1WBQA

Znmg substituted aminopeptidase p from e. coli
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 154
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wbqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wbqA02
2BWUA 4RGZ1 1QZYA 2GGBA 3PN9A 3O5VA 2BWWA 4U73A 4U71A 2GTXA 4IKTA 3FMRA 1M35A 5D6FA 2EVCA 2Q93A 2NQ7A 2EVMA 2Q94A 1QXYA 2BHBA 2B3LA 4U6EA 4ZWUA 5FCFA 5CDVA 1Y1NA 5JFRA 2GG5A 4ZWPA 5JI6A 4FO7A 2GU5A 4S2TP 2BHAA 1KP0A 2Q8KA 5E2CA 1B59A 2EA2A 3PKDA 1B6AA 2B3KA 4IKUA 4U6JA 4FKCA 2BH3A 1YJ3A 2GU6A 3IU9A 5CDLA 4FLLA 2B3HA 1WN1A 1C22A 4S2RP 1W7VA 2HOWA 1XGNA 3RVAA 1QXZA 1YVMA 1R5GA 4ZWOA 2GU7A 3PKAA 2BWVA 3OOOA 3BIQA 2P98A 2IW2A 3TAVA 3QOCA 4RZYA 2G6PA 4IU6A 3Q6DA 2NQ6A 5CLSA 1XGMA 2DFIA 3RORA 2BB7A 4U75A 2Q95A 3MX6A 2V6CA 4FLKA 3L24A 4IDYA 4KM3A 2BN7A 4U6WA 1BOAA 3OVKA 2GG2A 3PKBA 4R60A 1C24A 2GU4A 2GG9A 4HXXA 3I7MA 2EVOA 1QXWA 3IU8A 5D6EA 1JAWA 1A16A 1PV9A 1C21A 4QR8A 4IKRA 4JUQA 5JHUA 4B28A 2P9AA 2GGCA 3MATA 3IL0A 4PV4A 2V3YA 3CTZA 3S6BA 4IF7A 1R5HA 2BWXA 1YW8A 4FUKA 2V3XA 2GG0A 3CB6A 3BIPA 5E5BA 3MR1A 2P99A 4IPAA 2BWTA 2GZ5A 1KQ0A 3PKCA 4S01A 4FLJA 4A6VA 2OKNA 3FMQA 1W2MA 1XNZA 4OOKA 4U1BA 1KQ9A 2BWSA 4S00A 4U70A 2OAZA 4IKSA 2ADUA 4FLIA 3TB5A 4RZZA 2MATA 2Q92A 3IU7A 4U76A 1MATA 4U6ZA 1WBQA 4ZNGA 4Z7MA 1XGSA 4A6WA 3IG4A 3L7GA 2BHCA 1YW7A 2GA2A 1XGOA 1N51A 1WL9A 4U6CA 1CHMA 2GG8A 3PKEA 5CIKA 2V3ZA 1WLRA 1YW9A 4EGEA 5FCHA 4FO8A 3CB5A 1C27A 2BHDA 2ZSGA 1R58A 3D27A 4PNCA 3PEBA 2Q96A 4U69A 1WKMA 1O0XA 4MATA 2BWYA 5CE6A 1C23A 2EA4A 1WY2A 3FM3A 5CNXA 5CDEA 2GG3A 1WL6A 4IECA 3BITA 2GG7A 1BN5A
chains in the Genus database with same CATH superfamily
2BWUA 4RGZ1 1QZYA 2GGBA 3PN9A 3O5VA 2BWWA 4U73A 4U71A 2GTXA 4IKTA 3FMRA 1M35A 5D6FA 2EVCA 2Q93A 2NQ7A 2EVMA 2Q94A 1QXYA 2BHBA 2B3LA 4U6EA 4ZWUA 5FCFA 5CDVA 1Y1NA 5JFRA 2GG5A 4ZWPA 5JI6A 4FO7A 2GU5A 4S2TP 2BHAA 1KP0A 2Q8KA 5E2CA 1B59A 2EA2A 3PKDA 1B6AA 2B3KA 4IKUA 4U6JA 4FKCA 2BH3A 1YJ3A 2GU6A 3IU9A 5CDLA 4FLLA 2B3HA 1WN1A 1C22A 4S2RP 1W7VA 2HOWA 1XGNA 3RVAA 1QXZA 1YVMA 1R5GA 4ZWOA 2GU7A 3PKAA 2BWVA 3OOOA 3BIQA 2P98A 2IW2A 3TAVA 3QOCA 4RZYA 2G6PA 4IU6A 3Q6DA 2NQ6A 5CLSA 1XGMA 2DFIA 3RORA 2BB7A 4U75A 2Q95A 3MX6A 2V6CA 4FLKA 3L24A 4IDYA 4KM3A 2BN7A 4U6WA 1BOAA 3OVKA 2GG2A 3PKBA 4R60A 1C24A 2GU4A 2GG9A 4HXXA 3I7MA 2EVOA 1QXWA 3IU8A 5D6EA 1JAWA 1A16A 1PV9A 1C21A 4QR8A 4IKRA 4JUQA 5JHUA 4B28A 2P9AA 2GGCA 3MATA 3IL0A 4PV4A 2V3YA 3CTZA 3S6BA 4IF7A 1R5HA 2BWXA 1YW8A 4FUKA 2V3XA 2GG0A 3CB6A 3BIPA 5E5BA 3MR1A 2P99A 4IPAA 2BWTA 2GZ5A 1KQ0A 3PKCA 4S01A 4FLJA 4A6VA 2OKNA 3FMQA 1W2MA 1XNZA 4OOKA 4U1BA 1KQ9A 2BWSA 4S00A 4U70A 2OAZA 4IKSA 2ADUA 4FLIA 3TB5A 4RZZA 2MATA 2Q92A 3IU7A 4U76A 1MATA 4U6ZA 1WBQA 4ZNGA 4Z7MA 1XGSA 4A6WA 3IG4A 3L7GA 2BHCA 1YW7A 2GA2A 1XGOA 1N51A 1WL9A 4U6CA 1CHMA 2GG8A 3PKEA 5CIKA 2V3ZA 1WLRA 1YW9A 4EGEA 5FCHA 4FO8A 3CB5A 1C27A 2BHDA 2ZSGA 1R58A 3D27A 4PNCA 3PEBA 2Q96A 4U69A 1WKMA 1O0XA 4MATA 2BWYA 5CE6A 1C23A 2EA4A 1WY2A 3FM3A 5CNXA 5CDEA 2GG3A 1WL6A 4IECA 3BITA 2GG7A 1BN5A
chains in the Genus database with same CATH topology
2BWUA 4RGZ1 1QZYA 2GGBA 3PN9A 3O5VA 2BWWA 4U73A 4U71A 2GTXA 4IKTA 3FMRA 1M35A 5D6FA 2EVCA 2Q93A 2NQ7A 2EVMA 2Q94A 1QXYA 2BHBA 2B3LA 4U6EA 4ZWUA 5FCFA 5CDVA 1Y1NA 5JFRA 2GG5A 4ZWPA 5JI6A 4FO7A 2GU5A 4S2TP 2BHAA 1KP0A 2Q8KA 5E2CA 1B59A 2EA2A 3PKDA 1B6AA 2B3KA 4IKUA 4U6JA 4FKCA 2BH3A 1YJ3A 2GU6A 3IU9A 5CDLA 4FLLA 2B3HA 1WN1A 1C22A 4S2RP 1W7VA 2HOWA 1XGNA 3RVAA 1QXZA 1YVMA 1R5GA 4ZWOA 2GU7A 3PKAA 2BWVA 3OOOA 3BIQA 2P98A 2IW2A 3TAVA 3QOCA 4RZYA 2G6PA 4IU6A 3Q6DA 2NQ6A 5CLSA 1XGMA 2DFIA 3RORA 2BB7A 4U75A 2Q95A 3MX6A 2V6CA 4FLKA 3L24A 4IDYA 4KM3A 2BN7A 4U6WA 1BOAA 3OVKA 2GG2A 3PKBA 4R60A 1C24A 2GU4A 2GG9A 4HXXA 3I7MA 2EVOA 1QXWA 3IU8A 5D6EA 1JAWA 1A16A 1PV9A 1C21A 4QR8A 4IKRA 4JUQA 5JHUA 4B28A 2P9AA 2GGCA 3MATA 3IL0A 4PV4A 2V3YA 3CTZA 3S6BA 4IF7A 1R5HA 2BWXA 1YW8A 4FUKA 2V3XA 2GG0A 3CB6A 3BIPA 5E5BA 3MR1A 2P99A 4IPAA 2BWTA 2GZ5A 1KQ0A 3PKCA 4S01A 4FLJA 4A6VA 2OKNA 3FMQA 1W2MA 1XNZA 4OOKA 4U1BA 1KQ9A 2BWSA 4S00A 4U70A 2OAZA 4IKSA 2ADUA 4FLIA 3TB5A 4RZZA 2MATA 2Q92A 3IU7A 4U76A 1MATA 4U6ZA 1WBQA 4ZNGA 4Z7MA 1XGSA 4A6WA 3IG4A 3L7GA 2BHCA 1YW7A 2GA2A 1XGOA 1N51A 1WL9A 4U6CA 1CHMA 2GG8A 3PKEA 5CIKA 2V3ZA 1WLRA 1YW9A 4EGEA 5FCHA 4FO8A 3CB5A 1C27A 2BHDA 2ZSGA 1R58A 3D27A 4PNCA 3PEBA 2Q96A 4U69A 1WKMA 1O0XA 4MATA 2BWYA 5CE6A 1C23A 2EA4A 1WY2A 3FM3A 5CNXA 5CDEA 2GG3A 1WL6A 4IECA 3BITA 2GG7A 1BN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  4RGZ 1;  1QZY A;  2GGB A;  3PN9 A;  3O5V A;  2BWW A;  4U73 A;  4U71 A;  2GTX A;  4IKT A;  3FMR A;  1M35 A;  5D6F A;  2EVC A;  2Q93 A;  2NQ7 A;  2EVM A;  2Q94 A;  1QXY A;  2BHB A;  2B3L A;  4U6E A;  4ZWU A;  5FCF A;  5CDV A;  1Y1N A;  5JFR A;  2GG5 A;  4ZWP A;  5JI6 A;  4FO7 A;  2GU5 A;  4S2T P;  2BHA A;  1KP0 A;  2Q8K A;  5E2C A;  1B59 A;  2EA2 A;  3PKD A;  1B6A A;  2B3K A;  4IKU A;  4U6J A;  4FKC A;  2BH3 A;  1YJ3 A;  2GU6 A;  3IU9 A;  5CDL A;  4FLL A;  2B3H A;  1WN1 A;  1C22 A;  4S2R P;  1W7V A;  2HOW A;  1XGN A;  3RVA A;  1QXZ A;  1YVM A;  1R5G A;  4ZWO A;  2GU7 A;  3PKA A;  2BWV A;  3OOO A;  3BIQ A;  2P98 A;  2IW2 A;  3TAV A;  3QOC A;  4RZY A;  2G6P A;  4IU6 A;  3Q6D A;  2NQ6 A;  5CLS A;  1XGM A;  2DFI A;  3ROR A;  2BB7 A;  4U75 A;  2Q95 A;  3MX6 A;  2V6C A;  4FLK A;  3L24 A;  4IDY A;  4KM3 A;  2BN7 A;  4U6W A;  1BOA A;  3OVK A;  2GG2 A;  3PKB A;  4R60 A;  1C24 A;  2GU4 A;  2GG9 A;  4HXX A;  3I7M A;  2EVO A;  1QXW A;  3IU8 A;  5D6E A;  1JAW A;  1A16 A;  1PV9 A;  1C21 A;  4QR8 A;  4IKR A;  4JUQ A;  5JHU A;  4B28 A;  2P9A A;  2GGC A;  3MAT A;  3IL0 A;  4PV4 A;  2V3Y A;  3CTZ A;  3S6B A;  4IF7 A;  1R5H A;  2BWX A;  1YW8 A;  4FUK A;  2V3X A;  2GG0 A;  3CB6 A;  3BIP A;  5E5B A;  3MR1 A;  2P99 A;  4IPA A;  2BWT A;  2GZ5 A;  1KQ0 A;  3PKC A;  4S01 A;  4FLJ A;  4A6V A;  2OKN A;  3FMQ A;  1W2M A;  1XNZ A;  4OOK A;  4U1B A;  1KQ9 A;  2BWS A;  4S00 A;  4U70 A;  2OAZ A;  4IKS A;  2ADU A;  4FLI A;  3TB5 A;  4RZZ A;  2MAT A;  2Q92 A;  3IU7 A;  4U76 A;  1MAT A;  4U6Z A;  1WBQ A;  4ZNG A;  4Z7M A;  1XGS A;  4A6W A;  3IG4 A;  3L7G A;  2BHC A;  1YW7 A;  2GA2 A;  1XGO A;  1N51 A;  1WL9 A;  4U6C A;  1CHM A;  2GG8 A;  3PKE A;  5CIK A;  2V3Z A;  1WLR A;  1YW9 A;  4EGE A;  5FCH A;  4FO8 A;  3CB5 A;  1C27 A;  2BHD A;  2ZSG A;  1R58 A;  3D27 A;  4PNC A;  3PEB A;  2Q96 A;  4U69 A;  1WKM A;  1O0X A;  4MAT A;  2BWY A;  5CE6 A;  1C23 A;  2EA4 A;  1WY2 A;  3FM3 A;  5CNX A;  5CDE A;  2GG3 A;  1WL6 A;  4IEC A;  3BIT A;  2GG7 A;  1BN5 A; 
#chains in the Genus database with same CATH topology
 2BWU A;  4RGZ 1;  1QZY A;  2GGB A;  3PN9 A;  3O5V A;  2BWW A;  4U73 A;  4U71 A;  2GTX A;  4IKT A;  3FMR A;  1M35 A;  5D6F A;  2EVC A;  2Q93 A;  2NQ7 A;  2EVM A;  2Q94 A;  1QXY A;  2BHB A;  2B3L A;  4U6E A;  4ZWU A;  5FCF A;  5CDV A;  1Y1N A;  5JFR A;  2GG5 A;  4ZWP A;  5JI6 A;  4FO7 A;  2GU5 A;  4S2T P;  2BHA A;  1KP0 A;  2Q8K A;  5E2C A;  1B59 A;  2EA2 A;  3PKD A;  1B6A A;  2B3K A;  4IKU A;  4U6J A;  4FKC A;  2BH3 A;  1YJ3 A;  2GU6 A;  3IU9 A;  5CDL A;  4FLL A;  2B3H A;  1WN1 A;  1C22 A;  4S2R P;  1W7V A;  2HOW A;  1XGN A;  3RVA A;  1QXZ A;  1YVM A;  1R5G A;  4ZWO A;  2GU7 A;  3PKA A;  2BWV A;  3OOO A;  3BIQ A;  2P98 A;  2IW2 A;  3TAV A;  3QOC A;  4RZY A;  2G6P A;  4IU6 A;  3Q6D A;  2NQ6 A;  5CLS A;  1XGM A;  2DFI A;  3ROR A;  2BB7 A;  4U75 A;  2Q95 A;  3MX6 A;  2V6C A;  4FLK A;  3L24 A;  4IDY A;  4KM3 A;  2BN7 A;  4U6W A;  1BOA A;  3OVK A;  2GG2 A;  3PKB A;  4R60 A;  1C24 A;  2GU4 A;  2GG9 A;  4HXX A;  3I7M A;  2EVO A;  1QXW A;  3IU8 A;  5D6E A;  1JAW A;  1A16 A;  1PV9 A;  1C21 A;  4QR8 A;  4IKR A;  4JUQ A;  5JHU A;  4B28 A;  2P9A A;  2GGC A;  3MAT A;  3IL0 A;  4PV4 A;  2V3Y A;  3CTZ A;  3S6B A;  4IF7 A;  1R5H A;  2BWX A;  1YW8 A;  4FUK A;  2V3X A;  2GG0 A;  3CB6 A;  3BIP A;  5E5B A;  3MR1 A;  2P99 A;  4IPA A;  2BWT A;  2GZ5 A;  1KQ0 A;  3PKC A;  4S01 A;  4FLJ A;  4A6V A;  2OKN A;  3FMQ A;  1W2M A;  1XNZ A;  4OOK A;  4U1B A;  1KQ9 A;  2BWS A;  4S00 A;  4U70 A;  2OAZ A;  4IKS A;  2ADU A;  4FLI A;  3TB5 A;  4RZZ A;  2MAT A;  2Q92 A;  3IU7 A;  4U76 A;  1MAT A;  4U6Z A;  1WBQ A;  4ZNG A;  4Z7M A;  1XGS A;  4A6W A;  3IG4 A;  3L7G A;  2BHC A;  1YW7 A;  2GA2 A;  1XGO A;  1N51 A;  1WL9 A;  4U6C A;  1CHM A;  2GG8 A;  3PKE A;  5CIK A;  2V3Z A;  1WLR A;  1YW9 A;  4EGE A;  5FCH A;  4FO8 A;  3CB5 A;  1C27 A;  2BHD A;  2ZSG A;  1R58 A;  3D27 A;  4PNC A;  3PEB A;  2Q96 A;  4U69 A;  1WKM A;  1O0X A;  4MAT A;  2BWY A;  5CE6 A;  1C23 A;  2EA4 A;  1WY2 A;  3FM3 A;  5CNX A;  5CDE A;  2GG3 A;  1WL6 A;  4IEC A;  3BIT A;  2GG7 A;  1BN5 A; 
#chains in the Genus database with same CATH homology
 2BWU A;  4RGZ 1;  1QZY A;  2GGB A;  3PN9 A;  3O5V A;  2BWW A;  4U73 A;  4U71 A;  2GTX A;  4IKT A;  3FMR A;  1M35 A;  5D6F A;  2EVC A;  2Q93 A;  2NQ7 A;  2EVM A;  2Q94 A;  1QXY A;  2BHB A;  2B3L A;  4U6E A;  4ZWU A;  5FCF A;  5CDV A;  1Y1N A;  5JFR A;  2GG5 A;  4ZWP A;  5JI6 A;  4FO7 A;  2GU5 A;  4S2T P;  2BHA A;  1KP0 A;  2Q8K A;  5E2C A;  1B59 A;  2EA2 A;  3PKD A;  1B6A A;  2B3K A;  4IKU A;  4U6J A;  4FKC A;  2BH3 A;  1YJ3 A;  2GU6 A;  3IU9 A;  5CDL A;  4FLL A;  2B3H A;  1WN1 A;  1C22 A;  4S2R P;  1W7V A;  2HOW A;  1XGN A;  3RVA A;  1QXZ A;  1YVM A;  1R5G A;  4ZWO A;  2GU7 A;  3PKA A;  2BWV A;  3OOO A;  3BIQ A;  2P98 A;  2IW2 A;  3TAV A;  3QOC A;  4RZY A;  2G6P A;  4IU6 A;  3Q6D A;  2NQ6 A;  5CLS A;  1XGM A;  2DFI A;  3ROR A;  2BB7 A;  4U75 A;  2Q95 A;  3MX6 A;  2V6C A;  4FLK A;  3L24 A;  4IDY A;  4KM3 A;  2BN7 A;  4U6W A;  1BOA A;  3OVK A;  2GG2 A;  3PKB A;  4R60 A;  1C24 A;  2GU4 A;  2GG9 A;  4HXX A;  3I7M A;  2EVO A;  1QXW A;  3IU8 A;  5D6E A;  1JAW A;  1A16 A;  1PV9 A;  1C21 A;  4QR8 A;  4IKR A;  4JUQ A;  5JHU A;  4B28 A;  2P9A A;  2GGC A;  3MAT A;  3IL0 A;  4PV4 A;  2V3Y A;  3CTZ A;  3S6B A;  4IF7 A;  1R5H A;  2BWX A;  1YW8 A;  4FUK A;  2V3X A;  2GG0 A;  3CB6 A;  3BIP A;  5E5B A;  3MR1 A;  2P99 A;  4IPA A;  2BWT A;  2GZ5 A;  1KQ0 A;  3PKC A;  4S01 A;  4FLJ A;  4A6V A;  2OKN A;  3FMQ A;  1W2M A;  1XNZ A;  4OOK A;  4U1B A;  1KQ9 A;  2BWS A;  4S00 A;  4U70 A;  2OAZ A;  4IKS A;  2ADU A;  4FLI A;  3TB5 A;  4RZZ A;  2MAT A;  2Q92 A;  3IU7 A;  4U76 A;  1MAT A;  4U6Z A;  1WBQ A;  4ZNG A;  4Z7M A;  1XGS A;  4A6W A;  3IG4 A;  3L7G A;  2BHC A;  1YW7 A;  2GA2 A;  1XGO A;  1N51 A;  1WL9 A;  4U6C A;  1CHM A;  2GG8 A;  3PKE A;  5CIK A;  2V3Z A;  1WLR A;  1YW9 A;  4EGE A;  5FCH A;  4FO8 A;  3CB5 A;  1C27 A;  2BHD A;  2ZSG A;  1R58 A;  3D27 A;  4PNC A;  3PEB A;  2Q96 A;  4U69 A;  1WKM A;  1O0X A;  4MAT A;  2BWY A;  5CE6 A;  1C23 A;  2EA4 A;  1WY2 A;  3FM3 A;  5CNX A;  5CDE A;  2GG3 A;  1WL6 A;  4IEC A;  3BIT A;  2GG7 A;  1BN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...