4FKCA

Recombinant prolidase from thermococcus sibiricus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
370
structure length
370
Chain Sequence
b'HHHGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Influence of intermolecular contacts on the structure of recombinant prolidase from Thermococcus sibiricus.
pubmed doi rcsb
source organism Thermococcus sibiricus
molecule tags Hydrolase
total genus 122
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4fkcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fkcA02
2BWTA 5E5BA 1BN5A 1PV9A 2BWWA 3PKBA 3IL0A 2GG8A 2GG7A 2GGCA 2IW2A 1WL9A 3L7GA 4EGEA 1XGOA 5FCHA 4ZWOA 3IU7A 4FO7A 2BHBA 1N51A 1BOAA 5JI6A 4U6ZA 1W7VA 2B3HA 4U75A 4U69A 1WBQA 3RORA 5CIKA 4S01A 3Q6DA 2GG2A 4FO8A 3RVAA 3CB5A 2EVOA 2BWUA 4OOKA 2HOWA 2BHDA 4FLKA 2B3LA 2BN7A 1CHMA 2V3XA 2Q96A 3QOCA 3CB6A 4U6WA 4HXXA 4MATA 4U76A 5D6EA 3MR1A 4R60A 5FCFA 2GGBA 2G6PA 1MATA 1JAWA 1WY2A 2Q93A 3FMRA 4FLJA 3FMQA 4KM3A 5CDVA 1C23A 4U71A 1YW8A 2EA2A 1C27A 1B6AA 5E2CA 1QXWA 5CNXA 2GG3A 1YJ3A 4Z7MA 4FUKA 1XGNA 2ADUA 3IG4A 1YVMA 3TAVA 4IKUA 2GG5A 2Q95A 2B3KA 2GG0A 1QXYA 3IU8A 2GU6A 2V3YA 1W2MA 1YW7A 3IU9A 2P9AA 1WL6A 4FLIA 3S6BA 1XNZA 2BH3A 2EVMA 3CTZA 3OOOA 3PKEA 4RZZA 4A6WA 5CDLA 2NQ7A 2Q94A 4U6EA 4S2TP 2BHCA 3PKDA 1KQ0A 4U6JA 3BIPA 1O0XA 2GA2A 5JFRA 1M35A 5CE6A 1C24A 2V3ZA 3PKCA 3D27A 2NQ6A 1WN1A 1C21A 2P99A 4IKSA 2GU7A 4JUQA 4RGZ1 4B28A 1R5GA 2BWVA 2GU4A 1WKMA 3PEBA 3OVKA 2BWSA 4FKCA 4PV4A 4IECA 4FLLA 1QZYA 2OKNA 5CDEA 2GU5A 3BIQA 3PN9A 2EVCA 3TB5A 1YW9A 2V6CA 1A16A 4A6VA 2BWYA 3MATA 1XGSA 4QR8A 3BITA 5D6FA 1QXZA 4S00A 4IKRA 2MATA 4U6CA 3MX6A 4RZYA 4IDYA 4IPAA 4ZNGA 1R5HA 3PKAA 4U1BA 3L24A 1C22A 3FM3A 1WLRA 4IKTA 5CLSA 4U73A 2BHAA 2GTXA 2BWXA 2Q8KA 2Q92A 2DFIA 1XGMA 4ZWPA 1Y1NA 2EA4A 2OAZA 3I7MA 2BB7A 1R58A 2GZ5A 2GG9A 2ZSGA 4PNCA 5JHUA 4U70A 4S2RP 1KP0A 4IU6A 1B59A 1KQ9A 2P98A 3O5VA 4IF7A 4ZWUA
chains in the Genus database with same CATH superfamily
2BWTA 5E5BA 1BN5A 1PV9A 2BWWA 3PKBA 3IL0A 2GG8A 2GG7A 2GGCA 2IW2A 1WL9A 3L7GA 4EGEA 1XGOA 5FCHA 4ZWOA 3IU7A 4FO7A 2BHBA 1N51A 1BOAA 5JI6A 4U6ZA 1W7VA 2B3HA 4U75A 4U69A 1WBQA 3RORA 5CIKA 4S01A 3Q6DA 2GG2A 4FO8A 3RVAA 3CB5A 2EVOA 2BWUA 4OOKA 2HOWA 2BHDA 4FLKA 2B3LA 2BN7A 1CHMA 2V3XA 2Q96A 3QOCA 3CB6A 4U6WA 4HXXA 4MATA 4U76A 5D6EA 3MR1A 4R60A 5FCFA 2GGBA 2G6PA 1MATA 1JAWA 1WY2A 2Q93A 3FMRA 4FLJA 3FMQA 4KM3A 5CDVA 1C23A 4U71A 1YW8A 2EA2A 1C27A 1B6AA 5E2CA 1QXWA 5CNXA 2GG3A 1YJ3A 4Z7MA 4FUKA 1XGNA 2ADUA 3IG4A 1YVMA 3TAVA 4IKUA 2GG5A 2Q95A 2B3KA 2GG0A 1QXYA 3IU8A 2GU6A 2V3YA 1W2MA 1YW7A 3IU9A 2P9AA 1WL6A 4FLIA 3S6BA 1XNZA 2BH3A 2EVMA 3CTZA 3OOOA 3PKEA 4RZZA 4A6WA 5CDLA 2NQ7A 2Q94A 4U6EA 4S2TP 2BHCA 3PKDA 1KQ0A 4U6JA 3BIPA 1O0XA 2GA2A 5JFRA 1M35A 5CE6A 1C24A 2V3ZA 3PKCA 3D27A 2NQ6A 1WN1A 1C21A 2P99A 4IKSA 2GU7A 4JUQA 4RGZ1 4B28A 1R5GA 2BWVA 2GU4A 1WKMA 3PEBA 3OVKA 2BWSA 4FKCA 4PV4A 4IECA 4FLLA 1QZYA 2OKNA 5CDEA 2GU5A 3BIQA 3PN9A 2EVCA 3TB5A 1YW9A 2V6CA 1A16A 4A6VA 2BWYA 3MATA 1XGSA 4QR8A 3BITA 5D6FA 1QXZA 4S00A 4IKRA 2MATA 4U6CA 3MX6A 4RZYA 4IDYA 4IPAA 4ZNGA 1R5HA 3PKAA 4U1BA 3L24A 1C22A 3FM3A 1WLRA 4IKTA 5CLSA 4U73A 2BHAA 2GTXA 2BWXA 2Q8KA 2Q92A 2DFIA 1XGMA 4ZWPA 1Y1NA 2EA4A 2OAZA 3I7MA 2BB7A 1R58A 2GZ5A 2GG9A 2ZSGA 4PNCA 5JHUA 4U70A 4S2RP 1KP0A 4IU6A 1B59A 1KQ9A 2P98A 3O5VA 4IF7A 4ZWUA
chains in the Genus database with same CATH topology
2BWTA 5E5BA 1BN5A 1PV9A 2BWWA 3PKBA 3IL0A 2GG8A 2GG7A 2GGCA 2IW2A 1WL9A 3L7GA 4EGEA 1XGOA 5FCHA 4ZWOA 3IU7A 4FO7A 2BHBA 1N51A 1BOAA 5JI6A 4U6ZA 1W7VA 2B3HA 4U75A 4U69A 1WBQA 3RORA 5CIKA 4S01A 3Q6DA 2GG2A 4FO8A 3RVAA 3CB5A 2EVOA 2BWUA 4OOKA 2HOWA 2BHDA 4FLKA 2B3LA 2BN7A 1CHMA 2V3XA 2Q96A 3QOCA 3CB6A 4U6WA 4HXXA 4MATA 4U76A 5D6EA 3MR1A 4R60A 5FCFA 2GGBA 2G6PA 1MATA 1JAWA 1WY2A 2Q93A 3FMRA 4FLJA 3FMQA 4KM3A 5CDVA 1C23A 4U71A 1YW8A 2EA2A 1C27A 1B6AA 5E2CA 1QXWA 5CNXA 2GG3A 1YJ3A 4Z7MA 4FUKA 1XGNA 2ADUA 3IG4A 1YVMA 3TAVA 4IKUA 2GG5A 2Q95A 2B3KA 2GG0A 1QXYA 3IU8A 2GU6A 2V3YA 1W2MA 1YW7A 3IU9A 2P9AA 1WL6A 4FLIA 3S6BA 1XNZA 2BH3A 2EVMA 3CTZA 3OOOA 3PKEA 4RZZA 4A6WA 5CDLA 2NQ7A 2Q94A 4U6EA 4S2TP 2BHCA 3PKDA 1KQ0A 4U6JA 3BIPA 1O0XA 2GA2A 5JFRA 1M35A 5CE6A 1C24A 2V3ZA 3PKCA 3D27A 2NQ6A 1WN1A 1C21A 2P99A 4IKSA 2GU7A 4JUQA 4RGZ1 4B28A 1R5GA 2BWVA 2GU4A 1WKMA 3PEBA 3OVKA 2BWSA 4FKCA 4PV4A 4IECA 4FLLA 1QZYA 2OKNA 5CDEA 2GU5A 3BIQA 3PN9A 2EVCA 3TB5A 1YW9A 2V6CA 1A16A 4A6VA 2BWYA 3MATA 1XGSA 4QR8A 3BITA 5D6FA 1QXZA 4S00A 4IKRA 2MATA 4U6CA 3MX6A 4RZYA 4IDYA 4IPAA 4ZNGA 1R5HA 3PKAA 4U1BA 3L24A 1C22A 3FM3A 1WLRA 4IKTA 5CLSA 4U73A 2BHAA 2GTXA 2BWXA 2Q8KA 2Q92A 2DFIA 1XGMA 4ZWPA 1Y1NA 2EA4A 2OAZA 3I7MA 2BB7A 1R58A 2GZ5A 2GG9A 2ZSGA 4PNCA 5JHUA 4U70A 4S2RP 1KP0A 4IU6A 1B59A 1KQ9A 2P98A 3O5VA 4IF7A 4ZWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWT A;  5E5B A;  1BN5 A;  1PV9 A;  2BWW A;  3PKB A;  3IL0 A;  2GG8 A;  2GG7 A;  2GGC A;  2IW2 A;  1WL9 A;  3L7G A;  4EGE A;  1XGO A;  5FCH A;  4ZWO A;  3IU7 A;  4FO7 A;  2BHB A;  1N51 A;  1BOA A;  5JI6 A;  4U6Z A;  1W7V A;  2B3H A;  4U75 A;  4U69 A;  1WBQ A;  3ROR A;  5CIK A;  4S01 A;  3Q6D A;  2GG2 A;  4FO8 A;  3RVA A;  3CB5 A;  2EVO A;  2BWU A;  4OOK A;  2HOW A;  2BHD A;  4FLK A;  2B3L A;  2BN7 A;  1CHM A;  2V3X A;  2Q96 A;  3QOC A;  3CB6 A;  4U6W A;  4HXX A;  4MAT A;  4U76 A;  5D6E A;  3MR1 A;  4R60 A;  5FCF A;  2GGB A;  2G6P A;  1MAT A;  1JAW A;  1WY2 A;  2Q93 A;  3FMR A;  4FLJ A;  3FMQ A;  4KM3 A;  5CDV A;  1C23 A;  4U71 A;  1YW8 A;  2EA2 A;  1C27 A;  1B6A A;  5E2C A;  1QXW A;  5CNX A;  2GG3 A;  1YJ3 A;  4Z7M A;  4FUK A;  1XGN A;  2ADU A;  3IG4 A;  1YVM A;  3TAV A;  4IKU A;  2GG5 A;  2Q95 A;  2B3K A;  2GG0 A;  1QXY A;  3IU8 A;  2GU6 A;  2V3Y A;  1W2M A;  1YW7 A;  3IU9 A;  2P9A A;  1WL6 A;  4FLI A;  3S6B A;  1XNZ A;  2BH3 A;  2EVM A;  3CTZ A;  3OOO A;  3PKE A;  4RZZ A;  4A6W A;  5CDL A;  2NQ7 A;  2Q94 A;  4U6E A;  4S2T P;  2BHC A;  3PKD A;  1KQ0 A;  4U6J A;  3BIP A;  1O0X A;  2GA2 A;  5JFR A;  1M35 A;  5CE6 A;  1C24 A;  2V3Z A;  3PKC A;  3D27 A;  2NQ6 A;  1WN1 A;  1C21 A;  2P99 A;  4IKS A;  2GU7 A;  4JUQ A;  4RGZ 1;  4B28 A;  1R5G A;  2BWV A;  2GU4 A;  1WKM A;  3PEB A;  3OVK A;  2BWS A;  4FKC A;  4PV4 A;  4IEC A;  4FLL A;  1QZY A;  2OKN A;  5CDE A;  2GU5 A;  3BIQ A;  3PN9 A;  2EVC A;  3TB5 A;  1YW9 A;  2V6C A;  1A16 A;  4A6V A;  2BWY A;  3MAT A;  1XGS A;  4QR8 A;  3BIT A;  5D6F A;  1QXZ A;  4S00 A;  4IKR A;  2MAT A;  4U6C A;  3MX6 A;  4RZY A;  4IDY A;  4IPA A;  4ZNG A;  1R5H A;  3PKA A;  4U1B A;  3L24 A;  1C22 A;  3FM3 A;  1WLR A;  4IKT A;  5CLS A;  4U73 A;  2BHA A;  2GTX A;  2BWX A;  2Q8K A;  2Q92 A;  2DFI A;  1XGM A;  4ZWP A;  1Y1N A;  2EA4 A;  2OAZ A;  3I7M A;  2BB7 A;  1R58 A;  2GZ5 A;  2GG9 A;  2ZSG A;  4PNC A;  5JHU A;  4U70 A;  4S2R P;  1KP0 A;  4IU6 A;  1B59 A;  1KQ9 A;  2P98 A;  3O5V A;  4IF7 A;  4ZWU A; 
#chains in the Genus database with same CATH topology
 2BWT A;  5E5B A;  1BN5 A;  1PV9 A;  2BWW A;  3PKB A;  3IL0 A;  2GG8 A;  2GG7 A;  2GGC A;  2IW2 A;  1WL9 A;  3L7G A;  4EGE A;  1XGO A;  5FCH A;  4ZWO A;  3IU7 A;  4FO7 A;  2BHB A;  1N51 A;  1BOA A;  5JI6 A;  4U6Z A;  1W7V A;  2B3H A;  4U75 A;  4U69 A;  1WBQ A;  3ROR A;  5CIK A;  4S01 A;  3Q6D A;  2GG2 A;  4FO8 A;  3RVA A;  3CB5 A;  2EVO A;  2BWU A;  4OOK A;  2HOW A;  2BHD A;  4FLK A;  2B3L A;  2BN7 A;  1CHM A;  2V3X A;  2Q96 A;  3QOC A;  3CB6 A;  4U6W A;  4HXX A;  4MAT A;  4U76 A;  5D6E A;  3MR1 A;  4R60 A;  5FCF A;  2GGB A;  2G6P A;  1MAT A;  1JAW A;  1WY2 A;  2Q93 A;  3FMR A;  4FLJ A;  3FMQ A;  4KM3 A;  5CDV A;  1C23 A;  4U71 A;  1YW8 A;  2EA2 A;  1C27 A;  1B6A A;  5E2C A;  1QXW A;  5CNX A;  2GG3 A;  1YJ3 A;  4Z7M A;  4FUK A;  1XGN A;  2ADU A;  3IG4 A;  1YVM A;  3TAV A;  4IKU A;  2GG5 A;  2Q95 A;  2B3K A;  2GG0 A;  1QXY A;  3IU8 A;  2GU6 A;  2V3Y A;  1W2M A;  1YW7 A;  3IU9 A;  2P9A A;  1WL6 A;  4FLI A;  3S6B A;  1XNZ A;  2BH3 A;  2EVM A;  3CTZ A;  3OOO A;  3PKE A;  4RZZ A;  4A6W A;  5CDL A;  2NQ7 A;  2Q94 A;  4U6E A;  4S2T P;  2BHC A;  3PKD A;  1KQ0 A;  4U6J A;  3BIP A;  1O0X A;  2GA2 A;  5JFR A;  1M35 A;  5CE6 A;  1C24 A;  2V3Z A;  3PKC A;  3D27 A;  2NQ6 A;  1WN1 A;  1C21 A;  2P99 A;  4IKS A;  2GU7 A;  4JUQ A;  4RGZ 1;  4B28 A;  1R5G A;  2BWV A;  2GU4 A;  1WKM A;  3PEB A;  3OVK A;  2BWS A;  4FKC A;  4PV4 A;  4IEC A;  4FLL A;  1QZY A;  2OKN A;  5CDE A;  2GU5 A;  3BIQ A;  3PN9 A;  2EVC A;  3TB5 A;  1YW9 A;  2V6C A;  1A16 A;  4A6V A;  2BWY A;  3MAT A;  1XGS A;  4QR8 A;  3BIT A;  5D6F A;  1QXZ A;  4S00 A;  4IKR A;  2MAT A;  4U6C A;  3MX6 A;  4RZY A;  4IDY A;  4IPA A;  4ZNG A;  1R5H A;  3PKA A;  4U1B A;  3L24 A;  1C22 A;  3FM3 A;  1WLR A;  4IKT A;  5CLS A;  4U73 A;  2BHA A;  2GTX A;  2BWX A;  2Q8K A;  2Q92 A;  2DFI A;  1XGM A;  4ZWP A;  1Y1N A;  2EA4 A;  2OAZ A;  3I7M A;  2BB7 A;  1R58 A;  2GZ5 A;  2GG9 A;  2ZSG A;  4PNC A;  5JHU A;  4U70 A;  4S2R P;  1KP0 A;  4IU6 A;  1B59 A;  1KQ9 A;  2P98 A;  3O5V A;  4IF7 A;  4ZWU A; 
#chains in the Genus database with same CATH homology
 2BWT A;  5E5B A;  1BN5 A;  1PV9 A;  2BWW A;  3PKB A;  3IL0 A;  2GG8 A;  2GG7 A;  2GGC A;  2IW2 A;  1WL9 A;  3L7G A;  4EGE A;  1XGO A;  5FCH A;  4ZWO A;  3IU7 A;  4FO7 A;  2BHB A;  1N51 A;  1BOA A;  5JI6 A;  4U6Z A;  1W7V A;  2B3H A;  4U75 A;  4U69 A;  1WBQ A;  3ROR A;  5CIK A;  4S01 A;  3Q6D A;  2GG2 A;  4FO8 A;  3RVA A;  3CB5 A;  2EVO A;  2BWU A;  4OOK A;  2HOW A;  2BHD A;  4FLK A;  2B3L A;  2BN7 A;  1CHM A;  2V3X A;  2Q96 A;  3QOC A;  3CB6 A;  4U6W A;  4HXX A;  4MAT A;  4U76 A;  5D6E A;  3MR1 A;  4R60 A;  5FCF A;  2GGB A;  2G6P A;  1MAT A;  1JAW A;  1WY2 A;  2Q93 A;  3FMR A;  4FLJ A;  3FMQ A;  4KM3 A;  5CDV A;  1C23 A;  4U71 A;  1YW8 A;  2EA2 A;  1C27 A;  1B6A A;  5E2C A;  1QXW A;  5CNX A;  2GG3 A;  1YJ3 A;  4Z7M A;  4FUK A;  1XGN A;  2ADU A;  3IG4 A;  1YVM A;  3TAV A;  4IKU A;  2GG5 A;  2Q95 A;  2B3K A;  2GG0 A;  1QXY A;  3IU8 A;  2GU6 A;  2V3Y A;  1W2M A;  1YW7 A;  3IU9 A;  2P9A A;  1WL6 A;  4FLI A;  3S6B A;  1XNZ A;  2BH3 A;  2EVM A;  3CTZ A;  3OOO A;  3PKE A;  4RZZ A;  4A6W A;  5CDL A;  2NQ7 A;  2Q94 A;  4U6E A;  4S2T P;  2BHC A;  3PKD A;  1KQ0 A;  4U6J A;  3BIP A;  1O0X A;  2GA2 A;  5JFR A;  1M35 A;  5CE6 A;  1C24 A;  2V3Z A;  3PKC A;  3D27 A;  2NQ6 A;  1WN1 A;  1C21 A;  2P99 A;  4IKS A;  2GU7 A;  4JUQ A;  4RGZ 1;  4B28 A;  1R5G A;  2BWV A;  2GU4 A;  1WKM A;  3PEB A;  3OVK A;  2BWS A;  4FKC A;  4PV4 A;  4IEC A;  4FLL A;  1QZY A;  2OKN A;  5CDE A;  2GU5 A;  3BIQ A;  3PN9 A;  2EVC A;  3TB5 A;  1YW9 A;  2V6C A;  1A16 A;  4A6V A;  2BWY A;  3MAT A;  1XGS A;  4QR8 A;  3BIT A;  5D6F A;  1QXZ A;  4S00 A;  4IKR A;  2MAT A;  4U6C A;  3MX6 A;  4RZY A;  4IDY A;  4IPA A;  4ZNG A;  1R5H A;  3PKA A;  4U1B A;  3L24 A;  1C22 A;  3FM3 A;  1WLR A;  4IKT A;  5CLS A;  4U73 A;  2BHA A;  2GTX A;  2BWX A;  2Q8K A;  2Q92 A;  2DFI A;  1XGM A;  4ZWP A;  1Y1N A;  2EA4 A;  2OAZ A;  3I7M A;  2BB7 A;  1R58 A;  2GZ5 A;  2GG9 A;  2ZSG A;  4PNC A;  5JHU A;  4U70 A;  4S2R P;  1KP0 A;  4IU6 A;  1B59 A;  1KQ9 A;  2P98 A;  3O5V A;  4IF7 A;  4ZWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...