1WBQA

Znmg substituted aminopeptidase p from e. coli
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 154
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wbqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wbqA02
1YJ3A 1QZYA 2GG5A 4IKUA 1M35A 1R5GA 1XGMA 1N51A 2Q94A 4R60A 4S2TP 2Q96A 4ZWOA 2GG0A 1C24A 2V3XA 2GG9A 4FO8A 2OKNA 4FKCA 2GG3A 4IF7A 1QXYA 3PKAA 4U6WA 4A6WA 5JFRA 2Q93A 1WBQA 2BWWA 3OOOA 5CNXA 3PEBA 1BOAA 2GU5A 3MATA 5CE6A 1YW7A 1W2MA 3IG4A 1XGOA 4OOKA 4FUKA 1WN1A 5D6FA 1YW9A 4QR8A 4U70A 1QXZA 4JUQA 1KQ9A 3FMRA 1YVMA 4ZNGA 2GZ5A 1R58A 3PKDA 4IKRA 2BWUA 2GU6A 2BWSA 2GA2A 4PNCA 1W7VA 2BWVA 1Y1NA 1C21A 2NQ7A 1B6AA 3L24A 2P98A 2V3YA 3FMQA 4U73A 2V3ZA 2Q92A 1A16A 5FCHA 1YW8A 2Q8KA 4U6JA 1WY2A 4RZZA 4PV4A 1WL6A 4RGZ1 3OVKA 4S00A 4S2RP 5JHUA 3O5VA 1KP0A 2BH3A 1PV9A 5CIKA 2GTXA 2BHBA 2GU7A 4U71A 1CHMA 4IDYA 4Z7MA 5CDLA 1QXWA 3TB5A 2NQ6A 3FM3A 1JAWA 3CB6A 3Q6DA 2GGCA 2EVOA 2B3LA 2GGBA 2BHAA 3S6BA 1XNZA 5E2CA 3BITA 3PKBA 2OAZA 2BWYA 5E5BA 3MX6A 4FLIA 4A6VA 2G6PA 3L7GA 2BHDA 4FO7A 2HOWA 5JI6A 2BWXA 1XGNA 2P99A 2IW2A 3PN9A 3MR1A 4U6CA 2GG7A 4U1BA 2GG2A 3IL0A 2BN7A 2B3KA 2EA2A 1WL9A 3I7MA 4U69A 3BIQA 2ZSGA 3QOCA 3IU9A 4IKSA 1R5HA 2EVCA 4IECA 3CTZA 4FLJA 5CLSA 3PKEA 4IPAA 5CDEA 1C27A 2DFIA 3IU8A 3RVAA 4ZWPA 2ADUA 5CDVA 4HXXA 4S01A 1WKMA 4IU6A 5FCFA 2BWTA 1WLRA 2EVMA 1C23A 2GG8A 4U6EA 4U6ZA 1XGSA 3D27A 2BB7A 1MATA 2B3HA 2Q95A 4KM3A 3PKCA 4ZWUA 3CB5A 1KQ0A 3IU7A 3TAVA 3BIPA 4U76A 2BHCA 4MATA 4FLKA 4U75A 3RORA 4B28A 4RZYA 5D6EA 2GU4A 4FLLA 1O0XA 1B59A 1BN5A 1C22A 2V6CA 2P9AA 4IKTA 2EA4A 2MATA 4EGEA
chains in the Genus database with same CATH superfamily
1YJ3A 1QZYA 2GG5A 4IKUA 1M35A 1R5GA 1XGMA 1N51A 2Q94A 4R60A 4S2TP 2Q96A 4ZWOA 2GG0A 1C24A 2V3XA 2GG9A 4FO8A 2OKNA 4FKCA 2GG3A 4IF7A 1QXYA 3PKAA 4U6WA 4A6WA 5JFRA 2Q93A 1WBQA 2BWWA 3OOOA 5CNXA 3PEBA 1BOAA 2GU5A 3MATA 5CE6A 1YW7A 1W2MA 3IG4A 1XGOA 4OOKA 4FUKA 1WN1A 5D6FA 1YW9A 4QR8A 4U70A 1QXZA 4JUQA 1KQ9A 3FMRA 1YVMA 4ZNGA 2GZ5A 1R58A 3PKDA 4IKRA 2BWUA 2GU6A 2BWSA 2GA2A 4PNCA 1W7VA 2BWVA 1Y1NA 1C21A 2NQ7A 1B6AA 3L24A 2P98A 2V3YA 3FMQA 4U73A 2V3ZA 2Q92A 1A16A 5FCHA 1YW8A 2Q8KA 4U6JA 1WY2A 4RZZA 4PV4A 1WL6A 4RGZ1 3OVKA 4S00A 4S2RP 5JHUA 3O5VA 1KP0A 2BH3A 1PV9A 5CIKA 2GTXA 2BHBA 2GU7A 4U71A 1CHMA 4IDYA 4Z7MA 5CDLA 1QXWA 3TB5A 2NQ6A 3FM3A 1JAWA 3CB6A 3Q6DA 2GGCA 2EVOA 2B3LA 2GGBA 2BHAA 3S6BA 1XNZA 5E2CA 3BITA 3PKBA 2OAZA 2BWYA 5E5BA 3MX6A 4FLIA 4A6VA 2G6PA 3L7GA 2BHDA 4FO7A 2HOWA 5JI6A 2BWXA 1XGNA 2P99A 2IW2A 3PN9A 3MR1A 4U6CA 2GG7A 4U1BA 2GG2A 3IL0A 2BN7A 2B3KA 2EA2A 1WL9A 3I7MA 4U69A 3BIQA 2ZSGA 3QOCA 3IU9A 4IKSA 1R5HA 2EVCA 4IECA 3CTZA 4FLJA 5CLSA 3PKEA 4IPAA 5CDEA 1C27A 2DFIA 3IU8A 3RVAA 4ZWPA 2ADUA 5CDVA 4HXXA 4S01A 1WKMA 4IU6A 5FCFA 2BWTA 1WLRA 2EVMA 1C23A 2GG8A 4U6EA 4U6ZA 1XGSA 3D27A 2BB7A 1MATA 2B3HA 2Q95A 4KM3A 3PKCA 4ZWUA 3CB5A 1KQ0A 3IU7A 3TAVA 3BIPA 4U76A 2BHCA 4MATA 4FLKA 4U75A 3RORA 4B28A 4RZYA 5D6EA 2GU4A 4FLLA 1O0XA 1B59A 1BN5A 1C22A 2V6CA 2P9AA 4IKTA 2EA4A 2MATA 4EGEA
chains in the Genus database with same CATH topology
1YJ3A 1QZYA 2GG5A 4IKUA 1M35A 1R5GA 1XGMA 1N51A 2Q94A 4R60A 4S2TP 2Q96A 4ZWOA 2GG0A 1C24A 2V3XA 2GG9A 4FO8A 2OKNA 4FKCA 2GG3A 4IF7A 1QXYA 3PKAA 4U6WA 4A6WA 5JFRA 2Q93A 1WBQA 2BWWA 3OOOA 5CNXA 3PEBA 1BOAA 2GU5A 3MATA 5CE6A 1YW7A 1W2MA 3IG4A 1XGOA 4OOKA 4FUKA 1WN1A 5D6FA 1YW9A 4QR8A 4U70A 1QXZA 4JUQA 1KQ9A 3FMRA 1YVMA 4ZNGA 2GZ5A 1R58A 3PKDA 4IKRA 2BWUA 2GU6A 2BWSA 2GA2A 4PNCA 1W7VA 2BWVA 1Y1NA 1C21A 2NQ7A 1B6AA 3L24A 2P98A 2V3YA 3FMQA 4U73A 2V3ZA 2Q92A 1A16A 5FCHA 1YW8A 2Q8KA 4U6JA 1WY2A 4RZZA 4PV4A 1WL6A 4RGZ1 3OVKA 4S00A 4S2RP 5JHUA 3O5VA 1KP0A 2BH3A 1PV9A 5CIKA 2GTXA 2BHBA 2GU7A 4U71A 1CHMA 4IDYA 4Z7MA 5CDLA 1QXWA 3TB5A 2NQ6A 3FM3A 1JAWA 3CB6A 3Q6DA 2GGCA 2EVOA 2B3LA 2GGBA 2BHAA 3S6BA 1XNZA 5E2CA 3BITA 3PKBA 2OAZA 2BWYA 5E5BA 3MX6A 4FLIA 4A6VA 2G6PA 3L7GA 2BHDA 4FO7A 2HOWA 5JI6A 2BWXA 1XGNA 2P99A 2IW2A 3PN9A 3MR1A 4U6CA 2GG7A 4U1BA 2GG2A 3IL0A 2BN7A 2B3KA 2EA2A 1WL9A 3I7MA 4U69A 3BIQA 2ZSGA 3QOCA 3IU9A 4IKSA 1R5HA 2EVCA 4IECA 3CTZA 4FLJA 5CLSA 3PKEA 4IPAA 5CDEA 1C27A 2DFIA 3IU8A 3RVAA 4ZWPA 2ADUA 5CDVA 4HXXA 4S01A 1WKMA 4IU6A 5FCFA 2BWTA 1WLRA 2EVMA 1C23A 2GG8A 4U6EA 4U6ZA 1XGSA 3D27A 2BB7A 1MATA 2B3HA 2Q95A 4KM3A 3PKCA 4ZWUA 3CB5A 1KQ0A 3IU7A 3TAVA 3BIPA 4U76A 2BHCA 4MATA 4FLKA 4U75A 3RORA 4B28A 4RZYA 5D6EA 2GU4A 4FLLA 1O0XA 1B59A 1BN5A 1C22A 2V6CA 2P9AA 4IKTA 2EA4A 2MATA 4EGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  1QZY A;  2GG5 A;  4IKU A;  1M35 A;  1R5G A;  1XGM A;  1N51 A;  2Q94 A;  4R60 A;  4S2T P;  2Q96 A;  4ZWO A;  2GG0 A;  1C24 A;  2V3X A;  2GG9 A;  4FO8 A;  2OKN A;  4FKC A;  2GG3 A;  4IF7 A;  1QXY A;  3PKA A;  4U6W A;  4A6W A;  5JFR A;  2Q93 A;  1WBQ A;  2BWW A;  3OOO A;  5CNX A;  3PEB A;  1BOA A;  2GU5 A;  3MAT A;  5CE6 A;  1YW7 A;  1W2M A;  3IG4 A;  1XGO A;  4OOK A;  4FUK A;  1WN1 A;  5D6F A;  1YW9 A;  4QR8 A;  4U70 A;  1QXZ A;  4JUQ A;  1KQ9 A;  3FMR A;  1YVM A;  4ZNG A;  2GZ5 A;  1R58 A;  3PKD A;  4IKR A;  2BWU A;  2GU6 A;  2BWS A;  2GA2 A;  4PNC A;  1W7V A;  2BWV A;  1Y1N A;  1C21 A;  2NQ7 A;  1B6A A;  3L24 A;  2P98 A;  2V3Y A;  3FMQ A;  4U73 A;  2V3Z A;  2Q92 A;  1A16 A;  5FCH A;  1YW8 A;  2Q8K A;  4U6J A;  1WY2 A;  4RZZ A;  4PV4 A;  1WL6 A;  4RGZ 1;  3OVK A;  4S00 A;  4S2R P;  5JHU A;  3O5V A;  1KP0 A;  2BH3 A;  1PV9 A;  5CIK A;  2GTX A;  2BHB A;  2GU7 A;  4U71 A;  1CHM A;  4IDY A;  4Z7M A;  5CDL A;  1QXW A;  3TB5 A;  2NQ6 A;  3FM3 A;  1JAW A;  3CB6 A;  3Q6D A;  2GGC A;  2EVO A;  2B3L A;  2GGB A;  2BHA A;  3S6B A;  1XNZ A;  5E2C A;  3BIT A;  3PKB A;  2OAZ A;  2BWY A;  5E5B A;  3MX6 A;  4FLI A;  4A6V A;  2G6P A;  3L7G A;  2BHD A;  4FO7 A;  2HOW A;  5JI6 A;  2BWX A;  1XGN A;  2P99 A;  2IW2 A;  3PN9 A;  3MR1 A;  4U6C A;  2GG7 A;  4U1B A;  2GG2 A;  3IL0 A;  2BN7 A;  2B3K A;  2EA2 A;  1WL9 A;  3I7M A;  4U69 A;  3BIQ A;  2ZSG A;  3QOC A;  3IU9 A;  4IKS A;  1R5H A;  2EVC A;  4IEC A;  3CTZ A;  4FLJ A;  5CLS A;  3PKE A;  4IPA A;  5CDE A;  1C27 A;  2DFI A;  3IU8 A;  3RVA A;  4ZWP A;  2ADU A;  5CDV A;  4HXX A;  4S01 A;  1WKM A;  4IU6 A;  5FCF A;  2BWT A;  1WLR A;  2EVM A;  1C23 A;  2GG8 A;  4U6E A;  4U6Z A;  1XGS A;  3D27 A;  2BB7 A;  1MAT A;  2B3H A;  2Q95 A;  4KM3 A;  3PKC A;  4ZWU A;  3CB5 A;  1KQ0 A;  3IU7 A;  3TAV A;  3BIP A;  4U76 A;  2BHC A;  4MAT A;  4FLK A;  4U75 A;  3ROR A;  4B28 A;  4RZY A;  5D6E A;  2GU4 A;  4FLL A;  1O0X A;  1B59 A;  1BN5 A;  1C22 A;  2V6C A;  2P9A A;  4IKT A;  2EA4 A;  2MAT A;  4EGE A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  1QZY A;  2GG5 A;  4IKU A;  1M35 A;  1R5G A;  1XGM A;  1N51 A;  2Q94 A;  4R60 A;  4S2T P;  2Q96 A;  4ZWO A;  2GG0 A;  1C24 A;  2V3X A;  2GG9 A;  4FO8 A;  2OKN A;  4FKC A;  2GG3 A;  4IF7 A;  1QXY A;  3PKA A;  4U6W A;  4A6W A;  5JFR A;  2Q93 A;  1WBQ A;  2BWW A;  3OOO A;  5CNX A;  3PEB A;  1BOA A;  2GU5 A;  3MAT A;  5CE6 A;  1YW7 A;  1W2M A;  3IG4 A;  1XGO A;  4OOK A;  4FUK A;  1WN1 A;  5D6F A;  1YW9 A;  4QR8 A;  4U70 A;  1QXZ A;  4JUQ A;  1KQ9 A;  3FMR A;  1YVM A;  4ZNG A;  2GZ5 A;  1R58 A;  3PKD A;  4IKR A;  2BWU A;  2GU6 A;  2BWS A;  2GA2 A;  4PNC A;  1W7V A;  2BWV A;  1Y1N A;  1C21 A;  2NQ7 A;  1B6A A;  3L24 A;  2P98 A;  2V3Y A;  3FMQ A;  4U73 A;  2V3Z A;  2Q92 A;  1A16 A;  5FCH A;  1YW8 A;  2Q8K A;  4U6J A;  1WY2 A;  4RZZ A;  4PV4 A;  1WL6 A;  4RGZ 1;  3OVK A;  4S00 A;  4S2R P;  5JHU A;  3O5V A;  1KP0 A;  2BH3 A;  1PV9 A;  5CIK A;  2GTX A;  2BHB A;  2GU7 A;  4U71 A;  1CHM A;  4IDY A;  4Z7M A;  5CDL A;  1QXW A;  3TB5 A;  2NQ6 A;  3FM3 A;  1JAW A;  3CB6 A;  3Q6D A;  2GGC A;  2EVO A;  2B3L A;  2GGB A;  2BHA A;  3S6B A;  1XNZ A;  5E2C A;  3BIT A;  3PKB A;  2OAZ A;  2BWY A;  5E5B A;  3MX6 A;  4FLI A;  4A6V A;  2G6P A;  3L7G A;  2BHD A;  4FO7 A;  2HOW A;  5JI6 A;  2BWX A;  1XGN A;  2P99 A;  2IW2 A;  3PN9 A;  3MR1 A;  4U6C A;  2GG7 A;  4U1B A;  2GG2 A;  3IL0 A;  2BN7 A;  2B3K A;  2EA2 A;  1WL9 A;  3I7M A;  4U69 A;  3BIQ A;  2ZSG A;  3QOC A;  3IU9 A;  4IKS A;  1R5H A;  2EVC A;  4IEC A;  3CTZ A;  4FLJ A;  5CLS A;  3PKE A;  4IPA A;  5CDE A;  1C27 A;  2DFI A;  3IU8 A;  3RVA A;  4ZWP A;  2ADU A;  5CDV A;  4HXX A;  4S01 A;  1WKM A;  4IU6 A;  5FCF A;  2BWT A;  1WLR A;  2EVM A;  1C23 A;  2GG8 A;  4U6E A;  4U6Z A;  1XGS A;  3D27 A;  2BB7 A;  1MAT A;  2B3H A;  2Q95 A;  4KM3 A;  3PKC A;  4ZWU A;  3CB5 A;  1KQ0 A;  3IU7 A;  3TAV A;  3BIP A;  4U76 A;  2BHC A;  4MAT A;  4FLK A;  4U75 A;  3ROR A;  4B28 A;  4RZY A;  5D6E A;  2GU4 A;  4FLL A;  1O0X A;  1B59 A;  1BN5 A;  1C22 A;  2V6C A;  2P9A A;  4IKT A;  2EA4 A;  2MAT A;  4EGE A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  1QZY A;  2GG5 A;  4IKU A;  1M35 A;  1R5G A;  1XGM A;  1N51 A;  2Q94 A;  4R60 A;  4S2T P;  2Q96 A;  4ZWO A;  2GG0 A;  1C24 A;  2V3X A;  2GG9 A;  4FO8 A;  2OKN A;  4FKC A;  2GG3 A;  4IF7 A;  1QXY A;  3PKA A;  4U6W A;  4A6W A;  5JFR A;  2Q93 A;  1WBQ A;  2BWW A;  3OOO A;  5CNX A;  3PEB A;  1BOA A;  2GU5 A;  3MAT A;  5CE6 A;  1YW7 A;  1W2M A;  3IG4 A;  1XGO A;  4OOK A;  4FUK A;  1WN1 A;  5D6F A;  1YW9 A;  4QR8 A;  4U70 A;  1QXZ A;  4JUQ A;  1KQ9 A;  3FMR A;  1YVM A;  4ZNG A;  2GZ5 A;  1R58 A;  3PKD A;  4IKR A;  2BWU A;  2GU6 A;  2BWS A;  2GA2 A;  4PNC A;  1W7V A;  2BWV A;  1Y1N A;  1C21 A;  2NQ7 A;  1B6A A;  3L24 A;  2P98 A;  2V3Y A;  3FMQ A;  4U73 A;  2V3Z A;  2Q92 A;  1A16 A;  5FCH A;  1YW8 A;  2Q8K A;  4U6J A;  1WY2 A;  4RZZ A;  4PV4 A;  1WL6 A;  4RGZ 1;  3OVK A;  4S00 A;  4S2R P;  5JHU A;  3O5V A;  1KP0 A;  2BH3 A;  1PV9 A;  5CIK A;  2GTX A;  2BHB A;  2GU7 A;  4U71 A;  1CHM A;  4IDY A;  4Z7M A;  5CDL A;  1QXW A;  3TB5 A;  2NQ6 A;  3FM3 A;  1JAW A;  3CB6 A;  3Q6D A;  2GGC A;  2EVO A;  2B3L A;  2GGB A;  2BHA A;  3S6B A;  1XNZ A;  5E2C A;  3BIT A;  3PKB A;  2OAZ A;  2BWY A;  5E5B A;  3MX6 A;  4FLI A;  4A6V A;  2G6P A;  3L7G A;  2BHD A;  4FO7 A;  2HOW A;  5JI6 A;  2BWX A;  1XGN A;  2P99 A;  2IW2 A;  3PN9 A;  3MR1 A;  4U6C A;  2GG7 A;  4U1B A;  2GG2 A;  3IL0 A;  2BN7 A;  2B3K A;  2EA2 A;  1WL9 A;  3I7M A;  4U69 A;  3BIQ A;  2ZSG A;  3QOC A;  3IU9 A;  4IKS A;  1R5H A;  2EVC A;  4IEC A;  3CTZ A;  4FLJ A;  5CLS A;  3PKE A;  4IPA A;  5CDE A;  1C27 A;  2DFI A;  3IU8 A;  3RVA A;  4ZWP A;  2ADU A;  5CDV A;  4HXX A;  4S01 A;  1WKM A;  4IU6 A;  5FCF A;  2BWT A;  1WLR A;  2EVM A;  1C23 A;  2GG8 A;  4U6E A;  4U6Z A;  1XGS A;  3D27 A;  2BB7 A;  1MAT A;  2B3H A;  2Q95 A;  4KM3 A;  3PKC A;  4ZWU A;  3CB5 A;  1KQ0 A;  3IU7 A;  3TAV A;  3BIP A;  4U76 A;  2BHC A;  4MAT A;  4FLK A;  4U75 A;  3ROR A;  4B28 A;  4RZY A;  5D6E A;  2GU4 A;  4FLL A;  1O0X A;  1B59 A;  1BN5 A;  1C22 A;  2V6C A;  2P9A A;  4IKT A;  2EA4 A;  2MAT A;  4EGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...