 5FCFA 2B3LA 2OKNA 2OAZA 3MATA 4FKCA 2BWXA 4R60A 3BIPA 4RGZ1 2GU7A 3CTZA 4RZYA 5CLSA 3BITA 4IKTA 3PKDA 2GU4A 1YVMA 2BB7A 3IU7A 2BHCA 4KM3A 1O0XA 4IU6A 1C23A 1C27A 2NQ6A 4U70A 2GG8A 1XGSA 1C24A 4QR8A 2EA4A 1WKMA 2GA2A 2BN7A 4HXXA 3TAVA 1R5GA 2GTXA 3RVAA 1W2MA 4MATA 1R58A 3FM3A 2G6PA 2NQ7A 1CHMA 4RZZA 4OOKA 1WBQA 4ZNGA 2EVMA 1C22A 3S6BA 1XGOA 4ZWUA 2BHAA 3CB5A 4EGEA 2B3HA 2P99A 3IU9A 5JI6A 5D6EA 4U6EA 2BH3A 2EA2A 1WN1A 2BWYA 2V3YA 1QZYA 3FMQA 3PKEA 3RORA 4A6WA 4U6WA 2B3KA 4U71A 5E5BA 1YW7A 5CNXA 1YW8A 2ADUA 1QXYA 1Y1NA 1JAWA 3L24A 1QXZA 4B28A 4ZWPA 2Q96A 1KQ0A 3MR1A 1XNZA 2HOWA 4PV4A 3OVKA 3I7MA 4S2TP 2GU6A 1B59A 2BWSA 2MATA 2DFIA 2Q92A 1WL9A 2GGBA 2Q94A 1B6AA 2GG5A 2V3XA 3PKBA 4IF7A 3MX6A 2BWUA 1R5HA 1BOAA 2BWVA 1PV9A 1C21A 1XGNA 2GG0A 4S00A 2ZSGA 4IKRA 3PKAA 3IU8A 2BWTA 3CB6A 4U1BA 4FLIA 4U73A 2EVOA 3TB5A 1KP0A 3OOOA 3IL0A 3PEBA 5D6FA 1WY2A 2IW2A 4FO7A 3O5VA 4IKSA 3QOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZ5 A;  2Q95 A;  1YJ3 A;  4IKU A;  2BHB A;  4FUK A;  2GG3 A;  5CDE A;  4U75 A;  1KQ9 A;  5CIK A;  4FLL A;  2BHD A;  5CE6 A;  4PNC A;  4JUQ A;  4U6Z A;  1A16 A;  4IEC A;  2BWW A;  2GG9 A;  2GG2 A;  4FLJ A;  1M35 A;  3BIQ A;  3Q6D A;  5JFR A;  4IPA A;  1WL6 A;  1YW9 A;  3D27 A;  5FCH A;  3PKC A;  4S2R P;  1N51 A;  4FO8 A;  1QXW A;  2V3Z A;  2EVC A;  2P98 A;  5JHU A;  4ZWO A;  4U6J A;  4FLK A;  4U76 A;  2GG7 A;  4U6C A;  3L7G A;  2V6C A;  2GGC A;  4S01 A;  2GU5 A;  2P9A A;  3FMR A;  2Q93 A;  4Z7M A;  1XGM A;  3IG4 A;  1BN5 A;  5CDV A;  5E2C A;  4U69 A;  4A6V A;  4IDY A;  1MAT A;  3PN9 A;  5CDL A;  2Q8K A;  1W7V A;  1WLR A;  5FCF A;  2B3L A;  2OKN A;  2OAZ A;  3MAT A;  4FKC A;  2BWX A;  4R60 A;  3BIP A;  4RGZ 1;  2GU7 A;  3CTZ A;  4RZY A;  5CLS A;  3BIT A;  4IKT A;  3PKD A;  2GU4 A;  1YVM A;  2BB7 A;  3IU7 A;  2BHC A;  4KM3 A;  1O0X A;  4IU6 A;  1C23 A;  1C27 A;  2NQ6 A;  4U70 A;  2GG8 A;  1XGS A;  1C24 A;  4QR8 A;  2EA4 A;  1WKM A;  2GA2 A;  2BN7 A;  4HXX A;  3TAV A;  1R5G A;  2GTX A;  3RVA A;  1W2M A;  4MAT A;  1R58 A;  3FM3 A;  2G6P A;  2NQ7 A;  1CHM A;  4RZZ A;  4OOK A;  1WBQ A;  4ZNG A;  2EVM A;  1C22 A;  3S6B A;  1XGO A;  4ZWU A;  2BHA A;  3CB5 A;  4EGE A;  2B3H A;  2P99 A;  3IU9 A;  5JI6 A;  5D6E A;  4U6E A;  2BH3 A;  2EA2 A;  1WN1 A;  2BWY A;  2V3Y A;  1QZY A;  3FMQ A;  3PKE A;  3ROR A;  4A6W A;  4U6W A;  2B3K A;  4U71 A;  5E5B A;  1YW7 A;  5CNX A;  1YW8 A;  2ADU A;  1QXY A;  1Y1N A;  1JAW A;  3L24 A;  1QXZ A;  4B28 A;  4ZWP A;  2Q96 A;  1KQ0 A;  3MR1 A;  1XNZ A;  2HOW A;  4PV4 A;  3OVK A;  3I7M A;  4S2T P;  2GU6 A;  1B59 A;  2BWS A;  2MAT A;  2DFI A;  2Q92 A;  1WL9 A;  2GGB A;  2Q94 A;  1B6A A;  2GG5 A;  2V3X A;  3PKB A;  4IF7 A;  3MX6 A;  2BWU A;  1R5H A;  1BOA A;  2BWV A;  1PV9 A;  1C21 A;  1XGN A;  2GG0 A;  4S00 A;  2ZSG A;  4IKR A;  3PKA A;  3IU8 A;  2BWT A;  3CB6 A;  4U1B A;  4FLI A;  4U73 A;  2EVO A;  3TB5 A;  1KP0 A;  3OOO A;  3IL0 A;  3PEB A;  5D6F A;  1WY2 A;  2IW2 A;  4FO7 A;  3O5V A;  4IKS A;  3QOC A; 
#chains in the Genus database with same CATH topology
 2GZ5 A;  2Q95 A;  1YJ3 A;  4IKU A;  2BHB A;  4FUK A;  2GG3 A;  5CDE A;  4U75 A;  1KQ9 A;  5CIK A;  4FLL A;  2BHD A;  5CE6 A;  4PNC A;  4JUQ A;  4U6Z A;  1A16 A;  4IEC A;  2BWW A;  2GG9 A;  2GG2 A;  4FLJ A;  1M35 A;  3BIQ A;  3Q6D A;  5JFR A;  4IPA A;  1WL6 A;  1YW9 A;  3D27 A;  5FCH A;  3PKC A;  4S2R P;  1N51 A;  4FO8 A;  1QXW A;  2V3Z A;  2EVC A;  2P98 A;  5JHU A;  4ZWO A;  4U6J A;  4FLK A;  4U76 A;  2GG7 A;  4U6C A;  3L7G A;  2V6C A;  2GGC A;  4S01 A;  2GU5 A;  2P9A A;  3FMR A;  2Q93 A;  4Z7M A;  1XGM A;  3IG4 A;  1BN5 A;  5CDV A;  5E2C A;  4U69 A;  4A6V A;  4IDY A;  1MAT A;  3PN9 A;  5CDL A;  2Q8K A;  1W7V A;  1WLR A;  5FCF A;  2B3L A;  2OKN A;  2OAZ A;  3MAT A;  4FKC A;  2BWX A;  4R60 A;  3BIP A;  4RGZ 1;  2GU7 A;  3CTZ A;  4RZY A;  5CLS A;  3BIT A;  4IKT A;  3PKD A;  2GU4 A;  1YVM A;  2BB7 A;  3IU7 A;  2BHC A;  4KM3 A;  1O0X A;  4IU6 A;  1C23 A;  1C27 A;  2NQ6 A;  4U70 A;  2GG8 A;  1XGS A;  1C24 A;  4QR8 A;  2EA4 A;  1WKM A;  2GA2 A;  2BN7 A;  4HXX A;  3TAV A;  1R5G A;  2GTX A;  3RVA A;  1W2M A;  4MAT A;  1R58 A;  3FM3 A;  2G6P A;  2NQ7 A;  1CHM A;  4RZZ A;  4OOK A;  1WBQ A;  4ZNG A;  2EVM A;  1C22 A;  3S6B A;  1XGO A;  4ZWU A;  2BHA A;  3CB5 A;  4EGE A;  2B3H A;  2P99 A;  3IU9 A;  5JI6 A;  5D6E A;  4U6E A;  2BH3 A;  2EA2 A;  1WN1 A;  2BWY A;  2V3Y A;  1QZY A;  3FMQ A;  3PKE A;  3ROR A;  4A6W A;  4U6W A;  2B3K A;  4U71 A;  5E5B A;  1YW7 A;  5CNX A;  1YW8 A;  2ADU A;  1QXY A;  1Y1N A;  1JAW A;  3L24 A;  1QXZ A;  4B28 A;  4ZWP A;  2Q96 A;  1KQ0 A;  3MR1 A;  1XNZ A;  2HOW A;  4PV4 A;  3OVK A;  3I7M A;  4S2T P;  2GU6 A;  1B59 A;  2BWS A;  2MAT A;  2DFI A;  2Q92 A;  1WL9 A;  2GGB A;  2Q94 A;  1B6A A;  2GG5 A;  2V3X A;  3PKB A;  4IF7 A;  3MX6 A;  2BWU A;  1R5H A;  1BOA A;  2BWV A;  1PV9 A;  1C21 A;  1XGN A;  2GG0 A;  4S00 A;  2ZSG A;  4IKR A;  3PKA A;  3IU8 A;  2BWT A;  3CB6 A;  4U1B A;  4FLI A;  4U73 A;  2EVO A;  3TB5 A;  1KP0 A;  3OOO A;  3IL0 A;  3PEB A;  5D6F A;  1WY2 A;  2IW2 A;  4FO7 A;  3O5V A;  4IKS A;  3QOC A; 
#chains in the Genus database with same CATH homology
 2GZ5 A;  2Q95 A;  1YJ3 A;  4IKU A;  2BHB A;  4FUK A;  2GG3 A;  5CDE A;  4U75 A;  1KQ9 A;  5CIK A;  4FLL A;  2BHD A;  5CE6 A;  4PNC A;  4JUQ A;  4U6Z A;  1A16 A;  4IEC A;  2BWW A;  2GG9 A;  2GG2 A;  4FLJ A;  1M35 A;  3BIQ A;  3Q6D A;  5JFR A;  4IPA A;  1WL6 A;  1YW9 A;  3D27 A;  5FCH A;  3PKC A;  4S2R P;  1N51 A;  4FO8 A;  1QXW A;  2V3Z A;  2EVC A;  2P98 A;  5JHU A;  4ZWO A;  4U6J A;  4FLK A;  4U76 A;  2GG7 A;  4U6C A;  3L7G A;  2V6C A;  2GGC A;  4S01 A;  2GU5 A;  2P9A A;  3FMR A;  2Q93 A;  4Z7M A;  1XGM A;  3IG4 A;  1BN5 A;  5CDV A;  5E2C A;  4U69 A;  4A6V A;  4IDY A;  1MAT A;  3PN9 A;  5CDL A;  2Q8K A;  1W7V A;  1WLR A;  5FCF A;  2B3L A;  2OKN A;  2OAZ A;  3MAT A;  4FKC A;  2BWX A;  4R60 A;  3BIP A;  4RGZ 1;  2GU7 A;  3CTZ A;  4RZY A;  5CLS A;  3BIT A;  4IKT A;  3PKD A;  2GU4 A;  1YVM A;  2BB7 A;  3IU7 A;  2BHC A;  4KM3 A;  1O0X A;  4IU6 A;  1C23 A;  1C27 A;  2NQ6 A;  4U70 A;  2GG8 A;  1XGS A;  1C24 A;  4QR8 A;  2EA4 A;  1WKM A;  2GA2 A;  2BN7 A;  4HXX A;  3TAV A;  1R5G A;  2GTX A;  3RVA A;  1W2M A;  4MAT A;  1R58 A;  3FM3 A;  2G6P A;  2NQ7 A;  1CHM A;  4RZZ A;  4OOK A;  1WBQ A;  4ZNG A;  2EVM A;  1C22 A;  3S6B A;  1XGO A;  4ZWU A;  2BHA A;  3CB5 A;  4EGE A;  2B3H A;  2P99 A;  3IU9 A;  5JI6 A;  5D6E A;  4U6E A;  2BH3 A;  2EA2 A;  1WN1 A;  2BWY A;  2V3Y A;  1QZY A;  3FMQ A;  3PKE A;  3ROR A;  4A6W A;  4U6W A;  2B3K A;  4U71 A;  5E5B A;  1YW7 A;  5CNX A;  1YW8 A;  2ADU A;  1QXY A;  1Y1N A;  1JAW A;  3L24 A;  1QXZ A;  4B28 A;  4ZWP A;  2Q96 A;  1KQ0 A;  3MR1 A;  1XNZ A;  2HOW A;  4PV4 A;  3OVK A;  3I7M A;  4S2T P;  2GU6 A;  1B59 A;  2BWS A;  2MAT A;  2DFI A;  2Q92 A;  1WL9 A;  2GGB A;  2Q94 A;  1B6A A;  2GG5 A;  2V3X A;  3PKB A;  4IF7 A;  3MX6 A;  2BWU A;  1R5H A;  1BOA A;  2BWV A;  1PV9 A;  1C21 A;  1XGN A;  2GG0 A;  4S00 A;  2ZSG A;  4IKR A;  3PKA A;  3IU8 A;  2BWT A;  3CB6 A;  4U1B A;  4FLI A;  4U73 A;  2EVO A;  3TB5 A;  1KP0 A;  3OOO A;  3IL0 A;  3PEB A;  5D6F A;  1WY2 A;  2IW2 A;  4FO7 A;  3O5V A;  4IKS A;  3QOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...