1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
molecule tags Proline peptidase
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
2G6PA 4FKCA 1QXZA 2BHCA 4U71A 4IKTA 2P9AA 2BWXA 4FO8A 2V3YA 2BWWA 2BHDA 1QXYA 2B3LA 4RZYA 2GA2A 1XGMA 3IL0A 1YVMA 4FLLA 4R60A 4OOKA 1B6AA 5CNXA 2BN7A 3RORA 3TB5A 1C24A 4U73A 3BITA 5JHUA 1B59A 2V3XA 3O5VA 3IU7A 1W7VA 4IPAA 1MATA 2EA2A 1WL6A 3IU8A 2P99A 2BWVA 3IG4A 2GG7A 4S01A 3PKBA 2GG3A 4FLIA 4U6CA 2GG0A 3MR1A 2V6CA 5JI6A 3PKEA 2Q92A 2GG9A 5CDLA 4A6VA 3OVKA 4S2RP 3BIQA 5FCHA 3L7GA 2IW2A 4U69A 2B3HA 1N51A 3IU9A 4B28A 3PKAA 4MATA 3Q6DA 5FCFA 4IF7A 5CDVA 1WL9A 2HOWA 2GU5A 1R5HA 3FMQA 3L24A 3S6BA 4FLKA 2GU4A 4PNCA 4FUKA 1Y1NA 4U6EA 2BWSA 2ZSGA 1R5GA 2BWUA 1QZYA 2EVMA 2GGBA 2MATA 2Q96A 4IDYA 1C27A 4U76A 4U6ZA 3PKCA 2OKNA 2GTXA 4ZWPA 1YJ3A 4U6WA 1BN5A 2ADUA 2BHAA 4U6JA 3CTZA 2GU7A 2OAZA 2BH3A 3OOOA 3FM3A 4U70A 3PKDA 2P98A 1C22A 1KQ0A 4U1BA 4RZZA 3BIPA 2DFIA 5CLSA 3CB6A 3PEBA 1M35A 4S2TP 4FLJA 2BWTA 4ZWUA 1WN1A 4IKUA 4A6WA 3MX6A 2GZ5A 5E2CA 2BHBA 4HXXA 3I7MA 3D27A 3PN9A 2EVCA 4S00A 4IECA 1A16A 3MATA 4Z7MA 2Q93A 1XGOA 1BOAA 1KQ9A 1YW8A 3FMRA 1PV9A 2GG8A 1WKMA 4ZWOA 1XGNA 4IKSA 1JAWA 1C23A 2BB7A 2Q94A 5D6FA 2V3ZA 3CB5A 1YW9A 3TAVA 1CHMA 4IU6A 1O0XA 2GU6A 4PV4A 1R58A 5D6EA 3QOCA 1QXWA 2Q95A 5CIKA 4ZNGA 2GG5A 4QR8A 2Q8KA 5CE6A 4KM3A 4U75A 2NQ6A 2BWYA 4FO7A 2GGCA 2GG2A 1KP0A 4EGEA 5CDEA 2NQ7A 2EA4A 1WBQA 1WLRA 1XNZA 1YW7A 5JFRA 1C21A 2EVOA 1W2MA 4JUQA 4RGZ1 1XGSA 1WY2A 2B3KA 5E5BA 3RVAA 4IKRA
chains in the Genus database with same CATH superfamily
2G6PA 4FKCA 1QXZA 2BHCA 4U71A 4IKTA 2P9AA 2BWXA 4FO8A 2V3YA 2BWWA 2BHDA 1QXYA 2B3LA 4RZYA 2GA2A 1XGMA 3IL0A 1YVMA 4FLLA 4R60A 4OOKA 1B6AA 5CNXA 2BN7A 3RORA 3TB5A 1C24A 4U73A 3BITA 5JHUA 1B59A 2V3XA 3O5VA 3IU7A 1W7VA 4IPAA 1MATA 2EA2A 1WL6A 3IU8A 2P99A 2BWVA 3IG4A 2GG7A 4S01A 3PKBA 2GG3A 4FLIA 4U6CA 2GG0A 3MR1A 2V6CA 5JI6A 3PKEA 2Q92A 2GG9A 5CDLA 4A6VA 3OVKA 4S2RP 3BIQA 5FCHA 3L7GA 2IW2A 4U69A 2B3HA 1N51A 3IU9A 4B28A 3PKAA 4MATA 3Q6DA 5FCFA 4IF7A 5CDVA 1WL9A 2HOWA 2GU5A 1R5HA 3FMQA 3L24A 3S6BA 4FLKA 2GU4A 4PNCA 4FUKA 1Y1NA 4U6EA 2BWSA 2ZSGA 1R5GA 2BWUA 1QZYA 2EVMA 2GGBA 2MATA 2Q96A 4IDYA 1C27A 4U76A 4U6ZA 3PKCA 2OKNA 2GTXA 4ZWPA 1YJ3A 4U6WA 1BN5A 2ADUA 2BHAA 4U6JA 3CTZA 2GU7A 2OAZA 2BH3A 3OOOA 3FM3A 4U70A 3PKDA 2P98A 1C22A 1KQ0A 4U1BA 4RZZA 3BIPA 2DFIA 5CLSA 3CB6A 3PEBA 1M35A 4S2TP 4FLJA 2BWTA 4ZWUA 1WN1A 4IKUA 4A6WA 3MX6A 2GZ5A 5E2CA 2BHBA 4HXXA 3I7MA 3D27A 3PN9A 2EVCA 4S00A 4IECA 1A16A 3MATA 4Z7MA 2Q93A 1XGOA 1BOAA 1KQ9A 1YW8A 3FMRA 1PV9A 2GG8A 1WKMA 4ZWOA 1XGNA 4IKSA 1JAWA 1C23A 2BB7A 2Q94A 5D6FA 2V3ZA 3CB5A 1YW9A 3TAVA 1CHMA 4IU6A 1O0XA 2GU6A 4PV4A 1R58A 5D6EA 3QOCA 1QXWA 2Q95A 5CIKA 4ZNGA 2GG5A 4QR8A 2Q8KA 5CE6A 4KM3A 4U75A 2NQ6A 2BWYA 4FO7A 2GGCA 2GG2A 1KP0A 4EGEA 5CDEA 2NQ7A 2EA4A 1WBQA 1WLRA 1XNZA 1YW7A 5JFRA 1C21A 2EVOA 1W2MA 4JUQA 4RGZ1 1XGSA 1WY2A 2B3KA 5E5BA 3RVAA 4IKRA
chains in the Genus database with same CATH topology
2G6PA 4FKCA 1QXZA 2BHCA 4U71A 4IKTA 2P9AA 2BWXA 4FO8A 2V3YA 2BWWA 2BHDA 1QXYA 2B3LA 4RZYA 2GA2A 1XGMA 3IL0A 1YVMA 4FLLA 4R60A 4OOKA 1B6AA 5CNXA 2BN7A 3RORA 3TB5A 1C24A 4U73A 3BITA 5JHUA 1B59A 2V3XA 3O5VA 3IU7A 1W7VA 4IPAA 1MATA 2EA2A 1WL6A 3IU8A 2P99A 2BWVA 3IG4A 2GG7A 4S01A 3PKBA 2GG3A 4FLIA 4U6CA 2GG0A 3MR1A 2V6CA 5JI6A 3PKEA 2Q92A 2GG9A 5CDLA 4A6VA 3OVKA 4S2RP 3BIQA 5FCHA 3L7GA 2IW2A 4U69A 2B3HA 1N51A 3IU9A 4B28A 3PKAA 4MATA 3Q6DA 5FCFA 4IF7A 5CDVA 1WL9A 2HOWA 2GU5A 1R5HA 3FMQA 3L24A 3S6BA 4FLKA 2GU4A 4PNCA 4FUKA 1Y1NA 4U6EA 2BWSA 2ZSGA 1R5GA 2BWUA 1QZYA 2EVMA 2GGBA 2MATA 2Q96A 4IDYA 1C27A 4U76A 4U6ZA 3PKCA 2OKNA 2GTXA 4ZWPA 1YJ3A 4U6WA 1BN5A 2ADUA 2BHAA 4U6JA 3CTZA 2GU7A 2OAZA 2BH3A 3OOOA 3FM3A 4U70A 3PKDA 2P98A 1C22A 1KQ0A 4U1BA 4RZZA 3BIPA 2DFIA 5CLSA 3CB6A 3PEBA 1M35A 4S2TP 4FLJA 2BWTA 4ZWUA 1WN1A 4IKUA 4A6WA 3MX6A 2GZ5A 5E2CA 2BHBA 4HXXA 3I7MA 3D27A 3PN9A 2EVCA 4S00A 4IECA 1A16A 3MATA 4Z7MA 2Q93A 1XGOA 1BOAA 1KQ9A 1YW8A 3FMRA 1PV9A 2GG8A 1WKMA 4ZWOA 1XGNA 4IKSA 1JAWA 1C23A 2BB7A 2Q94A 5D6FA 2V3ZA 3CB5A 1YW9A 3TAVA 1CHMA 4IU6A 1O0XA 2GU6A 4PV4A 1R58A 5D6EA 3QOCA 1QXWA 2Q95A 5CIKA 4ZNGA 2GG5A 4QR8A 2Q8KA 5CE6A 4KM3A 4U75A 2NQ6A 2BWYA 4FO7A 2GGCA 2GG2A 1KP0A 4EGEA 5CDEA 2NQ7A 2EA4A 1WBQA 1WLRA 1XNZA 1YW7A 5JFRA 1C21A 2EVOA 1W2MA 4JUQA 4RGZ1 1XGSA 1WY2A 2B3KA 5E5BA 3RVAA 4IKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6P A;  4FKC A;  1QXZ A;  2BHC A;  4U71 A;  4IKT A;  2P9A A;  2BWX A;  4FO8 A;  2V3Y A;  2BWW A;  2BHD A;  1QXY A;  2B3L A;  4RZY A;  2GA2 A;  1XGM A;  3IL0 A;  1YVM A;  4FLL A;  4R60 A;  4OOK A;  1B6A A;  5CNX A;  2BN7 A;  3ROR A;  3TB5 A;  1C24 A;  4U73 A;  3BIT A;  5JHU A;  1B59 A;  2V3X A;  3O5V A;  3IU7 A;  1W7V A;  4IPA A;  1MAT A;  2EA2 A;  1WL6 A;  3IU8 A;  2P99 A;  2BWV A;  3IG4 A;  2GG7 A;  4S01 A;  3PKB A;  2GG3 A;  4FLI A;  4U6C A;  2GG0 A;  3MR1 A;  2V6C A;  5JI6 A;  3PKE A;  2Q92 A;  2GG9 A;  5CDL A;  4A6V A;  3OVK A;  4S2R P;  3BIQ A;  5FCH A;  3L7G A;  2IW2 A;  4U69 A;  2B3H A;  1N51 A;  3IU9 A;  4B28 A;  3PKA A;  4MAT A;  3Q6D A;  5FCF A;  4IF7 A;  5CDV A;  1WL9 A;  2HOW A;  2GU5 A;  1R5H A;  3FMQ A;  3L24 A;  3S6B A;  4FLK A;  2GU4 A;  4PNC A;  4FUK A;  1Y1N A;  4U6E A;  2BWS A;  2ZSG A;  1R5G A;  2BWU A;  1QZY A;  2EVM A;  2GGB A;  2MAT A;  2Q96 A;  4IDY A;  1C27 A;  4U76 A;  4U6Z A;  3PKC A;  2OKN A;  2GTX A;  4ZWP A;  1YJ3 A;  4U6W A;  1BN5 A;  2ADU A;  2BHA A;  4U6J A;  3CTZ A;  2GU7 A;  2OAZ A;  2BH3 A;  3OOO A;  3FM3 A;  4U70 A;  3PKD A;  2P98 A;  1C22 A;  1KQ0 A;  4U1B A;  4RZZ A;  3BIP A;  2DFI A;  5CLS A;  3CB6 A;  3PEB A;  1M35 A;  4S2T P;  4FLJ A;  2BWT A;  4ZWU A;  1WN1 A;  4IKU A;  4A6W A;  3MX6 A;  2GZ5 A;  5E2C A;  2BHB A;  4HXX A;  3I7M A;  3D27 A;  3PN9 A;  2EVC A;  4S00 A;  4IEC A;  1A16 A;  3MAT A;  4Z7M A;  2Q93 A;  1XGO A;  1BOA A;  1KQ9 A;  1YW8 A;  3FMR A;  1PV9 A;  2GG8 A;  1WKM A;  4ZWO A;  1XGN A;  4IKS A;  1JAW A;  1C23 A;  2BB7 A;  2Q94 A;  5D6F A;  2V3Z A;  3CB5 A;  1YW9 A;  3TAV A;  1CHM A;  4IU6 A;  1O0X A;  2GU6 A;  4PV4 A;  1R58 A;  5D6E A;  3QOC A;  1QXW A;  2Q95 A;  5CIK A;  4ZNG A;  2GG5 A;  4QR8 A;  2Q8K A;  5CE6 A;  4KM3 A;  4U75 A;  2NQ6 A;  2BWY A;  4FO7 A;  2GGC A;  2GG2 A;  1KP0 A;  4EGE A;  5CDE A;  2NQ7 A;  2EA4 A;  1WBQ A;  1WLR A;  1XNZ A;  1YW7 A;  5JFR A;  1C21 A;  2EVO A;  1W2M A;  4JUQ A;  4RGZ 1;  1XGS A;  1WY2 A;  2B3K A;  5E5B A;  3RVA A;  4IKR A; 
#chains in the Genus database with same CATH topology
 2G6P A;  4FKC A;  1QXZ A;  2BHC A;  4U71 A;  4IKT A;  2P9A A;  2BWX A;  4FO8 A;  2V3Y A;  2BWW A;  2BHD A;  1QXY A;  2B3L A;  4RZY A;  2GA2 A;  1XGM A;  3IL0 A;  1YVM A;  4FLL A;  4R60 A;  4OOK A;  1B6A A;  5CNX A;  2BN7 A;  3ROR A;  3TB5 A;  1C24 A;  4U73 A;  3BIT A;  5JHU A;  1B59 A;  2V3X A;  3O5V A;  3IU7 A;  1W7V A;  4IPA A;  1MAT A;  2EA2 A;  1WL6 A;  3IU8 A;  2P99 A;  2BWV A;  3IG4 A;  2GG7 A;  4S01 A;  3PKB A;  2GG3 A;  4FLI A;  4U6C A;  2GG0 A;  3MR1 A;  2V6C A;  5JI6 A;  3PKE A;  2Q92 A;  2GG9 A;  5CDL A;  4A6V A;  3OVK A;  4S2R P;  3BIQ A;  5FCH A;  3L7G A;  2IW2 A;  4U69 A;  2B3H A;  1N51 A;  3IU9 A;  4B28 A;  3PKA A;  4MAT A;  3Q6D A;  5FCF A;  4IF7 A;  5CDV A;  1WL9 A;  2HOW A;  2GU5 A;  1R5H A;  3FMQ A;  3L24 A;  3S6B A;  4FLK A;  2GU4 A;  4PNC A;  4FUK A;  1Y1N A;  4U6E A;  2BWS A;  2ZSG A;  1R5G A;  2BWU A;  1QZY A;  2EVM A;  2GGB A;  2MAT A;  2Q96 A;  4IDY A;  1C27 A;  4U76 A;  4U6Z A;  3PKC A;  2OKN A;  2GTX A;  4ZWP A;  1YJ3 A;  4U6W A;  1BN5 A;  2ADU A;  2BHA A;  4U6J A;  3CTZ A;  2GU7 A;  2OAZ A;  2BH3 A;  3OOO A;  3FM3 A;  4U70 A;  3PKD A;  2P98 A;  1C22 A;  1KQ0 A;  4U1B A;  4RZZ A;  3BIP A;  2DFI A;  5CLS A;  3CB6 A;  3PEB A;  1M35 A;  4S2T P;  4FLJ A;  2BWT A;  4ZWU A;  1WN1 A;  4IKU A;  4A6W A;  3MX6 A;  2GZ5 A;  5E2C A;  2BHB A;  4HXX A;  3I7M A;  3D27 A;  3PN9 A;  2EVC A;  4S00 A;  4IEC A;  1A16 A;  3MAT A;  4Z7M A;  2Q93 A;  1XGO A;  1BOA A;  1KQ9 A;  1YW8 A;  3FMR A;  1PV9 A;  2GG8 A;  1WKM A;  4ZWO A;  1XGN A;  4IKS A;  1JAW A;  1C23 A;  2BB7 A;  2Q94 A;  5D6F A;  2V3Z A;  3CB5 A;  1YW9 A;  3TAV A;  1CHM A;  4IU6 A;  1O0X A;  2GU6 A;  4PV4 A;  1R58 A;  5D6E A;  3QOC A;  1QXW A;  2Q95 A;  5CIK A;  4ZNG A;  2GG5 A;  4QR8 A;  2Q8K A;  5CE6 A;  4KM3 A;  4U75 A;  2NQ6 A;  2BWY A;  4FO7 A;  2GGC A;  2GG2 A;  1KP0 A;  4EGE A;  5CDE A;  2NQ7 A;  2EA4 A;  1WBQ A;  1WLR A;  1XNZ A;  1YW7 A;  5JFR A;  1C21 A;  2EVO A;  1W2M A;  4JUQ A;  4RGZ 1;  1XGS A;  1WY2 A;  2B3K A;  5E5B A;  3RVA A;  4IKR A; 
#chains in the Genus database with same CATH homology
 2G6P A;  4FKC A;  1QXZ A;  2BHC A;  4U71 A;  4IKT A;  2P9A A;  2BWX A;  4FO8 A;  2V3Y A;  2BWW A;  2BHD A;  1QXY A;  2B3L A;  4RZY A;  2GA2 A;  1XGM A;  3IL0 A;  1YVM A;  4FLL A;  4R60 A;  4OOK A;  1B6A A;  5CNX A;  2BN7 A;  3ROR A;  3TB5 A;  1C24 A;  4U73 A;  3BIT A;  5JHU A;  1B59 A;  2V3X A;  3O5V A;  3IU7 A;  1W7V A;  4IPA A;  1MAT A;  2EA2 A;  1WL6 A;  3IU8 A;  2P99 A;  2BWV A;  3IG4 A;  2GG7 A;  4S01 A;  3PKB A;  2GG3 A;  4FLI A;  4U6C A;  2GG0 A;  3MR1 A;  2V6C A;  5JI6 A;  3PKE A;  2Q92 A;  2GG9 A;  5CDL A;  4A6V A;  3OVK A;  4S2R P;  3BIQ A;  5FCH A;  3L7G A;  2IW2 A;  4U69 A;  2B3H A;  1N51 A;  3IU9 A;  4B28 A;  3PKA A;  4MAT A;  3Q6D A;  5FCF A;  4IF7 A;  5CDV A;  1WL9 A;  2HOW A;  2GU5 A;  1R5H A;  3FMQ A;  3L24 A;  3S6B A;  4FLK A;  2GU4 A;  4PNC A;  4FUK A;  1Y1N A;  4U6E A;  2BWS A;  2ZSG A;  1R5G A;  2BWU A;  1QZY A;  2EVM A;  2GGB A;  2MAT A;  2Q96 A;  4IDY A;  1C27 A;  4U76 A;  4U6Z A;  3PKC A;  2OKN A;  2GTX A;  4ZWP A;  1YJ3 A;  4U6W A;  1BN5 A;  2ADU A;  2BHA A;  4U6J A;  3CTZ A;  2GU7 A;  2OAZ A;  2BH3 A;  3OOO A;  3FM3 A;  4U70 A;  3PKD A;  2P98 A;  1C22 A;  1KQ0 A;  4U1B A;  4RZZ A;  3BIP A;  2DFI A;  5CLS A;  3CB6 A;  3PEB A;  1M35 A;  4S2T P;  4FLJ A;  2BWT A;  4ZWU A;  1WN1 A;  4IKU A;  4A6W A;  3MX6 A;  2GZ5 A;  5E2C A;  2BHB A;  4HXX A;  3I7M A;  3D27 A;  3PN9 A;  2EVC A;  4S00 A;  4IEC A;  1A16 A;  3MAT A;  4Z7M A;  2Q93 A;  1XGO A;  1BOA A;  1KQ9 A;  1YW8 A;  3FMR A;  1PV9 A;  2GG8 A;  1WKM A;  4ZWO A;  1XGN A;  4IKS A;  1JAW A;  1C23 A;  2BB7 A;  2Q94 A;  5D6F A;  2V3Z A;  3CB5 A;  1YW9 A;  3TAV A;  1CHM A;  4IU6 A;  1O0X A;  2GU6 A;  4PV4 A;  1R58 A;  5D6E A;  3QOC A;  1QXW A;  2Q95 A;  5CIK A;  4ZNG A;  2GG5 A;  4QR8 A;  2Q8K A;  5CE6 A;  4KM3 A;  4U75 A;  2NQ6 A;  2BWY A;  4FO7 A;  2GGC A;  2GG2 A;  1KP0 A;  4EGE A;  5CDE A;  2NQ7 A;  2EA4 A;  1WBQ A;  1WLR A;  1XNZ A;  1YW7 A;  5JFR A;  1C21 A;  2EVO A;  1W2M A;  4JUQ A;  4RGZ 1;  1XGS A;  1WY2 A;  2B3K A;  5E5B A;  3RVA A;  4IKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...