2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
1PV9A 1M35A 4IKUA 2Q94A 1QZYA 4S2RP 2Q8KA 4PV4A 1BOAA 4FLJA 1WBQA 2EA4A 1B59A 1R5GA 2Q95A 5CIKA 5E5BA 2OAZA 4R60A 1R5HA 2ADUA 2GU4A 1XGOA 2GG8A 1N51A 4FUKA 3BIPA 3O5VA 2GA2A 3QOCA 3FM3A 1YW9A 2GG9A 1W7VA 1YJ3A 3IU8A 4ZNGA 1WL6A 2GG3A 2GTXA 2V6CA 2GGBA 4RGZ1 4U6JA 1QXZA 2EVMA 1XGNA 3FMQA 4A6VA 4PNCA 4OOKA 4S2TP 4FO7A 4IDYA 4KM3A 1BN5A 4JUQA 2BWXA 2BHBA 5CDLA 3RVAA 1R58A 5CE6A 2DFIA 3CB6A 1YVMA 3IU7A 1B6AA 3TB5A 3MATA 3PKBA 3CTZA 2BHAA 4IKSA 1CHMA 2Q92A 4EGEA 3MX6A 1WY2A 2EVCA 4Z7MA 2BHDA 4IKRA 4U71A 1C22A 1WLRA 2GU7A 2OKNA 4MATA 4U6WA 1MATA 2G6PA 2EA2A 4U1BA 4HXXA 4IKTA 1O0XA 2NQ7A 4FLLA 3MR1A 3RORA 3S6BA 5FCFA 2BWTA 4U75A 2EVOA 3PEBA 3PKDA 2GG5A 2BWYA 3PKEA 2B3LA 3TAVA 3FMRA 1QXYA 5CNXA 2GU5A 2GG7A 2P98A 2BH3A 4FLKA 2GU6A 2ZSGA 4A6WA 3I7MA 4IPAA 2IW2A 3PKCA 2BHCA 2B3KA 4U76A 1WL9A 2BWUA 3IU9A 2P99A 3PN9A 5JHUA 4FLIA 4U6EA 2MATA 1KQ0A 2GGCA 4FKCA 2Q93A 2V3ZA 5CLSA 4U73A 3CB5A 1A16A 5D6EA 3Q6DA 4IF7A 2BWVA 2V3XA 1W2MA 1JAWA 2V3YA 4FO8A 3BIQA 4S01A 2GZ5A 5JFRA 4ZWUA 3D27A 3IG4A 1YW7A 2P9AA 1XGSA 3BITA 1WN1A 2BWSA 4S00A 5FCHA 4ZWPA 1XNZA 1Y1NA 1C23A 2BB7A 1QXWA 2GG2A 4U6ZA 1YW8A 2BWWA 4IECA 3L24A 4U69A 2GG0A 1XGMA 4U6CA 5CDEA 2Q96A 1C21A 4RZYA 5D6FA 2HOWA 3L7GA 1KQ9A 4B28A 2B3HA 3OOOA 1WKMA 5JI6A 1C24A 4ZWOA 2BN7A 3PKAA 5E2CA 1C27A 2NQ6A 4U70A 3IL0A 3OVKA 4IU6A 4RZZA 5CDVA 4QR8A 1KP0A
chains in the Genus database with same CATH superfamily
1PV9A 1M35A 4IKUA 2Q94A 1QZYA 4S2RP 2Q8KA 4PV4A 1BOAA 4FLJA 1WBQA 2EA4A 1B59A 1R5GA 2Q95A 5CIKA 5E5BA 2OAZA 4R60A 1R5HA 2ADUA 2GU4A 1XGOA 2GG8A 1N51A 4FUKA 3BIPA 3O5VA 2GA2A 3QOCA 3FM3A 1YW9A 2GG9A 1W7VA 1YJ3A 3IU8A 4ZNGA 1WL6A 2GG3A 2GTXA 2V6CA 2GGBA 4RGZ1 4U6JA 1QXZA 2EVMA 1XGNA 3FMQA 4A6VA 4PNCA 4OOKA 4S2TP 4FO7A 4IDYA 4KM3A 1BN5A 4JUQA 2BWXA 2BHBA 5CDLA 3RVAA 1R58A 5CE6A 2DFIA 3CB6A 1YVMA 3IU7A 1B6AA 3TB5A 3MATA 3PKBA 3CTZA 2BHAA 4IKSA 1CHMA 2Q92A 4EGEA 3MX6A 1WY2A 2EVCA 4Z7MA 2BHDA 4IKRA 4U71A 1C22A 1WLRA 2GU7A 2OKNA 4MATA 4U6WA 1MATA 2G6PA 2EA2A 4U1BA 4HXXA 4IKTA 1O0XA 2NQ7A 4FLLA 3MR1A 3RORA 3S6BA 5FCFA 2BWTA 4U75A 2EVOA 3PEBA 3PKDA 2GG5A 2BWYA 3PKEA 2B3LA 3TAVA 3FMRA 1QXYA 5CNXA 2GU5A 2GG7A 2P98A 2BH3A 4FLKA 2GU6A 2ZSGA 4A6WA 3I7MA 4IPAA 2IW2A 3PKCA 2BHCA 2B3KA 4U76A 1WL9A 2BWUA 3IU9A 2P99A 3PN9A 5JHUA 4FLIA 4U6EA 2MATA 1KQ0A 2GGCA 4FKCA 2Q93A 2V3ZA 5CLSA 4U73A 3CB5A 1A16A 5D6EA 3Q6DA 4IF7A 2BWVA 2V3XA 1W2MA 1JAWA 2V3YA 4FO8A 3BIQA 4S01A 2GZ5A 5JFRA 4ZWUA 3D27A 3IG4A 1YW7A 2P9AA 1XGSA 3BITA 1WN1A 2BWSA 4S00A 5FCHA 4ZWPA 1XNZA 1Y1NA 1C23A 2BB7A 1QXWA 2GG2A 4U6ZA 1YW8A 2BWWA 4IECA 3L24A 4U69A 2GG0A 1XGMA 4U6CA 5CDEA 2Q96A 1C21A 4RZYA 5D6FA 2HOWA 3L7GA 1KQ9A 4B28A 2B3HA 3OOOA 1WKMA 5JI6A 1C24A 4ZWOA 2BN7A 3PKAA 5E2CA 1C27A 2NQ6A 4U70A 3IL0A 3OVKA 4IU6A 4RZZA 5CDVA 4QR8A 1KP0A
chains in the Genus database with same CATH topology
1PV9A 1M35A 4IKUA 2Q94A 1QZYA 4S2RP 2Q8KA 4PV4A 1BOAA 4FLJA 1WBQA 2EA4A 1B59A 1R5GA 2Q95A 5CIKA 5E5BA 2OAZA 4R60A 1R5HA 2ADUA 2GU4A 1XGOA 2GG8A 1N51A 4FUKA 3BIPA 3O5VA 2GA2A 3QOCA 3FM3A 1YW9A 2GG9A 1W7VA 1YJ3A 3IU8A 4ZNGA 1WL6A 2GG3A 2GTXA 2V6CA 2GGBA 4RGZ1 4U6JA 1QXZA 2EVMA 1XGNA 3FMQA 4A6VA 4PNCA 4OOKA 4S2TP 4FO7A 4IDYA 4KM3A 1BN5A 4JUQA 2BWXA 2BHBA 5CDLA 3RVAA 1R58A 5CE6A 2DFIA 3CB6A 1YVMA 3IU7A 1B6AA 3TB5A 3MATA 3PKBA 3CTZA 2BHAA 4IKSA 1CHMA 2Q92A 4EGEA 3MX6A 1WY2A 2EVCA 4Z7MA 2BHDA 4IKRA 4U71A 1C22A 1WLRA 2GU7A 2OKNA 4MATA 4U6WA 1MATA 2G6PA 2EA2A 4U1BA 4HXXA 4IKTA 1O0XA 2NQ7A 4FLLA 3MR1A 3RORA 3S6BA 5FCFA 2BWTA 4U75A 2EVOA 3PEBA 3PKDA 2GG5A 2BWYA 3PKEA 2B3LA 3TAVA 3FMRA 1QXYA 5CNXA 2GU5A 2GG7A 2P98A 2BH3A 4FLKA 2GU6A 2ZSGA 4A6WA 3I7MA 4IPAA 2IW2A 3PKCA 2BHCA 2B3KA 4U76A 1WL9A 2BWUA 3IU9A 2P99A 3PN9A 5JHUA 4FLIA 4U6EA 2MATA 1KQ0A 2GGCA 4FKCA 2Q93A 2V3ZA 5CLSA 4U73A 3CB5A 1A16A 5D6EA 3Q6DA 4IF7A 2BWVA 2V3XA 1W2MA 1JAWA 2V3YA 4FO8A 3BIQA 4S01A 2GZ5A 5JFRA 4ZWUA 3D27A 3IG4A 1YW7A 2P9AA 1XGSA 3BITA 1WN1A 2BWSA 4S00A 5FCHA 4ZWPA 1XNZA 1Y1NA 1C23A 2BB7A 1QXWA 2GG2A 4U6ZA 1YW8A 2BWWA 4IECA 3L24A 4U69A 2GG0A 1XGMA 4U6CA 5CDEA 2Q96A 1C21A 4RZYA 5D6FA 2HOWA 3L7GA 1KQ9A 4B28A 2B3HA 3OOOA 1WKMA 5JI6A 1C24A 4ZWOA 2BN7A 3PKAA 5E2CA 1C27A 2NQ6A 4U70A 3IL0A 3OVKA 4IU6A 4RZZA 5CDVA 4QR8A 1KP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV9 A;  1M35 A;  4IKU A;  2Q94 A;  1QZY A;  4S2R P;  2Q8K A;  4PV4 A;  1BOA A;  4FLJ A;  1WBQ A;  2EA4 A;  1B59 A;  1R5G A;  2Q95 A;  5CIK A;  5E5B A;  2OAZ A;  4R60 A;  1R5H A;  2ADU A;  2GU4 A;  1XGO A;  2GG8 A;  1N51 A;  4FUK A;  3BIP A;  3O5V A;  2GA2 A;  3QOC A;  3FM3 A;  1YW9 A;  2GG9 A;  1W7V A;  1YJ3 A;  3IU8 A;  4ZNG A;  1WL6 A;  2GG3 A;  2GTX A;  2V6C A;  2GGB A;  4RGZ 1;  4U6J A;  1QXZ A;  2EVM A;  1XGN A;  3FMQ A;  4A6V A;  4PNC A;  4OOK A;  4S2T P;  4FO7 A;  4IDY A;  4KM3 A;  1BN5 A;  4JUQ A;  2BWX A;  2BHB A;  5CDL A;  3RVA A;  1R58 A;  5CE6 A;  2DFI A;  3CB6 A;  1YVM A;  3IU7 A;  1B6A A;  3TB5 A;  3MAT A;  3PKB A;  3CTZ A;  2BHA A;  4IKS A;  1CHM A;  2Q92 A;  4EGE A;  3MX6 A;  1WY2 A;  2EVC A;  4Z7M A;  2BHD A;  4IKR A;  4U71 A;  1C22 A;  1WLR A;  2GU7 A;  2OKN A;  4MAT A;  4U6W A;  1MAT A;  2G6P A;  2EA2 A;  4U1B A;  4HXX A;  4IKT A;  1O0X A;  2NQ7 A;  4FLL A;  3MR1 A;  3ROR A;  3S6B A;  5FCF A;  2BWT A;  4U75 A;  2EVO A;  3PEB A;  3PKD A;  2GG5 A;  2BWY A;  3PKE A;  2B3L A;  3TAV A;  3FMR A;  1QXY A;  5CNX A;  2GU5 A;  2GG7 A;  2P98 A;  2BH3 A;  4FLK A;  2GU6 A;  2ZSG A;  4A6W A;  3I7M A;  4IPA A;  2IW2 A;  3PKC A;  2BHC A;  2B3K A;  4U76 A;  1WL9 A;  2BWU A;  3IU9 A;  2P99 A;  3PN9 A;  5JHU A;  4FLI A;  4U6E A;  2MAT A;  1KQ0 A;  2GGC A;  4FKC A;  2Q93 A;  2V3Z A;  5CLS A;  4U73 A;  3CB5 A;  1A16 A;  5D6E A;  3Q6D A;  4IF7 A;  2BWV A;  2V3X A;  1W2M A;  1JAW A;  2V3Y A;  4FO8 A;  3BIQ A;  4S01 A;  2GZ5 A;  5JFR A;  4ZWU A;  3D27 A;  3IG4 A;  1YW7 A;  2P9A A;  1XGS A;  3BIT A;  1WN1 A;  2BWS A;  4S00 A;  5FCH A;  4ZWP A;  1XNZ A;  1Y1N A;  1C23 A;  2BB7 A;  1QXW A;  2GG2 A;  4U6Z A;  1YW8 A;  2BWW A;  4IEC A;  3L24 A;  4U69 A;  2GG0 A;  1XGM A;  4U6C A;  5CDE A;  2Q96 A;  1C21 A;  4RZY A;  5D6F A;  2HOW A;  3L7G A;  1KQ9 A;  4B28 A;  2B3H A;  3OOO A;  1WKM A;  5JI6 A;  1C24 A;  4ZWO A;  2BN7 A;  3PKA A;  5E2C A;  1C27 A;  2NQ6 A;  4U70 A;  3IL0 A;  3OVK A;  4IU6 A;  4RZZ A;  5CDV A;  4QR8 A;  1KP0 A; 
#chains in the Genus database with same CATH topology
 1PV9 A;  1M35 A;  4IKU A;  2Q94 A;  1QZY A;  4S2R P;  2Q8K A;  4PV4 A;  1BOA A;  4FLJ A;  1WBQ A;  2EA4 A;  1B59 A;  1R5G A;  2Q95 A;  5CIK A;  5E5B A;  2OAZ A;  4R60 A;  1R5H A;  2ADU A;  2GU4 A;  1XGO A;  2GG8 A;  1N51 A;  4FUK A;  3BIP A;  3O5V A;  2GA2 A;  3QOC A;  3FM3 A;  1YW9 A;  2GG9 A;  1W7V A;  1YJ3 A;  3IU8 A;  4ZNG A;  1WL6 A;  2GG3 A;  2GTX A;  2V6C A;  2GGB A;  4RGZ 1;  4U6J A;  1QXZ A;  2EVM A;  1XGN A;  3FMQ A;  4A6V A;  4PNC A;  4OOK A;  4S2T P;  4FO7 A;  4IDY A;  4KM3 A;  1BN5 A;  4JUQ A;  2BWX A;  2BHB A;  5CDL A;  3RVA A;  1R58 A;  5CE6 A;  2DFI A;  3CB6 A;  1YVM A;  3IU7 A;  1B6A A;  3TB5 A;  3MAT A;  3PKB A;  3CTZ A;  2BHA A;  4IKS A;  1CHM A;  2Q92 A;  4EGE A;  3MX6 A;  1WY2 A;  2EVC A;  4Z7M A;  2BHD A;  4IKR A;  4U71 A;  1C22 A;  1WLR A;  2GU7 A;  2OKN A;  4MAT A;  4U6W A;  1MAT A;  2G6P A;  2EA2 A;  4U1B A;  4HXX A;  4IKT A;  1O0X A;  2NQ7 A;  4FLL A;  3MR1 A;  3ROR A;  3S6B A;  5FCF A;  2BWT A;  4U75 A;  2EVO A;  3PEB A;  3PKD A;  2GG5 A;  2BWY A;  3PKE A;  2B3L A;  3TAV A;  3FMR A;  1QXY A;  5CNX A;  2GU5 A;  2GG7 A;  2P98 A;  2BH3 A;  4FLK A;  2GU6 A;  2ZSG A;  4A6W A;  3I7M A;  4IPA A;  2IW2 A;  3PKC A;  2BHC A;  2B3K A;  4U76 A;  1WL9 A;  2BWU A;  3IU9 A;  2P99 A;  3PN9 A;  5JHU A;  4FLI A;  4U6E A;  2MAT A;  1KQ0 A;  2GGC A;  4FKC A;  2Q93 A;  2V3Z A;  5CLS A;  4U73 A;  3CB5 A;  1A16 A;  5D6E A;  3Q6D A;  4IF7 A;  2BWV A;  2V3X A;  1W2M A;  1JAW A;  2V3Y A;  4FO8 A;  3BIQ A;  4S01 A;  2GZ5 A;  5JFR A;  4ZWU A;  3D27 A;  3IG4 A;  1YW7 A;  2P9A A;  1XGS A;  3BIT A;  1WN1 A;  2BWS A;  4S00 A;  5FCH A;  4ZWP A;  1XNZ A;  1Y1N A;  1C23 A;  2BB7 A;  1QXW A;  2GG2 A;  4U6Z A;  1YW8 A;  2BWW A;  4IEC A;  3L24 A;  4U69 A;  2GG0 A;  1XGM A;  4U6C A;  5CDE A;  2Q96 A;  1C21 A;  4RZY A;  5D6F A;  2HOW A;  3L7G A;  1KQ9 A;  4B28 A;  2B3H A;  3OOO A;  1WKM A;  5JI6 A;  1C24 A;  4ZWO A;  2BN7 A;  3PKA A;  5E2C A;  1C27 A;  2NQ6 A;  4U70 A;  3IL0 A;  3OVK A;  4IU6 A;  4RZZ A;  5CDV A;  4QR8 A;  1KP0 A; 
#chains in the Genus database with same CATH homology
 1PV9 A;  1M35 A;  4IKU A;  2Q94 A;  1QZY A;  4S2R P;  2Q8K A;  4PV4 A;  1BOA A;  4FLJ A;  1WBQ A;  2EA4 A;  1B59 A;  1R5G A;  2Q95 A;  5CIK A;  5E5B A;  2OAZ A;  4R60 A;  1R5H A;  2ADU A;  2GU4 A;  1XGO A;  2GG8 A;  1N51 A;  4FUK A;  3BIP A;  3O5V A;  2GA2 A;  3QOC A;  3FM3 A;  1YW9 A;  2GG9 A;  1W7V A;  1YJ3 A;  3IU8 A;  4ZNG A;  1WL6 A;  2GG3 A;  2GTX A;  2V6C A;  2GGB A;  4RGZ 1;  4U6J A;  1QXZ A;  2EVM A;  1XGN A;  3FMQ A;  4A6V A;  4PNC A;  4OOK A;  4S2T P;  4FO7 A;  4IDY A;  4KM3 A;  1BN5 A;  4JUQ A;  2BWX A;  2BHB A;  5CDL A;  3RVA A;  1R58 A;  5CE6 A;  2DFI A;  3CB6 A;  1YVM A;  3IU7 A;  1B6A A;  3TB5 A;  3MAT A;  3PKB A;  3CTZ A;  2BHA A;  4IKS A;  1CHM A;  2Q92 A;  4EGE A;  3MX6 A;  1WY2 A;  2EVC A;  4Z7M A;  2BHD A;  4IKR A;  4U71 A;  1C22 A;  1WLR A;  2GU7 A;  2OKN A;  4MAT A;  4U6W A;  1MAT A;  2G6P A;  2EA2 A;  4U1B A;  4HXX A;  4IKT A;  1O0X A;  2NQ7 A;  4FLL A;  3MR1 A;  3ROR A;  3S6B A;  5FCF A;  2BWT A;  4U75 A;  2EVO A;  3PEB A;  3PKD A;  2GG5 A;  2BWY A;  3PKE A;  2B3L A;  3TAV A;  3FMR A;  1QXY A;  5CNX A;  2GU5 A;  2GG7 A;  2P98 A;  2BH3 A;  4FLK A;  2GU6 A;  2ZSG A;  4A6W A;  3I7M A;  4IPA A;  2IW2 A;  3PKC A;  2BHC A;  2B3K A;  4U76 A;  1WL9 A;  2BWU A;  3IU9 A;  2P99 A;  3PN9 A;  5JHU A;  4FLI A;  4U6E A;  2MAT A;  1KQ0 A;  2GGC A;  4FKC A;  2Q93 A;  2V3Z A;  5CLS A;  4U73 A;  3CB5 A;  1A16 A;  5D6E A;  3Q6D A;  4IF7 A;  2BWV A;  2V3X A;  1W2M A;  1JAW A;  2V3Y A;  4FO8 A;  3BIQ A;  4S01 A;  2GZ5 A;  5JFR A;  4ZWU A;  3D27 A;  3IG4 A;  1YW7 A;  2P9A A;  1XGS A;  3BIT A;  1WN1 A;  2BWS A;  4S00 A;  5FCH A;  4ZWP A;  1XNZ A;  1Y1N A;  1C23 A;  2BB7 A;  1QXW A;  2GG2 A;  4U6Z A;  1YW8 A;  2BWW A;  4IEC A;  3L24 A;  4U69 A;  2GG0 A;  1XGM A;  4U6C A;  5CDE A;  2Q96 A;  1C21 A;  4RZY A;  5D6F A;  2HOW A;  3L7G A;  1KQ9 A;  4B28 A;  2B3H A;  3OOO A;  1WKM A;  5JI6 A;  1C24 A;  4ZWO A;  2BN7 A;  3PKA A;  5E2C A;  1C27 A;  2NQ6 A;  4U70 A;  3IL0 A;  3OVK A;  4IU6 A;  4RZZ A;  5CDV A;  4QR8 A;  1KP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...