1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Proline peptidase
molecule keywords AMINOPEPTIDASE P
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
1KP0A 2GU7A 1M35A 4HXXA 2GG3A 4RGZ1 5JFRA 4R60A 4S2TP 2IW2A 1R5GA 5FCHA 1WL6A 2B3LA 5CNXA 2Q94A 1C23A 4U76A 1WBQA 3S6BA 2GTXA 2V3XA 3OOOA 2Q96A 2V3YA 4U6JA 3L24A 2V6CA 2GG2A 3PKEA 2GG8A 4IECA 2GZ5A 1PV9A 4MATA 4U1BA 3MATA 3OVKA 1CHMA 2ZSGA 1YW8A 4A6VA 1C22A 2BHBA 5CE6A 2EVMA 2BWWA 4JUQA 1BN5A 4FLLA 5CDEA 1C24A 4KM3A 1YVMA 2EVOA 3IG4A 3FMRA 4IU6A 1R5HA 1XGMA 2EA2A 2DFIA 2BHCA 2OKNA 3L7GA 2P99A 4RZYA 5CDLA 2HOWA 1YJ3A 3PKDA 3Q6DA 4PNCA 4ZWUA 3PKCA 2GG5A 2GG7A 1WL9A 4ZNGA 2GU5A 1QXZA 1C27A 3RORA 2V3ZA 2B3KA 1WY2A 3D27A 1N51A 4FO8A 4PV4A 4IKUA 4IF7A 4U6EA 4A6WA 5JI6A 4U75A 2BWSA 4U69A 2EA4A 3FMQA 4U6WA 2Q92A 2BN7A 3IU9A 2BHDA 2B3HA 4S2RP 3PKAA 4OOKA 4S00A 5CLSA 3QOCA 1JAWA 4B28A 1XGNA 4U6CA 4FLKA 4U6ZA 3BIPA 3TAVA 2P9AA 2BWYA 1MATA 4IKRA 3I7MA 4U70A 5D6FA 4ZWPA 3FM3A 2BHAA 1WKMA 1XNZA 1W7VA 2GGBA 4RZZA 5JHUA 3BITA 3PEBA 5E5BA 3IU8A 3O5VA 1XGOA 4IPAA 1WN1A 2GU6A 2EVCA 3CB6A 1W2MA 3PN9A 2P98A 4FLIA 4ZWOA 3BIQA 1BOAA 2GU4A 5D6EA 2Q8KA 2GG9A 3IU7A 3RVAA 1WLRA 4U73A 3IL0A 4FKCA 1KQ0A 1R58A 2BWVA 2BB7A 2G6PA 2GG0A 3MX6A 2Q95A 4IKSA 3CTZA 4QR8A 3MR1A 4FUKA 4Z7MA 4FO7A 2BWXA 2BWTA 1KQ9A 1YW7A 1QZYA 3TB5A 1QXYA 2NQ6A 3CB5A 4EGEA 1B6AA 1QXWA 4IKTA 3PKBA 5CIKA 1XGSA 2Q93A 5E2CA 2ADUA 2NQ7A 5FCFA 2MATA 4IDYA 1B59A 1A16A 2OAZA 5CDVA 1C21A 2BH3A 1Y1NA 4FLJA 4U71A 4S01A 2GA2A 2BWUA 1YW9A 1O0XA 2GGCA
chains in the Genus database with same CATH superfamily
1KP0A 2GU7A 1M35A 4HXXA 2GG3A 4RGZ1 5JFRA 4R60A 4S2TP 2IW2A 1R5GA 5FCHA 1WL6A 2B3LA 5CNXA 2Q94A 1C23A 4U76A 1WBQA 3S6BA 2GTXA 2V3XA 3OOOA 2Q96A 2V3YA 4U6JA 3L24A 2V6CA 2GG2A 3PKEA 2GG8A 4IECA 2GZ5A 1PV9A 4MATA 4U1BA 3MATA 3OVKA 1CHMA 2ZSGA 1YW8A 4A6VA 1C22A 2BHBA 5CE6A 2EVMA 2BWWA 4JUQA 1BN5A 4FLLA 5CDEA 1C24A 4KM3A 1YVMA 2EVOA 3IG4A 3FMRA 4IU6A 1R5HA 1XGMA 2EA2A 2DFIA 2BHCA 2OKNA 3L7GA 2P99A 4RZYA 5CDLA 2HOWA 1YJ3A 3PKDA 3Q6DA 4PNCA 4ZWUA 3PKCA 2GG5A 2GG7A 1WL9A 4ZNGA 2GU5A 1QXZA 1C27A 3RORA 2V3ZA 2B3KA 1WY2A 3D27A 1N51A 4FO8A 4PV4A 4IKUA 4IF7A 4U6EA 4A6WA 5JI6A 4U75A 2BWSA 4U69A 2EA4A 3FMQA 4U6WA 2Q92A 2BN7A 3IU9A 2BHDA 2B3HA 4S2RP 3PKAA 4OOKA 4S00A 5CLSA 3QOCA 1JAWA 4B28A 1XGNA 4U6CA 4FLKA 4U6ZA 3BIPA 3TAVA 2P9AA 2BWYA 1MATA 4IKRA 3I7MA 4U70A 5D6FA 4ZWPA 3FM3A 2BHAA 1WKMA 1XNZA 1W7VA 2GGBA 4RZZA 5JHUA 3BITA 3PEBA 5E5BA 3IU8A 3O5VA 1XGOA 4IPAA 1WN1A 2GU6A 2EVCA 3CB6A 1W2MA 3PN9A 2P98A 4FLIA 4ZWOA 3BIQA 1BOAA 2GU4A 5D6EA 2Q8KA 2GG9A 3IU7A 3RVAA 1WLRA 4U73A 3IL0A 4FKCA 1KQ0A 1R58A 2BWVA 2BB7A 2G6PA 2GG0A 3MX6A 2Q95A 4IKSA 3CTZA 4QR8A 3MR1A 4FUKA 4Z7MA 4FO7A 2BWXA 2BWTA 1KQ9A 1YW7A 1QZYA 3TB5A 1QXYA 2NQ6A 3CB5A 4EGEA 1B6AA 1QXWA 4IKTA 3PKBA 5CIKA 1XGSA 2Q93A 5E2CA 2ADUA 2NQ7A 5FCFA 2MATA 4IDYA 1B59A 1A16A 2OAZA 5CDVA 1C21A 2BH3A 1Y1NA 4FLJA 4U71A 4S01A 2GA2A 2BWUA 1YW9A 1O0XA 2GGCA
chains in the Genus database with same CATH topology
1KP0A 2GU7A 1M35A 4HXXA 2GG3A 4RGZ1 5JFRA 4R60A 4S2TP 2IW2A 1R5GA 5FCHA 1WL6A 2B3LA 5CNXA 2Q94A 1C23A 4U76A 1WBQA 3S6BA 2GTXA 2V3XA 3OOOA 2Q96A 2V3YA 4U6JA 3L24A 2V6CA 2GG2A 3PKEA 2GG8A 4IECA 2GZ5A 1PV9A 4MATA 4U1BA 3MATA 3OVKA 1CHMA 2ZSGA 1YW8A 4A6VA 1C22A 2BHBA 5CE6A 2EVMA 2BWWA 4JUQA 1BN5A 4FLLA 5CDEA 1C24A 4KM3A 1YVMA 2EVOA 3IG4A 3FMRA 4IU6A 1R5HA 1XGMA 2EA2A 2DFIA 2BHCA 2OKNA 3L7GA 2P99A 4RZYA 5CDLA 2HOWA 1YJ3A 3PKDA 3Q6DA 4PNCA 4ZWUA 3PKCA 2GG5A 2GG7A 1WL9A 4ZNGA 2GU5A 1QXZA 1C27A 3RORA 2V3ZA 2B3KA 1WY2A 3D27A 1N51A 4FO8A 4PV4A 4IKUA 4IF7A 4U6EA 4A6WA 5JI6A 4U75A 2BWSA 4U69A 2EA4A 3FMQA 4U6WA 2Q92A 2BN7A 3IU9A 2BHDA 2B3HA 4S2RP 3PKAA 4OOKA 4S00A 5CLSA 3QOCA 1JAWA 4B28A 1XGNA 4U6CA 4FLKA 4U6ZA 3BIPA 3TAVA 2P9AA 2BWYA 1MATA 4IKRA 3I7MA 4U70A 5D6FA 4ZWPA 3FM3A 2BHAA 1WKMA 1XNZA 1W7VA 2GGBA 4RZZA 5JHUA 3BITA 3PEBA 5E5BA 3IU8A 3O5VA 1XGOA 4IPAA 1WN1A 2GU6A 2EVCA 3CB6A 1W2MA 3PN9A 2P98A 4FLIA 4ZWOA 3BIQA 1BOAA 2GU4A 5D6EA 2Q8KA 2GG9A 3IU7A 3RVAA 1WLRA 4U73A 3IL0A 4FKCA 1KQ0A 1R58A 2BWVA 2BB7A 2G6PA 2GG0A 3MX6A 2Q95A 4IKSA 3CTZA 4QR8A 3MR1A 4FUKA 4Z7MA 4FO7A 2BWXA 2BWTA 1KQ9A 1YW7A 1QZYA 3TB5A 1QXYA 2NQ6A 3CB5A 4EGEA 1B6AA 1QXWA 4IKTA 3PKBA 5CIKA 1XGSA 2Q93A 5E2CA 2ADUA 2NQ7A 5FCFA 2MATA 4IDYA 1B59A 1A16A 2OAZA 5CDVA 1C21A 2BH3A 1Y1NA 4FLJA 4U71A 4S01A 2GA2A 2BWUA 1YW9A 1O0XA 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP0 A;  2GU7 A;  1M35 A;  4HXX A;  2GG3 A;  4RGZ 1;  5JFR A;  4R60 A;  4S2T P;  2IW2 A;  1R5G A;  5FCH A;  1WL6 A;  2B3L A;  5CNX A;  2Q94 A;  1C23 A;  4U76 A;  1WBQ A;  3S6B A;  2GTX A;  2V3X A;  3OOO A;  2Q96 A;  2V3Y A;  4U6J A;  3L24 A;  2V6C A;  2GG2 A;  3PKE A;  2GG8 A;  4IEC A;  2GZ5 A;  1PV9 A;  4MAT A;  4U1B A;  3MAT A;  3OVK A;  1CHM A;  2ZSG A;  1YW8 A;  4A6V A;  1C22 A;  2BHB A;  5CE6 A;  2EVM A;  2BWW A;  4JUQ A;  1BN5 A;  4FLL A;  5CDE A;  1C24 A;  4KM3 A;  1YVM A;  2EVO A;  3IG4 A;  3FMR A;  4IU6 A;  1R5H A;  1XGM A;  2EA2 A;  2DFI A;  2BHC A;  2OKN A;  3L7G A;  2P99 A;  4RZY A;  5CDL A;  2HOW A;  1YJ3 A;  3PKD A;  3Q6D A;  4PNC A;  4ZWU A;  3PKC A;  2GG5 A;  2GG7 A;  1WL9 A;  4ZNG A;  2GU5 A;  1QXZ A;  1C27 A;  3ROR A;  2V3Z A;  2B3K A;  1WY2 A;  3D27 A;  1N51 A;  4FO8 A;  4PV4 A;  4IKU A;  4IF7 A;  4U6E A;  4A6W A;  5JI6 A;  4U75 A;  2BWS A;  4U69 A;  2EA4 A;  3FMQ A;  4U6W A;  2Q92 A;  2BN7 A;  3IU9 A;  2BHD A;  2B3H A;  4S2R P;  3PKA A;  4OOK A;  4S00 A;  5CLS A;  3QOC A;  1JAW A;  4B28 A;  1XGN A;  4U6C A;  4FLK A;  4U6Z A;  3BIP A;  3TAV A;  2P9A A;  2BWY A;  1MAT A;  4IKR A;  3I7M A;  4U70 A;  5D6F A;  4ZWP A;  3FM3 A;  2BHA A;  1WKM A;  1XNZ A;  1W7V A;  2GGB A;  4RZZ A;  5JHU A;  3BIT A;  3PEB A;  5E5B A;  3IU8 A;  3O5V A;  1XGO A;  4IPA A;  1WN1 A;  2GU6 A;  2EVC A;  3CB6 A;  1W2M A;  3PN9 A;  2P98 A;  4FLI A;  4ZWO A;  3BIQ A;  1BOA A;  2GU4 A;  5D6E A;  2Q8K A;  2GG9 A;  3IU7 A;  3RVA A;  1WLR A;  4U73 A;  3IL0 A;  4FKC A;  1KQ0 A;  1R58 A;  2BWV A;  2BB7 A;  2G6P A;  2GG0 A;  3MX6 A;  2Q95 A;  4IKS A;  3CTZ A;  4QR8 A;  3MR1 A;  4FUK A;  4Z7M A;  4FO7 A;  2BWX A;  2BWT A;  1KQ9 A;  1YW7 A;  1QZY A;  3TB5 A;  1QXY A;  2NQ6 A;  3CB5 A;  4EGE A;  1B6A A;  1QXW A;  4IKT A;  3PKB A;  5CIK A;  1XGS A;  2Q93 A;  5E2C A;  2ADU A;  2NQ7 A;  5FCF A;  2MAT A;  4IDY A;  1B59 A;  1A16 A;  2OAZ A;  5CDV A;  1C21 A;  2BH3 A;  1Y1N A;  4FLJ A;  4U71 A;  4S01 A;  2GA2 A;  2BWU A;  1YW9 A;  1O0X A;  2GGC A; 
#chains in the Genus database with same CATH topology
 1KP0 A;  2GU7 A;  1M35 A;  4HXX A;  2GG3 A;  4RGZ 1;  5JFR A;  4R60 A;  4S2T P;  2IW2 A;  1R5G A;  5FCH A;  1WL6 A;  2B3L A;  5CNX A;  2Q94 A;  1C23 A;  4U76 A;  1WBQ A;  3S6B A;  2GTX A;  2V3X A;  3OOO A;  2Q96 A;  2V3Y A;  4U6J A;  3L24 A;  2V6C A;  2GG2 A;  3PKE A;  2GG8 A;  4IEC A;  2GZ5 A;  1PV9 A;  4MAT A;  4U1B A;  3MAT A;  3OVK A;  1CHM A;  2ZSG A;  1YW8 A;  4A6V A;  1C22 A;  2BHB A;  5CE6 A;  2EVM A;  2BWW A;  4JUQ A;  1BN5 A;  4FLL A;  5CDE A;  1C24 A;  4KM3 A;  1YVM A;  2EVO A;  3IG4 A;  3FMR A;  4IU6 A;  1R5H A;  1XGM A;  2EA2 A;  2DFI A;  2BHC A;  2OKN A;  3L7G A;  2P99 A;  4RZY A;  5CDL A;  2HOW A;  1YJ3 A;  3PKD A;  3Q6D A;  4PNC A;  4ZWU A;  3PKC A;  2GG5 A;  2GG7 A;  1WL9 A;  4ZNG A;  2GU5 A;  1QXZ A;  1C27 A;  3ROR A;  2V3Z A;  2B3K A;  1WY2 A;  3D27 A;  1N51 A;  4FO8 A;  4PV4 A;  4IKU A;  4IF7 A;  4U6E A;  4A6W A;  5JI6 A;  4U75 A;  2BWS A;  4U69 A;  2EA4 A;  3FMQ A;  4U6W A;  2Q92 A;  2BN7 A;  3IU9 A;  2BHD A;  2B3H A;  4S2R P;  3PKA A;  4OOK A;  4S00 A;  5CLS A;  3QOC A;  1JAW A;  4B28 A;  1XGN A;  4U6C A;  4FLK A;  4U6Z A;  3BIP A;  3TAV A;  2P9A A;  2BWY A;  1MAT A;  4IKR A;  3I7M A;  4U70 A;  5D6F A;  4ZWP A;  3FM3 A;  2BHA A;  1WKM A;  1XNZ A;  1W7V A;  2GGB A;  4RZZ A;  5JHU A;  3BIT A;  3PEB A;  5E5B A;  3IU8 A;  3O5V A;  1XGO A;  4IPA A;  1WN1 A;  2GU6 A;  2EVC A;  3CB6 A;  1W2M A;  3PN9 A;  2P98 A;  4FLI A;  4ZWO A;  3BIQ A;  1BOA A;  2GU4 A;  5D6E A;  2Q8K A;  2GG9 A;  3IU7 A;  3RVA A;  1WLR A;  4U73 A;  3IL0 A;  4FKC A;  1KQ0 A;  1R58 A;  2BWV A;  2BB7 A;  2G6P A;  2GG0 A;  3MX6 A;  2Q95 A;  4IKS A;  3CTZ A;  4QR8 A;  3MR1 A;  4FUK A;  4Z7M A;  4FO7 A;  2BWX A;  2BWT A;  1KQ9 A;  1YW7 A;  1QZY A;  3TB5 A;  1QXY A;  2NQ6 A;  3CB5 A;  4EGE A;  1B6A A;  1QXW A;  4IKT A;  3PKB A;  5CIK A;  1XGS A;  2Q93 A;  5E2C A;  2ADU A;  2NQ7 A;  5FCF A;  2MAT A;  4IDY A;  1B59 A;  1A16 A;  2OAZ A;  5CDV A;  1C21 A;  2BH3 A;  1Y1N A;  4FLJ A;  4U71 A;  4S01 A;  2GA2 A;  2BWU A;  1YW9 A;  1O0X A;  2GGC A; 
#chains in the Genus database with same CATH homology
 1KP0 A;  2GU7 A;  1M35 A;  4HXX A;  2GG3 A;  4RGZ 1;  5JFR A;  4R60 A;  4S2T P;  2IW2 A;  1R5G A;  5FCH A;  1WL6 A;  2B3L A;  5CNX A;  2Q94 A;  1C23 A;  4U76 A;  1WBQ A;  3S6B A;  2GTX A;  2V3X A;  3OOO A;  2Q96 A;  2V3Y A;  4U6J A;  3L24 A;  2V6C A;  2GG2 A;  3PKE A;  2GG8 A;  4IEC A;  2GZ5 A;  1PV9 A;  4MAT A;  4U1B A;  3MAT A;  3OVK A;  1CHM A;  2ZSG A;  1YW8 A;  4A6V A;  1C22 A;  2BHB A;  5CE6 A;  2EVM A;  2BWW A;  4JUQ A;  1BN5 A;  4FLL A;  5CDE A;  1C24 A;  4KM3 A;  1YVM A;  2EVO A;  3IG4 A;  3FMR A;  4IU6 A;  1R5H A;  1XGM A;  2EA2 A;  2DFI A;  2BHC A;  2OKN A;  3L7G A;  2P99 A;  4RZY A;  5CDL A;  2HOW A;  1YJ3 A;  3PKD A;  3Q6D A;  4PNC A;  4ZWU A;  3PKC A;  2GG5 A;  2GG7 A;  1WL9 A;  4ZNG A;  2GU5 A;  1QXZ A;  1C27 A;  3ROR A;  2V3Z A;  2B3K A;  1WY2 A;  3D27 A;  1N51 A;  4FO8 A;  4PV4 A;  4IKU A;  4IF7 A;  4U6E A;  4A6W A;  5JI6 A;  4U75 A;  2BWS A;  4U69 A;  2EA4 A;  3FMQ A;  4U6W A;  2Q92 A;  2BN7 A;  3IU9 A;  2BHD A;  2B3H A;  4S2R P;  3PKA A;  4OOK A;  4S00 A;  5CLS A;  3QOC A;  1JAW A;  4B28 A;  1XGN A;  4U6C A;  4FLK A;  4U6Z A;  3BIP A;  3TAV A;  2P9A A;  2BWY A;  1MAT A;  4IKR A;  3I7M A;  4U70 A;  5D6F A;  4ZWP A;  3FM3 A;  2BHA A;  1WKM A;  1XNZ A;  1W7V A;  2GGB A;  4RZZ A;  5JHU A;  3BIT A;  3PEB A;  5E5B A;  3IU8 A;  3O5V A;  1XGO A;  4IPA A;  1WN1 A;  2GU6 A;  2EVC A;  3CB6 A;  1W2M A;  3PN9 A;  2P98 A;  4FLI A;  4ZWO A;  3BIQ A;  1BOA A;  2GU4 A;  5D6E A;  2Q8K A;  2GG9 A;  3IU7 A;  3RVA A;  1WLR A;  4U73 A;  3IL0 A;  4FKC A;  1KQ0 A;  1R58 A;  2BWV A;  2BB7 A;  2G6P A;  2GG0 A;  3MX6 A;  2Q95 A;  4IKS A;  3CTZ A;  4QR8 A;  3MR1 A;  4FUK A;  4Z7M A;  4FO7 A;  2BWX A;  2BWT A;  1KQ9 A;  1YW7 A;  1QZY A;  3TB5 A;  1QXY A;  2NQ6 A;  3CB5 A;  4EGE A;  1B6A A;  1QXW A;  4IKT A;  3PKB A;  5CIK A;  1XGS A;  2Q93 A;  5E2C A;  2ADU A;  2NQ7 A;  5FCF A;  2MAT A;  4IDY A;  1B59 A;  1A16 A;  2OAZ A;  5CDV A;  1C21 A;  2BH3 A;  1Y1N A;  4FLJ A;  4U71 A;  4S01 A;  2GA2 A;  2BWU A;  1YW9 A;  1O0X A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...