2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
1M35A 1B59A 1YW8A 2GG7A 5E5BA 3S6BA 3IU9A 4FO8A 4S00A 4U75A 2BHCA 3OOOA 4ZWUA 2IW2A 3BIQA 4IF7A 2GU6A 4A6VA 1W7VA 2BWSA 3IU7A 4U6EA 2V3YA 1YVMA 2Q96A 4A6WA 1KQ0A 2EA4A 5CE6A 4FUKA 4Z7MA 4U70A 3CB5A 2BB7A 3L24A 1A16A 2BHBA 5E2CA 4R60A 1JAWA 2GU4A 2G6PA 4FLJA 2BWVA 1MATA 5FCHA 1QXWA 2GG9A 2B3KA 4IKTA 1PV9A 2BWYA 2BWXA 1C23A 2OAZA 2V3XA 4PNCA 1WY2A 5JI6A 4S01A 2GA2A 3MX6A 4OOKA 1WL6A 2Q95A 4FKCA 4ZWOA 3O5VA 3CTZA 2GTXA 4U1BA 5D6EA 5CIKA 1W2MA 5CNXA 4U6JA 3BIPA 2EVCA 2V6CA 3PKCA 4QR8A 2GU5A 2ZSGA 3OVKA 2GU7A 2NQ7A 1XNZA 5JHUA 1WL9A 2GG3A 1QXYA 3IG4A 4KM3A 3BITA 4EGEA 2BWUA 3PKBA 1R58A 2GG8A 4S2TP 4U6ZA 2BN7A 1WBQA 2ADUA 2B3LA 4ZNGA 1KP0A 1QZYA 4IKRA 2GGBA 2BHAA 2EA2A 1XGNA 5JFRA 2B3HA 4IECA 4JUQA 4U6WA 3MATA 1C24A 4B28A 3FMQA 4FLIA 5CLSA 4IDYA 2GG0A 2BWWA 4U69A 3FM3A 1CHMA 4IPAA 5CDLA 1O0XA 1WN1A 3PKAA 5CDEA 4FLKA 3MR1A 4S2RP 2BHDA 4PV4A 1KQ9A 1BOAA 2GG2A 3PEBA 2NQ6A 2Q93A 3TAVA 2OKNA 1BN5A 4IKUA 2HOWA 1R5HA 2EVOA 2BH3A 2MATA 2Q94A 3D27A 3Q6DA 4IKSA 3I7MA 5CDVA 1WKMA 4RZYA 3RVAA 4RGZ1 1B6AA 1XGMA 2EVMA 3CB6A 3PN9A 1C22A 4U6CA 4U73A 1YW9A 2DFIA 3QOCA 4ZWPA 2GZ5A 2P98A 4FLLA 1XGSA 3IL0A 5FCFA 1XGOA 3IU8A 3PKDA 4FO7A 1YW7A 2GGCA 2V3ZA 5D6FA 1Y1NA 1QXZA 3L7GA 2Q92A 1N51A 2Q8KA 1WLRA 4U71A 4MATA 4HXXA 3TB5A 1R5GA 2BWTA 1C27A 2P99A 2GG5A 4RZZA 1C21A 4IU6A 3FMRA 3PKEA 1YJ3A 3RORA 2P9AA 4U76A
chains in the Genus database with same CATH superfamily
1M35A 1B59A 1YW8A 2GG7A 5E5BA 3S6BA 3IU9A 4FO8A 4S00A 4U75A 2BHCA 3OOOA 4ZWUA 2IW2A 3BIQA 4IF7A 2GU6A 4A6VA 1W7VA 2BWSA 3IU7A 4U6EA 2V3YA 1YVMA 2Q96A 4A6WA 1KQ0A 2EA4A 5CE6A 4FUKA 4Z7MA 4U70A 3CB5A 2BB7A 3L24A 1A16A 2BHBA 5E2CA 4R60A 1JAWA 2GU4A 2G6PA 4FLJA 2BWVA 1MATA 5FCHA 1QXWA 2GG9A 2B3KA 4IKTA 1PV9A 2BWYA 2BWXA 1C23A 2OAZA 2V3XA 4PNCA 1WY2A 5JI6A 4S01A 2GA2A 3MX6A 4OOKA 1WL6A 2Q95A 4FKCA 4ZWOA 3O5VA 3CTZA 2GTXA 4U1BA 5D6EA 5CIKA 1W2MA 5CNXA 4U6JA 3BIPA 2EVCA 2V6CA 3PKCA 4QR8A 2GU5A 2ZSGA 3OVKA 2GU7A 2NQ7A 1XNZA 5JHUA 1WL9A 2GG3A 1QXYA 3IG4A 4KM3A 3BITA 4EGEA 2BWUA 3PKBA 1R58A 2GG8A 4S2TP 4U6ZA 2BN7A 1WBQA 2ADUA 2B3LA 4ZNGA 1KP0A 1QZYA 4IKRA 2GGBA 2BHAA 2EA2A 1XGNA 5JFRA 2B3HA 4IECA 4JUQA 4U6WA 3MATA 1C24A 4B28A 3FMQA 4FLIA 5CLSA 4IDYA 2GG0A 2BWWA 4U69A 3FM3A 1CHMA 4IPAA 5CDLA 1O0XA 1WN1A 3PKAA 5CDEA 4FLKA 3MR1A 4S2RP 2BHDA 4PV4A 1KQ9A 1BOAA 2GG2A 3PEBA 2NQ6A 2Q93A 3TAVA 2OKNA 1BN5A 4IKUA 2HOWA 1R5HA 2EVOA 2BH3A 2MATA 2Q94A 3D27A 3Q6DA 4IKSA 3I7MA 5CDVA 1WKMA 4RZYA 3RVAA 4RGZ1 1B6AA 1XGMA 2EVMA 3CB6A 3PN9A 1C22A 4U6CA 4U73A 1YW9A 2DFIA 3QOCA 4ZWPA 2GZ5A 2P98A 4FLLA 1XGSA 3IL0A 5FCFA 1XGOA 3IU8A 3PKDA 4FO7A 1YW7A 2GGCA 2V3ZA 5D6FA 1Y1NA 1QXZA 3L7GA 2Q92A 1N51A 2Q8KA 1WLRA 4U71A 4MATA 4HXXA 3TB5A 1R5GA 2BWTA 1C27A 2P99A 2GG5A 4RZZA 1C21A 4IU6A 3FMRA 3PKEA 1YJ3A 3RORA 2P9AA 4U76A
chains in the Genus database with same CATH topology
1M35A 1B59A 1YW8A 2GG7A 5E5BA 3S6BA 3IU9A 4FO8A 4S00A 4U75A 2BHCA 3OOOA 4ZWUA 2IW2A 3BIQA 4IF7A 2GU6A 4A6VA 1W7VA 2BWSA 3IU7A 4U6EA 2V3YA 1YVMA 2Q96A 4A6WA 1KQ0A 2EA4A 5CE6A 4FUKA 4Z7MA 4U70A 3CB5A 2BB7A 3L24A 1A16A 2BHBA 5E2CA 4R60A 1JAWA 2GU4A 2G6PA 4FLJA 2BWVA 1MATA 5FCHA 1QXWA 2GG9A 2B3KA 4IKTA 1PV9A 2BWYA 2BWXA 1C23A 2OAZA 2V3XA 4PNCA 1WY2A 5JI6A 4S01A 2GA2A 3MX6A 4OOKA 1WL6A 2Q95A 4FKCA 4ZWOA 3O5VA 3CTZA 2GTXA 4U1BA 5D6EA 5CIKA 1W2MA 5CNXA 4U6JA 3BIPA 2EVCA 2V6CA 3PKCA 4QR8A 2GU5A 2ZSGA 3OVKA 2GU7A 2NQ7A 1XNZA 5JHUA 1WL9A 2GG3A 1QXYA 3IG4A 4KM3A 3BITA 4EGEA 2BWUA 3PKBA 1R58A 2GG8A 4S2TP 4U6ZA 2BN7A 1WBQA 2ADUA 2B3LA 4ZNGA 1KP0A 1QZYA 4IKRA 2GGBA 2BHAA 2EA2A 1XGNA 5JFRA 2B3HA 4IECA 4JUQA 4U6WA 3MATA 1C24A 4B28A 3FMQA 4FLIA 5CLSA 4IDYA 2GG0A 2BWWA 4U69A 3FM3A 1CHMA 4IPAA 5CDLA 1O0XA 1WN1A 3PKAA 5CDEA 4FLKA 3MR1A 4S2RP 2BHDA 4PV4A 1KQ9A 1BOAA 2GG2A 3PEBA 2NQ6A 2Q93A 3TAVA 2OKNA 1BN5A 4IKUA 2HOWA 1R5HA 2EVOA 2BH3A 2MATA 2Q94A 3D27A 3Q6DA 4IKSA 3I7MA 5CDVA 1WKMA 4RZYA 3RVAA 4RGZ1 1B6AA 1XGMA 2EVMA 3CB6A 3PN9A 1C22A 4U6CA 4U73A 1YW9A 2DFIA 3QOCA 4ZWPA 2GZ5A 2P98A 4FLLA 1XGSA 3IL0A 5FCFA 1XGOA 3IU8A 3PKDA 4FO7A 1YW7A 2GGCA 2V3ZA 5D6FA 1Y1NA 1QXZA 3L7GA 2Q92A 1N51A 2Q8KA 1WLRA 4U71A 4MATA 4HXXA 3TB5A 1R5GA 2BWTA 1C27A 2P99A 2GG5A 4RZZA 1C21A 4IU6A 3FMRA 3PKEA 1YJ3A 3RORA 2P9AA 4U76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M35 A;  1B59 A;  1YW8 A;  2GG7 A;  5E5B A;  3S6B A;  3IU9 A;  4FO8 A;  4S00 A;  4U75 A;  2BHC A;  3OOO A;  4ZWU A;  2IW2 A;  3BIQ A;  4IF7 A;  2GU6 A;  4A6V A;  1W7V A;  2BWS A;  3IU7 A;  4U6E A;  2V3Y A;  1YVM A;  2Q96 A;  4A6W A;  1KQ0 A;  2EA4 A;  5CE6 A;  4FUK A;  4Z7M A;  4U70 A;  3CB5 A;  2BB7 A;  3L24 A;  1A16 A;  2BHB A;  5E2C A;  4R60 A;  1JAW A;  2GU4 A;  2G6P A;  4FLJ A;  2BWV A;  1MAT A;  5FCH A;  1QXW A;  2GG9 A;  2B3K A;  4IKT A;  1PV9 A;  2BWY A;  2BWX A;  1C23 A;  2OAZ A;  2V3X A;  4PNC A;  1WY2 A;  5JI6 A;  4S01 A;  2GA2 A;  3MX6 A;  4OOK A;  1WL6 A;  2Q95 A;  4FKC A;  4ZWO A;  3O5V A;  3CTZ A;  2GTX A;  4U1B A;  5D6E A;  5CIK A;  1W2M A;  5CNX A;  4U6J A;  3BIP A;  2EVC A;  2V6C A;  3PKC A;  4QR8 A;  2GU5 A;  2ZSG A;  3OVK A;  2GU7 A;  2NQ7 A;  1XNZ A;  5JHU A;  1WL9 A;  2GG3 A;  1QXY A;  3IG4 A;  4KM3 A;  3BIT A;  4EGE A;  2BWU A;  3PKB A;  1R58 A;  2GG8 A;  4S2T P;  4U6Z A;  2BN7 A;  1WBQ A;  2ADU A;  2B3L A;  4ZNG A;  1KP0 A;  1QZY A;  4IKR A;  2GGB A;  2BHA A;  2EA2 A;  1XGN A;  5JFR A;  2B3H A;  4IEC A;  4JUQ A;  4U6W A;  3MAT A;  1C24 A;  4B28 A;  3FMQ A;  4FLI A;  5CLS A;  4IDY A;  2GG0 A;  2BWW A;  4U69 A;  3FM3 A;  1CHM A;  4IPA A;  5CDL A;  1O0X A;  1WN1 A;  3PKA A;  5CDE A;  4FLK A;  3MR1 A;  4S2R P;  2BHD A;  4PV4 A;  1KQ9 A;  1BOA A;  2GG2 A;  3PEB A;  2NQ6 A;  2Q93 A;  3TAV A;  2OKN A;  1BN5 A;  4IKU A;  2HOW A;  1R5H A;  2EVO A;  2BH3 A;  2MAT A;  2Q94 A;  3D27 A;  3Q6D A;  4IKS A;  3I7M A;  5CDV A;  1WKM A;  4RZY A;  3RVA A;  4RGZ 1;  1B6A A;  1XGM A;  2EVM A;  3CB6 A;  3PN9 A;  1C22 A;  4U6C A;  4U73 A;  1YW9 A;  2DFI A;  3QOC A;  4ZWP A;  2GZ5 A;  2P98 A;  4FLL A;  1XGS A;  3IL0 A;  5FCF A;  1XGO A;  3IU8 A;  3PKD A;  4FO7 A;  1YW7 A;  2GGC A;  2V3Z A;  5D6F A;  1Y1N A;  1QXZ A;  3L7G A;  2Q92 A;  1N51 A;  2Q8K A;  1WLR A;  4U71 A;  4MAT A;  4HXX A;  3TB5 A;  1R5G A;  2BWT A;  1C27 A;  2P99 A;  2GG5 A;  4RZZ A;  1C21 A;  4IU6 A;  3FMR A;  3PKE A;  1YJ3 A;  3ROR A;  2P9A A;  4U76 A; 
#chains in the Genus database with same CATH topology
 1M35 A;  1B59 A;  1YW8 A;  2GG7 A;  5E5B A;  3S6B A;  3IU9 A;  4FO8 A;  4S00 A;  4U75 A;  2BHC A;  3OOO A;  4ZWU A;  2IW2 A;  3BIQ A;  4IF7 A;  2GU6 A;  4A6V A;  1W7V A;  2BWS A;  3IU7 A;  4U6E A;  2V3Y A;  1YVM A;  2Q96 A;  4A6W A;  1KQ0 A;  2EA4 A;  5CE6 A;  4FUK A;  4Z7M A;  4U70 A;  3CB5 A;  2BB7 A;  3L24 A;  1A16 A;  2BHB A;  5E2C A;  4R60 A;  1JAW A;  2GU4 A;  2G6P A;  4FLJ A;  2BWV A;  1MAT A;  5FCH A;  1QXW A;  2GG9 A;  2B3K A;  4IKT A;  1PV9 A;  2BWY A;  2BWX A;  1C23 A;  2OAZ A;  2V3X A;  4PNC A;  1WY2 A;  5JI6 A;  4S01 A;  2GA2 A;  3MX6 A;  4OOK A;  1WL6 A;  2Q95 A;  4FKC A;  4ZWO A;  3O5V A;  3CTZ A;  2GTX A;  4U1B A;  5D6E A;  5CIK A;  1W2M A;  5CNX A;  4U6J A;  3BIP A;  2EVC A;  2V6C A;  3PKC A;  4QR8 A;  2GU5 A;  2ZSG A;  3OVK A;  2GU7 A;  2NQ7 A;  1XNZ A;  5JHU A;  1WL9 A;  2GG3 A;  1QXY A;  3IG4 A;  4KM3 A;  3BIT A;  4EGE A;  2BWU A;  3PKB A;  1R58 A;  2GG8 A;  4S2T P;  4U6Z A;  2BN7 A;  1WBQ A;  2ADU A;  2B3L A;  4ZNG A;  1KP0 A;  1QZY A;  4IKR A;  2GGB A;  2BHA A;  2EA2 A;  1XGN A;  5JFR A;  2B3H A;  4IEC A;  4JUQ A;  4U6W A;  3MAT A;  1C24 A;  4B28 A;  3FMQ A;  4FLI A;  5CLS A;  4IDY A;  2GG0 A;  2BWW A;  4U69 A;  3FM3 A;  1CHM A;  4IPA A;  5CDL A;  1O0X A;  1WN1 A;  3PKA A;  5CDE A;  4FLK A;  3MR1 A;  4S2R P;  2BHD A;  4PV4 A;  1KQ9 A;  1BOA A;  2GG2 A;  3PEB A;  2NQ6 A;  2Q93 A;  3TAV A;  2OKN A;  1BN5 A;  4IKU A;  2HOW A;  1R5H A;  2EVO A;  2BH3 A;  2MAT A;  2Q94 A;  3D27 A;  3Q6D A;  4IKS A;  3I7M A;  5CDV A;  1WKM A;  4RZY A;  3RVA A;  4RGZ 1;  1B6A A;  1XGM A;  2EVM A;  3CB6 A;  3PN9 A;  1C22 A;  4U6C A;  4U73 A;  1YW9 A;  2DFI A;  3QOC A;  4ZWP A;  2GZ5 A;  2P98 A;  4FLL A;  1XGS A;  3IL0 A;  5FCF A;  1XGO A;  3IU8 A;  3PKD A;  4FO7 A;  1YW7 A;  2GGC A;  2V3Z A;  5D6F A;  1Y1N A;  1QXZ A;  3L7G A;  2Q92 A;  1N51 A;  2Q8K A;  1WLR A;  4U71 A;  4MAT A;  4HXX A;  3TB5 A;  1R5G A;  2BWT A;  1C27 A;  2P99 A;  2GG5 A;  4RZZ A;  1C21 A;  4IU6 A;  3FMR A;  3PKE A;  1YJ3 A;  3ROR A;  2P9A A;  4U76 A; 
#chains in the Genus database with same CATH homology
 1M35 A;  1B59 A;  1YW8 A;  2GG7 A;  5E5B A;  3S6B A;  3IU9 A;  4FO8 A;  4S00 A;  4U75 A;  2BHC A;  3OOO A;  4ZWU A;  2IW2 A;  3BIQ A;  4IF7 A;  2GU6 A;  4A6V A;  1W7V A;  2BWS A;  3IU7 A;  4U6E A;  2V3Y A;  1YVM A;  2Q96 A;  4A6W A;  1KQ0 A;  2EA4 A;  5CE6 A;  4FUK A;  4Z7M A;  4U70 A;  3CB5 A;  2BB7 A;  3L24 A;  1A16 A;  2BHB A;  5E2C A;  4R60 A;  1JAW A;  2GU4 A;  2G6P A;  4FLJ A;  2BWV A;  1MAT A;  5FCH A;  1QXW A;  2GG9 A;  2B3K A;  4IKT A;  1PV9 A;  2BWY A;  2BWX A;  1C23 A;  2OAZ A;  2V3X A;  4PNC A;  1WY2 A;  5JI6 A;  4S01 A;  2GA2 A;  3MX6 A;  4OOK A;  1WL6 A;  2Q95 A;  4FKC A;  4ZWO A;  3O5V A;  3CTZ A;  2GTX A;  4U1B A;  5D6E A;  5CIK A;  1W2M A;  5CNX A;  4U6J A;  3BIP A;  2EVC A;  2V6C A;  3PKC A;  4QR8 A;  2GU5 A;  2ZSG A;  3OVK A;  2GU7 A;  2NQ7 A;  1XNZ A;  5JHU A;  1WL9 A;  2GG3 A;  1QXY A;  3IG4 A;  4KM3 A;  3BIT A;  4EGE A;  2BWU A;  3PKB A;  1R58 A;  2GG8 A;  4S2T P;  4U6Z A;  2BN7 A;  1WBQ A;  2ADU A;  2B3L A;  4ZNG A;  1KP0 A;  1QZY A;  4IKR A;  2GGB A;  2BHA A;  2EA2 A;  1XGN A;  5JFR A;  2B3H A;  4IEC A;  4JUQ A;  4U6W A;  3MAT A;  1C24 A;  4B28 A;  3FMQ A;  4FLI A;  5CLS A;  4IDY A;  2GG0 A;  2BWW A;  4U69 A;  3FM3 A;  1CHM A;  4IPA A;  5CDL A;  1O0X A;  1WN1 A;  3PKA A;  5CDE A;  4FLK A;  3MR1 A;  4S2R P;  2BHD A;  4PV4 A;  1KQ9 A;  1BOA A;  2GG2 A;  3PEB A;  2NQ6 A;  2Q93 A;  3TAV A;  2OKN A;  1BN5 A;  4IKU A;  2HOW A;  1R5H A;  2EVO A;  2BH3 A;  2MAT A;  2Q94 A;  3D27 A;  3Q6D A;  4IKS A;  3I7M A;  5CDV A;  1WKM A;  4RZY A;  3RVA A;  4RGZ 1;  1B6A A;  1XGM A;  2EVM A;  3CB6 A;  3PN9 A;  1C22 A;  4U6C A;  4U73 A;  1YW9 A;  2DFI A;  3QOC A;  4ZWP A;  2GZ5 A;  2P98 A;  4FLL A;  1XGS A;  3IL0 A;  5FCF A;  1XGO A;  3IU8 A;  3PKD A;  4FO7 A;  1YW7 A;  2GGC A;  2V3Z A;  5D6F A;  1Y1N A;  1QXZ A;  3L7G A;  2Q92 A;  1N51 A;  2Q8K A;  1WLR A;  4U71 A;  4MAT A;  4HXX A;  3TB5 A;  1R5G A;  2BWT A;  1C27 A;  2P99 A;  2GG5 A;  4RZZ A;  1C21 A;  4IU6 A;  3FMR A;  3PKE A;  1YJ3 A;  3ROR A;  2P9A A;  4U76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...