2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
3TAVA 1YJ3A 1WBQA 2V6CA 1KQ9A 3MR1A 1YW9A 3FM3A 2B3KA 2BWYA 4FLLA 2BWSA 2BN7A 4IU6A 1O0XA 2ADUA 1JAWA 2OKNA 2Q92A 1WL6A 2NQ6A 5CNXA 2V3XA 2BB7A 4R60A 2BH3A 4S01A 1YW8A 4ZNGA 4U1BA 1QXZA 5JFRA 4FO8A 3O5VA 1QXWA 2GU5A 4U6JA 3OOOA 2B3LA 2BHCA 2GG2A 2Q93A 4U69A 2GG7A 1C24A 3D27A 1Y1NA 4FLIA 3S6BA 2P9AA 4IECA 2Q8KA 3CB5A 3RVAA 2Q95A 3PKBA 2GU7A 3IU7A 4RGZ1 4RZZA 2GU4A 4FO7A 4HXXA 2BWWA 3IL0A 5JHUA 2BHBA 4IF7A 4U6WA 2IW2A 1M35A 3QOCA 1C27A 1YVMA 4IKSA 2HOWA 4MATA 3IU8A 2GGCA 1A16A 1WY2A 1CHMA 4U76A 2V3YA 1XGNA 5CDVA 1YW7A 3RORA 1WLRA 4IKRA 4A6WA 3PKDA 3PKAA 2GG0A 1XNZA 2GG8A 3L24A 4FLJA 1BN5A 2V3ZA 1XGMA 3FMQA 3I7MA 2ZSGA 3L7GA 4U73A 4A6VA 3OVKA 2GG5A 5FCFA 1WN1A 2EA2A 1WKMA 4IDYA 4U6CA 2GG9A 3BITA 2EVCA 1C22A 4U6EA 1QZYA 2EVOA 4IPAA 2GG3A 5E5BA 3MX6A 4U70A 2GGBA 4OOKA 5CDLA 3TB5A 1XGOA 1KP0A 1QXYA 4B28A 2GA2A 2MATA 4Z7MA 2BWVA 2EVMA 3Q6DA 5E2CA 2OAZA 4FUKA 4U75A 4FLKA 1C23A 2G6PA 2GZ5A 2B3HA 3FMRA 4IKTA 2GU6A 4QR8A 2Q94A 1WL9A 4U6ZA 4S2RP 5D6EA 5JI6A 4FKCA 4ZWOA 4ZWPA 1PV9A 3MATA 4S2TP 3IU9A 2BWTA 2DFIA 4EGEA 2P99A 5CLSA 1R58A 2BWXA 4PV4A 4U71A 1XGSA 1R5GA 5FCHA 1R5HA 3CTZA 3PN9A 1N51A 1MATA 4KM3A 3PEBA 3CB6A 5CDEA 5CIKA 5D6FA 1KQ0A 4ZWUA 2EA4A 3BIPA 3PKCA 1B6AA 3IG4A 3BIQA 4RZYA 1W2MA 1B59A 3PKEA 1BOAA 2NQ7A 2BWUA 4IKUA 1W7VA 2BHAA 1C21A 5CE6A 2BHDA 2Q96A 2P98A 4JUQA 4S00A 4PNCA 2GTXA
chains in the Genus database with same CATH superfamily
3TAVA 1YJ3A 1WBQA 2V6CA 1KQ9A 3MR1A 1YW9A 3FM3A 2B3KA 2BWYA 4FLLA 2BWSA 2BN7A 4IU6A 1O0XA 2ADUA 1JAWA 2OKNA 2Q92A 1WL6A 2NQ6A 5CNXA 2V3XA 2BB7A 4R60A 2BH3A 4S01A 1YW8A 4ZNGA 4U1BA 1QXZA 5JFRA 4FO8A 3O5VA 1QXWA 2GU5A 4U6JA 3OOOA 2B3LA 2BHCA 2GG2A 2Q93A 4U69A 2GG7A 1C24A 3D27A 1Y1NA 4FLIA 3S6BA 2P9AA 4IECA 2Q8KA 3CB5A 3RVAA 2Q95A 3PKBA 2GU7A 3IU7A 4RGZ1 4RZZA 2GU4A 4FO7A 4HXXA 2BWWA 3IL0A 5JHUA 2BHBA 4IF7A 4U6WA 2IW2A 1M35A 3QOCA 1C27A 1YVMA 4IKSA 2HOWA 4MATA 3IU8A 2GGCA 1A16A 1WY2A 1CHMA 4U76A 2V3YA 1XGNA 5CDVA 1YW7A 3RORA 1WLRA 4IKRA 4A6WA 3PKDA 3PKAA 2GG0A 1XNZA 2GG8A 3L24A 4FLJA 1BN5A 2V3ZA 1XGMA 3FMQA 3I7MA 2ZSGA 3L7GA 4U73A 4A6VA 3OVKA 2GG5A 5FCFA 1WN1A 2EA2A 1WKMA 4IDYA 4U6CA 2GG9A 3BITA 2EVCA 1C22A 4U6EA 1QZYA 2EVOA 4IPAA 2GG3A 5E5BA 3MX6A 4U70A 2GGBA 4OOKA 5CDLA 3TB5A 1XGOA 1KP0A 1QXYA 4B28A 2GA2A 2MATA 4Z7MA 2BWVA 2EVMA 3Q6DA 5E2CA 2OAZA 4FUKA 4U75A 4FLKA 1C23A 2G6PA 2GZ5A 2B3HA 3FMRA 4IKTA 2GU6A 4QR8A 2Q94A 1WL9A 4U6ZA 4S2RP 5D6EA 5JI6A 4FKCA 4ZWOA 4ZWPA 1PV9A 3MATA 4S2TP 3IU9A 2BWTA 2DFIA 4EGEA 2P99A 5CLSA 1R58A 2BWXA 4PV4A 4U71A 1XGSA 1R5GA 5FCHA 1R5HA 3CTZA 3PN9A 1N51A 1MATA 4KM3A 3PEBA 3CB6A 5CDEA 5CIKA 5D6FA 1KQ0A 4ZWUA 2EA4A 3BIPA 3PKCA 1B6AA 3IG4A 3BIQA 4RZYA 1W2MA 1B59A 3PKEA 1BOAA 2NQ7A 2BWUA 4IKUA 1W7VA 2BHAA 1C21A 5CE6A 2BHDA 2Q96A 2P98A 4JUQA 4S00A 4PNCA 2GTXA
chains in the Genus database with same CATH topology
3TAVA 1YJ3A 1WBQA 2V6CA 1KQ9A 3MR1A 1YW9A 3FM3A 2B3KA 2BWYA 4FLLA 2BWSA 2BN7A 4IU6A 1O0XA 2ADUA 1JAWA 2OKNA 2Q92A 1WL6A 2NQ6A 5CNXA 2V3XA 2BB7A 4R60A 2BH3A 4S01A 1YW8A 4ZNGA 4U1BA 1QXZA 5JFRA 4FO8A 3O5VA 1QXWA 2GU5A 4U6JA 3OOOA 2B3LA 2BHCA 2GG2A 2Q93A 4U69A 2GG7A 1C24A 3D27A 1Y1NA 4FLIA 3S6BA 2P9AA 4IECA 2Q8KA 3CB5A 3RVAA 2Q95A 3PKBA 2GU7A 3IU7A 4RGZ1 4RZZA 2GU4A 4FO7A 4HXXA 2BWWA 3IL0A 5JHUA 2BHBA 4IF7A 4U6WA 2IW2A 1M35A 3QOCA 1C27A 1YVMA 4IKSA 2HOWA 4MATA 3IU8A 2GGCA 1A16A 1WY2A 1CHMA 4U76A 2V3YA 1XGNA 5CDVA 1YW7A 3RORA 1WLRA 4IKRA 4A6WA 3PKDA 3PKAA 2GG0A 1XNZA 2GG8A 3L24A 4FLJA 1BN5A 2V3ZA 1XGMA 3FMQA 3I7MA 2ZSGA 3L7GA 4U73A 4A6VA 3OVKA 2GG5A 5FCFA 1WN1A 2EA2A 1WKMA 4IDYA 4U6CA 2GG9A 3BITA 2EVCA 1C22A 4U6EA 1QZYA 2EVOA 4IPAA 2GG3A 5E5BA 3MX6A 4U70A 2GGBA 4OOKA 5CDLA 3TB5A 1XGOA 1KP0A 1QXYA 4B28A 2GA2A 2MATA 4Z7MA 2BWVA 2EVMA 3Q6DA 5E2CA 2OAZA 4FUKA 4U75A 4FLKA 1C23A 2G6PA 2GZ5A 2B3HA 3FMRA 4IKTA 2GU6A 4QR8A 2Q94A 1WL9A 4U6ZA 4S2RP 5D6EA 5JI6A 4FKCA 4ZWOA 4ZWPA 1PV9A 3MATA 4S2TP 3IU9A 2BWTA 2DFIA 4EGEA 2P99A 5CLSA 1R58A 2BWXA 4PV4A 4U71A 1XGSA 1R5GA 5FCHA 1R5HA 3CTZA 3PN9A 1N51A 1MATA 4KM3A 3PEBA 3CB6A 5CDEA 5CIKA 5D6FA 1KQ0A 4ZWUA 2EA4A 3BIPA 3PKCA 1B6AA 3IG4A 3BIQA 4RZYA 1W2MA 1B59A 3PKEA 1BOAA 2NQ7A 2BWUA 4IKUA 1W7VA 2BHAA 1C21A 5CE6A 2BHDA 2Q96A 2P98A 4JUQA 4S00A 4PNCA 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAV A;  1YJ3 A;  1WBQ A;  2V6C A;  1KQ9 A;  3MR1 A;  1YW9 A;  3FM3 A;  2B3K A;  2BWY A;  4FLL A;  2BWS A;  2BN7 A;  4IU6 A;  1O0X A;  2ADU A;  1JAW A;  2OKN A;  2Q92 A;  1WL6 A;  2NQ6 A;  5CNX A;  2V3X A;  2BB7 A;  4R60 A;  2BH3 A;  4S01 A;  1YW8 A;  4ZNG A;  4U1B A;  1QXZ A;  5JFR A;  4FO8 A;  3O5V A;  1QXW A;  2GU5 A;  4U6J A;  3OOO A;  2B3L A;  2BHC A;  2GG2 A;  2Q93 A;  4U69 A;  2GG7 A;  1C24 A;  3D27 A;  1Y1N A;  4FLI A;  3S6B A;  2P9A A;  4IEC A;  2Q8K A;  3CB5 A;  3RVA A;  2Q95 A;  3PKB A;  2GU7 A;  3IU7 A;  4RGZ 1;  4RZZ A;  2GU4 A;  4FO7 A;  4HXX A;  2BWW A;  3IL0 A;  5JHU A;  2BHB A;  4IF7 A;  4U6W A;  2IW2 A;  1M35 A;  3QOC A;  1C27 A;  1YVM A;  4IKS A;  2HOW A;  4MAT A;  3IU8 A;  2GGC A;  1A16 A;  1WY2 A;  1CHM A;  4U76 A;  2V3Y A;  1XGN A;  5CDV A;  1YW7 A;  3ROR A;  1WLR A;  4IKR A;  4A6W A;  3PKD A;  3PKA A;  2GG0 A;  1XNZ A;  2GG8 A;  3L24 A;  4FLJ A;  1BN5 A;  2V3Z A;  1XGM A;  3FMQ A;  3I7M A;  2ZSG A;  3L7G A;  4U73 A;  4A6V A;  3OVK A;  2GG5 A;  5FCF A;  1WN1 A;  2EA2 A;  1WKM A;  4IDY A;  4U6C A;  2GG9 A;  3BIT A;  2EVC A;  1C22 A;  4U6E A;  1QZY A;  2EVO A;  4IPA A;  2GG3 A;  5E5B A;  3MX6 A;  4U70 A;  2GGB A;  4OOK A;  5CDL A;  3TB5 A;  1XGO A;  1KP0 A;  1QXY A;  4B28 A;  2GA2 A;  2MAT A;  4Z7M A;  2BWV A;  2EVM A;  3Q6D A;  5E2C A;  2OAZ A;  4FUK A;  4U75 A;  4FLK A;  1C23 A;  2G6P A;  2GZ5 A;  2B3H A;  3FMR A;  4IKT A;  2GU6 A;  4QR8 A;  2Q94 A;  1WL9 A;  4U6Z A;  4S2R P;  5D6E A;  5JI6 A;  4FKC A;  4ZWO A;  4ZWP A;  1PV9 A;  3MAT A;  4S2T P;  3IU9 A;  2BWT A;  2DFI A;  4EGE A;  2P99 A;  5CLS A;  1R58 A;  2BWX A;  4PV4 A;  4U71 A;  1XGS A;  1R5G A;  5FCH A;  1R5H A;  3CTZ A;  3PN9 A;  1N51 A;  1MAT A;  4KM3 A;  3PEB A;  3CB6 A;  5CDE A;  5CIK A;  5D6F A;  1KQ0 A;  4ZWU A;  2EA4 A;  3BIP A;  3PKC A;  1B6A A;  3IG4 A;  3BIQ A;  4RZY A;  1W2M A;  1B59 A;  3PKE A;  1BOA A;  2NQ7 A;  2BWU A;  4IKU A;  1W7V A;  2BHA A;  1C21 A;  5CE6 A;  2BHD A;  2Q96 A;  2P98 A;  4JUQ A;  4S00 A;  4PNC A;  2GTX A; 
#chains in the Genus database with same CATH topology
 3TAV A;  1YJ3 A;  1WBQ A;  2V6C A;  1KQ9 A;  3MR1 A;  1YW9 A;  3FM3 A;  2B3K A;  2BWY A;  4FLL A;  2BWS A;  2BN7 A;  4IU6 A;  1O0X A;  2ADU A;  1JAW A;  2OKN A;  2Q92 A;  1WL6 A;  2NQ6 A;  5CNX A;  2V3X A;  2BB7 A;  4R60 A;  2BH3 A;  4S01 A;  1YW8 A;  4ZNG A;  4U1B A;  1QXZ A;  5JFR A;  4FO8 A;  3O5V A;  1QXW A;  2GU5 A;  4U6J A;  3OOO A;  2B3L A;  2BHC A;  2GG2 A;  2Q93 A;  4U69 A;  2GG7 A;  1C24 A;  3D27 A;  1Y1N A;  4FLI A;  3S6B A;  2P9A A;  4IEC A;  2Q8K A;  3CB5 A;  3RVA A;  2Q95 A;  3PKB A;  2GU7 A;  3IU7 A;  4RGZ 1;  4RZZ A;  2GU4 A;  4FO7 A;  4HXX A;  2BWW A;  3IL0 A;  5JHU A;  2BHB A;  4IF7 A;  4U6W A;  2IW2 A;  1M35 A;  3QOC A;  1C27 A;  1YVM A;  4IKS A;  2HOW A;  4MAT A;  3IU8 A;  2GGC A;  1A16 A;  1WY2 A;  1CHM A;  4U76 A;  2V3Y A;  1XGN A;  5CDV A;  1YW7 A;  3ROR A;  1WLR A;  4IKR A;  4A6W A;  3PKD A;  3PKA A;  2GG0 A;  1XNZ A;  2GG8 A;  3L24 A;  4FLJ A;  1BN5 A;  2V3Z A;  1XGM A;  3FMQ A;  3I7M A;  2ZSG A;  3L7G A;  4U73 A;  4A6V A;  3OVK A;  2GG5 A;  5FCF A;  1WN1 A;  2EA2 A;  1WKM A;  4IDY A;  4U6C A;  2GG9 A;  3BIT A;  2EVC A;  1C22 A;  4U6E A;  1QZY A;  2EVO A;  4IPA A;  2GG3 A;  5E5B A;  3MX6 A;  4U70 A;  2GGB A;  4OOK A;  5CDL A;  3TB5 A;  1XGO A;  1KP0 A;  1QXY A;  4B28 A;  2GA2 A;  2MAT A;  4Z7M A;  2BWV A;  2EVM A;  3Q6D A;  5E2C A;  2OAZ A;  4FUK A;  4U75 A;  4FLK A;  1C23 A;  2G6P A;  2GZ5 A;  2B3H A;  3FMR A;  4IKT A;  2GU6 A;  4QR8 A;  2Q94 A;  1WL9 A;  4U6Z A;  4S2R P;  5D6E A;  5JI6 A;  4FKC A;  4ZWO A;  4ZWP A;  1PV9 A;  3MAT A;  4S2T P;  3IU9 A;  2BWT A;  2DFI A;  4EGE A;  2P99 A;  5CLS A;  1R58 A;  2BWX A;  4PV4 A;  4U71 A;  1XGS A;  1R5G A;  5FCH A;  1R5H A;  3CTZ A;  3PN9 A;  1N51 A;  1MAT A;  4KM3 A;  3PEB A;  3CB6 A;  5CDE A;  5CIK A;  5D6F A;  1KQ0 A;  4ZWU A;  2EA4 A;  3BIP A;  3PKC A;  1B6A A;  3IG4 A;  3BIQ A;  4RZY A;  1W2M A;  1B59 A;  3PKE A;  1BOA A;  2NQ7 A;  2BWU A;  4IKU A;  1W7V A;  2BHA A;  1C21 A;  5CE6 A;  2BHD A;  2Q96 A;  2P98 A;  4JUQ A;  4S00 A;  4PNC A;  2GTX A; 
#chains in the Genus database with same CATH homology
 3TAV A;  1YJ3 A;  1WBQ A;  2V6C A;  1KQ9 A;  3MR1 A;  1YW9 A;  3FM3 A;  2B3K A;  2BWY A;  4FLL A;  2BWS A;  2BN7 A;  4IU6 A;  1O0X A;  2ADU A;  1JAW A;  2OKN A;  2Q92 A;  1WL6 A;  2NQ6 A;  5CNX A;  2V3X A;  2BB7 A;  4R60 A;  2BH3 A;  4S01 A;  1YW8 A;  4ZNG A;  4U1B A;  1QXZ A;  5JFR A;  4FO8 A;  3O5V A;  1QXW A;  2GU5 A;  4U6J A;  3OOO A;  2B3L A;  2BHC A;  2GG2 A;  2Q93 A;  4U69 A;  2GG7 A;  1C24 A;  3D27 A;  1Y1N A;  4FLI A;  3S6B A;  2P9A A;  4IEC A;  2Q8K A;  3CB5 A;  3RVA A;  2Q95 A;  3PKB A;  2GU7 A;  3IU7 A;  4RGZ 1;  4RZZ A;  2GU4 A;  4FO7 A;  4HXX A;  2BWW A;  3IL0 A;  5JHU A;  2BHB A;  4IF7 A;  4U6W A;  2IW2 A;  1M35 A;  3QOC A;  1C27 A;  1YVM A;  4IKS A;  2HOW A;  4MAT A;  3IU8 A;  2GGC A;  1A16 A;  1WY2 A;  1CHM A;  4U76 A;  2V3Y A;  1XGN A;  5CDV A;  1YW7 A;  3ROR A;  1WLR A;  4IKR A;  4A6W A;  3PKD A;  3PKA A;  2GG0 A;  1XNZ A;  2GG8 A;  3L24 A;  4FLJ A;  1BN5 A;  2V3Z A;  1XGM A;  3FMQ A;  3I7M A;  2ZSG A;  3L7G A;  4U73 A;  4A6V A;  3OVK A;  2GG5 A;  5FCF A;  1WN1 A;  2EA2 A;  1WKM A;  4IDY A;  4U6C A;  2GG9 A;  3BIT A;  2EVC A;  1C22 A;  4U6E A;  1QZY A;  2EVO A;  4IPA A;  2GG3 A;  5E5B A;  3MX6 A;  4U70 A;  2GGB A;  4OOK A;  5CDL A;  3TB5 A;  1XGO A;  1KP0 A;  1QXY A;  4B28 A;  2GA2 A;  2MAT A;  4Z7M A;  2BWV A;  2EVM A;  3Q6D A;  5E2C A;  2OAZ A;  4FUK A;  4U75 A;  4FLK A;  1C23 A;  2G6P A;  2GZ5 A;  2B3H A;  3FMR A;  4IKT A;  2GU6 A;  4QR8 A;  2Q94 A;  1WL9 A;  4U6Z A;  4S2R P;  5D6E A;  5JI6 A;  4FKC A;  4ZWO A;  4ZWP A;  1PV9 A;  3MAT A;  4S2T P;  3IU9 A;  2BWT A;  2DFI A;  4EGE A;  2P99 A;  5CLS A;  1R58 A;  2BWX A;  4PV4 A;  4U71 A;  1XGS A;  1R5G A;  5FCH A;  1R5H A;  3CTZ A;  3PN9 A;  1N51 A;  1MAT A;  4KM3 A;  3PEB A;  3CB6 A;  5CDE A;  5CIK A;  5D6F A;  1KQ0 A;  4ZWU A;  2EA4 A;  3BIP A;  3PKC A;  1B6A A;  3IG4 A;  3BIQ A;  4RZY A;  1W2M A;  1B59 A;  3PKE A;  1BOA A;  2NQ7 A;  2BWU A;  4IKU A;  1W7V A;  2BHA A;  1C21 A;  5CE6 A;  2BHD A;  2Q96 A;  2P98 A;  4JUQ A;  4S00 A;  4PNC A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...