1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Proline peptidase
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
3CTZA 4U70A 4S00A 4ZNGA 1KQ0A 2B3LA 4U6EA 3FMQA 2GG5A 4IKUA 3S6BA 2NQ6A 4U1BA 5JFRA 1C22A 2B3KA 4MATA 1Y1NA 5JHUA 2BHBA 4EGEA 3IU8A 2Q94A 1CHMA 5FCFA 3TB5A 4KM3A 3IL0A 3OOOA 1XGMA 2P99A 1C27A 1N51A 2IW2A 4U75A 1B6AA 1WN1A 5CNXA 2GTXA 2GG7A 4U73A 2P98A 4QR8A 1WL9A 2GU7A 4IKTA 4RZYA 4ZWPA 3PEBA 1KQ9A 2GG2A 5CE6A 1MATA 4B28A 2DFIA 2BB7A 3O5VA 4JUQA 3CB5A 2HOWA 1JAWA 5E5BA 2V3XA 2V6CA 2BHCA 2BN7A 4FLIA 1A16A 2BWSA 1R5GA 1PV9A 1YJ3A 2OKNA 4ZWOA 2EA4A 3IG4A 4S2TP 4IF7A 2GGBA 5CDVA 1WY2A 1KP0A 4FUKA 4PV4A 1R5HA 1WLRA 2GG8A 3L7GA 2Q93A 4ZWUA 2BHDA 2BH3A 2V3YA 1YW8A 4U71A 4A6WA 1BOAA 1BN5A 2NQ7A 1W7VA 5E2CA 5CDEA 4IDYA 1XGSA 3L24A 1C21A 2G6PA 3FMRA 4HXXA 4A6VA 2GG3A 4U6ZA 3BIPA 1R58A 5CDLA 1WL6A 2EVOA 4U69A 2BHAA 1B59A 1C23A 2Q96A 2BWTA 3IU9A 2B3HA 3D27A 4S2RP 3PKEA 4FLKA 4FLJA 4IKSA 2P9AA 3FM3A 4PNCA 1YW7A 2BWWA 3PKCA 4FKCA 3MX6A 5JI6A 5CLSA 4U6CA 4IPAA 1W2MA 2BWYA 4U76A 3IU7A 3MR1A 2GU4A 4FO8A 1QZYA 1QXZA 3QOCA 1YW9A 1WBQA 2BWVA 4IKRA 1XGNA 2Q95A 1YVMA 4FO7A 3RVAA 2BWXA 2Q92A 4RGZ1 4S01A 4IECA 2GU5A 5D6EA 3PN9A 4IU6A 1XNZA 3MATA 5D6FA 2EVCA 1WKMA 1QXWA 5FCHA 4FLLA 4R60A 2GGCA 2EA2A 4RZZA 1C24A 4U6WA 4OOKA 3Q6DA 3RORA 1M35A 3OVKA 3BITA 1XGOA 2MATA 3TAVA 2GZ5A 2V3ZA 3PKBA 2Q8KA 4Z7MA 2GG9A 3I7MA 2BWUA 2GU6A 3BIQA 2GA2A 2ADUA 4U6JA 5CIKA 2ZSGA 3PKAA 2OAZA 3PKDA 1O0XA 1QXYA 3CB6A 2EVMA 2GG0A
chains in the Genus database with same CATH superfamily
3CTZA 4U70A 4S00A 4ZNGA 1KQ0A 2B3LA 4U6EA 3FMQA 2GG5A 4IKUA 3S6BA 2NQ6A 4U1BA 5JFRA 1C22A 2B3KA 4MATA 1Y1NA 5JHUA 2BHBA 4EGEA 3IU8A 2Q94A 1CHMA 5FCFA 3TB5A 4KM3A 3IL0A 3OOOA 1XGMA 2P99A 1C27A 1N51A 2IW2A 4U75A 1B6AA 1WN1A 5CNXA 2GTXA 2GG7A 4U73A 2P98A 4QR8A 1WL9A 2GU7A 4IKTA 4RZYA 4ZWPA 3PEBA 1KQ9A 2GG2A 5CE6A 1MATA 4B28A 2DFIA 2BB7A 3O5VA 4JUQA 3CB5A 2HOWA 1JAWA 5E5BA 2V3XA 2V6CA 2BHCA 2BN7A 4FLIA 1A16A 2BWSA 1R5GA 1PV9A 1YJ3A 2OKNA 4ZWOA 2EA4A 3IG4A 4S2TP 4IF7A 2GGBA 5CDVA 1WY2A 1KP0A 4FUKA 4PV4A 1R5HA 1WLRA 2GG8A 3L7GA 2Q93A 4ZWUA 2BHDA 2BH3A 2V3YA 1YW8A 4U71A 4A6WA 1BOAA 1BN5A 2NQ7A 1W7VA 5E2CA 5CDEA 4IDYA 1XGSA 3L24A 1C21A 2G6PA 3FMRA 4HXXA 4A6VA 2GG3A 4U6ZA 3BIPA 1R58A 5CDLA 1WL6A 2EVOA 4U69A 2BHAA 1B59A 1C23A 2Q96A 2BWTA 3IU9A 2B3HA 3D27A 4S2RP 3PKEA 4FLKA 4FLJA 4IKSA 2P9AA 3FM3A 4PNCA 1YW7A 2BWWA 3PKCA 4FKCA 3MX6A 5JI6A 5CLSA 4U6CA 4IPAA 1W2MA 2BWYA 4U76A 3IU7A 3MR1A 2GU4A 4FO8A 1QZYA 1QXZA 3QOCA 1YW9A 1WBQA 2BWVA 4IKRA 1XGNA 2Q95A 1YVMA 4FO7A 3RVAA 2BWXA 2Q92A 4RGZ1 4S01A 4IECA 2GU5A 5D6EA 3PN9A 4IU6A 1XNZA 3MATA 5D6FA 2EVCA 1WKMA 1QXWA 5FCHA 4FLLA 4R60A 2GGCA 2EA2A 4RZZA 1C24A 4U6WA 4OOKA 3Q6DA 3RORA 1M35A 3OVKA 3BITA 1XGOA 2MATA 3TAVA 2GZ5A 2V3ZA 3PKBA 2Q8KA 4Z7MA 2GG9A 3I7MA 2BWUA 2GU6A 3BIQA 2GA2A 2ADUA 4U6JA 5CIKA 2ZSGA 3PKAA 2OAZA 3PKDA 1O0XA 1QXYA 3CB6A 2EVMA 2GG0A
chains in the Genus database with same CATH topology
3CTZA 4U70A 4S00A 4ZNGA 1KQ0A 2B3LA 4U6EA 3FMQA 2GG5A 4IKUA 3S6BA 2NQ6A 4U1BA 5JFRA 1C22A 2B3KA 4MATA 1Y1NA 5JHUA 2BHBA 4EGEA 3IU8A 2Q94A 1CHMA 5FCFA 3TB5A 4KM3A 3IL0A 3OOOA 1XGMA 2P99A 1C27A 1N51A 2IW2A 4U75A 1B6AA 1WN1A 5CNXA 2GTXA 2GG7A 4U73A 2P98A 4QR8A 1WL9A 2GU7A 4IKTA 4RZYA 4ZWPA 3PEBA 1KQ9A 2GG2A 5CE6A 1MATA 4B28A 2DFIA 2BB7A 3O5VA 4JUQA 3CB5A 2HOWA 1JAWA 5E5BA 2V3XA 2V6CA 2BHCA 2BN7A 4FLIA 1A16A 2BWSA 1R5GA 1PV9A 1YJ3A 2OKNA 4ZWOA 2EA4A 3IG4A 4S2TP 4IF7A 2GGBA 5CDVA 1WY2A 1KP0A 4FUKA 4PV4A 1R5HA 1WLRA 2GG8A 3L7GA 2Q93A 4ZWUA 2BHDA 2BH3A 2V3YA 1YW8A 4U71A 4A6WA 1BOAA 1BN5A 2NQ7A 1W7VA 5E2CA 5CDEA 4IDYA 1XGSA 3L24A 1C21A 2G6PA 3FMRA 4HXXA 4A6VA 2GG3A 4U6ZA 3BIPA 1R58A 5CDLA 1WL6A 2EVOA 4U69A 2BHAA 1B59A 1C23A 2Q96A 2BWTA 3IU9A 2B3HA 3D27A 4S2RP 3PKEA 4FLKA 4FLJA 4IKSA 2P9AA 3FM3A 4PNCA 1YW7A 2BWWA 3PKCA 4FKCA 3MX6A 5JI6A 5CLSA 4U6CA 4IPAA 1W2MA 2BWYA 4U76A 3IU7A 3MR1A 2GU4A 4FO8A 1QZYA 1QXZA 3QOCA 1YW9A 1WBQA 2BWVA 4IKRA 1XGNA 2Q95A 1YVMA 4FO7A 3RVAA 2BWXA 2Q92A 4RGZ1 4S01A 4IECA 2GU5A 5D6EA 3PN9A 4IU6A 1XNZA 3MATA 5D6FA 2EVCA 1WKMA 1QXWA 5FCHA 4FLLA 4R60A 2GGCA 2EA2A 4RZZA 1C24A 4U6WA 4OOKA 3Q6DA 3RORA 1M35A 3OVKA 3BITA 1XGOA 2MATA 3TAVA 2GZ5A 2V3ZA 3PKBA 2Q8KA 4Z7MA 2GG9A 3I7MA 2BWUA 2GU6A 3BIQA 2GA2A 2ADUA 4U6JA 5CIKA 2ZSGA 3PKAA 2OAZA 3PKDA 1O0XA 1QXYA 3CB6A 2EVMA 2GG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTZ A;  4U70 A;  4S00 A;  4ZNG A;  1KQ0 A;  2B3L A;  4U6E A;  3FMQ A;  2GG5 A;  4IKU A;  3S6B A;  2NQ6 A;  4U1B A;  5JFR A;  1C22 A;  2B3K A;  4MAT A;  1Y1N A;  5JHU A;  2BHB A;  4EGE A;  3IU8 A;  2Q94 A;  1CHM A;  5FCF A;  3TB5 A;  4KM3 A;  3IL0 A;  3OOO A;  1XGM A;  2P99 A;  1C27 A;  1N51 A;  2IW2 A;  4U75 A;  1B6A A;  1WN1 A;  5CNX A;  2GTX A;  2GG7 A;  4U73 A;  2P98 A;  4QR8 A;  1WL9 A;  2GU7 A;  4IKT A;  4RZY A;  4ZWP A;  3PEB A;  1KQ9 A;  2GG2 A;  5CE6 A;  1MAT A;  4B28 A;  2DFI A;  2BB7 A;  3O5V A;  4JUQ A;  3CB5 A;  2HOW A;  1JAW A;  5E5B A;  2V3X A;  2V6C A;  2BHC A;  2BN7 A;  4FLI A;  1A16 A;  2BWS A;  1R5G A;  1PV9 A;  1YJ3 A;  2OKN A;  4ZWO A;  2EA4 A;  3IG4 A;  4S2T P;  4IF7 A;  2GGB A;  5CDV A;  1WY2 A;  1KP0 A;  4FUK A;  4PV4 A;  1R5H A;  1WLR A;  2GG8 A;  3L7G A;  2Q93 A;  4ZWU A;  2BHD A;  2BH3 A;  2V3Y A;  1YW8 A;  4U71 A;  4A6W A;  1BOA A;  1BN5 A;  2NQ7 A;  1W7V A;  5E2C A;  5CDE A;  4IDY A;  1XGS A;  3L24 A;  1C21 A;  2G6P A;  3FMR A;  4HXX A;  4A6V A;  2GG3 A;  4U6Z A;  3BIP A;  1R58 A;  5CDL A;  1WL6 A;  2EVO A;  4U69 A;  2BHA A;  1B59 A;  1C23 A;  2Q96 A;  2BWT A;  3IU9 A;  2B3H A;  3D27 A;  4S2R P;  3PKE A;  4FLK A;  4FLJ A;  4IKS A;  2P9A A;  3FM3 A;  4PNC A;  1YW7 A;  2BWW A;  3PKC A;  4FKC A;  3MX6 A;  5JI6 A;  5CLS A;  4U6C A;  4IPA A;  1W2M A;  2BWY A;  4U76 A;  3IU7 A;  3MR1 A;  2GU4 A;  4FO8 A;  1QZY A;  1QXZ A;  3QOC A;  1YW9 A;  1WBQ A;  2BWV A;  4IKR A;  1XGN A;  2Q95 A;  1YVM A;  4FO7 A;  3RVA A;  2BWX A;  2Q92 A;  4RGZ 1;  4S01 A;  4IEC A;  2GU5 A;  5D6E A;  3PN9 A;  4IU6 A;  1XNZ A;  3MAT A;  5D6F A;  2EVC A;  1WKM A;  1QXW A;  5FCH A;  4FLL A;  4R60 A;  2GGC A;  2EA2 A;  4RZZ A;  1C24 A;  4U6W A;  4OOK A;  3Q6D A;  3ROR A;  1M35 A;  3OVK A;  3BIT A;  1XGO A;  2MAT A;  3TAV A;  2GZ5 A;  2V3Z A;  3PKB A;  2Q8K A;  4Z7M A;  2GG9 A;  3I7M A;  2BWU A;  2GU6 A;  3BIQ A;  2GA2 A;  2ADU A;  4U6J A;  5CIK A;  2ZSG A;  3PKA A;  2OAZ A;  3PKD A;  1O0X A;  1QXY A;  3CB6 A;  2EVM A;  2GG0 A; 
#chains in the Genus database with same CATH topology
 3CTZ A;  4U70 A;  4S00 A;  4ZNG A;  1KQ0 A;  2B3L A;  4U6E A;  3FMQ A;  2GG5 A;  4IKU A;  3S6B A;  2NQ6 A;  4U1B A;  5JFR A;  1C22 A;  2B3K A;  4MAT A;  1Y1N A;  5JHU A;  2BHB A;  4EGE A;  3IU8 A;  2Q94 A;  1CHM A;  5FCF A;  3TB5 A;  4KM3 A;  3IL0 A;  3OOO A;  1XGM A;  2P99 A;  1C27 A;  1N51 A;  2IW2 A;  4U75 A;  1B6A A;  1WN1 A;  5CNX A;  2GTX A;  2GG7 A;  4U73 A;  2P98 A;  4QR8 A;  1WL9 A;  2GU7 A;  4IKT A;  4RZY A;  4ZWP A;  3PEB A;  1KQ9 A;  2GG2 A;  5CE6 A;  1MAT A;  4B28 A;  2DFI A;  2BB7 A;  3O5V A;  4JUQ A;  3CB5 A;  2HOW A;  1JAW A;  5E5B A;  2V3X A;  2V6C A;  2BHC A;  2BN7 A;  4FLI A;  1A16 A;  2BWS A;  1R5G A;  1PV9 A;  1YJ3 A;  2OKN A;  4ZWO A;  2EA4 A;  3IG4 A;  4S2T P;  4IF7 A;  2GGB A;  5CDV A;  1WY2 A;  1KP0 A;  4FUK A;  4PV4 A;  1R5H A;  1WLR A;  2GG8 A;  3L7G A;  2Q93 A;  4ZWU A;  2BHD A;  2BH3 A;  2V3Y A;  1YW8 A;  4U71 A;  4A6W A;  1BOA A;  1BN5 A;  2NQ7 A;  1W7V A;  5E2C A;  5CDE A;  4IDY A;  1XGS A;  3L24 A;  1C21 A;  2G6P A;  3FMR A;  4HXX A;  4A6V A;  2GG3 A;  4U6Z A;  3BIP A;  1R58 A;  5CDL A;  1WL6 A;  2EVO A;  4U69 A;  2BHA A;  1B59 A;  1C23 A;  2Q96 A;  2BWT A;  3IU9 A;  2B3H A;  3D27 A;  4S2R P;  3PKE A;  4FLK A;  4FLJ A;  4IKS A;  2P9A A;  3FM3 A;  4PNC A;  1YW7 A;  2BWW A;  3PKC A;  4FKC A;  3MX6 A;  5JI6 A;  5CLS A;  4U6C A;  4IPA A;  1W2M A;  2BWY A;  4U76 A;  3IU7 A;  3MR1 A;  2GU4 A;  4FO8 A;  1QZY A;  1QXZ A;  3QOC A;  1YW9 A;  1WBQ A;  2BWV A;  4IKR A;  1XGN A;  2Q95 A;  1YVM A;  4FO7 A;  3RVA A;  2BWX A;  2Q92 A;  4RGZ 1;  4S01 A;  4IEC A;  2GU5 A;  5D6E A;  3PN9 A;  4IU6 A;  1XNZ A;  3MAT A;  5D6F A;  2EVC A;  1WKM A;  1QXW A;  5FCH A;  4FLL A;  4R60 A;  2GGC A;  2EA2 A;  4RZZ A;  1C24 A;  4U6W A;  4OOK A;  3Q6D A;  3ROR A;  1M35 A;  3OVK A;  3BIT A;  1XGO A;  2MAT A;  3TAV A;  2GZ5 A;  2V3Z A;  3PKB A;  2Q8K A;  4Z7M A;  2GG9 A;  3I7M A;  2BWU A;  2GU6 A;  3BIQ A;  2GA2 A;  2ADU A;  4U6J A;  5CIK A;  2ZSG A;  3PKA A;  2OAZ A;  3PKD A;  1O0X A;  1QXY A;  3CB6 A;  2EVM A;  2GG0 A; 
#chains in the Genus database with same CATH homology
 3CTZ A;  4U70 A;  4S00 A;  4ZNG A;  1KQ0 A;  2B3L A;  4U6E A;  3FMQ A;  2GG5 A;  4IKU A;  3S6B A;  2NQ6 A;  4U1B A;  5JFR A;  1C22 A;  2B3K A;  4MAT A;  1Y1N A;  5JHU A;  2BHB A;  4EGE A;  3IU8 A;  2Q94 A;  1CHM A;  5FCF A;  3TB5 A;  4KM3 A;  3IL0 A;  3OOO A;  1XGM A;  2P99 A;  1C27 A;  1N51 A;  2IW2 A;  4U75 A;  1B6A A;  1WN1 A;  5CNX A;  2GTX A;  2GG7 A;  4U73 A;  2P98 A;  4QR8 A;  1WL9 A;  2GU7 A;  4IKT A;  4RZY A;  4ZWP A;  3PEB A;  1KQ9 A;  2GG2 A;  5CE6 A;  1MAT A;  4B28 A;  2DFI A;  2BB7 A;  3O5V A;  4JUQ A;  3CB5 A;  2HOW A;  1JAW A;  5E5B A;  2V3X A;  2V6C A;  2BHC A;  2BN7 A;  4FLI A;  1A16 A;  2BWS A;  1R5G A;  1PV9 A;  1YJ3 A;  2OKN A;  4ZWO A;  2EA4 A;  3IG4 A;  4S2T P;  4IF7 A;  2GGB A;  5CDV A;  1WY2 A;  1KP0 A;  4FUK A;  4PV4 A;  1R5H A;  1WLR A;  2GG8 A;  3L7G A;  2Q93 A;  4ZWU A;  2BHD A;  2BH3 A;  2V3Y A;  1YW8 A;  4U71 A;  4A6W A;  1BOA A;  1BN5 A;  2NQ7 A;  1W7V A;  5E2C A;  5CDE A;  4IDY A;  1XGS A;  3L24 A;  1C21 A;  2G6P A;  3FMR A;  4HXX A;  4A6V A;  2GG3 A;  4U6Z A;  3BIP A;  1R58 A;  5CDL A;  1WL6 A;  2EVO A;  4U69 A;  2BHA A;  1B59 A;  1C23 A;  2Q96 A;  2BWT A;  3IU9 A;  2B3H A;  3D27 A;  4S2R P;  3PKE A;  4FLK A;  4FLJ A;  4IKS A;  2P9A A;  3FM3 A;  4PNC A;  1YW7 A;  2BWW A;  3PKC A;  4FKC A;  3MX6 A;  5JI6 A;  5CLS A;  4U6C A;  4IPA A;  1W2M A;  2BWY A;  4U76 A;  3IU7 A;  3MR1 A;  2GU4 A;  4FO8 A;  1QZY A;  1QXZ A;  3QOC A;  1YW9 A;  1WBQ A;  2BWV A;  4IKR A;  1XGN A;  2Q95 A;  1YVM A;  4FO7 A;  3RVA A;  2BWX A;  2Q92 A;  4RGZ 1;  4S01 A;  4IEC A;  2GU5 A;  5D6E A;  3PN9 A;  4IU6 A;  1XNZ A;  3MAT A;  5D6F A;  2EVC A;  1WKM A;  1QXW A;  5FCH A;  4FLL A;  4R60 A;  2GGC A;  2EA2 A;  4RZZ A;  1C24 A;  4U6W A;  4OOK A;  3Q6D A;  3ROR A;  1M35 A;  3OVK A;  3BIT A;  1XGO A;  2MAT A;  3TAV A;  2GZ5 A;  2V3Z A;  3PKB A;  2Q8K A;  4Z7M A;  2GG9 A;  3I7M A;  2BWU A;  2GU6 A;  3BIQ A;  2GA2 A;  2ADU A;  4U6J A;  5CIK A;  2ZSG A;  3PKA A;  2OAZ A;  3PKD A;  1O0X A;  1QXY A;  3CB6 A;  2EVM A;  2GG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...