1WBQA

Znmg substituted aminopeptidase p from e. coli
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 154
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wbqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wbqA02
2BWUA 3MX6A 3D27A 5CDVA 3Q6DA 3OOOA 4IECA 4IKUA 3FM3A 1C27A 3BIPA 2BWVA 4B28A 2EA2A 3I7MA 4FKCA 3TB5A 4RGZ1 2ADUA 2BHAA 2BHDA 3O5VA 3PKDA 1YW8A 1XGMA 3TAVA 1WBQA 1WKMA 3L7GA 2HOWA 2EVCA 2BHBA 4IKRA 1Y1NA 2GU5A 1C23A 4S00A 2BWTA 1XNZA 3RVAA 2B3LA 2V3XA 1W2MA 5CNXA 3QOCA 4IPAA 5D6FA 1QXYA 4HXXA 2GG9A 1B6AA 4FLIA 1C21A 2P99A 2V6CA 2GG0A 4IDYA 2B3HA 1N51A 4IKSA 2DFIA 2P98A 4RZYA 5CIKA 4S01A 2GGCA 4FO7A 2GTXA 2BB7A 2IW2A 4FLKA 2GG8A 4S2RP 4U70A 3FMRA 2GG7A 3S6BA 1KQ9A 4U6ZA 1A16A 2BH3A 3BITA 4JUQA 1KP0A 5E5BA 3PKAA 4A6VA 5FCHA 2OAZA 4FLJA 4IF7A 3IU9A 1XGSA 1M35A 4IU6A 4EGEA 1WY2A 2BWSA 4A6WA 2GG3A 1R58A 2GG5A 1YW9A 2B3KA 2Q92A 1BOAA 2Q94A 1BN5A 4IKTA 2BWWA 2Q96A 4U6WA 3IG4A 5D6EA 4MATA 1CHMA 4U6EA 5CDEA 4U6JA 3CB6A 2GG2A 1JAWA 4RZZA 3MR1A 4PV4A 1MATA 2P9AA 4FLLA 1YJ3A 1WL9A 4U73A 2OKNA 4S2TP 1C22A 2BN7A 5CE6A 1QXZA 4U71A 1R5GA 4U69A 5CDLA 4ZWOA 1XGOA 3OVKA 2G6PA 2BWYA 2NQ6A 3L24A 4QR8A 3CB5A 1R5HA 3BIQA 4R60A 1QZYA 4U75A 3PN9A 1B59A 1WN1A 4Z7MA 1PV9A 2ZSGA 2BWXA 1XGNA 3CTZA 5FCFA 4FUKA 4U6CA 2BHCA 3PKCA 2GU4A 5JFRA 4ZWPA 2EVMA 2EVOA 3MATA 4FO8A 1W7VA 1C24A 2MATA 1YW7A 2NQ7A 1QXWA 2EA4A 2V3ZA 2GA2A 3IU7A 1O0XA 2Q93A 3IU8A 3IL0A 1WLRA 4PNCA 5JHUA 5E2CA 4KM3A 4OOKA 2V3YA 5JI6A 5CLSA 1YVMA 2GU6A 2GU7A 2Q95A 2Q8KA 4U1BA 1WL6A 2GZ5A 3PKBA 3RORA 4ZWUA 3PEBA 3FMQA 1KQ0A 4ZNGA 4U76A 2GGBA 3PKEA
chains in the Genus database with same CATH superfamily
2BWUA 3MX6A 3D27A 5CDVA 3Q6DA 3OOOA 4IECA 4IKUA 3FM3A 1C27A 3BIPA 2BWVA 4B28A 2EA2A 3I7MA 4FKCA 3TB5A 4RGZ1 2ADUA 2BHAA 2BHDA 3O5VA 3PKDA 1YW8A 1XGMA 3TAVA 1WBQA 1WKMA 3L7GA 2HOWA 2EVCA 2BHBA 4IKRA 1Y1NA 2GU5A 1C23A 4S00A 2BWTA 1XNZA 3RVAA 2B3LA 2V3XA 1W2MA 5CNXA 3QOCA 4IPAA 5D6FA 1QXYA 4HXXA 2GG9A 1B6AA 4FLIA 1C21A 2P99A 2V6CA 2GG0A 4IDYA 2B3HA 1N51A 4IKSA 2DFIA 2P98A 4RZYA 5CIKA 4S01A 2GGCA 4FO7A 2GTXA 2BB7A 2IW2A 4FLKA 2GG8A 4S2RP 4U70A 3FMRA 2GG7A 3S6BA 1KQ9A 4U6ZA 1A16A 2BH3A 3BITA 4JUQA 1KP0A 5E5BA 3PKAA 4A6VA 5FCHA 2OAZA 4FLJA 4IF7A 3IU9A 1XGSA 1M35A 4IU6A 4EGEA 1WY2A 2BWSA 4A6WA 2GG3A 1R58A 2GG5A 1YW9A 2B3KA 2Q92A 1BOAA 2Q94A 1BN5A 4IKTA 2BWWA 2Q96A 4U6WA 3IG4A 5D6EA 4MATA 1CHMA 4U6EA 5CDEA 4U6JA 3CB6A 2GG2A 1JAWA 4RZZA 3MR1A 4PV4A 1MATA 2P9AA 4FLLA 1YJ3A 1WL9A 4U73A 2OKNA 4S2TP 1C22A 2BN7A 5CE6A 1QXZA 4U71A 1R5GA 4U69A 5CDLA 4ZWOA 1XGOA 3OVKA 2G6PA 2BWYA 2NQ6A 3L24A 4QR8A 3CB5A 1R5HA 3BIQA 4R60A 1QZYA 4U75A 3PN9A 1B59A 1WN1A 4Z7MA 1PV9A 2ZSGA 2BWXA 1XGNA 3CTZA 5FCFA 4FUKA 4U6CA 2BHCA 3PKCA 2GU4A 5JFRA 4ZWPA 2EVMA 2EVOA 3MATA 4FO8A 1W7VA 1C24A 2MATA 1YW7A 2NQ7A 1QXWA 2EA4A 2V3ZA 2GA2A 3IU7A 1O0XA 2Q93A 3IU8A 3IL0A 1WLRA 4PNCA 5JHUA 5E2CA 4KM3A 4OOKA 2V3YA 5JI6A 5CLSA 1YVMA 2GU6A 2GU7A 2Q95A 2Q8KA 4U1BA 1WL6A 2GZ5A 3PKBA 3RORA 4ZWUA 3PEBA 3FMQA 1KQ0A 4ZNGA 4U76A 2GGBA 3PKEA
chains in the Genus database with same CATH topology
2BWUA 3MX6A 3D27A 5CDVA 3Q6DA 3OOOA 4IECA 4IKUA 3FM3A 1C27A 3BIPA 2BWVA 4B28A 2EA2A 3I7MA 4FKCA 3TB5A 4RGZ1 2ADUA 2BHAA 2BHDA 3O5VA 3PKDA 1YW8A 1XGMA 3TAVA 1WBQA 1WKMA 3L7GA 2HOWA 2EVCA 2BHBA 4IKRA 1Y1NA 2GU5A 1C23A 4S00A 2BWTA 1XNZA 3RVAA 2B3LA 2V3XA 1W2MA 5CNXA 3QOCA 4IPAA 5D6FA 1QXYA 4HXXA 2GG9A 1B6AA 4FLIA 1C21A 2P99A 2V6CA 2GG0A 4IDYA 2B3HA 1N51A 4IKSA 2DFIA 2P98A 4RZYA 5CIKA 4S01A 2GGCA 4FO7A 2GTXA 2BB7A 2IW2A 4FLKA 2GG8A 4S2RP 4U70A 3FMRA 2GG7A 3S6BA 1KQ9A 4U6ZA 1A16A 2BH3A 3BITA 4JUQA 1KP0A 5E5BA 3PKAA 4A6VA 5FCHA 2OAZA 4FLJA 4IF7A 3IU9A 1XGSA 1M35A 4IU6A 4EGEA 1WY2A 2BWSA 4A6WA 2GG3A 1R58A 2GG5A 1YW9A 2B3KA 2Q92A 1BOAA 2Q94A 1BN5A 4IKTA 2BWWA 2Q96A 4U6WA 3IG4A 5D6EA 4MATA 1CHMA 4U6EA 5CDEA 4U6JA 3CB6A 2GG2A 1JAWA 4RZZA 3MR1A 4PV4A 1MATA 2P9AA 4FLLA 1YJ3A 1WL9A 4U73A 2OKNA 4S2TP 1C22A 2BN7A 5CE6A 1QXZA 4U71A 1R5GA 4U69A 5CDLA 4ZWOA 1XGOA 3OVKA 2G6PA 2BWYA 2NQ6A 3L24A 4QR8A 3CB5A 1R5HA 3BIQA 4R60A 1QZYA 4U75A 3PN9A 1B59A 1WN1A 4Z7MA 1PV9A 2ZSGA 2BWXA 1XGNA 3CTZA 5FCFA 4FUKA 4U6CA 2BHCA 3PKCA 2GU4A 5JFRA 4ZWPA 2EVMA 2EVOA 3MATA 4FO8A 1W7VA 1C24A 2MATA 1YW7A 2NQ7A 1QXWA 2EA4A 2V3ZA 2GA2A 3IU7A 1O0XA 2Q93A 3IU8A 3IL0A 1WLRA 4PNCA 5JHUA 5E2CA 4KM3A 4OOKA 2V3YA 5JI6A 5CLSA 1YVMA 2GU6A 2GU7A 2Q95A 2Q8KA 4U1BA 1WL6A 2GZ5A 3PKBA 3RORA 4ZWUA 3PEBA 3FMQA 1KQ0A 4ZNGA 4U76A 2GGBA 3PKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  3MX6 A;  3D27 A;  5CDV A;  3Q6D A;  3OOO A;  4IEC A;  4IKU A;  3FM3 A;  1C27 A;  3BIP A;  2BWV A;  4B28 A;  2EA2 A;  3I7M A;  4FKC A;  3TB5 A;  4RGZ 1;  2ADU A;  2BHA A;  2BHD A;  3O5V A;  3PKD A;  1YW8 A;  1XGM A;  3TAV A;  1WBQ A;  1WKM A;  3L7G A;  2HOW A;  2EVC A;  2BHB A;  4IKR A;  1Y1N A;  2GU5 A;  1C23 A;  4S00 A;  2BWT A;  1XNZ A;  3RVA A;  2B3L A;  2V3X A;  1W2M A;  5CNX A;  3QOC A;  4IPA A;  5D6F A;  1QXY A;  4HXX A;  2GG9 A;  1B6A A;  4FLI A;  1C21 A;  2P99 A;  2V6C A;  2GG0 A;  4IDY A;  2B3H A;  1N51 A;  4IKS A;  2DFI A;  2P98 A;  4RZY A;  5CIK A;  4S01 A;  2GGC A;  4FO7 A;  2GTX A;  2BB7 A;  2IW2 A;  4FLK A;  2GG8 A;  4S2R P;  4U70 A;  3FMR A;  2GG7 A;  3S6B A;  1KQ9 A;  4U6Z A;  1A16 A;  2BH3 A;  3BIT A;  4JUQ A;  1KP0 A;  5E5B A;  3PKA A;  4A6V A;  5FCH A;  2OAZ A;  4FLJ A;  4IF7 A;  3IU9 A;  1XGS A;  1M35 A;  4IU6 A;  4EGE A;  1WY2 A;  2BWS A;  4A6W A;  2GG3 A;  1R58 A;  2GG5 A;  1YW9 A;  2B3K A;  2Q92 A;  1BOA A;  2Q94 A;  1BN5 A;  4IKT A;  2BWW A;  2Q96 A;  4U6W A;  3IG4 A;  5D6E A;  4MAT A;  1CHM A;  4U6E A;  5CDE A;  4U6J A;  3CB6 A;  2GG2 A;  1JAW A;  4RZZ A;  3MR1 A;  4PV4 A;  1MAT A;  2P9A A;  4FLL A;  1YJ3 A;  1WL9 A;  4U73 A;  2OKN A;  4S2T P;  1C22 A;  2BN7 A;  5CE6 A;  1QXZ A;  4U71 A;  1R5G A;  4U69 A;  5CDL A;  4ZWO A;  1XGO A;  3OVK A;  2G6P A;  2BWY A;  2NQ6 A;  3L24 A;  4QR8 A;  3CB5 A;  1R5H A;  3BIQ A;  4R60 A;  1QZY A;  4U75 A;  3PN9 A;  1B59 A;  1WN1 A;  4Z7M A;  1PV9 A;  2ZSG A;  2BWX A;  1XGN A;  3CTZ A;  5FCF A;  4FUK A;  4U6C A;  2BHC A;  3PKC A;  2GU4 A;  5JFR A;  4ZWP A;  2EVM A;  2EVO A;  3MAT A;  4FO8 A;  1W7V A;  1C24 A;  2MAT A;  1YW7 A;  2NQ7 A;  1QXW A;  2EA4 A;  2V3Z A;  2GA2 A;  3IU7 A;  1O0X A;  2Q93 A;  3IU8 A;  3IL0 A;  1WLR A;  4PNC A;  5JHU A;  5E2C A;  4KM3 A;  4OOK A;  2V3Y A;  5JI6 A;  5CLS A;  1YVM A;  2GU6 A;  2GU7 A;  2Q95 A;  2Q8K A;  4U1B A;  1WL6 A;  2GZ5 A;  3PKB A;  3ROR A;  4ZWU A;  3PEB A;  3FMQ A;  1KQ0 A;  4ZNG A;  4U76 A;  2GGB A;  3PKE A; 
#chains in the Genus database with same CATH topology
 2BWU A;  3MX6 A;  3D27 A;  5CDV A;  3Q6D A;  3OOO A;  4IEC A;  4IKU A;  3FM3 A;  1C27 A;  3BIP A;  2BWV A;  4B28 A;  2EA2 A;  3I7M A;  4FKC A;  3TB5 A;  4RGZ 1;  2ADU A;  2BHA A;  2BHD A;  3O5V A;  3PKD A;  1YW8 A;  1XGM A;  3TAV A;  1WBQ A;  1WKM A;  3L7G A;  2HOW A;  2EVC A;  2BHB A;  4IKR A;  1Y1N A;  2GU5 A;  1C23 A;  4S00 A;  2BWT A;  1XNZ A;  3RVA A;  2B3L A;  2V3X A;  1W2M A;  5CNX A;  3QOC A;  4IPA A;  5D6F A;  1QXY A;  4HXX A;  2GG9 A;  1B6A A;  4FLI A;  1C21 A;  2P99 A;  2V6C A;  2GG0 A;  4IDY A;  2B3H A;  1N51 A;  4IKS A;  2DFI A;  2P98 A;  4RZY A;  5CIK A;  4S01 A;  2GGC A;  4FO7 A;  2GTX A;  2BB7 A;  2IW2 A;  4FLK A;  2GG8 A;  4S2R P;  4U70 A;  3FMR A;  2GG7 A;  3S6B A;  1KQ9 A;  4U6Z A;  1A16 A;  2BH3 A;  3BIT A;  4JUQ A;  1KP0 A;  5E5B A;  3PKA A;  4A6V A;  5FCH A;  2OAZ A;  4FLJ A;  4IF7 A;  3IU9 A;  1XGS A;  1M35 A;  4IU6 A;  4EGE A;  1WY2 A;  2BWS A;  4A6W A;  2GG3 A;  1R58 A;  2GG5 A;  1YW9 A;  2B3K A;  2Q92 A;  1BOA A;  2Q94 A;  1BN5 A;  4IKT A;  2BWW A;  2Q96 A;  4U6W A;  3IG4 A;  5D6E A;  4MAT A;  1CHM A;  4U6E A;  5CDE A;  4U6J A;  3CB6 A;  2GG2 A;  1JAW A;  4RZZ A;  3MR1 A;  4PV4 A;  1MAT A;  2P9A A;  4FLL A;  1YJ3 A;  1WL9 A;  4U73 A;  2OKN A;  4S2T P;  1C22 A;  2BN7 A;  5CE6 A;  1QXZ A;  4U71 A;  1R5G A;  4U69 A;  5CDL A;  4ZWO A;  1XGO A;  3OVK A;  2G6P A;  2BWY A;  2NQ6 A;  3L24 A;  4QR8 A;  3CB5 A;  1R5H A;  3BIQ A;  4R60 A;  1QZY A;  4U75 A;  3PN9 A;  1B59 A;  1WN1 A;  4Z7M A;  1PV9 A;  2ZSG A;  2BWX A;  1XGN A;  3CTZ A;  5FCF A;  4FUK A;  4U6C A;  2BHC A;  3PKC A;  2GU4 A;  5JFR A;  4ZWP A;  2EVM A;  2EVO A;  3MAT A;  4FO8 A;  1W7V A;  1C24 A;  2MAT A;  1YW7 A;  2NQ7 A;  1QXW A;  2EA4 A;  2V3Z A;  2GA2 A;  3IU7 A;  1O0X A;  2Q93 A;  3IU8 A;  3IL0 A;  1WLR A;  4PNC A;  5JHU A;  5E2C A;  4KM3 A;  4OOK A;  2V3Y A;  5JI6 A;  5CLS A;  1YVM A;  2GU6 A;  2GU7 A;  2Q95 A;  2Q8K A;  4U1B A;  1WL6 A;  2GZ5 A;  3PKB A;  3ROR A;  4ZWU A;  3PEB A;  3FMQ A;  1KQ0 A;  4ZNG A;  4U76 A;  2GGB A;  3PKE A; 
#chains in the Genus database with same CATH homology
 2BWU A;  3MX6 A;  3D27 A;  5CDV A;  3Q6D A;  3OOO A;  4IEC A;  4IKU A;  3FM3 A;  1C27 A;  3BIP A;  2BWV A;  4B28 A;  2EA2 A;  3I7M A;  4FKC A;  3TB5 A;  4RGZ 1;  2ADU A;  2BHA A;  2BHD A;  3O5V A;  3PKD A;  1YW8 A;  1XGM A;  3TAV A;  1WBQ A;  1WKM A;  3L7G A;  2HOW A;  2EVC A;  2BHB A;  4IKR A;  1Y1N A;  2GU5 A;  1C23 A;  4S00 A;  2BWT A;  1XNZ A;  3RVA A;  2B3L A;  2V3X A;  1W2M A;  5CNX A;  3QOC A;  4IPA A;  5D6F A;  1QXY A;  4HXX A;  2GG9 A;  1B6A A;  4FLI A;  1C21 A;  2P99 A;  2V6C A;  2GG0 A;  4IDY A;  2B3H A;  1N51 A;  4IKS A;  2DFI A;  2P98 A;  4RZY A;  5CIK A;  4S01 A;  2GGC A;  4FO7 A;  2GTX A;  2BB7 A;  2IW2 A;  4FLK A;  2GG8 A;  4S2R P;  4U70 A;  3FMR A;  2GG7 A;  3S6B A;  1KQ9 A;  4U6Z A;  1A16 A;  2BH3 A;  3BIT A;  4JUQ A;  1KP0 A;  5E5B A;  3PKA A;  4A6V A;  5FCH A;  2OAZ A;  4FLJ A;  4IF7 A;  3IU9 A;  1XGS A;  1M35 A;  4IU6 A;  4EGE A;  1WY2 A;  2BWS A;  4A6W A;  2GG3 A;  1R58 A;  2GG5 A;  1YW9 A;  2B3K A;  2Q92 A;  1BOA A;  2Q94 A;  1BN5 A;  4IKT A;  2BWW A;  2Q96 A;  4U6W A;  3IG4 A;  5D6E A;  4MAT A;  1CHM A;  4U6E A;  5CDE A;  4U6J A;  3CB6 A;  2GG2 A;  1JAW A;  4RZZ A;  3MR1 A;  4PV4 A;  1MAT A;  2P9A A;  4FLL A;  1YJ3 A;  1WL9 A;  4U73 A;  2OKN A;  4S2T P;  1C22 A;  2BN7 A;  5CE6 A;  1QXZ A;  4U71 A;  1R5G A;  4U69 A;  5CDL A;  4ZWO A;  1XGO A;  3OVK A;  2G6P A;  2BWY A;  2NQ6 A;  3L24 A;  4QR8 A;  3CB5 A;  1R5H A;  3BIQ A;  4R60 A;  1QZY A;  4U75 A;  3PN9 A;  1B59 A;  1WN1 A;  4Z7M A;  1PV9 A;  2ZSG A;  2BWX A;  1XGN A;  3CTZ A;  5FCF A;  4FUK A;  4U6C A;  2BHC A;  3PKC A;  2GU4 A;  5JFR A;  4ZWP A;  2EVM A;  2EVO A;  3MAT A;  4FO8 A;  1W7V A;  1C24 A;  2MAT A;  1YW7 A;  2NQ7 A;  1QXW A;  2EA4 A;  2V3Z A;  2GA2 A;  3IU7 A;  1O0X A;  2Q93 A;  3IU8 A;  3IL0 A;  1WLR A;  4PNC A;  5JHU A;  5E2C A;  4KM3 A;  4OOK A;  2V3Y A;  5JI6 A;  5CLS A;  1YVM A;  2GU6 A;  2GU7 A;  2Q95 A;  2Q8K A;  4U1B A;  1WL6 A;  2GZ5 A;  3PKB A;  3ROR A;  4ZWU A;  3PEB A;  3FMQ A;  1KQ0 A;  4ZNG A;  4U76 A;  2GGB A;  3PKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...