4FKCA

Recombinant prolidase from thermococcus sibiricus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
370
structure length
370
Chain Sequence
b'HHHGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
molecule tags Hydrolase
source organism Thermococcus sibiricus
publication title Influence of intermolecular contacts on the structure of recombinant prolidase from Thermococcus sibiricus.
pubmed doi rcsb
total genus 122
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4fkcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fkcA02
1WL6A 2GG3A 2GU7A 2GA2A 4PV4A 1W7VA 2B3LA 2BWSA 1BN5A 2EA2A 3CB5A 4KM3A 1WBQA 4IECA 4IPAA 3IU7A 3MATA 3I7MA 4U6CA 2Q94A 3QOCA 4FLLA 5JHUA 2GTXA 2B3KA 2V3YA 3BIPA 1PV9A 3PKBA 2BN7A 4ZNGA 3FMQA 4U69A 2BWYA 1B6AA 3MX6A 2GU6A 3CB6A 3OVKA 3IL0A 5CE6A 3IU9A 5JFRA 2GG8A 4B28A 4U6ZA 5CNXA 3PKDA 1XNZA 2G6PA 5D6FA 1O0XA 5FCFA 3BITA 4FO8A 1KQ9A 2BH3A 2EVCA 4OOKA 4S2RP 2BHDA 1WLRA 4FUKA 2ADUA 3TB5A 3FMRA 4RGZ1 1BOAA 2V3ZA 1YW8A 1C24A 1QXYA 1C21A 2Q93A 4ZWOA 2P98A 5CDEA 2MATA 2ZSGA 1XGSA 2BWXA 4IKTA 1YW7A 4S01A 1WN1A 4ZWUA 1Y1NA 2GG7A 2NQ7A 4U70A 3TAVA 2BWUA 2IW2A 5CLSA 3S6BA 3MR1A 4U6EA 5E5BA 4S2TP 4FLKA 2GG2A 5CIKA 4HXXA 2P99A 2BHBA 3BIQA 4MATA 2HOWA 2V3XA 3O5VA 2EVMA 2Q92A 3D27A 2BWVA 3CTZA 1B59A 3PKAA 5JI6A 3Q6DA 2BHCA 2EA4A 4EGEA 2Q95A 2GG5A 1A16A 2GU5A 1MATA 4IU6A 4U1BA 2GG0A 3FM3A 4IKRA 1C22A 4R60A 4FLJA 5D6EA 4Z7MA 3L24A 5E2CA 4JUQA 3PKCA 4U71A 1JAWA 1R5GA 3L7GA 4S00A 2B3HA 1KQ0A 2OAZA 1KP0A 2GG9A 1XGNA 2BWTA 1QXZA 2BB7A 1R58A 3PKEA 4A6VA 3PN9A 4PNCA 1W2MA 1WL9A 4U6JA 1WY2A 5FCHA 5CDLA 4FO7A 1YW9A 4IKUA 1R5HA 4FLIA 2NQ6A 4RZZA 2V6CA 4U75A 4U73A 2GU4A 2Q8KA 1C23A 3RORA 1QZYA 1WKMA 1M35A 2BWWA 3OOOA 4U76A 3IU8A 2OKNA 1QXWA 1YVMA 4IKSA 2DFIA 2BHAA 2GGCA 2GZ5A 1YJ3A 3IG4A 2P9AA 1C27A 4FKCA 1XGMA 2GGBA 2Q96A 4U6WA 4QR8A 3PEBA 5CDVA 1CHMA 1N51A 2EVOA 4IF7A 4A6WA 3RVAA 4IDYA 1XGOA 4RZYA 4ZWPA
chains in the Genus database with same CATH superfamily
1WL6A 2GG3A 2GU7A 2GA2A 4PV4A 1W7VA 2B3LA 2BWSA 1BN5A 2EA2A 3CB5A 4KM3A 1WBQA 4IECA 4IPAA 3IU7A 3MATA 3I7MA 4U6CA 2Q94A 3QOCA 4FLLA 5JHUA 2GTXA 2B3KA 2V3YA 3BIPA 1PV9A 3PKBA 2BN7A 4ZNGA 3FMQA 4U69A 2BWYA 1B6AA 3MX6A 2GU6A 3CB6A 3OVKA 3IL0A 5CE6A 3IU9A 5JFRA 2GG8A 4B28A 4U6ZA 5CNXA 3PKDA 1XNZA 2G6PA 5D6FA 1O0XA 5FCFA 3BITA 4FO8A 1KQ9A 2BH3A 2EVCA 4OOKA 4S2RP 2BHDA 1WLRA 4FUKA 2ADUA 3TB5A 3FMRA 4RGZ1 1BOAA 2V3ZA 1YW8A 1C24A 1QXYA 1C21A 2Q93A 4ZWOA 2P98A 5CDEA 2MATA 2ZSGA 1XGSA 2BWXA 4IKTA 1YW7A 4S01A 1WN1A 4ZWUA 1Y1NA 2GG7A 2NQ7A 4U70A 3TAVA 2BWUA 2IW2A 5CLSA 3S6BA 3MR1A 4U6EA 5E5BA 4S2TP 4FLKA 2GG2A 5CIKA 4HXXA 2P99A 2BHBA 3BIQA 4MATA 2HOWA 2V3XA 3O5VA 2EVMA 2Q92A 3D27A 2BWVA 3CTZA 1B59A 3PKAA 5JI6A 3Q6DA 2BHCA 2EA4A 4EGEA 2Q95A 2GG5A 1A16A 2GU5A 1MATA 4IU6A 4U1BA 2GG0A 3FM3A 4IKRA 1C22A 4R60A 4FLJA 5D6EA 4Z7MA 3L24A 5E2CA 4JUQA 3PKCA 4U71A 1JAWA 1R5GA 3L7GA 4S00A 2B3HA 1KQ0A 2OAZA 1KP0A 2GG9A 1XGNA 2BWTA 1QXZA 2BB7A 1R58A 3PKEA 4A6VA 3PN9A 4PNCA 1W2MA 1WL9A 4U6JA 1WY2A 5FCHA 5CDLA 4FO7A 1YW9A 4IKUA 1R5HA 4FLIA 2NQ6A 4RZZA 2V6CA 4U75A 4U73A 2GU4A 2Q8KA 1C23A 3RORA 1QZYA 1WKMA 1M35A 2BWWA 3OOOA 4U76A 3IU8A 2OKNA 1QXWA 1YVMA 4IKSA 2DFIA 2BHAA 2GGCA 2GZ5A 1YJ3A 3IG4A 2P9AA 1C27A 4FKCA 1XGMA 2GGBA 2Q96A 4U6WA 4QR8A 3PEBA 5CDVA 1CHMA 1N51A 2EVOA 4IF7A 4A6WA 3RVAA 4IDYA 1XGOA 4RZYA 4ZWPA
chains in the Genus database with same CATH topology
1WL6A 2GG3A 2GU7A 2GA2A 4PV4A 1W7VA 2B3LA 2BWSA 1BN5A 2EA2A 3CB5A 4KM3A 1WBQA 4IECA 4IPAA 3IU7A 3MATA 3I7MA 4U6CA 2Q94A 3QOCA 4FLLA 5JHUA 2GTXA 2B3KA 2V3YA 3BIPA 1PV9A 3PKBA 2BN7A 4ZNGA 3FMQA 4U69A 2BWYA 1B6AA 3MX6A 2GU6A 3CB6A 3OVKA 3IL0A 5CE6A 3IU9A 5JFRA 2GG8A 4B28A 4U6ZA 5CNXA 3PKDA 1XNZA 2G6PA 5D6FA 1O0XA 5FCFA 3BITA 4FO8A 1KQ9A 2BH3A 2EVCA 4OOKA 4S2RP 2BHDA 1WLRA 4FUKA 2ADUA 3TB5A 3FMRA 4RGZ1 1BOAA 2V3ZA 1YW8A 1C24A 1QXYA 1C21A 2Q93A 4ZWOA 2P98A 5CDEA 2MATA 2ZSGA 1XGSA 2BWXA 4IKTA 1YW7A 4S01A 1WN1A 4ZWUA 1Y1NA 2GG7A 2NQ7A 4U70A 3TAVA 2BWUA 2IW2A 5CLSA 3S6BA 3MR1A 4U6EA 5E5BA 4S2TP 4FLKA 2GG2A 5CIKA 4HXXA 2P99A 2BHBA 3BIQA 4MATA 2HOWA 2V3XA 3O5VA 2EVMA 2Q92A 3D27A 2BWVA 3CTZA 1B59A 3PKAA 5JI6A 3Q6DA 2BHCA 2EA4A 4EGEA 2Q95A 2GG5A 1A16A 2GU5A 1MATA 4IU6A 4U1BA 2GG0A 3FM3A 4IKRA 1C22A 4R60A 4FLJA 5D6EA 4Z7MA 3L24A 5E2CA 4JUQA 3PKCA 4U71A 1JAWA 1R5GA 3L7GA 4S00A 2B3HA 1KQ0A 2OAZA 1KP0A 2GG9A 1XGNA 2BWTA 1QXZA 2BB7A 1R58A 3PKEA 4A6VA 3PN9A 4PNCA 1W2MA 1WL9A 4U6JA 1WY2A 5FCHA 5CDLA 4FO7A 1YW9A 4IKUA 1R5HA 4FLIA 2NQ6A 4RZZA 2V6CA 4U75A 4U73A 2GU4A 2Q8KA 1C23A 3RORA 1QZYA 1WKMA 1M35A 2BWWA 3OOOA 4U76A 3IU8A 2OKNA 1QXWA 1YVMA 4IKSA 2DFIA 2BHAA 2GGCA 2GZ5A 1YJ3A 3IG4A 2P9AA 1C27A 4FKCA 1XGMA 2GGBA 2Q96A 4U6WA 4QR8A 3PEBA 5CDVA 1CHMA 1N51A 2EVOA 4IF7A 4A6WA 3RVAA 4IDYA 1XGOA 4RZYA 4ZWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL6 A;  2GG3 A;  2GU7 A;  2GA2 A;  4PV4 A;  1W7V A;  2B3L A;  2BWS A;  1BN5 A;  2EA2 A;  3CB5 A;  4KM3 A;  1WBQ A;  4IEC A;  4IPA A;  3IU7 A;  3MAT A;  3I7M A;  4U6C A;  2Q94 A;  3QOC A;  4FLL A;  5JHU A;  2GTX A;  2B3K A;  2V3Y A;  3BIP A;  1PV9 A;  3PKB A;  2BN7 A;  4ZNG A;  3FMQ A;  4U69 A;  2BWY A;  1B6A A;  3MX6 A;  2GU6 A;  3CB6 A;  3OVK A;  3IL0 A;  5CE6 A;  3IU9 A;  5JFR A;  2GG8 A;  4B28 A;  4U6Z A;  5CNX A;  3PKD A;  1XNZ A;  2G6P A;  5D6F A;  1O0X A;  5FCF A;  3BIT A;  4FO8 A;  1KQ9 A;  2BH3 A;  2EVC A;  4OOK A;  4S2R P;  2BHD A;  1WLR A;  4FUK A;  2ADU A;  3TB5 A;  3FMR A;  4RGZ 1;  1BOA A;  2V3Z A;  1YW8 A;  1C24 A;  1QXY A;  1C21 A;  2Q93 A;  4ZWO A;  2P98 A;  5CDE A;  2MAT A;  2ZSG A;  1XGS A;  2BWX A;  4IKT A;  1YW7 A;  4S01 A;  1WN1 A;  4ZWU A;  1Y1N A;  2GG7 A;  2NQ7 A;  4U70 A;  3TAV A;  2BWU A;  2IW2 A;  5CLS A;  3S6B A;  3MR1 A;  4U6E A;  5E5B A;  4S2T P;  4FLK A;  2GG2 A;  5CIK A;  4HXX A;  2P99 A;  2BHB A;  3BIQ A;  4MAT A;  2HOW A;  2V3X A;  3O5V A;  2EVM A;  2Q92 A;  3D27 A;  2BWV A;  3CTZ A;  1B59 A;  3PKA A;  5JI6 A;  3Q6D A;  2BHC A;  2EA4 A;  4EGE A;  2Q95 A;  2GG5 A;  1A16 A;  2GU5 A;  1MAT A;  4IU6 A;  4U1B A;  2GG0 A;  3FM3 A;  4IKR A;  1C22 A;  4R60 A;  4FLJ A;  5D6E A;  4Z7M A;  3L24 A;  5E2C A;  4JUQ A;  3PKC A;  4U71 A;  1JAW A;  1R5G A;  3L7G A;  4S00 A;  2B3H A;  1KQ0 A;  2OAZ A;  1KP0 A;  2GG9 A;  1XGN A;  2BWT A;  1QXZ A;  2BB7 A;  1R58 A;  3PKE A;  4A6V A;  3PN9 A;  4PNC A;  1W2M A;  1WL9 A;  4U6J A;  1WY2 A;  5FCH A;  5CDL A;  4FO7 A;  1YW9 A;  4IKU A;  1R5H A;  4FLI A;  2NQ6 A;  4RZZ A;  2V6C A;  4U75 A;  4U73 A;  2GU4 A;  2Q8K A;  1C23 A;  3ROR A;  1QZY A;  1WKM A;  1M35 A;  2BWW A;  3OOO A;  4U76 A;  3IU8 A;  2OKN A;  1QXW A;  1YVM A;  4IKS A;  2DFI A;  2BHA A;  2GGC A;  2GZ5 A;  1YJ3 A;  3IG4 A;  2P9A A;  1C27 A;  4FKC A;  1XGM A;  2GGB A;  2Q96 A;  4U6W A;  4QR8 A;  3PEB A;  5CDV A;  1CHM A;  1N51 A;  2EVO A;  4IF7 A;  4A6W A;  3RVA A;  4IDY A;  1XGO A;  4RZY A;  4ZWP A; 
#chains in the Genus database with same CATH topology
 1WL6 A;  2GG3 A;  2GU7 A;  2GA2 A;  4PV4 A;  1W7V A;  2B3L A;  2BWS A;  1BN5 A;  2EA2 A;  3CB5 A;  4KM3 A;  1WBQ A;  4IEC A;  4IPA A;  3IU7 A;  3MAT A;  3I7M A;  4U6C A;  2Q94 A;  3QOC A;  4FLL A;  5JHU A;  2GTX A;  2B3K A;  2V3Y A;  3BIP A;  1PV9 A;  3PKB A;  2BN7 A;  4ZNG A;  3FMQ A;  4U69 A;  2BWY A;  1B6A A;  3MX6 A;  2GU6 A;  3CB6 A;  3OVK A;  3IL0 A;  5CE6 A;  3IU9 A;  5JFR A;  2GG8 A;  4B28 A;  4U6Z A;  5CNX A;  3PKD A;  1XNZ A;  2G6P A;  5D6F A;  1O0X A;  5FCF A;  3BIT A;  4FO8 A;  1KQ9 A;  2BH3 A;  2EVC A;  4OOK A;  4S2R P;  2BHD A;  1WLR A;  4FUK A;  2ADU A;  3TB5 A;  3FMR A;  4RGZ 1;  1BOA A;  2V3Z A;  1YW8 A;  1C24 A;  1QXY A;  1C21 A;  2Q93 A;  4ZWO A;  2P98 A;  5CDE A;  2MAT A;  2ZSG A;  1XGS A;  2BWX A;  4IKT A;  1YW7 A;  4S01 A;  1WN1 A;  4ZWU A;  1Y1N A;  2GG7 A;  2NQ7 A;  4U70 A;  3TAV A;  2BWU A;  2IW2 A;  5CLS A;  3S6B A;  3MR1 A;  4U6E A;  5E5B A;  4S2T P;  4FLK A;  2GG2 A;  5CIK A;  4HXX A;  2P99 A;  2BHB A;  3BIQ A;  4MAT A;  2HOW A;  2V3X A;  3O5V A;  2EVM A;  2Q92 A;  3D27 A;  2BWV A;  3CTZ A;  1B59 A;  3PKA A;  5JI6 A;  3Q6D A;  2BHC A;  2EA4 A;  4EGE A;  2Q95 A;  2GG5 A;  1A16 A;  2GU5 A;  1MAT A;  4IU6 A;  4U1B A;  2GG0 A;  3FM3 A;  4IKR A;  1C22 A;  4R60 A;  4FLJ A;  5D6E A;  4Z7M A;  3L24 A;  5E2C A;  4JUQ A;  3PKC A;  4U71 A;  1JAW A;  1R5G A;  3L7G A;  4S00 A;  2B3H A;  1KQ0 A;  2OAZ A;  1KP0 A;  2GG9 A;  1XGN A;  2BWT A;  1QXZ A;  2BB7 A;  1R58 A;  3PKE A;  4A6V A;  3PN9 A;  4PNC A;  1W2M A;  1WL9 A;  4U6J A;  1WY2 A;  5FCH A;  5CDL A;  4FO7 A;  1YW9 A;  4IKU A;  1R5H A;  4FLI A;  2NQ6 A;  4RZZ A;  2V6C A;  4U75 A;  4U73 A;  2GU4 A;  2Q8K A;  1C23 A;  3ROR A;  1QZY A;  1WKM A;  1M35 A;  2BWW A;  3OOO A;  4U76 A;  3IU8 A;  2OKN A;  1QXW A;  1YVM A;  4IKS A;  2DFI A;  2BHA A;  2GGC A;  2GZ5 A;  1YJ3 A;  3IG4 A;  2P9A A;  1C27 A;  4FKC A;  1XGM A;  2GGB A;  2Q96 A;  4U6W A;  4QR8 A;  3PEB A;  5CDV A;  1CHM A;  1N51 A;  2EVO A;  4IF7 A;  4A6W A;  3RVA A;  4IDY A;  1XGO A;  4RZY A;  4ZWP A; 
#chains in the Genus database with same CATH homology
 1WL6 A;  2GG3 A;  2GU7 A;  2GA2 A;  4PV4 A;  1W7V A;  2B3L A;  2BWS A;  1BN5 A;  2EA2 A;  3CB5 A;  4KM3 A;  1WBQ A;  4IEC A;  4IPA A;  3IU7 A;  3MAT A;  3I7M A;  4U6C A;  2Q94 A;  3QOC A;  4FLL A;  5JHU A;  2GTX A;  2B3K A;  2V3Y A;  3BIP A;  1PV9 A;  3PKB A;  2BN7 A;  4ZNG A;  3FMQ A;  4U69 A;  2BWY A;  1B6A A;  3MX6 A;  2GU6 A;  3CB6 A;  3OVK A;  3IL0 A;  5CE6 A;  3IU9 A;  5JFR A;  2GG8 A;  4B28 A;  4U6Z A;  5CNX A;  3PKD A;  1XNZ A;  2G6P A;  5D6F A;  1O0X A;  5FCF A;  3BIT A;  4FO8 A;  1KQ9 A;  2BH3 A;  2EVC A;  4OOK A;  4S2R P;  2BHD A;  1WLR A;  4FUK A;  2ADU A;  3TB5 A;  3FMR A;  4RGZ 1;  1BOA A;  2V3Z A;  1YW8 A;  1C24 A;  1QXY A;  1C21 A;  2Q93 A;  4ZWO A;  2P98 A;  5CDE A;  2MAT A;  2ZSG A;  1XGS A;  2BWX A;  4IKT A;  1YW7 A;  4S01 A;  1WN1 A;  4ZWU A;  1Y1N A;  2GG7 A;  2NQ7 A;  4U70 A;  3TAV A;  2BWU A;  2IW2 A;  5CLS A;  3S6B A;  3MR1 A;  4U6E A;  5E5B A;  4S2T P;  4FLK A;  2GG2 A;  5CIK A;  4HXX A;  2P99 A;  2BHB A;  3BIQ A;  4MAT A;  2HOW A;  2V3X A;  3O5V A;  2EVM A;  2Q92 A;  3D27 A;  2BWV A;  3CTZ A;  1B59 A;  3PKA A;  5JI6 A;  3Q6D A;  2BHC A;  2EA4 A;  4EGE A;  2Q95 A;  2GG5 A;  1A16 A;  2GU5 A;  1MAT A;  4IU6 A;  4U1B A;  2GG0 A;  3FM3 A;  4IKR A;  1C22 A;  4R60 A;  4FLJ A;  5D6E A;  4Z7M A;  3L24 A;  5E2C A;  4JUQ A;  3PKC A;  4U71 A;  1JAW A;  1R5G A;  3L7G A;  4S00 A;  2B3H A;  1KQ0 A;  2OAZ A;  1KP0 A;  2GG9 A;  1XGN A;  2BWT A;  1QXZ A;  2BB7 A;  1R58 A;  3PKE A;  4A6V A;  3PN9 A;  4PNC A;  1W2M A;  1WL9 A;  4U6J A;  1WY2 A;  5FCH A;  5CDL A;  4FO7 A;  1YW9 A;  4IKU A;  1R5H A;  4FLI A;  2NQ6 A;  4RZZ A;  2V6C A;  4U75 A;  4U73 A;  2GU4 A;  2Q8K A;  1C23 A;  3ROR A;  1QZY A;  1WKM A;  1M35 A;  2BWW A;  3OOO A;  4U76 A;  3IU8 A;  2OKN A;  1QXW A;  1YVM A;  4IKS A;  2DFI A;  2BHA A;  2GGC A;  2GZ5 A;  1YJ3 A;  3IG4 A;  2P9A A;  1C27 A;  4FKC A;  1XGM A;  2GGB A;  2Q96 A;  4U6W A;  4QR8 A;  3PEB A;  5CDV A;  1CHM A;  1N51 A;  2EVO A;  4IF7 A;  4A6W A;  3RVA A;  4IDY A;  1XGO A;  4RZY A;  4ZWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...