2BWWA

His350ala escherichia coli aminopeptidase p
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMAGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 153
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwwA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwwA02
1YJ3A 2P99A 2V6CA 3RORA 5JI6A 2ZSGA 3RVAA 1WL6A 2HOWA 5FCHA 3FMQA 2BWSA 2BWYA 1BOAA 4S00A 2BWVA 3I7MA 4S01A 5CDEA 1MATA 1XGMA 2Q95A 3PKEA 4IKRA 3IG4A 4JUQA 3OOOA 4ZWOA 4EGEA 2GGCA 2EVMA 4FO7A 1O0XA 4U6CA 5CIKA 3QOCA 4Z7MA 5JHUA 2BHDA 2GG8A 4RZZA 5CDLA 2P9AA 5D6FA 1YVMA 2OAZA 5CE6A 2GTXA 2NQ7A 4FO8A 1C24A 1QXZA 3PKAA 4U69A 4FLLA 4IECA 2BN7A 3FM3A 3TAVA 4U6EA 4U70A 1JAWA 2GU7A 1R5GA 2GU6A 3MATA 2BWWA 4U75A 1XGOA 5CNXA 2GA2A 4IF7A 4FLKA 1QXWA 2BWUA 2GG5A 5E5BA 4S2TP 3MX6A 1BN5A 4FUKA 4U6WA 3TB5A 5E2CA 4FLIA 1QZYA 1KQ9A 4ZWPA 3PN9A 1C21A 3Q6DA 4B28A 4OOKA 3PKCA 4KM3A 4MATA 4PNCA 1C23A 4ZNGA 3BITA 2V3XA 2GZ5A 1B6AA 3CB6A 1W7VA 1YW8A 4PV4A 1WLRA 2EVOA 3IU8A 1YW7A 4A6WA 4S2RP 2V3YA 2DFIA 5JFRA 2EA2A 4U73A 2OKNA 4IPAA 1WN1A 1CHMA 3PEBA 5CDVA 3IU7A 4RGZ1 4R60A 3PKDA 4U1BA 2ADUA 2GG7A 1WY2A 2EA4A 2V3ZA 3PKBA 2Q96A 1C22A 2G6PA 2GU4A 2Q8KA 3OVKA 2MATA 2GU5A 5CLSA 2BB7A 4A6VA 3S6BA 4HXXA 2Q93A 2IW2A 4U6ZA 5D6EA 1KP0A 2GG0A 2B3LA 2GGBA 4U6JA 2GG2A 2GG3A 2NQ6A 4IKSA 4ZWUA 1WBQA 2BWXA 1N51A 4U76A 1XGSA 3BIPA 1B59A 2Q92A 3BIQA 3CTZA 4FLJA 5FCFA 1YW9A 4IU6A 3FMRA 1R5HA 2BWTA 3D27A 2Q94A 1Y1NA 4IKTA 1W2MA 1XNZA 3IU9A 4FKCA 4RZYA 2B3KA 3MR1A 4IKUA 2EVCA 3L7GA 2B3HA 1QXYA 1KQ0A 4U71A 2BH3A 4QR8A 2BHCA 2BHBA 1M35A 3L24A 3O5VA 3IL0A 2GG9A 1R58A 2P98A 1A16A 3CB5A 1WL9A 2BHAA 1XGNA 4IDYA 1PV9A 1WKMA 1C27A
chains in the Genus database with same CATH superfamily
1YJ3A 2P99A 2V6CA 3RORA 5JI6A 2ZSGA 3RVAA 1WL6A 2HOWA 5FCHA 3FMQA 2BWSA 2BWYA 1BOAA 4S00A 2BWVA 3I7MA 4S01A 5CDEA 1MATA 1XGMA 2Q95A 3PKEA 4IKRA 3IG4A 4JUQA 3OOOA 4ZWOA 4EGEA 2GGCA 2EVMA 4FO7A 1O0XA 4U6CA 5CIKA 3QOCA 4Z7MA 5JHUA 2BHDA 2GG8A 4RZZA 5CDLA 2P9AA 5D6FA 1YVMA 2OAZA 5CE6A 2GTXA 2NQ7A 4FO8A 1C24A 1QXZA 3PKAA 4U69A 4FLLA 4IECA 2BN7A 3FM3A 3TAVA 4U6EA 4U70A 1JAWA 2GU7A 1R5GA 2GU6A 3MATA 2BWWA 4U75A 1XGOA 5CNXA 2GA2A 4IF7A 4FLKA 1QXWA 2BWUA 2GG5A 5E5BA 4S2TP 3MX6A 1BN5A 4FUKA 4U6WA 3TB5A 5E2CA 4FLIA 1QZYA 1KQ9A 4ZWPA 3PN9A 1C21A 3Q6DA 4B28A 4OOKA 3PKCA 4KM3A 4MATA 4PNCA 1C23A 4ZNGA 3BITA 2V3XA 2GZ5A 1B6AA 3CB6A 1W7VA 1YW8A 4PV4A 1WLRA 2EVOA 3IU8A 1YW7A 4A6WA 4S2RP 2V3YA 2DFIA 5JFRA 2EA2A 4U73A 2OKNA 4IPAA 1WN1A 1CHMA 3PEBA 5CDVA 3IU7A 4RGZ1 4R60A 3PKDA 4U1BA 2ADUA 2GG7A 1WY2A 2EA4A 2V3ZA 3PKBA 2Q96A 1C22A 2G6PA 2GU4A 2Q8KA 3OVKA 2MATA 2GU5A 5CLSA 2BB7A 4A6VA 3S6BA 4HXXA 2Q93A 2IW2A 4U6ZA 5D6EA 1KP0A 2GG0A 2B3LA 2GGBA 4U6JA 2GG2A 2GG3A 2NQ6A 4IKSA 4ZWUA 1WBQA 2BWXA 1N51A 4U76A 1XGSA 3BIPA 1B59A 2Q92A 3BIQA 3CTZA 4FLJA 5FCFA 1YW9A 4IU6A 3FMRA 1R5HA 2BWTA 3D27A 2Q94A 1Y1NA 4IKTA 1W2MA 1XNZA 3IU9A 4FKCA 4RZYA 2B3KA 3MR1A 4IKUA 2EVCA 3L7GA 2B3HA 1QXYA 1KQ0A 4U71A 2BH3A 4QR8A 2BHCA 2BHBA 1M35A 3L24A 3O5VA 3IL0A 2GG9A 1R58A 2P98A 1A16A 3CB5A 1WL9A 2BHAA 1XGNA 4IDYA 1PV9A 1WKMA 1C27A
chains in the Genus database with same CATH topology
1YJ3A 2P99A 2V6CA 3RORA 5JI6A 2ZSGA 3RVAA 1WL6A 2HOWA 5FCHA 3FMQA 2BWSA 2BWYA 1BOAA 4S00A 2BWVA 3I7MA 4S01A 5CDEA 1MATA 1XGMA 2Q95A 3PKEA 4IKRA 3IG4A 4JUQA 3OOOA 4ZWOA 4EGEA 2GGCA 2EVMA 4FO7A 1O0XA 4U6CA 5CIKA 3QOCA 4Z7MA 5JHUA 2BHDA 2GG8A 4RZZA 5CDLA 2P9AA 5D6FA 1YVMA 2OAZA 5CE6A 2GTXA 2NQ7A 4FO8A 1C24A 1QXZA 3PKAA 4U69A 4FLLA 4IECA 2BN7A 3FM3A 3TAVA 4U6EA 4U70A 1JAWA 2GU7A 1R5GA 2GU6A 3MATA 2BWWA 4U75A 1XGOA 5CNXA 2GA2A 4IF7A 4FLKA 1QXWA 2BWUA 2GG5A 5E5BA 4S2TP 3MX6A 1BN5A 4FUKA 4U6WA 3TB5A 5E2CA 4FLIA 1QZYA 1KQ9A 4ZWPA 3PN9A 1C21A 3Q6DA 4B28A 4OOKA 3PKCA 4KM3A 4MATA 4PNCA 1C23A 4ZNGA 3BITA 2V3XA 2GZ5A 1B6AA 3CB6A 1W7VA 1YW8A 4PV4A 1WLRA 2EVOA 3IU8A 1YW7A 4A6WA 4S2RP 2V3YA 2DFIA 5JFRA 2EA2A 4U73A 2OKNA 4IPAA 1WN1A 1CHMA 3PEBA 5CDVA 3IU7A 4RGZ1 4R60A 3PKDA 4U1BA 2ADUA 2GG7A 1WY2A 2EA4A 2V3ZA 3PKBA 2Q96A 1C22A 2G6PA 2GU4A 2Q8KA 3OVKA 2MATA 2GU5A 5CLSA 2BB7A 4A6VA 3S6BA 4HXXA 2Q93A 2IW2A 4U6ZA 5D6EA 1KP0A 2GG0A 2B3LA 2GGBA 4U6JA 2GG2A 2GG3A 2NQ6A 4IKSA 4ZWUA 1WBQA 2BWXA 1N51A 4U76A 1XGSA 3BIPA 1B59A 2Q92A 3BIQA 3CTZA 4FLJA 5FCFA 1YW9A 4IU6A 3FMRA 1R5HA 2BWTA 3D27A 2Q94A 1Y1NA 4IKTA 1W2MA 1XNZA 3IU9A 4FKCA 4RZYA 2B3KA 3MR1A 4IKUA 2EVCA 3L7GA 2B3HA 1QXYA 1KQ0A 4U71A 2BH3A 4QR8A 2BHCA 2BHBA 1M35A 3L24A 3O5VA 3IL0A 2GG9A 1R58A 2P98A 1A16A 3CB5A 1WL9A 2BHAA 1XGNA 4IDYA 1PV9A 1WKMA 1C27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  2P99 A;  2V6C A;  3ROR A;  5JI6 A;  2ZSG A;  3RVA A;  1WL6 A;  2HOW A;  5FCH A;  3FMQ A;  2BWS A;  2BWY A;  1BOA A;  4S00 A;  2BWV A;  3I7M A;  4S01 A;  5CDE A;  1MAT A;  1XGM A;  2Q95 A;  3PKE A;  4IKR A;  3IG4 A;  4JUQ A;  3OOO A;  4ZWO A;  4EGE A;  2GGC A;  2EVM A;  4FO7 A;  1O0X A;  4U6C A;  5CIK A;  3QOC A;  4Z7M A;  5JHU A;  2BHD A;  2GG8 A;  4RZZ A;  5CDL A;  2P9A A;  5D6F A;  1YVM A;  2OAZ A;  5CE6 A;  2GTX A;  2NQ7 A;  4FO8 A;  1C24 A;  1QXZ A;  3PKA A;  4U69 A;  4FLL A;  4IEC A;  2BN7 A;  3FM3 A;  3TAV A;  4U6E A;  4U70 A;  1JAW A;  2GU7 A;  1R5G A;  2GU6 A;  3MAT A;  2BWW A;  4U75 A;  1XGO A;  5CNX A;  2GA2 A;  4IF7 A;  4FLK A;  1QXW A;  2BWU A;  2GG5 A;  5E5B A;  4S2T P;  3MX6 A;  1BN5 A;  4FUK A;  4U6W A;  3TB5 A;  5E2C A;  4FLI A;  1QZY A;  1KQ9 A;  4ZWP A;  3PN9 A;  1C21 A;  3Q6D A;  4B28 A;  4OOK A;  3PKC A;  4KM3 A;  4MAT A;  4PNC A;  1C23 A;  4ZNG A;  3BIT A;  2V3X A;  2GZ5 A;  1B6A A;  3CB6 A;  1W7V A;  1YW8 A;  4PV4 A;  1WLR A;  2EVO A;  3IU8 A;  1YW7 A;  4A6W A;  4S2R P;  2V3Y A;  2DFI A;  5JFR A;  2EA2 A;  4U73 A;  2OKN A;  4IPA A;  1WN1 A;  1CHM A;  3PEB A;  5CDV A;  3IU7 A;  4RGZ 1;  4R60 A;  3PKD A;  4U1B A;  2ADU A;  2GG7 A;  1WY2 A;  2EA4 A;  2V3Z A;  3PKB A;  2Q96 A;  1C22 A;  2G6P A;  2GU4 A;  2Q8K A;  3OVK A;  2MAT A;  2GU5 A;  5CLS A;  2BB7 A;  4A6V A;  3S6B A;  4HXX A;  2Q93 A;  2IW2 A;  4U6Z A;  5D6E A;  1KP0 A;  2GG0 A;  2B3L A;  2GGB A;  4U6J A;  2GG2 A;  2GG3 A;  2NQ6 A;  4IKS A;  4ZWU A;  1WBQ A;  2BWX A;  1N51 A;  4U76 A;  1XGS A;  3BIP A;  1B59 A;  2Q92 A;  3BIQ A;  3CTZ A;  4FLJ A;  5FCF A;  1YW9 A;  4IU6 A;  3FMR A;  1R5H A;  2BWT A;  3D27 A;  2Q94 A;  1Y1N A;  4IKT A;  1W2M A;  1XNZ A;  3IU9 A;  4FKC A;  4RZY A;  2B3K A;  3MR1 A;  4IKU A;  2EVC A;  3L7G A;  2B3H A;  1QXY A;  1KQ0 A;  4U71 A;  2BH3 A;  4QR8 A;  2BHC A;  2BHB A;  1M35 A;  3L24 A;  3O5V A;  3IL0 A;  2GG9 A;  1R58 A;  2P98 A;  1A16 A;  3CB5 A;  1WL9 A;  2BHA A;  1XGN A;  4IDY A;  1PV9 A;  1WKM A;  1C27 A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  2P99 A;  2V6C A;  3ROR A;  5JI6 A;  2ZSG A;  3RVA A;  1WL6 A;  2HOW A;  5FCH A;  3FMQ A;  2BWS A;  2BWY A;  1BOA A;  4S00 A;  2BWV A;  3I7M A;  4S01 A;  5CDE A;  1MAT A;  1XGM A;  2Q95 A;  3PKE A;  4IKR A;  3IG4 A;  4JUQ A;  3OOO A;  4ZWO A;  4EGE A;  2GGC A;  2EVM A;  4FO7 A;  1O0X A;  4U6C A;  5CIK A;  3QOC A;  4Z7M A;  5JHU A;  2BHD A;  2GG8 A;  4RZZ A;  5CDL A;  2P9A A;  5D6F A;  1YVM A;  2OAZ A;  5CE6 A;  2GTX A;  2NQ7 A;  4FO8 A;  1C24 A;  1QXZ A;  3PKA A;  4U69 A;  4FLL A;  4IEC A;  2BN7 A;  3FM3 A;  3TAV A;  4U6E A;  4U70 A;  1JAW A;  2GU7 A;  1R5G A;  2GU6 A;  3MAT A;  2BWW A;  4U75 A;  1XGO A;  5CNX A;  2GA2 A;  4IF7 A;  4FLK A;  1QXW A;  2BWU A;  2GG5 A;  5E5B A;  4S2T P;  3MX6 A;  1BN5 A;  4FUK A;  4U6W A;  3TB5 A;  5E2C A;  4FLI A;  1QZY A;  1KQ9 A;  4ZWP A;  3PN9 A;  1C21 A;  3Q6D A;  4B28 A;  4OOK A;  3PKC A;  4KM3 A;  4MAT A;  4PNC A;  1C23 A;  4ZNG A;  3BIT A;  2V3X A;  2GZ5 A;  1B6A A;  3CB6 A;  1W7V A;  1YW8 A;  4PV4 A;  1WLR A;  2EVO A;  3IU8 A;  1YW7 A;  4A6W A;  4S2R P;  2V3Y A;  2DFI A;  5JFR A;  2EA2 A;  4U73 A;  2OKN A;  4IPA A;  1WN1 A;  1CHM A;  3PEB A;  5CDV A;  3IU7 A;  4RGZ 1;  4R60 A;  3PKD A;  4U1B A;  2ADU A;  2GG7 A;  1WY2 A;  2EA4 A;  2V3Z A;  3PKB A;  2Q96 A;  1C22 A;  2G6P A;  2GU4 A;  2Q8K A;  3OVK A;  2MAT A;  2GU5 A;  5CLS A;  2BB7 A;  4A6V A;  3S6B A;  4HXX A;  2Q93 A;  2IW2 A;  4U6Z A;  5D6E A;  1KP0 A;  2GG0 A;  2B3L A;  2GGB A;  4U6J A;  2GG2 A;  2GG3 A;  2NQ6 A;  4IKS A;  4ZWU A;  1WBQ A;  2BWX A;  1N51 A;  4U76 A;  1XGS A;  3BIP A;  1B59 A;  2Q92 A;  3BIQ A;  3CTZ A;  4FLJ A;  5FCF A;  1YW9 A;  4IU6 A;  3FMR A;  1R5H A;  2BWT A;  3D27 A;  2Q94 A;  1Y1N A;  4IKT A;  1W2M A;  1XNZ A;  3IU9 A;  4FKC A;  4RZY A;  2B3K A;  3MR1 A;  4IKU A;  2EVC A;  3L7G A;  2B3H A;  1QXY A;  1KQ0 A;  4U71 A;  2BH3 A;  4QR8 A;  2BHC A;  2BHB A;  1M35 A;  3L24 A;  3O5V A;  3IL0 A;  2GG9 A;  1R58 A;  2P98 A;  1A16 A;  3CB5 A;  1WL9 A;  2BHA A;  1XGN A;  4IDY A;  1PV9 A;  1WKM A;  1C27 A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  2P99 A;  2V6C A;  3ROR A;  5JI6 A;  2ZSG A;  3RVA A;  1WL6 A;  2HOW A;  5FCH A;  3FMQ A;  2BWS A;  2BWY A;  1BOA A;  4S00 A;  2BWV A;  3I7M A;  4S01 A;  5CDE A;  1MAT A;  1XGM A;  2Q95 A;  3PKE A;  4IKR A;  3IG4 A;  4JUQ A;  3OOO A;  4ZWO A;  4EGE A;  2GGC A;  2EVM A;  4FO7 A;  1O0X A;  4U6C A;  5CIK A;  3QOC A;  4Z7M A;  5JHU A;  2BHD A;  2GG8 A;  4RZZ A;  5CDL A;  2P9A A;  5D6F A;  1YVM A;  2OAZ A;  5CE6 A;  2GTX A;  2NQ7 A;  4FO8 A;  1C24 A;  1QXZ A;  3PKA A;  4U69 A;  4FLL A;  4IEC A;  2BN7 A;  3FM3 A;  3TAV A;  4U6E A;  4U70 A;  1JAW A;  2GU7 A;  1R5G A;  2GU6 A;  3MAT A;  2BWW A;  4U75 A;  1XGO A;  5CNX A;  2GA2 A;  4IF7 A;  4FLK A;  1QXW A;  2BWU A;  2GG5 A;  5E5B A;  4S2T P;  3MX6 A;  1BN5 A;  4FUK A;  4U6W A;  3TB5 A;  5E2C A;  4FLI A;  1QZY A;  1KQ9 A;  4ZWP A;  3PN9 A;  1C21 A;  3Q6D A;  4B28 A;  4OOK A;  3PKC A;  4KM3 A;  4MAT A;  4PNC A;  1C23 A;  4ZNG A;  3BIT A;  2V3X A;  2GZ5 A;  1B6A A;  3CB6 A;  1W7V A;  1YW8 A;  4PV4 A;  1WLR A;  2EVO A;  3IU8 A;  1YW7 A;  4A6W A;  4S2R P;  2V3Y A;  2DFI A;  5JFR A;  2EA2 A;  4U73 A;  2OKN A;  4IPA A;  1WN1 A;  1CHM A;  3PEB A;  5CDV A;  3IU7 A;  4RGZ 1;  4R60 A;  3PKD A;  4U1B A;  2ADU A;  2GG7 A;  1WY2 A;  2EA4 A;  2V3Z A;  3PKB A;  2Q96 A;  1C22 A;  2G6P A;  2GU4 A;  2Q8K A;  3OVK A;  2MAT A;  2GU5 A;  5CLS A;  2BB7 A;  4A6V A;  3S6B A;  4HXX A;  2Q93 A;  2IW2 A;  4U6Z A;  5D6E A;  1KP0 A;  2GG0 A;  2B3L A;  2GGB A;  4U6J A;  2GG2 A;  2GG3 A;  2NQ6 A;  4IKS A;  4ZWU A;  1WBQ A;  2BWX A;  1N51 A;  4U76 A;  1XGS A;  3BIP A;  1B59 A;  2Q92 A;  3BIQ A;  3CTZ A;  4FLJ A;  5FCF A;  1YW9 A;  4IU6 A;  3FMR A;  1R5H A;  2BWT A;  3D27 A;  2Q94 A;  1Y1N A;  4IKT A;  1W2M A;  1XNZ A;  3IU9 A;  4FKC A;  4RZY A;  2B3K A;  3MR1 A;  4IKU A;  2EVC A;  3L7G A;  2B3H A;  1QXY A;  1KQ0 A;  4U71 A;  2BH3 A;  4QR8 A;  2BHC A;  2BHB A;  1M35 A;  3L24 A;  3O5V A;  3IL0 A;  2GG9 A;  1R58 A;  2P98 A;  1A16 A;  3CB5 A;  1WL9 A;  2BHA A;  1XGN A;  4IDY A;  1PV9 A;  1WKM A;  1C27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...