2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
3OOOA 2GZ5A 3I7MA 3PKBA 1M35A 4ZWUA 4QR8A 3L7GA 4RGZ1 2MATA 1WKMA 5CDVA 5CLSA 5CDLA 1MATA 2ADUA 4IF7A 3CB5A 3RORA 1BN5A 1W2MA 5D6EA 1WL9A 3CTZA 2EA2A 1WL6A 3PKAA 2P98A 2EVMA 4R60A 1XGNA 2B3LA 4U6ZA 4S2TP 1WY2A 3FM3A 3BIQA 1O0XA 1A16A 3CB6A 4ZWPA 1C21A 2Q95A 4HXXA 4U76A 5JHUA 4ZNGA 5E5BA 1WN1A 2OKNA 4EGEA 1R58A 3Q6DA 2GG8A 2P99A 5JFRA 2V3YA 5D6FA 3PN9A 4IKTA 2OAZA 3IG4A 4U70A 4FLJA 5E2CA 1QZYA 1KQ0A 2Q92A 4U75A 3MR1A 2HOWA 3MX6A 4OOKA 2NQ7A 5CIKA 2EVCA 1C24A 5CE6A 2Q8KA 3TB5A 1YW9A 2GU7A 3OVKA 4U1BA 3PEBA 2BHDA 5CNXA 1C27A 2BH3A 3D27A 4B28A 2NQ6A 4U6WA 1C22A 3RVAA 1YW8A 1KQ9A 4FLKA 4KM3A 2GG7A 1C23A 1YVMA 1BOAA 4S2RP 4IKSA 3TAVA 2Q94A 4IPAA 3L24A 2GG2A 4U69A 1XGSA 5JI6A 2GG9A 3BIPA 2BWSA 4ZWOA 1QXZA 2DFIA 4U6EA 1YJ3A 3MATA 1XGMA 1N51A 4FLIA 1JAWA 4FUKA 4S01A 2GGCA 5FCFA 2GTXA 1CHMA 3IL0A 3PKCA 2BWUA 1KP0A 3FMQA 5CDEA 2Q93A 4FO7A 2BHAA 2BWTA 1WBQA 3O5VA 1R5HA 2BWYA 2B3KA 4U6CA 1Y1NA 1QXWA 1B6AA 4PNCA 1YW7A 4IECA 5FCHA 4A6WA 4U73A 2BWXA 2GGBA 2BWVA 1XGOA 2GG5A 2GU6A 4RZZA 4A6VA 2EA4A 4PV4A 4U6JA 2BB7A 3IU8A 2GU5A 3IU9A 1W7VA 2BWWA 4FKCA 1XNZA 3PKDA 4IKRA 4IKUA 2GU4A 4FLLA 2V3ZA 1QXYA 2G6PA 3QOCA 2GA2A 4FO8A 4MATA 4JUQA 1R5GA 4U71A 1WLRA 1B59A 4IDYA 2BHBA 4IU6A 3BITA 2BHCA 3S6BA 4Z7MA 3PKEA 4RZYA 2ZSGA 2P9AA 2B3HA 1PV9A 4S00A 2EVOA 2Q96A 2V3XA 2IW2A 2GG3A 2V6CA 2BN7A 3FMRA 3IU7A 2GG0A
chains in the Genus database with same CATH superfamily
3OOOA 2GZ5A 3I7MA 3PKBA 1M35A 4ZWUA 4QR8A 3L7GA 4RGZ1 2MATA 1WKMA 5CDVA 5CLSA 5CDLA 1MATA 2ADUA 4IF7A 3CB5A 3RORA 1BN5A 1W2MA 5D6EA 1WL9A 3CTZA 2EA2A 1WL6A 3PKAA 2P98A 2EVMA 4R60A 1XGNA 2B3LA 4U6ZA 4S2TP 1WY2A 3FM3A 3BIQA 1O0XA 1A16A 3CB6A 4ZWPA 1C21A 2Q95A 4HXXA 4U76A 5JHUA 4ZNGA 5E5BA 1WN1A 2OKNA 4EGEA 1R58A 3Q6DA 2GG8A 2P99A 5JFRA 2V3YA 5D6FA 3PN9A 4IKTA 2OAZA 3IG4A 4U70A 4FLJA 5E2CA 1QZYA 1KQ0A 2Q92A 4U75A 3MR1A 2HOWA 3MX6A 4OOKA 2NQ7A 5CIKA 2EVCA 1C24A 5CE6A 2Q8KA 3TB5A 1YW9A 2GU7A 3OVKA 4U1BA 3PEBA 2BHDA 5CNXA 1C27A 2BH3A 3D27A 4B28A 2NQ6A 4U6WA 1C22A 3RVAA 1YW8A 1KQ9A 4FLKA 4KM3A 2GG7A 1C23A 1YVMA 1BOAA 4S2RP 4IKSA 3TAVA 2Q94A 4IPAA 3L24A 2GG2A 4U69A 1XGSA 5JI6A 2GG9A 3BIPA 2BWSA 4ZWOA 1QXZA 2DFIA 4U6EA 1YJ3A 3MATA 1XGMA 1N51A 4FLIA 1JAWA 4FUKA 4S01A 2GGCA 5FCFA 2GTXA 1CHMA 3IL0A 3PKCA 2BWUA 1KP0A 3FMQA 5CDEA 2Q93A 4FO7A 2BHAA 2BWTA 1WBQA 3O5VA 1R5HA 2BWYA 2B3KA 4U6CA 1Y1NA 1QXWA 1B6AA 4PNCA 1YW7A 4IECA 5FCHA 4A6WA 4U73A 2BWXA 2GGBA 2BWVA 1XGOA 2GG5A 2GU6A 4RZZA 4A6VA 2EA4A 4PV4A 4U6JA 2BB7A 3IU8A 2GU5A 3IU9A 1W7VA 2BWWA 4FKCA 1XNZA 3PKDA 4IKRA 4IKUA 2GU4A 4FLLA 2V3ZA 1QXYA 2G6PA 3QOCA 2GA2A 4FO8A 4MATA 4JUQA 1R5GA 4U71A 1WLRA 1B59A 4IDYA 2BHBA 4IU6A 3BITA 2BHCA 3S6BA 4Z7MA 3PKEA 4RZYA 2ZSGA 2P9AA 2B3HA 1PV9A 4S00A 2EVOA 2Q96A 2V3XA 2IW2A 2GG3A 2V6CA 2BN7A 3FMRA 3IU7A 2GG0A
chains in the Genus database with same CATH topology
3OOOA 2GZ5A 3I7MA 3PKBA 1M35A 4ZWUA 4QR8A 3L7GA 4RGZ1 2MATA 1WKMA 5CDVA 5CLSA 5CDLA 1MATA 2ADUA 4IF7A 3CB5A 3RORA 1BN5A 1W2MA 5D6EA 1WL9A 3CTZA 2EA2A 1WL6A 3PKAA 2P98A 2EVMA 4R60A 1XGNA 2B3LA 4U6ZA 4S2TP 1WY2A 3FM3A 3BIQA 1O0XA 1A16A 3CB6A 4ZWPA 1C21A 2Q95A 4HXXA 4U76A 5JHUA 4ZNGA 5E5BA 1WN1A 2OKNA 4EGEA 1R58A 3Q6DA 2GG8A 2P99A 5JFRA 2V3YA 5D6FA 3PN9A 4IKTA 2OAZA 3IG4A 4U70A 4FLJA 5E2CA 1QZYA 1KQ0A 2Q92A 4U75A 3MR1A 2HOWA 3MX6A 4OOKA 2NQ7A 5CIKA 2EVCA 1C24A 5CE6A 2Q8KA 3TB5A 1YW9A 2GU7A 3OVKA 4U1BA 3PEBA 2BHDA 5CNXA 1C27A 2BH3A 3D27A 4B28A 2NQ6A 4U6WA 1C22A 3RVAA 1YW8A 1KQ9A 4FLKA 4KM3A 2GG7A 1C23A 1YVMA 1BOAA 4S2RP 4IKSA 3TAVA 2Q94A 4IPAA 3L24A 2GG2A 4U69A 1XGSA 5JI6A 2GG9A 3BIPA 2BWSA 4ZWOA 1QXZA 2DFIA 4U6EA 1YJ3A 3MATA 1XGMA 1N51A 4FLIA 1JAWA 4FUKA 4S01A 2GGCA 5FCFA 2GTXA 1CHMA 3IL0A 3PKCA 2BWUA 1KP0A 3FMQA 5CDEA 2Q93A 4FO7A 2BHAA 2BWTA 1WBQA 3O5VA 1R5HA 2BWYA 2B3KA 4U6CA 1Y1NA 1QXWA 1B6AA 4PNCA 1YW7A 4IECA 5FCHA 4A6WA 4U73A 2BWXA 2GGBA 2BWVA 1XGOA 2GG5A 2GU6A 4RZZA 4A6VA 2EA4A 4PV4A 4U6JA 2BB7A 3IU8A 2GU5A 3IU9A 1W7VA 2BWWA 4FKCA 1XNZA 3PKDA 4IKRA 4IKUA 2GU4A 4FLLA 2V3ZA 1QXYA 2G6PA 3QOCA 2GA2A 4FO8A 4MATA 4JUQA 1R5GA 4U71A 1WLRA 1B59A 4IDYA 2BHBA 4IU6A 3BITA 2BHCA 3S6BA 4Z7MA 3PKEA 4RZYA 2ZSGA 2P9AA 2B3HA 1PV9A 4S00A 2EVOA 2Q96A 2V3XA 2IW2A 2GG3A 2V6CA 2BN7A 3FMRA 3IU7A 2GG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOO A;  2GZ5 A;  3I7M A;  3PKB A;  1M35 A;  4ZWU A;  4QR8 A;  3L7G A;  4RGZ 1;  2MAT A;  1WKM A;  5CDV A;  5CLS A;  5CDL A;  1MAT A;  2ADU A;  4IF7 A;  3CB5 A;  3ROR A;  1BN5 A;  1W2M A;  5D6E A;  1WL9 A;  3CTZ A;  2EA2 A;  1WL6 A;  3PKA A;  2P98 A;  2EVM A;  4R60 A;  1XGN A;  2B3L A;  4U6Z A;  4S2T P;  1WY2 A;  3FM3 A;  3BIQ A;  1O0X A;  1A16 A;  3CB6 A;  4ZWP A;  1C21 A;  2Q95 A;  4HXX A;  4U76 A;  5JHU A;  4ZNG A;  5E5B A;  1WN1 A;  2OKN A;  4EGE A;  1R58 A;  3Q6D A;  2GG8 A;  2P99 A;  5JFR A;  2V3Y A;  5D6F A;  3PN9 A;  4IKT A;  2OAZ A;  3IG4 A;  4U70 A;  4FLJ A;  5E2C A;  1QZY A;  1KQ0 A;  2Q92 A;  4U75 A;  3MR1 A;  2HOW A;  3MX6 A;  4OOK A;  2NQ7 A;  5CIK A;  2EVC A;  1C24 A;  5CE6 A;  2Q8K A;  3TB5 A;  1YW9 A;  2GU7 A;  3OVK A;  4U1B A;  3PEB A;  2BHD A;  5CNX A;  1C27 A;  2BH3 A;  3D27 A;  4B28 A;  2NQ6 A;  4U6W A;  1C22 A;  3RVA A;  1YW8 A;  1KQ9 A;  4FLK A;  4KM3 A;  2GG7 A;  1C23 A;  1YVM A;  1BOA A;  4S2R P;  4IKS A;  3TAV A;  2Q94 A;  4IPA A;  3L24 A;  2GG2 A;  4U69 A;  1XGS A;  5JI6 A;  2GG9 A;  3BIP A;  2BWS A;  4ZWO A;  1QXZ A;  2DFI A;  4U6E A;  1YJ3 A;  3MAT A;  1XGM A;  1N51 A;  4FLI A;  1JAW A;  4FUK A;  4S01 A;  2GGC A;  5FCF A;  2GTX A;  1CHM A;  3IL0 A;  3PKC A;  2BWU A;  1KP0 A;  3FMQ A;  5CDE A;  2Q93 A;  4FO7 A;  2BHA A;  2BWT A;  1WBQ A;  3O5V A;  1R5H A;  2BWY A;  2B3K A;  4U6C A;  1Y1N A;  1QXW A;  1B6A A;  4PNC A;  1YW7 A;  4IEC A;  5FCH A;  4A6W A;  4U73 A;  2BWX A;  2GGB A;  2BWV A;  1XGO A;  2GG5 A;  2GU6 A;  4RZZ A;  4A6V A;  2EA4 A;  4PV4 A;  4U6J A;  2BB7 A;  3IU8 A;  2GU5 A;  3IU9 A;  1W7V A;  2BWW A;  4FKC A;  1XNZ A;  3PKD A;  4IKR A;  4IKU A;  2GU4 A;  4FLL A;  2V3Z A;  1QXY A;  2G6P A;  3QOC A;  2GA2 A;  4FO8 A;  4MAT A;  4JUQ A;  1R5G A;  4U71 A;  1WLR A;  1B59 A;  4IDY A;  2BHB A;  4IU6 A;  3BIT A;  2BHC A;  3S6B A;  4Z7M A;  3PKE A;  4RZY A;  2ZSG A;  2P9A A;  2B3H A;  1PV9 A;  4S00 A;  2EVO A;  2Q96 A;  2V3X A;  2IW2 A;  2GG3 A;  2V6C A;  2BN7 A;  3FMR A;  3IU7 A;  2GG0 A; 
#chains in the Genus database with same CATH topology
 3OOO A;  2GZ5 A;  3I7M A;  3PKB A;  1M35 A;  4ZWU A;  4QR8 A;  3L7G A;  4RGZ 1;  2MAT A;  1WKM A;  5CDV A;  5CLS A;  5CDL A;  1MAT A;  2ADU A;  4IF7 A;  3CB5 A;  3ROR A;  1BN5 A;  1W2M A;  5D6E A;  1WL9 A;  3CTZ A;  2EA2 A;  1WL6 A;  3PKA A;  2P98 A;  2EVM A;  4R60 A;  1XGN A;  2B3L A;  4U6Z A;  4S2T P;  1WY2 A;  3FM3 A;  3BIQ A;  1O0X A;  1A16 A;  3CB6 A;  4ZWP A;  1C21 A;  2Q95 A;  4HXX A;  4U76 A;  5JHU A;  4ZNG A;  5E5B A;  1WN1 A;  2OKN A;  4EGE A;  1R58 A;  3Q6D A;  2GG8 A;  2P99 A;  5JFR A;  2V3Y A;  5D6F A;  3PN9 A;  4IKT A;  2OAZ A;  3IG4 A;  4U70 A;  4FLJ A;  5E2C A;  1QZY A;  1KQ0 A;  2Q92 A;  4U75 A;  3MR1 A;  2HOW A;  3MX6 A;  4OOK A;  2NQ7 A;  5CIK A;  2EVC A;  1C24 A;  5CE6 A;  2Q8K A;  3TB5 A;  1YW9 A;  2GU7 A;  3OVK A;  4U1B A;  3PEB A;  2BHD A;  5CNX A;  1C27 A;  2BH3 A;  3D27 A;  4B28 A;  2NQ6 A;  4U6W A;  1C22 A;  3RVA A;  1YW8 A;  1KQ9 A;  4FLK A;  4KM3 A;  2GG7 A;  1C23 A;  1YVM A;  1BOA A;  4S2R P;  4IKS A;  3TAV A;  2Q94 A;  4IPA A;  3L24 A;  2GG2 A;  4U69 A;  1XGS A;  5JI6 A;  2GG9 A;  3BIP A;  2BWS A;  4ZWO A;  1QXZ A;  2DFI A;  4U6E A;  1YJ3 A;  3MAT A;  1XGM A;  1N51 A;  4FLI A;  1JAW A;  4FUK A;  4S01 A;  2GGC A;  5FCF A;  2GTX A;  1CHM A;  3IL0 A;  3PKC A;  2BWU A;  1KP0 A;  3FMQ A;  5CDE A;  2Q93 A;  4FO7 A;  2BHA A;  2BWT A;  1WBQ A;  3O5V A;  1R5H A;  2BWY A;  2B3K A;  4U6C A;  1Y1N A;  1QXW A;  1B6A A;  4PNC A;  1YW7 A;  4IEC A;  5FCH A;  4A6W A;  4U73 A;  2BWX A;  2GGB A;  2BWV A;  1XGO A;  2GG5 A;  2GU6 A;  4RZZ A;  4A6V A;  2EA4 A;  4PV4 A;  4U6J A;  2BB7 A;  3IU8 A;  2GU5 A;  3IU9 A;  1W7V A;  2BWW A;  4FKC A;  1XNZ A;  3PKD A;  4IKR A;  4IKU A;  2GU4 A;  4FLL A;  2V3Z A;  1QXY A;  2G6P A;  3QOC A;  2GA2 A;  4FO8 A;  4MAT A;  4JUQ A;  1R5G A;  4U71 A;  1WLR A;  1B59 A;  4IDY A;  2BHB A;  4IU6 A;  3BIT A;  2BHC A;  3S6B A;  4Z7M A;  3PKE A;  4RZY A;  2ZSG A;  2P9A A;  2B3H A;  1PV9 A;  4S00 A;  2EVO A;  2Q96 A;  2V3X A;  2IW2 A;  2GG3 A;  2V6C A;  2BN7 A;  3FMR A;  3IU7 A;  2GG0 A; 
#chains in the Genus database with same CATH homology
 3OOO A;  2GZ5 A;  3I7M A;  3PKB A;  1M35 A;  4ZWU A;  4QR8 A;  3L7G A;  4RGZ 1;  2MAT A;  1WKM A;  5CDV A;  5CLS A;  5CDL A;  1MAT A;  2ADU A;  4IF7 A;  3CB5 A;  3ROR A;  1BN5 A;  1W2M A;  5D6E A;  1WL9 A;  3CTZ A;  2EA2 A;  1WL6 A;  3PKA A;  2P98 A;  2EVM A;  4R60 A;  1XGN A;  2B3L A;  4U6Z A;  4S2T P;  1WY2 A;  3FM3 A;  3BIQ A;  1O0X A;  1A16 A;  3CB6 A;  4ZWP A;  1C21 A;  2Q95 A;  4HXX A;  4U76 A;  5JHU A;  4ZNG A;  5E5B A;  1WN1 A;  2OKN A;  4EGE A;  1R58 A;  3Q6D A;  2GG8 A;  2P99 A;  5JFR A;  2V3Y A;  5D6F A;  3PN9 A;  4IKT A;  2OAZ A;  3IG4 A;  4U70 A;  4FLJ A;  5E2C A;  1QZY A;  1KQ0 A;  2Q92 A;  4U75 A;  3MR1 A;  2HOW A;  3MX6 A;  4OOK A;  2NQ7 A;  5CIK A;  2EVC A;  1C24 A;  5CE6 A;  2Q8K A;  3TB5 A;  1YW9 A;  2GU7 A;  3OVK A;  4U1B A;  3PEB A;  2BHD A;  5CNX A;  1C27 A;  2BH3 A;  3D27 A;  4B28 A;  2NQ6 A;  4U6W A;  1C22 A;  3RVA A;  1YW8 A;  1KQ9 A;  4FLK A;  4KM3 A;  2GG7 A;  1C23 A;  1YVM A;  1BOA A;  4S2R P;  4IKS A;  3TAV A;  2Q94 A;  4IPA A;  3L24 A;  2GG2 A;  4U69 A;  1XGS A;  5JI6 A;  2GG9 A;  3BIP A;  2BWS A;  4ZWO A;  1QXZ A;  2DFI A;  4U6E A;  1YJ3 A;  3MAT A;  1XGM A;  1N51 A;  4FLI A;  1JAW A;  4FUK A;  4S01 A;  2GGC A;  5FCF A;  2GTX A;  1CHM A;  3IL0 A;  3PKC A;  2BWU A;  1KP0 A;  3FMQ A;  5CDE A;  2Q93 A;  4FO7 A;  2BHA A;  2BWT A;  1WBQ A;  3O5V A;  1R5H A;  2BWY A;  2B3K A;  4U6C A;  1Y1N A;  1QXW A;  1B6A A;  4PNC A;  1YW7 A;  4IEC A;  5FCH A;  4A6W A;  4U73 A;  2BWX A;  2GGB A;  2BWV A;  1XGO A;  2GG5 A;  2GU6 A;  4RZZ A;  4A6V A;  2EA4 A;  4PV4 A;  4U6J A;  2BB7 A;  3IU8 A;  2GU5 A;  3IU9 A;  1W7V A;  2BWW A;  4FKC A;  1XNZ A;  3PKD A;  4IKR A;  4IKU A;  2GU4 A;  4FLL A;  2V3Z A;  1QXY A;  2G6P A;  3QOC A;  2GA2 A;  4FO8 A;  4MAT A;  4JUQ A;  1R5G A;  4U71 A;  1WLR A;  1B59 A;  4IDY A;  2BHB A;  4IU6 A;  3BIT A;  2BHC A;  3S6B A;  4Z7M A;  3PKE A;  4RZY A;  2ZSG A;  2P9A A;  2B3H A;  1PV9 A;  4S00 A;  2EVO A;  2Q96 A;  2V3X A;  2IW2 A;  2GG3 A;  2V6C A;  2BN7 A;  3FMR A;  3IU7 A;  2GG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...