1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Proline peptidase
molecule keywords AMINOPEPTIDASE P
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
4U6WA 3IL0A 2Q92A 2GG8A 4U6EA 3CB5A 1MATA 2EA4A 1W7VA 4IKUA 1QXYA 4FUKA 2BWVA 1KQ0A 1PV9A 1WKMA 1WLRA 2OKNA 2NQ7A 2GG9A 2GU4A 1O0XA 5CLSA 4MATA 4U6JA 2P9AA 2V3ZA 3Q6DA 4IKSA 3OOOA 3L7GA 1YJ3A 5D6EA 4FLLA 4S01A 1Y1NA 2BHAA 3FMRA 4FLIA 1XGNA 2Q96A 4IKTA 4Z7MA 4ZWOA 2DFIA 3QOCA 5D6FA 1YW7A 4JUQA 1JAWA 1W2MA 3PKCA 5JI6A 2GG7A 4PV4A 2GGCA 1XNZA 2BHDA 3RORA 1WBQA 1C21A 3IU8A 1R58A 2GG3A 2G6PA 4RZYA 2EVMA 4IU6A 2B3KA 3TAVA 1C24A 2ZSGA 2P99A 4QR8A 1YW9A 3BIPA 1N51A 3FMQA 2BWTA 3PKDA 1WN1A 5E2CA 2GTXA 4U76A 3IU7A 1BN5A 2BWXA 3IU9A 3CB6A 3PKBA 4OOKA 4U69A 1YW8A 1M35A 2B3LA 4U73A 4U1BA 5CDEA 4ZNGA 3MR1A 3BIQA 1WL6A 1YVMA 5CE6A 4A6WA 4KM3A 2BB7A 3OVKA 4S2TP 2Q95A 2GA2A 2GU7A 2GU6A 3PKEA 3MATA 2BWYA 4IPAA 5CDLA 1C22A 5JHUA 1A16A 1QZYA 4IKRA 1CHMA 4EGEA 1BOAA 4U6CA 4U71A 2EVOA 1XGMA 2P98A 3O5VA 2BN7A 5E5BA 2GZ5A 4S2RP 4IDYA 4A6VA 2Q94A 4B28A 2GG0A 3FM3A 3I7MA 4FO7A 2HOWA 5FCFA 1KQ9A 3CTZA 1C27A 1WL9A 3D27A 1B6AA 1C23A 4ZWUA 1XGOA 4HXXA 4U70A 3RVAA 2IW2A 2BWSA 5FCHA 1XGSA 2EA2A 3L24A 2OAZA 3BITA 4FKCA 3PKAA 4U75A 3PEBA 2GU5A 1WY2A 2GG5A 3IG4A 5CNXA 2GG2A 4S00A 2GGBA 3MX6A 4FO8A 1R5GA 4IECA 3TB5A 4RGZ1 2Q93A 1QXWA 3S6BA 1R5HA 2ADUA 4U6ZA 4FLJA 4RZZA 2Q8KA 2V3XA 4IF7A 2NQ6A 2V6CA 5CIKA 3PN9A 5CDVA 4PNCA 2B3HA 2BWWA 2BHCA 1QXZA 1KP0A 2BH3A 2V3YA 2MATA 4R60A 4ZWPA 2EVCA 1B59A 5JFRA 2BWUA 4FLKA 2BHBA
chains in the Genus database with same CATH superfamily
4U6WA 3IL0A 2Q92A 2GG8A 4U6EA 3CB5A 1MATA 2EA4A 1W7VA 4IKUA 1QXYA 4FUKA 2BWVA 1KQ0A 1PV9A 1WKMA 1WLRA 2OKNA 2NQ7A 2GG9A 2GU4A 1O0XA 5CLSA 4MATA 4U6JA 2P9AA 2V3ZA 3Q6DA 4IKSA 3OOOA 3L7GA 1YJ3A 5D6EA 4FLLA 4S01A 1Y1NA 2BHAA 3FMRA 4FLIA 1XGNA 2Q96A 4IKTA 4Z7MA 4ZWOA 2DFIA 3QOCA 5D6FA 1YW7A 4JUQA 1JAWA 1W2MA 3PKCA 5JI6A 2GG7A 4PV4A 2GGCA 1XNZA 2BHDA 3RORA 1WBQA 1C21A 3IU8A 1R58A 2GG3A 2G6PA 4RZYA 2EVMA 4IU6A 2B3KA 3TAVA 1C24A 2ZSGA 2P99A 4QR8A 1YW9A 3BIPA 1N51A 3FMQA 2BWTA 3PKDA 1WN1A 5E2CA 2GTXA 4U76A 3IU7A 1BN5A 2BWXA 3IU9A 3CB6A 3PKBA 4OOKA 4U69A 1YW8A 1M35A 2B3LA 4U73A 4U1BA 5CDEA 4ZNGA 3MR1A 3BIQA 1WL6A 1YVMA 5CE6A 4A6WA 4KM3A 2BB7A 3OVKA 4S2TP 2Q95A 2GA2A 2GU7A 2GU6A 3PKEA 3MATA 2BWYA 4IPAA 5CDLA 1C22A 5JHUA 1A16A 1QZYA 4IKRA 1CHMA 4EGEA 1BOAA 4U6CA 4U71A 2EVOA 1XGMA 2P98A 3O5VA 2BN7A 5E5BA 2GZ5A 4S2RP 4IDYA 4A6VA 2Q94A 4B28A 2GG0A 3FM3A 3I7MA 4FO7A 2HOWA 5FCFA 1KQ9A 3CTZA 1C27A 1WL9A 3D27A 1B6AA 1C23A 4ZWUA 1XGOA 4HXXA 4U70A 3RVAA 2IW2A 2BWSA 5FCHA 1XGSA 2EA2A 3L24A 2OAZA 3BITA 4FKCA 3PKAA 4U75A 3PEBA 2GU5A 1WY2A 2GG5A 3IG4A 5CNXA 2GG2A 4S00A 2GGBA 3MX6A 4FO8A 1R5GA 4IECA 3TB5A 4RGZ1 2Q93A 1QXWA 3S6BA 1R5HA 2ADUA 4U6ZA 4FLJA 4RZZA 2Q8KA 2V3XA 4IF7A 2NQ6A 2V6CA 5CIKA 3PN9A 5CDVA 4PNCA 2B3HA 2BWWA 2BHCA 1QXZA 1KP0A 2BH3A 2V3YA 2MATA 4R60A 4ZWPA 2EVCA 1B59A 5JFRA 2BWUA 4FLKA 2BHBA
chains in the Genus database with same CATH topology
4U6WA 3IL0A 2Q92A 2GG8A 4U6EA 3CB5A 1MATA 2EA4A 1W7VA 4IKUA 1QXYA 4FUKA 2BWVA 1KQ0A 1PV9A 1WKMA 1WLRA 2OKNA 2NQ7A 2GG9A 2GU4A 1O0XA 5CLSA 4MATA 4U6JA 2P9AA 2V3ZA 3Q6DA 4IKSA 3OOOA 3L7GA 1YJ3A 5D6EA 4FLLA 4S01A 1Y1NA 2BHAA 3FMRA 4FLIA 1XGNA 2Q96A 4IKTA 4Z7MA 4ZWOA 2DFIA 3QOCA 5D6FA 1YW7A 4JUQA 1JAWA 1W2MA 3PKCA 5JI6A 2GG7A 4PV4A 2GGCA 1XNZA 2BHDA 3RORA 1WBQA 1C21A 3IU8A 1R58A 2GG3A 2G6PA 4RZYA 2EVMA 4IU6A 2B3KA 3TAVA 1C24A 2ZSGA 2P99A 4QR8A 1YW9A 3BIPA 1N51A 3FMQA 2BWTA 3PKDA 1WN1A 5E2CA 2GTXA 4U76A 3IU7A 1BN5A 2BWXA 3IU9A 3CB6A 3PKBA 4OOKA 4U69A 1YW8A 1M35A 2B3LA 4U73A 4U1BA 5CDEA 4ZNGA 3MR1A 3BIQA 1WL6A 1YVMA 5CE6A 4A6WA 4KM3A 2BB7A 3OVKA 4S2TP 2Q95A 2GA2A 2GU7A 2GU6A 3PKEA 3MATA 2BWYA 4IPAA 5CDLA 1C22A 5JHUA 1A16A 1QZYA 4IKRA 1CHMA 4EGEA 1BOAA 4U6CA 4U71A 2EVOA 1XGMA 2P98A 3O5VA 2BN7A 5E5BA 2GZ5A 4S2RP 4IDYA 4A6VA 2Q94A 4B28A 2GG0A 3FM3A 3I7MA 4FO7A 2HOWA 5FCFA 1KQ9A 3CTZA 1C27A 1WL9A 3D27A 1B6AA 1C23A 4ZWUA 1XGOA 4HXXA 4U70A 3RVAA 2IW2A 2BWSA 5FCHA 1XGSA 2EA2A 3L24A 2OAZA 3BITA 4FKCA 3PKAA 4U75A 3PEBA 2GU5A 1WY2A 2GG5A 3IG4A 5CNXA 2GG2A 4S00A 2GGBA 3MX6A 4FO8A 1R5GA 4IECA 3TB5A 4RGZ1 2Q93A 1QXWA 3S6BA 1R5HA 2ADUA 4U6ZA 4FLJA 4RZZA 2Q8KA 2V3XA 4IF7A 2NQ6A 2V6CA 5CIKA 3PN9A 5CDVA 4PNCA 2B3HA 2BWWA 2BHCA 1QXZA 1KP0A 2BH3A 2V3YA 2MATA 4R60A 4ZWPA 2EVCA 1B59A 5JFRA 2BWUA 4FLKA 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6W A;  3IL0 A;  2Q92 A;  2GG8 A;  4U6E A;  3CB5 A;  1MAT A;  2EA4 A;  1W7V A;  4IKU A;  1QXY A;  4FUK A;  2BWV A;  1KQ0 A;  1PV9 A;  1WKM A;  1WLR A;  2OKN A;  2NQ7 A;  2GG9 A;  2GU4 A;  1O0X A;  5CLS A;  4MAT A;  4U6J A;  2P9A A;  2V3Z A;  3Q6D A;  4IKS A;  3OOO A;  3L7G A;  1YJ3 A;  5D6E A;  4FLL A;  4S01 A;  1Y1N A;  2BHA A;  3FMR A;  4FLI A;  1XGN A;  2Q96 A;  4IKT A;  4Z7M A;  4ZWO A;  2DFI A;  3QOC A;  5D6F A;  1YW7 A;  4JUQ A;  1JAW A;  1W2M A;  3PKC A;  5JI6 A;  2GG7 A;  4PV4 A;  2GGC A;  1XNZ A;  2BHD A;  3ROR A;  1WBQ A;  1C21 A;  3IU8 A;  1R58 A;  2GG3 A;  2G6P A;  4RZY A;  2EVM A;  4IU6 A;  2B3K A;  3TAV A;  1C24 A;  2ZSG A;  2P99 A;  4QR8 A;  1YW9 A;  3BIP A;  1N51 A;  3FMQ A;  2BWT A;  3PKD A;  1WN1 A;  5E2C A;  2GTX A;  4U76 A;  3IU7 A;  1BN5 A;  2BWX A;  3IU9 A;  3CB6 A;  3PKB A;  4OOK A;  4U69 A;  1YW8 A;  1M35 A;  2B3L A;  4U73 A;  4U1B A;  5CDE A;  4ZNG A;  3MR1 A;  3BIQ A;  1WL6 A;  1YVM A;  5CE6 A;  4A6W A;  4KM3 A;  2BB7 A;  3OVK A;  4S2T P;  2Q95 A;  2GA2 A;  2GU7 A;  2GU6 A;  3PKE A;  3MAT A;  2BWY A;  4IPA A;  5CDL A;  1C22 A;  5JHU A;  1A16 A;  1QZY A;  4IKR A;  1CHM A;  4EGE A;  1BOA A;  4U6C A;  4U71 A;  2EVO A;  1XGM A;  2P98 A;  3O5V A;  2BN7 A;  5E5B A;  2GZ5 A;  4S2R P;  4IDY A;  4A6V A;  2Q94 A;  4B28 A;  2GG0 A;  3FM3 A;  3I7M A;  4FO7 A;  2HOW A;  5FCF A;  1KQ9 A;  3CTZ A;  1C27 A;  1WL9 A;  3D27 A;  1B6A A;  1C23 A;  4ZWU A;  1XGO A;  4HXX A;  4U70 A;  3RVA A;  2IW2 A;  2BWS A;  5FCH A;  1XGS A;  2EA2 A;  3L24 A;  2OAZ A;  3BIT A;  4FKC A;  3PKA A;  4U75 A;  3PEB A;  2GU5 A;  1WY2 A;  2GG5 A;  3IG4 A;  5CNX A;  2GG2 A;  4S00 A;  2GGB A;  3MX6 A;  4FO8 A;  1R5G A;  4IEC A;  3TB5 A;  4RGZ 1;  2Q93 A;  1QXW A;  3S6B A;  1R5H A;  2ADU A;  4U6Z A;  4FLJ A;  4RZZ A;  2Q8K A;  2V3X A;  4IF7 A;  2NQ6 A;  2V6C A;  5CIK A;  3PN9 A;  5CDV A;  4PNC A;  2B3H A;  2BWW A;  2BHC A;  1QXZ A;  1KP0 A;  2BH3 A;  2V3Y A;  2MAT A;  4R60 A;  4ZWP A;  2EVC A;  1B59 A;  5JFR A;  2BWU A;  4FLK A;  2BHB A; 
#chains in the Genus database with same CATH topology
 4U6W A;  3IL0 A;  2Q92 A;  2GG8 A;  4U6E A;  3CB5 A;  1MAT A;  2EA4 A;  1W7V A;  4IKU A;  1QXY A;  4FUK A;  2BWV A;  1KQ0 A;  1PV9 A;  1WKM A;  1WLR A;  2OKN A;  2NQ7 A;  2GG9 A;  2GU4 A;  1O0X A;  5CLS A;  4MAT A;  4U6J A;  2P9A A;  2V3Z A;  3Q6D A;  4IKS A;  3OOO A;  3L7G A;  1YJ3 A;  5D6E A;  4FLL A;  4S01 A;  1Y1N A;  2BHA A;  3FMR A;  4FLI A;  1XGN A;  2Q96 A;  4IKT A;  4Z7M A;  4ZWO A;  2DFI A;  3QOC A;  5D6F A;  1YW7 A;  4JUQ A;  1JAW A;  1W2M A;  3PKC A;  5JI6 A;  2GG7 A;  4PV4 A;  2GGC A;  1XNZ A;  2BHD A;  3ROR A;  1WBQ A;  1C21 A;  3IU8 A;  1R58 A;  2GG3 A;  2G6P A;  4RZY A;  2EVM A;  4IU6 A;  2B3K A;  3TAV A;  1C24 A;  2ZSG A;  2P99 A;  4QR8 A;  1YW9 A;  3BIP A;  1N51 A;  3FMQ A;  2BWT A;  3PKD A;  1WN1 A;  5E2C A;  2GTX A;  4U76 A;  3IU7 A;  1BN5 A;  2BWX A;  3IU9 A;  3CB6 A;  3PKB A;  4OOK A;  4U69 A;  1YW8 A;  1M35 A;  2B3L A;  4U73 A;  4U1B A;  5CDE A;  4ZNG A;  3MR1 A;  3BIQ A;  1WL6 A;  1YVM A;  5CE6 A;  4A6W A;  4KM3 A;  2BB7 A;  3OVK A;  4S2T P;  2Q95 A;  2GA2 A;  2GU7 A;  2GU6 A;  3PKE A;  3MAT A;  2BWY A;  4IPA A;  5CDL A;  1C22 A;  5JHU A;  1A16 A;  1QZY A;  4IKR A;  1CHM A;  4EGE A;  1BOA A;  4U6C A;  4U71 A;  2EVO A;  1XGM A;  2P98 A;  3O5V A;  2BN7 A;  5E5B A;  2GZ5 A;  4S2R P;  4IDY A;  4A6V A;  2Q94 A;  4B28 A;  2GG0 A;  3FM3 A;  3I7M A;  4FO7 A;  2HOW A;  5FCF A;  1KQ9 A;  3CTZ A;  1C27 A;  1WL9 A;  3D27 A;  1B6A A;  1C23 A;  4ZWU A;  1XGO A;  4HXX A;  4U70 A;  3RVA A;  2IW2 A;  2BWS A;  5FCH A;  1XGS A;  2EA2 A;  3L24 A;  2OAZ A;  3BIT A;  4FKC A;  3PKA A;  4U75 A;  3PEB A;  2GU5 A;  1WY2 A;  2GG5 A;  3IG4 A;  5CNX A;  2GG2 A;  4S00 A;  2GGB A;  3MX6 A;  4FO8 A;  1R5G A;  4IEC A;  3TB5 A;  4RGZ 1;  2Q93 A;  1QXW A;  3S6B A;  1R5H A;  2ADU A;  4U6Z A;  4FLJ A;  4RZZ A;  2Q8K A;  2V3X A;  4IF7 A;  2NQ6 A;  2V6C A;  5CIK A;  3PN9 A;  5CDV A;  4PNC A;  2B3H A;  2BWW A;  2BHC A;  1QXZ A;  1KP0 A;  2BH3 A;  2V3Y A;  2MAT A;  4R60 A;  4ZWP A;  2EVC A;  1B59 A;  5JFR A;  2BWU A;  4FLK A;  2BHB A; 
#chains in the Genus database with same CATH homology
 4U6W A;  3IL0 A;  2Q92 A;  2GG8 A;  4U6E A;  3CB5 A;  1MAT A;  2EA4 A;  1W7V A;  4IKU A;  1QXY A;  4FUK A;  2BWV A;  1KQ0 A;  1PV9 A;  1WKM A;  1WLR A;  2OKN A;  2NQ7 A;  2GG9 A;  2GU4 A;  1O0X A;  5CLS A;  4MAT A;  4U6J A;  2P9A A;  2V3Z A;  3Q6D A;  4IKS A;  3OOO A;  3L7G A;  1YJ3 A;  5D6E A;  4FLL A;  4S01 A;  1Y1N A;  2BHA A;  3FMR A;  4FLI A;  1XGN A;  2Q96 A;  4IKT A;  4Z7M A;  4ZWO A;  2DFI A;  3QOC A;  5D6F A;  1YW7 A;  4JUQ A;  1JAW A;  1W2M A;  3PKC A;  5JI6 A;  2GG7 A;  4PV4 A;  2GGC A;  1XNZ A;  2BHD A;  3ROR A;  1WBQ A;  1C21 A;  3IU8 A;  1R58 A;  2GG3 A;  2G6P A;  4RZY A;  2EVM A;  4IU6 A;  2B3K A;  3TAV A;  1C24 A;  2ZSG A;  2P99 A;  4QR8 A;  1YW9 A;  3BIP A;  1N51 A;  3FMQ A;  2BWT A;  3PKD A;  1WN1 A;  5E2C A;  2GTX A;  4U76 A;  3IU7 A;  1BN5 A;  2BWX A;  3IU9 A;  3CB6 A;  3PKB A;  4OOK A;  4U69 A;  1YW8 A;  1M35 A;  2B3L A;  4U73 A;  4U1B A;  5CDE A;  4ZNG A;  3MR1 A;  3BIQ A;  1WL6 A;  1YVM A;  5CE6 A;  4A6W A;  4KM3 A;  2BB7 A;  3OVK A;  4S2T P;  2Q95 A;  2GA2 A;  2GU7 A;  2GU6 A;  3PKE A;  3MAT A;  2BWY A;  4IPA A;  5CDL A;  1C22 A;  5JHU A;  1A16 A;  1QZY A;  4IKR A;  1CHM A;  4EGE A;  1BOA A;  4U6C A;  4U71 A;  2EVO A;  1XGM A;  2P98 A;  3O5V A;  2BN7 A;  5E5B A;  2GZ5 A;  4S2R P;  4IDY A;  4A6V A;  2Q94 A;  4B28 A;  2GG0 A;  3FM3 A;  3I7M A;  4FO7 A;  2HOW A;  5FCF A;  1KQ9 A;  3CTZ A;  1C27 A;  1WL9 A;  3D27 A;  1B6A A;  1C23 A;  4ZWU A;  1XGO A;  4HXX A;  4U70 A;  3RVA A;  2IW2 A;  2BWS A;  5FCH A;  1XGS A;  2EA2 A;  3L24 A;  2OAZ A;  3BIT A;  4FKC A;  3PKA A;  4U75 A;  3PEB A;  2GU5 A;  1WY2 A;  2GG5 A;  3IG4 A;  5CNX A;  2GG2 A;  4S00 A;  2GGB A;  3MX6 A;  4FO8 A;  1R5G A;  4IEC A;  3TB5 A;  4RGZ 1;  2Q93 A;  1QXW A;  3S6B A;  1R5H A;  2ADU A;  4U6Z A;  4FLJ A;  4RZZ A;  2Q8K A;  2V3X A;  4IF7 A;  2NQ6 A;  2V6C A;  5CIK A;  3PN9 A;  5CDV A;  4PNC A;  2B3H A;  2BWW A;  2BHC A;  1QXZ A;  1KP0 A;  2BH3 A;  2V3Y A;  2MAT A;  4R60 A;  4ZWP A;  2EVC A;  1B59 A;  5JFR A;  2BWU A;  4FLK A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...