1WBQA

Znmg substituted aminopeptidase p from e. coli
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 154
structure length 439
sequence length 440
chains with identical sequence B, C, D
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wbqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wbqA02
4QR8A 2BN7A 2GG2A 4IKRA 1WL6A 5CDEA 2BHBA 5CIKA 2GTXA 4IKTA 5CNXA 1N51A 1WN1A 4U6ZA 3S6BA 2Q94A 2Q92A 1C23A 2B3LA 2GU5A 2EA2A 3PKDA 1PV9A 1A16A 1R5GA 1YW9A 3IU7A 2BWWA 3IU8A 2GU7A 4RGZ1 2GG0A 1KQ9A 5E2CA 1YVMA 4U76A 2ADUA 4MATA 5JFRA 2V3ZA 1MATA 3CB6A 2OKNA 3FM3A 3TAVA 2BWUA 3CTZA 3L7GA 3PN9A 3Q6DA 1W7VA 3MATA 3TB5A 2BB7A 4U1BA 3FMRA 3QOCA 3PKCA 3L24A 1YW7A 3PEBA 1YW8A 4U70A 2GA2A 1R5HA 4FKCA 2Q96A 4IKSA 5JI6A 2NQ7A 2BWTA 5CLSA 2BWSA 3MX6A 4IKUA 1KP0A 2B3KA 2EA4A 2BH3A 4S01A 2BHDA 4KM3A 1XGOA 2GG8A 5JHUA 1B6AA 2GG9A 2BHCA 2GU6A 2ZSGA 4FLJA 3BIQA 4PV4A 1BN5A 3PKEA 2BWVA 4R60A 1WKMA 2V3XA 4S00A 3RVAA 2Q8KA 4FLLA 4FLIA 4U75A 1R58A 3CB5A 3O5VA 4ZNGA 1WY2A 1XGSA 2GGCA 1XGNA 1QZYA 1M35A 2EVCA 4U6JA 1CHMA 1KQ0A 3BITA 1C24A 2V3YA 3BIPA 1C27A 2V6CA 4IECA 4ZWOA 4ZWUA 2B3HA 2Q93A 2BWXA 4U6WA 3IU9A 2MATA 4FUKA 4S2RP 2P9AA 1W2MA 1QXZA 5CDVA 2BWYA 3D27A 4IDYA 5FCHA 4EGEA 1JAWA 2NQ6A 4RZYA 2GU4A 5D6EA 1WL9A 2IW2A 2GG3A 3IL0A 2GZ5A 5CDLA 3I7MA 3FMQA 3PKBA 4ZWPA 1Y1NA 2DFIA 4IF7A 3PKAA 1QXWA 4JUQA 5CE6A 4S2TP 1C21A 4OOKA 4A6VA 5D6FA 3IG4A 2OAZA 1QXYA 3OOOA 4IU6A 2BHAA 2G6PA 4FO7A 4PNCA 4U6EA 2GG5A 2EVMA 3MR1A 1XGMA 4U69A 1O0XA 1XNZA 4HXXA 4U71A 4FLKA 1YJ3A 1WBQA 1C22A 5E5BA 4U6CA 2GG7A 2GGBA 2P99A 1WLRA 4U73A 1B59A 4B28A 2P98A 3OVKA 2EVOA 1BOAA 4FO8A 5FCFA 4A6WA 3RORA 4Z7MA 4IPAA 2HOWA 2Q95A 4RZZA
chains in the Genus database with same CATH superfamily
4QR8A 2BN7A 2GG2A 4IKRA 1WL6A 5CDEA 2BHBA 5CIKA 2GTXA 4IKTA 5CNXA 1N51A 1WN1A 4U6ZA 3S6BA 2Q94A 2Q92A 1C23A 2B3LA 2GU5A 2EA2A 3PKDA 1PV9A 1A16A 1R5GA 1YW9A 3IU7A 2BWWA 3IU8A 2GU7A 4RGZ1 2GG0A 1KQ9A 5E2CA 1YVMA 4U76A 2ADUA 4MATA 5JFRA 2V3ZA 1MATA 3CB6A 2OKNA 3FM3A 3TAVA 2BWUA 3CTZA 3L7GA 3PN9A 3Q6DA 1W7VA 3MATA 3TB5A 2BB7A 4U1BA 3FMRA 3QOCA 3PKCA 3L24A 1YW7A 3PEBA 1YW8A 4U70A 2GA2A 1R5HA 4FKCA 2Q96A 4IKSA 5JI6A 2NQ7A 2BWTA 5CLSA 2BWSA 3MX6A 4IKUA 1KP0A 2B3KA 2EA4A 2BH3A 4S01A 2BHDA 4KM3A 1XGOA 2GG8A 5JHUA 1B6AA 2GG9A 2BHCA 2GU6A 2ZSGA 4FLJA 3BIQA 4PV4A 1BN5A 3PKEA 2BWVA 4R60A 1WKMA 2V3XA 4S00A 3RVAA 2Q8KA 4FLLA 4FLIA 4U75A 1R58A 3CB5A 3O5VA 4ZNGA 1WY2A 1XGSA 2GGCA 1XGNA 1QZYA 1M35A 2EVCA 4U6JA 1CHMA 1KQ0A 3BITA 1C24A 2V3YA 3BIPA 1C27A 2V6CA 4IECA 4ZWOA 4ZWUA 2B3HA 2Q93A 2BWXA 4U6WA 3IU9A 2MATA 4FUKA 4S2RP 2P9AA 1W2MA 1QXZA 5CDVA 2BWYA 3D27A 4IDYA 5FCHA 4EGEA 1JAWA 2NQ6A 4RZYA 2GU4A 5D6EA 1WL9A 2IW2A 2GG3A 3IL0A 2GZ5A 5CDLA 3I7MA 3FMQA 3PKBA 4ZWPA 1Y1NA 2DFIA 4IF7A 3PKAA 1QXWA 4JUQA 5CE6A 4S2TP 1C21A 4OOKA 4A6VA 5D6FA 3IG4A 2OAZA 1QXYA 3OOOA 4IU6A 2BHAA 2G6PA 4FO7A 4PNCA 4U6EA 2GG5A 2EVMA 3MR1A 1XGMA 4U69A 1O0XA 1XNZA 4HXXA 4U71A 4FLKA 1YJ3A 1WBQA 1C22A 5E5BA 4U6CA 2GG7A 2GGBA 2P99A 1WLRA 4U73A 1B59A 4B28A 2P98A 3OVKA 2EVOA 1BOAA 4FO8A 5FCFA 4A6WA 3RORA 4Z7MA 4IPAA 2HOWA 2Q95A 4RZZA
chains in the Genus database with same CATH topology
4QR8A 2BN7A 2GG2A 4IKRA 1WL6A 5CDEA 2BHBA 5CIKA 2GTXA 4IKTA 5CNXA 1N51A 1WN1A 4U6ZA 3S6BA 2Q94A 2Q92A 1C23A 2B3LA 2GU5A 2EA2A 3PKDA 1PV9A 1A16A 1R5GA 1YW9A 3IU7A 2BWWA 3IU8A 2GU7A 4RGZ1 2GG0A 1KQ9A 5E2CA 1YVMA 4U76A 2ADUA 4MATA 5JFRA 2V3ZA 1MATA 3CB6A 2OKNA 3FM3A 3TAVA 2BWUA 3CTZA 3L7GA 3PN9A 3Q6DA 1W7VA 3MATA 3TB5A 2BB7A 4U1BA 3FMRA 3QOCA 3PKCA 3L24A 1YW7A 3PEBA 1YW8A 4U70A 2GA2A 1R5HA 4FKCA 2Q96A 4IKSA 5JI6A 2NQ7A 2BWTA 5CLSA 2BWSA 3MX6A 4IKUA 1KP0A 2B3KA 2EA4A 2BH3A 4S01A 2BHDA 4KM3A 1XGOA 2GG8A 5JHUA 1B6AA 2GG9A 2BHCA 2GU6A 2ZSGA 4FLJA 3BIQA 4PV4A 1BN5A 3PKEA 2BWVA 4R60A 1WKMA 2V3XA 4S00A 3RVAA 2Q8KA 4FLLA 4FLIA 4U75A 1R58A 3CB5A 3O5VA 4ZNGA 1WY2A 1XGSA 2GGCA 1XGNA 1QZYA 1M35A 2EVCA 4U6JA 1CHMA 1KQ0A 3BITA 1C24A 2V3YA 3BIPA 1C27A 2V6CA 4IECA 4ZWOA 4ZWUA 2B3HA 2Q93A 2BWXA 4U6WA 3IU9A 2MATA 4FUKA 4S2RP 2P9AA 1W2MA 1QXZA 5CDVA 2BWYA 3D27A 4IDYA 5FCHA 4EGEA 1JAWA 2NQ6A 4RZYA 2GU4A 5D6EA 1WL9A 2IW2A 2GG3A 3IL0A 2GZ5A 5CDLA 3I7MA 3FMQA 3PKBA 4ZWPA 1Y1NA 2DFIA 4IF7A 3PKAA 1QXWA 4JUQA 5CE6A 4S2TP 1C21A 4OOKA 4A6VA 5D6FA 3IG4A 2OAZA 1QXYA 3OOOA 4IU6A 2BHAA 2G6PA 4FO7A 4PNCA 4U6EA 2GG5A 2EVMA 3MR1A 1XGMA 4U69A 1O0XA 1XNZA 4HXXA 4U71A 4FLKA 1YJ3A 1WBQA 1C22A 5E5BA 4U6CA 2GG7A 2GGBA 2P99A 1WLRA 4U73A 1B59A 4B28A 2P98A 3OVKA 2EVOA 1BOAA 4FO8A 5FCFA 4A6WA 3RORA 4Z7MA 4IPAA 2HOWA 2Q95A 4RZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR8 A;  2BN7 A;  2GG2 A;  4IKR A;  1WL6 A;  5CDE A;  2BHB A;  5CIK A;  2GTX A;  4IKT A;  5CNX A;  1N51 A;  1WN1 A;  4U6Z A;  3S6B A;  2Q94 A;  2Q92 A;  1C23 A;  2B3L A;  2GU5 A;  2EA2 A;  3PKD A;  1PV9 A;  1A16 A;  1R5G A;  1YW9 A;  3IU7 A;  2BWW A;  3IU8 A;  2GU7 A;  4RGZ 1;  2GG0 A;  1KQ9 A;  5E2C A;  1YVM A;  4U76 A;  2ADU A;  4MAT A;  5JFR A;  2V3Z A;  1MAT A;  3CB6 A;  2OKN A;  3FM3 A;  3TAV A;  2BWU A;  3CTZ A;  3L7G A;  3PN9 A;  3Q6D A;  1W7V A;  3MAT A;  3TB5 A;  2BB7 A;  4U1B A;  3FMR A;  3QOC A;  3PKC A;  3L24 A;  1YW7 A;  3PEB A;  1YW8 A;  4U70 A;  2GA2 A;  1R5H A;  4FKC A;  2Q96 A;  4IKS A;  5JI6 A;  2NQ7 A;  2BWT A;  5CLS A;  2BWS A;  3MX6 A;  4IKU A;  1KP0 A;  2B3K A;  2EA4 A;  2BH3 A;  4S01 A;  2BHD A;  4KM3 A;  1XGO A;  2GG8 A;  5JHU A;  1B6A A;  2GG9 A;  2BHC A;  2GU6 A;  2ZSG A;  4FLJ A;  3BIQ A;  4PV4 A;  1BN5 A;  3PKE A;  2BWV A;  4R60 A;  1WKM A;  2V3X A;  4S00 A;  3RVA A;  2Q8K A;  4FLL A;  4FLI A;  4U75 A;  1R58 A;  3CB5 A;  3O5V A;  4ZNG A;  1WY2 A;  1XGS A;  2GGC A;  1XGN A;  1QZY A;  1M35 A;  2EVC A;  4U6J A;  1CHM A;  1KQ0 A;  3BIT A;  1C24 A;  2V3Y A;  3BIP A;  1C27 A;  2V6C A;  4IEC A;  4ZWO A;  4ZWU A;  2B3H A;  2Q93 A;  2BWX A;  4U6W A;  3IU9 A;  2MAT A;  4FUK A;  4S2R P;  2P9A A;  1W2M A;  1QXZ A;  5CDV A;  2BWY A;  3D27 A;  4IDY A;  5FCH A;  4EGE A;  1JAW A;  2NQ6 A;  4RZY A;  2GU4 A;  5D6E A;  1WL9 A;  2IW2 A;  2GG3 A;  3IL0 A;  2GZ5 A;  5CDL A;  3I7M A;  3FMQ A;  3PKB A;  4ZWP A;  1Y1N A;  2DFI A;  4IF7 A;  3PKA A;  1QXW A;  4JUQ A;  5CE6 A;  4S2T P;  1C21 A;  4OOK A;  4A6V A;  5D6F A;  3IG4 A;  2OAZ A;  1QXY A;  3OOO A;  4IU6 A;  2BHA A;  2G6P A;  4FO7 A;  4PNC A;  4U6E A;  2GG5 A;  2EVM A;  3MR1 A;  1XGM A;  4U69 A;  1O0X A;  1XNZ A;  4HXX A;  4U71 A;  4FLK A;  1YJ3 A;  1WBQ A;  1C22 A;  5E5B A;  4U6C A;  2GG7 A;  2GGB A;  2P99 A;  1WLR A;  4U73 A;  1B59 A;  4B28 A;  2P98 A;  3OVK A;  2EVO A;  1BOA A;  4FO8 A;  5FCF A;  4A6W A;  3ROR A;  4Z7M A;  4IPA A;  2HOW A;  2Q95 A;  4RZZ A; 
#chains in the Genus database with same CATH topology
 4QR8 A;  2BN7 A;  2GG2 A;  4IKR A;  1WL6 A;  5CDE A;  2BHB A;  5CIK A;  2GTX A;  4IKT A;  5CNX A;  1N51 A;  1WN1 A;  4U6Z A;  3S6B A;  2Q94 A;  2Q92 A;  1C23 A;  2B3L A;  2GU5 A;  2EA2 A;  3PKD A;  1PV9 A;  1A16 A;  1R5G A;  1YW9 A;  3IU7 A;  2BWW A;  3IU8 A;  2GU7 A;  4RGZ 1;  2GG0 A;  1KQ9 A;  5E2C A;  1YVM A;  4U76 A;  2ADU A;  4MAT A;  5JFR A;  2V3Z A;  1MAT A;  3CB6 A;  2OKN A;  3FM3 A;  3TAV A;  2BWU A;  3CTZ A;  3L7G A;  3PN9 A;  3Q6D A;  1W7V A;  3MAT A;  3TB5 A;  2BB7 A;  4U1B A;  3FMR A;  3QOC A;  3PKC A;  3L24 A;  1YW7 A;  3PEB A;  1YW8 A;  4U70 A;  2GA2 A;  1R5H A;  4FKC A;  2Q96 A;  4IKS A;  5JI6 A;  2NQ7 A;  2BWT A;  5CLS A;  2BWS A;  3MX6 A;  4IKU A;  1KP0 A;  2B3K A;  2EA4 A;  2BH3 A;  4S01 A;  2BHD A;  4KM3 A;  1XGO A;  2GG8 A;  5JHU A;  1B6A A;  2GG9 A;  2BHC A;  2GU6 A;  2ZSG A;  4FLJ A;  3BIQ A;  4PV4 A;  1BN5 A;  3PKE A;  2BWV A;  4R60 A;  1WKM A;  2V3X A;  4S00 A;  3RVA A;  2Q8K A;  4FLL A;  4FLI A;  4U75 A;  1R58 A;  3CB5 A;  3O5V A;  4ZNG A;  1WY2 A;  1XGS A;  2GGC A;  1XGN A;  1QZY A;  1M35 A;  2EVC A;  4U6J A;  1CHM A;  1KQ0 A;  3BIT A;  1C24 A;  2V3Y A;  3BIP A;  1C27 A;  2V6C A;  4IEC A;  4ZWO A;  4ZWU A;  2B3H A;  2Q93 A;  2BWX A;  4U6W A;  3IU9 A;  2MAT A;  4FUK A;  4S2R P;  2P9A A;  1W2M A;  1QXZ A;  5CDV A;  2BWY A;  3D27 A;  4IDY A;  5FCH A;  4EGE A;  1JAW A;  2NQ6 A;  4RZY A;  2GU4 A;  5D6E A;  1WL9 A;  2IW2 A;  2GG3 A;  3IL0 A;  2GZ5 A;  5CDL A;  3I7M A;  3FMQ A;  3PKB A;  4ZWP A;  1Y1N A;  2DFI A;  4IF7 A;  3PKA A;  1QXW A;  4JUQ A;  5CE6 A;  4S2T P;  1C21 A;  4OOK A;  4A6V A;  5D6F A;  3IG4 A;  2OAZ A;  1QXY A;  3OOO A;  4IU6 A;  2BHA A;  2G6P A;  4FO7 A;  4PNC A;  4U6E A;  2GG5 A;  2EVM A;  3MR1 A;  1XGM A;  4U69 A;  1O0X A;  1XNZ A;  4HXX A;  4U71 A;  4FLK A;  1YJ3 A;  1WBQ A;  1C22 A;  5E5B A;  4U6C A;  2GG7 A;  2GGB A;  2P99 A;  1WLR A;  4U73 A;  1B59 A;  4B28 A;  2P98 A;  3OVK A;  2EVO A;  1BOA A;  4FO8 A;  5FCF A;  4A6W A;  3ROR A;  4Z7M A;  4IPA A;  2HOW A;  2Q95 A;  4RZZ A; 
#chains in the Genus database with same CATH homology
 4QR8 A;  2BN7 A;  2GG2 A;  4IKR A;  1WL6 A;  5CDE A;  2BHB A;  5CIK A;  2GTX A;  4IKT A;  5CNX A;  1N51 A;  1WN1 A;  4U6Z A;  3S6B A;  2Q94 A;  2Q92 A;  1C23 A;  2B3L A;  2GU5 A;  2EA2 A;  3PKD A;  1PV9 A;  1A16 A;  1R5G A;  1YW9 A;  3IU7 A;  2BWW A;  3IU8 A;  2GU7 A;  4RGZ 1;  2GG0 A;  1KQ9 A;  5E2C A;  1YVM A;  4U76 A;  2ADU A;  4MAT A;  5JFR A;  2V3Z A;  1MAT A;  3CB6 A;  2OKN A;  3FM3 A;  3TAV A;  2BWU A;  3CTZ A;  3L7G A;  3PN9 A;  3Q6D A;  1W7V A;  3MAT A;  3TB5 A;  2BB7 A;  4U1B A;  3FMR A;  3QOC A;  3PKC A;  3L24 A;  1YW7 A;  3PEB A;  1YW8 A;  4U70 A;  2GA2 A;  1R5H A;  4FKC A;  2Q96 A;  4IKS A;  5JI6 A;  2NQ7 A;  2BWT A;  5CLS A;  2BWS A;  3MX6 A;  4IKU A;  1KP0 A;  2B3K A;  2EA4 A;  2BH3 A;  4S01 A;  2BHD A;  4KM3 A;  1XGO A;  2GG8 A;  5JHU A;  1B6A A;  2GG9 A;  2BHC A;  2GU6 A;  2ZSG A;  4FLJ A;  3BIQ A;  4PV4 A;  1BN5 A;  3PKE A;  2BWV A;  4R60 A;  1WKM A;  2V3X A;  4S00 A;  3RVA A;  2Q8K A;  4FLL A;  4FLI A;  4U75 A;  1R58 A;  3CB5 A;  3O5V A;  4ZNG A;  1WY2 A;  1XGS A;  2GGC A;  1XGN A;  1QZY A;  1M35 A;  2EVC A;  4U6J A;  1CHM A;  1KQ0 A;  3BIT A;  1C24 A;  2V3Y A;  3BIP A;  1C27 A;  2V6C A;  4IEC A;  4ZWO A;  4ZWU A;  2B3H A;  2Q93 A;  2BWX A;  4U6W A;  3IU9 A;  2MAT A;  4FUK A;  4S2R P;  2P9A A;  1W2M A;  1QXZ A;  5CDV A;  2BWY A;  3D27 A;  4IDY A;  5FCH A;  4EGE A;  1JAW A;  2NQ6 A;  4RZY A;  2GU4 A;  5D6E A;  1WL9 A;  2IW2 A;  2GG3 A;  3IL0 A;  2GZ5 A;  5CDL A;  3I7M A;  3FMQ A;  3PKB A;  4ZWP A;  1Y1N A;  2DFI A;  4IF7 A;  3PKA A;  1QXW A;  4JUQ A;  5CE6 A;  4S2T P;  1C21 A;  4OOK A;  4A6V A;  5D6F A;  3IG4 A;  2OAZ A;  1QXY A;  3OOO A;  4IU6 A;  2BHA A;  2G6P A;  4FO7 A;  4PNC A;  4U6E A;  2GG5 A;  2EVM A;  3MR1 A;  1XGM A;  4U69 A;  1O0X A;  1XNZ A;  4HXX A;  4U71 A;  4FLK A;  1YJ3 A;  1WBQ A;  1C22 A;  5E5B A;  4U6C A;  2GG7 A;  2GGB A;  2P99 A;  1WLR A;  4U73 A;  1B59 A;  4B28 A;  2P98 A;  3OVK A;  2EVO A;  1BOA A;  4FO8 A;  5FCF A;  4A6W A;  3ROR A;  4Z7M A;  4IPA A;  2HOW A;  2Q95 A;  4RZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...