4FKCA

Recombinant prolidase from thermococcus sibiricus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
370
structure length
370
Chain Sequence
HHHGSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Influence of intermolecular contacts on the structure of recombinant prolidase from Thermococcus sibiricus.
pubmed doi rcsb
source organism Thermococcus sibiricus
molecule tags Hydrolase
total genus 122
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4fkcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4fkcA02
4U6ZA 4FUKA 2EVCA 1R58A 2B3KA 5CE6A 3CTZA 3D27A 1R5HA 3MR1A 5CDEA 2GG7A 2BHCA 2HOWA 3PKDA 1XGNA 1BN5A 4U70A 1C27A 1XGOA 2BWTA 2OKNA 4RGZ1 2GZ5A 5CIKA 2NQ7A 1WLRA 1QXWA 3FM3A 2BWXA 1XNZA 2B3LA 1KQ9A 2Q92A 2V3ZA 4ZWUA 1XGSA 2MATA 3TAVA 4IPAA 5E5BA 5CDVA 4ZWOA 1YW8A 1Y1NA 1WL6A 3S6BA 2EVOA 4FLLA 4OOKA 1YW7A 4JUQA 3BIPA 1WKMA 3BIQA 2BB7A 2EA2A 2P99A 4IU6A 4QR8A 3Q6DA 4KM3A 2BWUA 2GG9A 5JHUA 1N51A 4FO8A 2Q96A 2V6CA 2GU7A 1C22A 2EVMA 4U1BA 2GA2A 4IKUA 2ZSGA 3O5VA 4S01A 2OAZA 5JFRA 1QXYA 2GG3A 2BWSA 2DFIA 1KQ0A 2BWYA 2Q8KA 4ZWPA 3TB5A 5CLSA 3L24A 2IW2A 3MX6A 1C21A 4RZZA 4R60A 1XGMA 2EA4A 4IDYA 4FLKA 2GG2A 1B59A 2Q94A 3IU7A 4U6CA 3PKEA 1M35A 2GGCA 4FO7A 1CHMA 4IKRA 3QOCA 3IU9A 5D6EA 1WBQA 4IF7A 5D6FA 2BWVA 1YJ3A 4IECA 4A6WA 3L7GA 2G6PA 3CB5A 2BHDA 3BITA 2GU4A 1BOAA 2Q93A 2P98A 4U6WA 1WY2A 4FKCA 4U69A 5JI6A 1MATA 3I7MA 2GG8A 3OVKA 1PV9A 3IL0A 3PKCA 1C23A 4PNCA 4FLIA 1QXZA 4IKSA 1W2MA 3IG4A 4IKTA 2BHBA 2GGBA 2NQ6A 3PN9A 4S2RP 2BH3A 5FCFA 3RVAA 2BWWA 4RZYA 4U6JA 1YW9A 1B6AA 4A6VA 4PV4A 1A16A 1KP0A 3CB6A 3FMQA 3RORA 3FMRA 4S2TP 2GU6A 4Z7MA 2GG5A 2B3HA 1R5GA 5FCHA 1QZYA 4B28A 3MATA 1W7VA 4U73A 4MATA 5E2CA 2BHAA 1YVMA 2GTXA 4HXXA 3PKAA 2V3YA 4S00A 2V3XA 1JAWA 4FLJA 1WN1A 4U6EA 3OOOA 4U71A 4EGEA 2ADUA 5CNXA 1WL9A 4ZNGA 3PKBA 3IU8A 2BN7A 5CDLA 2Q95A 3PEBA 1O0XA 1C24A 2GU5A 2GG0A 4U75A 4U76A 2P9AA
chains in the Genus database with same CATH superfamily
4U6ZA 4FUKA 2EVCA 1R58A 2B3KA 5CE6A 3CTZA 3D27A 1R5HA 3MR1A 5CDEA 2GG7A 2BHCA 2HOWA 3PKDA 1XGNA 1BN5A 4U70A 1C27A 1XGOA 2BWTA 2OKNA 4RGZ1 2GZ5A 5CIKA 2NQ7A 1WLRA 1QXWA 3FM3A 2BWXA 1XNZA 2B3LA 1KQ9A 2Q92A 2V3ZA 4ZWUA 1XGSA 2MATA 3TAVA 4IPAA 5E5BA 5CDVA 4ZWOA 1YW8A 1Y1NA 1WL6A 3S6BA 2EVOA 4FLLA 4OOKA 1YW7A 4JUQA 3BIPA 1WKMA 3BIQA 2BB7A 2EA2A 2P99A 4IU6A 4QR8A 3Q6DA 4KM3A 2BWUA 2GG9A 5JHUA 1N51A 4FO8A 2Q96A 2V6CA 2GU7A 1C22A 2EVMA 4U1BA 2GA2A 4IKUA 2ZSGA 3O5VA 4S01A 2OAZA 5JFRA 1QXYA 2GG3A 2BWSA 2DFIA 1KQ0A 2BWYA 2Q8KA 4ZWPA 3TB5A 5CLSA 3L24A 2IW2A 3MX6A 1C21A 4RZZA 4R60A 1XGMA 2EA4A 4IDYA 4FLKA 2GG2A 1B59A 2Q94A 3IU7A 4U6CA 3PKEA 1M35A 2GGCA 4FO7A 1CHMA 4IKRA 3QOCA 3IU9A 5D6EA 1WBQA 4IF7A 5D6FA 2BWVA 1YJ3A 4IECA 4A6WA 3L7GA 2G6PA 3CB5A 2BHDA 3BITA 2GU4A 1BOAA 2Q93A 2P98A 4U6WA 1WY2A 4FKCA 4U69A 5JI6A 1MATA 3I7MA 2GG8A 3OVKA 1PV9A 3IL0A 3PKCA 1C23A 4PNCA 4FLIA 1QXZA 4IKSA 1W2MA 3IG4A 4IKTA 2BHBA 2GGBA 2NQ6A 3PN9A 4S2RP 2BH3A 5FCFA 3RVAA 2BWWA 4RZYA 4U6JA 1YW9A 1B6AA 4A6VA 4PV4A 1A16A 1KP0A 3CB6A 3FMQA 3RORA 3FMRA 4S2TP 2GU6A 4Z7MA 2GG5A 2B3HA 1R5GA 5FCHA 1QZYA 4B28A 3MATA 1W7VA 4U73A 4MATA 5E2CA 2BHAA 1YVMA 2GTXA 4HXXA 3PKAA 2V3YA 4S00A 2V3XA 1JAWA 4FLJA 1WN1A 4U6EA 3OOOA 4U71A 4EGEA 2ADUA 5CNXA 1WL9A 4ZNGA 3PKBA 3IU8A 2BN7A 5CDLA 2Q95A 3PEBA 1O0XA 1C24A 2GU5A 2GG0A 4U75A 4U76A 2P9AA
chains in the Genus database with same CATH topology
4U6ZA 4FUKA 2EVCA 1R58A 2B3KA 5CE6A 3CTZA 3D27A 1R5HA 3MR1A 5CDEA 2GG7A 2BHCA 2HOWA 3PKDA 1XGNA 1BN5A 4U70A 1C27A 1XGOA 2BWTA 2OKNA 4RGZ1 2GZ5A 5CIKA 2NQ7A 1WLRA 1QXWA 3FM3A 2BWXA 1XNZA 2B3LA 1KQ9A 2Q92A 2V3ZA 4ZWUA 1XGSA 2MATA 3TAVA 4IPAA 5E5BA 5CDVA 4ZWOA 1YW8A 1Y1NA 1WL6A 3S6BA 2EVOA 4FLLA 4OOKA 1YW7A 4JUQA 3BIPA 1WKMA 3BIQA 2BB7A 2EA2A 2P99A 4IU6A 4QR8A 3Q6DA 4KM3A 2BWUA 2GG9A 5JHUA 1N51A 4FO8A 2Q96A 2V6CA 2GU7A 1C22A 2EVMA 4U1BA 2GA2A 4IKUA 2ZSGA 3O5VA 4S01A 2OAZA 5JFRA 1QXYA 2GG3A 2BWSA 2DFIA 1KQ0A 2BWYA 2Q8KA 4ZWPA 3TB5A 5CLSA 3L24A 2IW2A 3MX6A 1C21A 4RZZA 4R60A 1XGMA 2EA4A 4IDYA 4FLKA 2GG2A 1B59A 2Q94A 3IU7A 4U6CA 3PKEA 1M35A 2GGCA 4FO7A 1CHMA 4IKRA 3QOCA 3IU9A 5D6EA 1WBQA 4IF7A 5D6FA 2BWVA 1YJ3A 4IECA 4A6WA 3L7GA 2G6PA 3CB5A 2BHDA 3BITA 2GU4A 1BOAA 2Q93A 2P98A 4U6WA 1WY2A 4FKCA 4U69A 5JI6A 1MATA 3I7MA 2GG8A 3OVKA 1PV9A 3IL0A 3PKCA 1C23A 4PNCA 4FLIA 1QXZA 4IKSA 1W2MA 3IG4A 4IKTA 2BHBA 2GGBA 2NQ6A 3PN9A 4S2RP 2BH3A 5FCFA 3RVAA 2BWWA 4RZYA 4U6JA 1YW9A 1B6AA 4A6VA 4PV4A 1A16A 1KP0A 3CB6A 3FMQA 3RORA 3FMRA 4S2TP 2GU6A 4Z7MA 2GG5A 2B3HA 1R5GA 5FCHA 1QZYA 4B28A 3MATA 1W7VA 4U73A 4MATA 5E2CA 2BHAA 1YVMA 2GTXA 4HXXA 3PKAA 2V3YA 4S00A 2V3XA 1JAWA 4FLJA 1WN1A 4U6EA 3OOOA 4U71A 4EGEA 2ADUA 5CNXA 1WL9A 4ZNGA 3PKBA 3IU8A 2BN7A 5CDLA 2Q95A 3PEBA 1O0XA 1C24A 2GU5A 2GG0A 4U75A 4U76A 2P9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6Z A;  4FUK A;  2EVC A;  1R58 A;  2B3K A;  5CE6 A;  3CTZ A;  3D27 A;  1R5H A;  3MR1 A;  5CDE A;  2GG7 A;  2BHC A;  2HOW A;  3PKD A;  1XGN A;  1BN5 A;  4U70 A;  1C27 A;  1XGO A;  2BWT A;  2OKN A;  4RGZ 1;  2GZ5 A;  5CIK A;  2NQ7 A;  1WLR A;  1QXW A;  3FM3 A;  2BWX A;  1XNZ A;  2B3L A;  1KQ9 A;  2Q92 A;  2V3Z A;  4ZWU A;  1XGS A;  2MAT A;  3TAV A;  4IPA A;  5E5B A;  5CDV A;  4ZWO A;  1YW8 A;  1Y1N A;  1WL6 A;  3S6B A;  2EVO A;  4FLL A;  4OOK A;  1YW7 A;  4JUQ A;  3BIP A;  1WKM A;  3BIQ A;  2BB7 A;  2EA2 A;  2P99 A;  4IU6 A;  4QR8 A;  3Q6D A;  4KM3 A;  2BWU A;  2GG9 A;  5JHU A;  1N51 A;  4FO8 A;  2Q96 A;  2V6C A;  2GU7 A;  1C22 A;  2EVM A;  4U1B A;  2GA2 A;  4IKU A;  2ZSG A;  3O5V A;  4S01 A;  2OAZ A;  5JFR A;  1QXY A;  2GG3 A;  2BWS A;  2DFI A;  1KQ0 A;  2BWY A;  2Q8K A;  4ZWP A;  3TB5 A;  5CLS A;  3L24 A;  2IW2 A;  3MX6 A;  1C21 A;  4RZZ A;  4R60 A;  1XGM A;  2EA4 A;  4IDY A;  4FLK A;  2GG2 A;  1B59 A;  2Q94 A;  3IU7 A;  4U6C A;  3PKE A;  1M35 A;  2GGC A;  4FO7 A;  1CHM A;  4IKR A;  3QOC A;  3IU9 A;  5D6E A;  1WBQ A;  4IF7 A;  5D6F A;  2BWV A;  1YJ3 A;  4IEC A;  4A6W A;  3L7G A;  2G6P A;  3CB5 A;  2BHD A;  3BIT A;  2GU4 A;  1BOA A;  2Q93 A;  2P98 A;  4U6W A;  1WY2 A;  4FKC A;  4U69 A;  5JI6 A;  1MAT A;  3I7M A;  2GG8 A;  3OVK A;  1PV9 A;  3IL0 A;  3PKC A;  1C23 A;  4PNC A;  4FLI A;  1QXZ A;  4IKS A;  1W2M A;  3IG4 A;  4IKT A;  2BHB A;  2GGB A;  2NQ6 A;  3PN9 A;  4S2R P;  2BH3 A;  5FCF A;  3RVA A;  2BWW A;  4RZY A;  4U6J A;  1YW9 A;  1B6A A;  4A6V A;  4PV4 A;  1A16 A;  1KP0 A;  3CB6 A;  3FMQ A;  3ROR A;  3FMR A;  4S2T P;  2GU6 A;  4Z7M A;  2GG5 A;  2B3H A;  1R5G A;  5FCH A;  1QZY A;  4B28 A;  3MAT A;  1W7V A;  4U73 A;  4MAT A;  5E2C A;  2BHA A;  1YVM A;  2GTX A;  4HXX A;  3PKA A;  2V3Y A;  4S00 A;  2V3X A;  1JAW A;  4FLJ A;  1WN1 A;  4U6E A;  3OOO A;  4U71 A;  4EGE A;  2ADU A;  5CNX A;  1WL9 A;  4ZNG A;  3PKB A;  3IU8 A;  2BN7 A;  5CDL A;  2Q95 A;  3PEB A;  1O0X A;  1C24 A;  2GU5 A;  2GG0 A;  4U75 A;  4U76 A;  2P9A A; 
#chains in the Genus database with same CATH topology
 4U6Z A;  4FUK A;  2EVC A;  1R58 A;  2B3K A;  5CE6 A;  3CTZ A;  3D27 A;  1R5H A;  3MR1 A;  5CDE A;  2GG7 A;  2BHC A;  2HOW A;  3PKD A;  1XGN A;  1BN5 A;  4U70 A;  1C27 A;  1XGO A;  2BWT A;  2OKN A;  4RGZ 1;  2GZ5 A;  5CIK A;  2NQ7 A;  1WLR A;  1QXW A;  3FM3 A;  2BWX A;  1XNZ A;  2B3L A;  1KQ9 A;  2Q92 A;  2V3Z A;  4ZWU A;  1XGS A;  2MAT A;  3TAV A;  4IPA A;  5E5B A;  5CDV A;  4ZWO A;  1YW8 A;  1Y1N A;  1WL6 A;  3S6B A;  2EVO A;  4FLL A;  4OOK A;  1YW7 A;  4JUQ A;  3BIP A;  1WKM A;  3BIQ A;  2BB7 A;  2EA2 A;  2P99 A;  4IU6 A;  4QR8 A;  3Q6D A;  4KM3 A;  2BWU A;  2GG9 A;  5JHU A;  1N51 A;  4FO8 A;  2Q96 A;  2V6C A;  2GU7 A;  1C22 A;  2EVM A;  4U1B A;  2GA2 A;  4IKU A;  2ZSG A;  3O5V A;  4S01 A;  2OAZ A;  5JFR A;  1QXY A;  2GG3 A;  2BWS A;  2DFI A;  1KQ0 A;  2BWY A;  2Q8K A;  4ZWP A;  3TB5 A;  5CLS A;  3L24 A;  2IW2 A;  3MX6 A;  1C21 A;  4RZZ A;  4R60 A;  1XGM A;  2EA4 A;  4IDY A;  4FLK A;  2GG2 A;  1B59 A;  2Q94 A;  3IU7 A;  4U6C A;  3PKE A;  1M35 A;  2GGC A;  4FO7 A;  1CHM A;  4IKR A;  3QOC A;  3IU9 A;  5D6E A;  1WBQ A;  4IF7 A;  5D6F A;  2BWV A;  1YJ3 A;  4IEC A;  4A6W A;  3L7G A;  2G6P A;  3CB5 A;  2BHD A;  3BIT A;  2GU4 A;  1BOA A;  2Q93 A;  2P98 A;  4U6W A;  1WY2 A;  4FKC A;  4U69 A;  5JI6 A;  1MAT A;  3I7M A;  2GG8 A;  3OVK A;  1PV9 A;  3IL0 A;  3PKC A;  1C23 A;  4PNC A;  4FLI A;  1QXZ A;  4IKS A;  1W2M A;  3IG4 A;  4IKT A;  2BHB A;  2GGB A;  2NQ6 A;  3PN9 A;  4S2R P;  2BH3 A;  5FCF A;  3RVA A;  2BWW A;  4RZY A;  4U6J A;  1YW9 A;  1B6A A;  4A6V A;  4PV4 A;  1A16 A;  1KP0 A;  3CB6 A;  3FMQ A;  3ROR A;  3FMR A;  4S2T P;  2GU6 A;  4Z7M A;  2GG5 A;  2B3H A;  1R5G A;  5FCH A;  1QZY A;  4B28 A;  3MAT A;  1W7V A;  4U73 A;  4MAT A;  5E2C A;  2BHA A;  1YVM A;  2GTX A;  4HXX A;  3PKA A;  2V3Y A;  4S00 A;  2V3X A;  1JAW A;  4FLJ A;  1WN1 A;  4U6E A;  3OOO A;  4U71 A;  4EGE A;  2ADU A;  5CNX A;  1WL9 A;  4ZNG A;  3PKB A;  3IU8 A;  2BN7 A;  5CDL A;  2Q95 A;  3PEB A;  1O0X A;  1C24 A;  2GU5 A;  2GG0 A;  4U75 A;  4U76 A;  2P9A A; 
#chains in the Genus database with same CATH homology
 4U6Z A;  4FUK A;  2EVC A;  1R58 A;  2B3K A;  5CE6 A;  3CTZ A;  3D27 A;  1R5H A;  3MR1 A;  5CDE A;  2GG7 A;  2BHC A;  2HOW A;  3PKD A;  1XGN A;  1BN5 A;  4U70 A;  1C27 A;  1XGO A;  2BWT A;  2OKN A;  4RGZ 1;  2GZ5 A;  5CIK A;  2NQ7 A;  1WLR A;  1QXW A;  3FM3 A;  2BWX A;  1XNZ A;  2B3L A;  1KQ9 A;  2Q92 A;  2V3Z A;  4ZWU A;  1XGS A;  2MAT A;  3TAV A;  4IPA A;  5E5B A;  5CDV A;  4ZWO A;  1YW8 A;  1Y1N A;  1WL6 A;  3S6B A;  2EVO A;  4FLL A;  4OOK A;  1YW7 A;  4JUQ A;  3BIP A;  1WKM A;  3BIQ A;  2BB7 A;  2EA2 A;  2P99 A;  4IU6 A;  4QR8 A;  3Q6D A;  4KM3 A;  2BWU A;  2GG9 A;  5JHU A;  1N51 A;  4FO8 A;  2Q96 A;  2V6C A;  2GU7 A;  1C22 A;  2EVM A;  4U1B A;  2GA2 A;  4IKU A;  2ZSG A;  3O5V A;  4S01 A;  2OAZ A;  5JFR A;  1QXY A;  2GG3 A;  2BWS A;  2DFI A;  1KQ0 A;  2BWY A;  2Q8K A;  4ZWP A;  3TB5 A;  5CLS A;  3L24 A;  2IW2 A;  3MX6 A;  1C21 A;  4RZZ A;  4R60 A;  1XGM A;  2EA4 A;  4IDY A;  4FLK A;  2GG2 A;  1B59 A;  2Q94 A;  3IU7 A;  4U6C A;  3PKE A;  1M35 A;  2GGC A;  4FO7 A;  1CHM A;  4IKR A;  3QOC A;  3IU9 A;  5D6E A;  1WBQ A;  4IF7 A;  5D6F A;  2BWV A;  1YJ3 A;  4IEC A;  4A6W A;  3L7G A;  2G6P A;  3CB5 A;  2BHD A;  3BIT A;  2GU4 A;  1BOA A;  2Q93 A;  2P98 A;  4U6W A;  1WY2 A;  4FKC A;  4U69 A;  5JI6 A;  1MAT A;  3I7M A;  2GG8 A;  3OVK A;  1PV9 A;  3IL0 A;  3PKC A;  1C23 A;  4PNC A;  4FLI A;  1QXZ A;  4IKS A;  1W2M A;  3IG4 A;  4IKT A;  2BHB A;  2GGB A;  2NQ6 A;  3PN9 A;  4S2R P;  2BH3 A;  5FCF A;  3RVA A;  2BWW A;  4RZY A;  4U6J A;  1YW9 A;  1B6A A;  4A6V A;  4PV4 A;  1A16 A;  1KP0 A;  3CB6 A;  3FMQ A;  3ROR A;  3FMR A;  4S2T P;  2GU6 A;  4Z7M A;  2GG5 A;  2B3H A;  1R5G A;  5FCH A;  1QZY A;  4B28 A;  3MAT A;  1W7V A;  4U73 A;  4MAT A;  5E2C A;  2BHA A;  1YVM A;  2GTX A;  4HXX A;  3PKA A;  2V3Y A;  4S00 A;  2V3X A;  1JAW A;  4FLJ A;  1WN1 A;  4U6E A;  3OOO A;  4U71 A;  4EGE A;  2ADU A;  5CNX A;  1WL9 A;  4ZNG A;  3PKB A;  3IU8 A;  2BN7 A;  5CDL A;  2Q95 A;  3PEB A;  1O0X A;  1C24 A;  2GU5 A;  2GG0 A;  4U75 A;  4U76 A;  2P9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...