2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
1O0XA 2G6PA 3FMQA 3IL0A 4IECA 2GU4A 2V6CA 2EA2A 4ZWOA 1M35A 5FCHA 2GTXA 3CB5A 5CDVA 1WL9A 1QXYA 1R58A 2DFIA 2GU5A 2GZ5A 4R60A 3QOCA 1WBQA 1C27A 2BWUA 4FLIA 1B6AA 1WLRA 4ZWPA 3BITA 1C24A 1BN5A 3IU7A 2BWYA 1C21A 1YW7A 2Q95A 3FM3A 3PKBA 1QXZA 4S2TP 1BOAA 1YVMA 4FUKA 2BHDA 5D6EA 4U75A 1XGMA 1MATA 2GG5A 2HOWA 3IG4A 1R5HA 2Q92A 2GG7A 2Q93A 2NQ7A 2P98A 1R5GA 4IKRA 4U6JA 4S2RP 4OOKA 4RZYA 1PV9A 2EVCA 1N51A 4ZWUA 4FLJA 4ZNGA 4IKUA 4FKCA 5E5BA 2OKNA 4U69A 4U6WA 5CDLA 1WY2A 5CNXA 3CB6A 1B59A 2BHAA 2OAZA 4RGZ1 4IU6A 4U6EA 2P9AA 2V3ZA 5CE6A 1A16A 4FO7A 3PEBA 4U70A 4QR8A 5JI6A 2ADUA 2BWTA 4IKTA 2BWXA 4IDYA 4U71A 2BHCA 2Q8KA 3L24A 2GG0A 3MATA 3BIQA 3OOOA 2GU6A 2GG8A 2EVMA 4JUQA 3PKDA 1CHMA 3BIPA 2BH3A 5FCFA 3FMRA 3IU8A 4FO8A 5D6FA 1W2MA 4MATA 1WL6A 4FLKA 1XNZA 3OVKA 3I7MA 2B3KA 1QXWA 3D27A 3PKAA 4A6WA 1XGSA 1YW8A 3CTZA 1W7VA 2B3LA 4IKSA 3IU9A 4U76A 2GGCA 1KQ9A 2BWVA 2V3YA 4IPAA 1C22A 4HXXA 3L7GA 2GG2A 2GU7A 3MX6A 4FLLA 4U6CA 2P99A 1KP0A 3PKEA 1YJ3A 2V3XA 1KQ0A 4B28A 3PKCA 4IF7A 2GG3A 2NQ6A 1WKMA 1Y1NA 2BWSA 2B3HA 4RZZA 5CLSA 3TAVA 3RORA 1YW9A 4PNCA 1C23A 4Z7MA 4PV4A 1WN1A 4S00A 4EGEA 5E2CA 5CIKA 2GGBA 4U1BA 2IW2A 2Q94A 3TB5A 3PN9A 2Q96A 4KM3A 5CDEA 2GG9A 3MR1A 4U6ZA 1XGOA 2BB7A 3RVAA 4A6VA 2EVOA 5JFRA 2MATA 2BN7A 3O5VA 2BHBA 2BWWA 1QZYA 2ZSGA 3S6BA 4S01A 2GA2A 4U73A 5JHUA 1JAWA 1XGNA 2EA4A 3Q6DA
chains in the Genus database with same CATH superfamily
1O0XA 2G6PA 3FMQA 3IL0A 4IECA 2GU4A 2V6CA 2EA2A 4ZWOA 1M35A 5FCHA 2GTXA 3CB5A 5CDVA 1WL9A 1QXYA 1R58A 2DFIA 2GU5A 2GZ5A 4R60A 3QOCA 1WBQA 1C27A 2BWUA 4FLIA 1B6AA 1WLRA 4ZWPA 3BITA 1C24A 1BN5A 3IU7A 2BWYA 1C21A 1YW7A 2Q95A 3FM3A 3PKBA 1QXZA 4S2TP 1BOAA 1YVMA 4FUKA 2BHDA 5D6EA 4U75A 1XGMA 1MATA 2GG5A 2HOWA 3IG4A 1R5HA 2Q92A 2GG7A 2Q93A 2NQ7A 2P98A 1R5GA 4IKRA 4U6JA 4S2RP 4OOKA 4RZYA 1PV9A 2EVCA 1N51A 4ZWUA 4FLJA 4ZNGA 4IKUA 4FKCA 5E5BA 2OKNA 4U69A 4U6WA 5CDLA 1WY2A 5CNXA 3CB6A 1B59A 2BHAA 2OAZA 4RGZ1 4IU6A 4U6EA 2P9AA 2V3ZA 5CE6A 1A16A 4FO7A 3PEBA 4U70A 4QR8A 5JI6A 2ADUA 2BWTA 4IKTA 2BWXA 4IDYA 4U71A 2BHCA 2Q8KA 3L24A 2GG0A 3MATA 3BIQA 3OOOA 2GU6A 2GG8A 2EVMA 4JUQA 3PKDA 1CHMA 3BIPA 2BH3A 5FCFA 3FMRA 3IU8A 4FO8A 5D6FA 1W2MA 4MATA 1WL6A 4FLKA 1XNZA 3OVKA 3I7MA 2B3KA 1QXWA 3D27A 3PKAA 4A6WA 1XGSA 1YW8A 3CTZA 1W7VA 2B3LA 4IKSA 3IU9A 4U76A 2GGCA 1KQ9A 2BWVA 2V3YA 4IPAA 1C22A 4HXXA 3L7GA 2GG2A 2GU7A 3MX6A 4FLLA 4U6CA 2P99A 1KP0A 3PKEA 1YJ3A 2V3XA 1KQ0A 4B28A 3PKCA 4IF7A 2GG3A 2NQ6A 1WKMA 1Y1NA 2BWSA 2B3HA 4RZZA 5CLSA 3TAVA 3RORA 1YW9A 4PNCA 1C23A 4Z7MA 4PV4A 1WN1A 4S00A 4EGEA 5E2CA 5CIKA 2GGBA 4U1BA 2IW2A 2Q94A 3TB5A 3PN9A 2Q96A 4KM3A 5CDEA 2GG9A 3MR1A 4U6ZA 1XGOA 2BB7A 3RVAA 4A6VA 2EVOA 5JFRA 2MATA 2BN7A 3O5VA 2BHBA 2BWWA 1QZYA 2ZSGA 3S6BA 4S01A 2GA2A 4U73A 5JHUA 1JAWA 1XGNA 2EA4A 3Q6DA
chains in the Genus database with same CATH topology
1O0XA 2G6PA 3FMQA 3IL0A 4IECA 2GU4A 2V6CA 2EA2A 4ZWOA 1M35A 5FCHA 2GTXA 3CB5A 5CDVA 1WL9A 1QXYA 1R58A 2DFIA 2GU5A 2GZ5A 4R60A 3QOCA 1WBQA 1C27A 2BWUA 4FLIA 1B6AA 1WLRA 4ZWPA 3BITA 1C24A 1BN5A 3IU7A 2BWYA 1C21A 1YW7A 2Q95A 3FM3A 3PKBA 1QXZA 4S2TP 1BOAA 1YVMA 4FUKA 2BHDA 5D6EA 4U75A 1XGMA 1MATA 2GG5A 2HOWA 3IG4A 1R5HA 2Q92A 2GG7A 2Q93A 2NQ7A 2P98A 1R5GA 4IKRA 4U6JA 4S2RP 4OOKA 4RZYA 1PV9A 2EVCA 1N51A 4ZWUA 4FLJA 4ZNGA 4IKUA 4FKCA 5E5BA 2OKNA 4U69A 4U6WA 5CDLA 1WY2A 5CNXA 3CB6A 1B59A 2BHAA 2OAZA 4RGZ1 4IU6A 4U6EA 2P9AA 2V3ZA 5CE6A 1A16A 4FO7A 3PEBA 4U70A 4QR8A 5JI6A 2ADUA 2BWTA 4IKTA 2BWXA 4IDYA 4U71A 2BHCA 2Q8KA 3L24A 2GG0A 3MATA 3BIQA 3OOOA 2GU6A 2GG8A 2EVMA 4JUQA 3PKDA 1CHMA 3BIPA 2BH3A 5FCFA 3FMRA 3IU8A 4FO8A 5D6FA 1W2MA 4MATA 1WL6A 4FLKA 1XNZA 3OVKA 3I7MA 2B3KA 1QXWA 3D27A 3PKAA 4A6WA 1XGSA 1YW8A 3CTZA 1W7VA 2B3LA 4IKSA 3IU9A 4U76A 2GGCA 1KQ9A 2BWVA 2V3YA 4IPAA 1C22A 4HXXA 3L7GA 2GG2A 2GU7A 3MX6A 4FLLA 4U6CA 2P99A 1KP0A 3PKEA 1YJ3A 2V3XA 1KQ0A 4B28A 3PKCA 4IF7A 2GG3A 2NQ6A 1WKMA 1Y1NA 2BWSA 2B3HA 4RZZA 5CLSA 3TAVA 3RORA 1YW9A 4PNCA 1C23A 4Z7MA 4PV4A 1WN1A 4S00A 4EGEA 5E2CA 5CIKA 2GGBA 4U1BA 2IW2A 2Q94A 3TB5A 3PN9A 2Q96A 4KM3A 5CDEA 2GG9A 3MR1A 4U6ZA 1XGOA 2BB7A 3RVAA 4A6VA 2EVOA 5JFRA 2MATA 2BN7A 3O5VA 2BHBA 2BWWA 1QZYA 2ZSGA 3S6BA 4S01A 2GA2A 4U73A 5JHUA 1JAWA 1XGNA 2EA4A 3Q6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  2G6P A;  3FMQ A;  3IL0 A;  4IEC A;  2GU4 A;  2V6C A;  2EA2 A;  4ZWO A;  1M35 A;  5FCH A;  2GTX A;  3CB5 A;  5CDV A;  1WL9 A;  1QXY A;  1R58 A;  2DFI A;  2GU5 A;  2GZ5 A;  4R60 A;  3QOC A;  1WBQ A;  1C27 A;  2BWU A;  4FLI A;  1B6A A;  1WLR A;  4ZWP A;  3BIT A;  1C24 A;  1BN5 A;  3IU7 A;  2BWY A;  1C21 A;  1YW7 A;  2Q95 A;  3FM3 A;  3PKB A;  1QXZ A;  4S2T P;  1BOA A;  1YVM A;  4FUK A;  2BHD A;  5D6E A;  4U75 A;  1XGM A;  1MAT A;  2GG5 A;  2HOW A;  3IG4 A;  1R5H A;  2Q92 A;  2GG7 A;  2Q93 A;  2NQ7 A;  2P98 A;  1R5G A;  4IKR A;  4U6J A;  4S2R P;  4OOK A;  4RZY A;  1PV9 A;  2EVC A;  1N51 A;  4ZWU A;  4FLJ A;  4ZNG A;  4IKU A;  4FKC A;  5E5B A;  2OKN A;  4U69 A;  4U6W A;  5CDL A;  1WY2 A;  5CNX A;  3CB6 A;  1B59 A;  2BHA A;  2OAZ A;  4RGZ 1;  4IU6 A;  4U6E A;  2P9A A;  2V3Z A;  5CE6 A;  1A16 A;  4FO7 A;  3PEB A;  4U70 A;  4QR8 A;  5JI6 A;  2ADU A;  2BWT A;  4IKT A;  2BWX A;  4IDY A;  4U71 A;  2BHC A;  2Q8K A;  3L24 A;  2GG0 A;  3MAT A;  3BIQ A;  3OOO A;  2GU6 A;  2GG8 A;  2EVM A;  4JUQ A;  3PKD A;  1CHM A;  3BIP A;  2BH3 A;  5FCF A;  3FMR A;  3IU8 A;  4FO8 A;  5D6F A;  1W2M A;  4MAT A;  1WL6 A;  4FLK A;  1XNZ A;  3OVK A;  3I7M A;  2B3K A;  1QXW A;  3D27 A;  3PKA A;  4A6W A;  1XGS A;  1YW8 A;  3CTZ A;  1W7V A;  2B3L A;  4IKS A;  3IU9 A;  4U76 A;  2GGC A;  1KQ9 A;  2BWV A;  2V3Y A;  4IPA A;  1C22 A;  4HXX A;  3L7G A;  2GG2 A;  2GU7 A;  3MX6 A;  4FLL A;  4U6C A;  2P99 A;  1KP0 A;  3PKE A;  1YJ3 A;  2V3X A;  1KQ0 A;  4B28 A;  3PKC A;  4IF7 A;  2GG3 A;  2NQ6 A;  1WKM A;  1Y1N A;  2BWS A;  2B3H A;  4RZZ A;  5CLS A;  3TAV A;  3ROR A;  1YW9 A;  4PNC A;  1C23 A;  4Z7M A;  4PV4 A;  1WN1 A;  4S00 A;  4EGE A;  5E2C A;  5CIK A;  2GGB A;  4U1B A;  2IW2 A;  2Q94 A;  3TB5 A;  3PN9 A;  2Q96 A;  4KM3 A;  5CDE A;  2GG9 A;  3MR1 A;  4U6Z A;  1XGO A;  2BB7 A;  3RVA A;  4A6V A;  2EVO A;  5JFR A;  2MAT A;  2BN7 A;  3O5V A;  2BHB A;  2BWW A;  1QZY A;  2ZSG A;  3S6B A;  4S01 A;  2GA2 A;  4U73 A;  5JHU A;  1JAW A;  1XGN A;  2EA4 A;  3Q6D A; 
#chains in the Genus database with same CATH topology
 1O0X A;  2G6P A;  3FMQ A;  3IL0 A;  4IEC A;  2GU4 A;  2V6C A;  2EA2 A;  4ZWO A;  1M35 A;  5FCH A;  2GTX A;  3CB5 A;  5CDV A;  1WL9 A;  1QXY A;  1R58 A;  2DFI A;  2GU5 A;  2GZ5 A;  4R60 A;  3QOC A;  1WBQ A;  1C27 A;  2BWU A;  4FLI A;  1B6A A;  1WLR A;  4ZWP A;  3BIT A;  1C24 A;  1BN5 A;  3IU7 A;  2BWY A;  1C21 A;  1YW7 A;  2Q95 A;  3FM3 A;  3PKB A;  1QXZ A;  4S2T P;  1BOA A;  1YVM A;  4FUK A;  2BHD A;  5D6E A;  4U75 A;  1XGM A;  1MAT A;  2GG5 A;  2HOW A;  3IG4 A;  1R5H A;  2Q92 A;  2GG7 A;  2Q93 A;  2NQ7 A;  2P98 A;  1R5G A;  4IKR A;  4U6J A;  4S2R P;  4OOK A;  4RZY A;  1PV9 A;  2EVC A;  1N51 A;  4ZWU A;  4FLJ A;  4ZNG A;  4IKU A;  4FKC A;  5E5B A;  2OKN A;  4U69 A;  4U6W A;  5CDL A;  1WY2 A;  5CNX A;  3CB6 A;  1B59 A;  2BHA A;  2OAZ A;  4RGZ 1;  4IU6 A;  4U6E A;  2P9A A;  2V3Z A;  5CE6 A;  1A16 A;  4FO7 A;  3PEB A;  4U70 A;  4QR8 A;  5JI6 A;  2ADU A;  2BWT A;  4IKT A;  2BWX A;  4IDY A;  4U71 A;  2BHC A;  2Q8K A;  3L24 A;  2GG0 A;  3MAT A;  3BIQ A;  3OOO A;  2GU6 A;  2GG8 A;  2EVM A;  4JUQ A;  3PKD A;  1CHM A;  3BIP A;  2BH3 A;  5FCF A;  3FMR A;  3IU8 A;  4FO8 A;  5D6F A;  1W2M A;  4MAT A;  1WL6 A;  4FLK A;  1XNZ A;  3OVK A;  3I7M A;  2B3K A;  1QXW A;  3D27 A;  3PKA A;  4A6W A;  1XGS A;  1YW8 A;  3CTZ A;  1W7V A;  2B3L A;  4IKS A;  3IU9 A;  4U76 A;  2GGC A;  1KQ9 A;  2BWV A;  2V3Y A;  4IPA A;  1C22 A;  4HXX A;  3L7G A;  2GG2 A;  2GU7 A;  3MX6 A;  4FLL A;  4U6C A;  2P99 A;  1KP0 A;  3PKE A;  1YJ3 A;  2V3X A;  1KQ0 A;  4B28 A;  3PKC A;  4IF7 A;  2GG3 A;  2NQ6 A;  1WKM A;  1Y1N A;  2BWS A;  2B3H A;  4RZZ A;  5CLS A;  3TAV A;  3ROR A;  1YW9 A;  4PNC A;  1C23 A;  4Z7M A;  4PV4 A;  1WN1 A;  4S00 A;  4EGE A;  5E2C A;  5CIK A;  2GGB A;  4U1B A;  2IW2 A;  2Q94 A;  3TB5 A;  3PN9 A;  2Q96 A;  4KM3 A;  5CDE A;  2GG9 A;  3MR1 A;  4U6Z A;  1XGO A;  2BB7 A;  3RVA A;  4A6V A;  2EVO A;  5JFR A;  2MAT A;  2BN7 A;  3O5V A;  2BHB A;  2BWW A;  1QZY A;  2ZSG A;  3S6B A;  4S01 A;  2GA2 A;  4U73 A;  5JHU A;  1JAW A;  1XGN A;  2EA4 A;  3Q6D A; 
#chains in the Genus database with same CATH homology
 1O0X A;  2G6P A;  3FMQ A;  3IL0 A;  4IEC A;  2GU4 A;  2V6C A;  2EA2 A;  4ZWO A;  1M35 A;  5FCH A;  2GTX A;  3CB5 A;  5CDV A;  1WL9 A;  1QXY A;  1R58 A;  2DFI A;  2GU5 A;  2GZ5 A;  4R60 A;  3QOC A;  1WBQ A;  1C27 A;  2BWU A;  4FLI A;  1B6A A;  1WLR A;  4ZWP A;  3BIT A;  1C24 A;  1BN5 A;  3IU7 A;  2BWY A;  1C21 A;  1YW7 A;  2Q95 A;  3FM3 A;  3PKB A;  1QXZ A;  4S2T P;  1BOA A;  1YVM A;  4FUK A;  2BHD A;  5D6E A;  4U75 A;  1XGM A;  1MAT A;  2GG5 A;  2HOW A;  3IG4 A;  1R5H A;  2Q92 A;  2GG7 A;  2Q93 A;  2NQ7 A;  2P98 A;  1R5G A;  4IKR A;  4U6J A;  4S2R P;  4OOK A;  4RZY A;  1PV9 A;  2EVC A;  1N51 A;  4ZWU A;  4FLJ A;  4ZNG A;  4IKU A;  4FKC A;  5E5B A;  2OKN A;  4U69 A;  4U6W A;  5CDL A;  1WY2 A;  5CNX A;  3CB6 A;  1B59 A;  2BHA A;  2OAZ A;  4RGZ 1;  4IU6 A;  4U6E A;  2P9A A;  2V3Z A;  5CE6 A;  1A16 A;  4FO7 A;  3PEB A;  4U70 A;  4QR8 A;  5JI6 A;  2ADU A;  2BWT A;  4IKT A;  2BWX A;  4IDY A;  4U71 A;  2BHC A;  2Q8K A;  3L24 A;  2GG0 A;  3MAT A;  3BIQ A;  3OOO A;  2GU6 A;  2GG8 A;  2EVM A;  4JUQ A;  3PKD A;  1CHM A;  3BIP A;  2BH3 A;  5FCF A;  3FMR A;  3IU8 A;  4FO8 A;  5D6F A;  1W2M A;  4MAT A;  1WL6 A;  4FLK A;  1XNZ A;  3OVK A;  3I7M A;  2B3K A;  1QXW A;  3D27 A;  3PKA A;  4A6W A;  1XGS A;  1YW8 A;  3CTZ A;  1W7V A;  2B3L A;  4IKS A;  3IU9 A;  4U76 A;  2GGC A;  1KQ9 A;  2BWV A;  2V3Y A;  4IPA A;  1C22 A;  4HXX A;  3L7G A;  2GG2 A;  2GU7 A;  3MX6 A;  4FLL A;  4U6C A;  2P99 A;  1KP0 A;  3PKE A;  1YJ3 A;  2V3X A;  1KQ0 A;  4B28 A;  3PKC A;  4IF7 A;  2GG3 A;  2NQ6 A;  1WKM A;  1Y1N A;  2BWS A;  2B3H A;  4RZZ A;  5CLS A;  3TAV A;  3ROR A;  1YW9 A;  4PNC A;  1C23 A;  4Z7M A;  4PV4 A;  1WN1 A;  4S00 A;  4EGE A;  5E2C A;  5CIK A;  2GGB A;  4U1B A;  2IW2 A;  2Q94 A;  3TB5 A;  3PN9 A;  2Q96 A;  4KM3 A;  5CDE A;  2GG9 A;  3MR1 A;  4U6Z A;  1XGO A;  2BB7 A;  3RVA A;  4A6V A;  2EVO A;  5JFR A;  2MAT A;  2BN7 A;  3O5V A;  2BHB A;  2BWW A;  1QZY A;  2ZSG A;  3S6B A;  4S01 A;  2GA2 A;  4U73 A;  5JHU A;  1JAW A;  1XGN A;  2EA4 A;  3Q6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...