1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proline peptidase
molecule keywords AMINOPEPTIDASE P
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
3BIQA 1WBQA 3I7MA 1XGOA 1O0XA 4A6WA 1Y1NA 2BWYA 4IKRA 2GTXA 4IKTA 1WKMA 3PKDA 5D6EA 2NQ7A 2BN7A 1QXWA 2B3LA 2GU7A 3FMRA 4S2TP 3RORA 5E5BA 4RGZ1 4IU6A 2GU4A 2Q92A 1C24A 3L7GA 2G6PA 1R5GA 5D6FA 3S6BA 4B28A 3FM3A 3IU9A 1BOAA 1YW8A 4FLLA 5CLSA 4S01A 5JI6A 2V6CA 2EVMA 4ZWPA 1BN5A 2MATA 5CDLA 2GU6A 2BWXA 2IW2A 3PKAA 2V3ZA 4RZZA 4PV4A 2GA2A 3PKCA 4U71A 5CNXA 2P9AA 4FLJA 4U75A 5JFRA 1YJ3A 3OOOA 2GG3A 3CTZA 4U69A 1B6AA 2EVOA 4IF7A 4KM3A 1B59A 2OAZA 1YW7A 2BHDA 3O5VA 2P98A 4FO8A 2BWWA 1XGNA 4FLIA 2OKNA 4QR8A 4U73A 2Q8KA 2V3XA 2GG5A 1XGMA 4HXXA 1KQ9A 3QOCA 2GG7A 3D27A 1C23A 3L24A 2B3KA 1N51A 1PV9A 1WN1A 4RZYA 4ZNGA 1XGSA 1MATA 1C22A 3TAVA 4U6ZA 3OVKA 4U1BA 1WL9A 1YW9A 5CDVA 3PN9A 4S00A 4S2RP 2NQ6A 1WY2A 1C21A 3PEBA 1KP0A 4ZWUA 2Q95A 4MATA 3CB6A 4IPAA 4U6WA 2EA4A 3PKEA 3FMQA 5FCHA 1QZYA 2GU5A 2GG8A 1W2MA 4IDYA 4U70A 3BIPA 2B3HA 3MATA 1WLRA 1YVMA 2ZSGA 3RVAA 4FO7A 4ZWOA 1C27A 3IU8A 1WL6A 4IKSA 5CIKA 4U6CA 3Q6DA 2GG2A 1QXZA 4Z7MA 3TB5A 1A16A 2DFIA 1W7VA 3CB5A 2P99A 5JHUA 2BWTA 2GGBA 1QXYA 2BWVA 2Q93A 2HOWA 1XNZA 4R60A 4FLKA 1KQ0A 2BH3A 4OOKA 1CHMA 4U6EA 2BHCA 4U6JA 4JUQA 2GZ5A 2BWUA 4FKCA 5CE6A 2V3YA 1R5HA 2GG0A 3MR1A 1R58A 4FUKA 2Q96A 3PKBA 3IU7A 5FCFA 3IG4A 2BWSA 5E2CA 3MX6A 2GGCA 2BB7A 2GG9A 4A6VA 5CDEA 3BITA 4PNCA 4U76A 2Q94A 2EA2A 4EGEA 1M35A 2BHBA 4IECA 3IL0A 2EVCA 2ADUA 4IKUA 2BHAA 1JAWA
chains in the Genus database with same CATH superfamily
3BIQA 1WBQA 3I7MA 1XGOA 1O0XA 4A6WA 1Y1NA 2BWYA 4IKRA 2GTXA 4IKTA 1WKMA 3PKDA 5D6EA 2NQ7A 2BN7A 1QXWA 2B3LA 2GU7A 3FMRA 4S2TP 3RORA 5E5BA 4RGZ1 4IU6A 2GU4A 2Q92A 1C24A 3L7GA 2G6PA 1R5GA 5D6FA 3S6BA 4B28A 3FM3A 3IU9A 1BOAA 1YW8A 4FLLA 5CLSA 4S01A 5JI6A 2V6CA 2EVMA 4ZWPA 1BN5A 2MATA 5CDLA 2GU6A 2BWXA 2IW2A 3PKAA 2V3ZA 4RZZA 4PV4A 2GA2A 3PKCA 4U71A 5CNXA 2P9AA 4FLJA 4U75A 5JFRA 1YJ3A 3OOOA 2GG3A 3CTZA 4U69A 1B6AA 2EVOA 4IF7A 4KM3A 1B59A 2OAZA 1YW7A 2BHDA 3O5VA 2P98A 4FO8A 2BWWA 1XGNA 4FLIA 2OKNA 4QR8A 4U73A 2Q8KA 2V3XA 2GG5A 1XGMA 4HXXA 1KQ9A 3QOCA 2GG7A 3D27A 1C23A 3L24A 2B3KA 1N51A 1PV9A 1WN1A 4RZYA 4ZNGA 1XGSA 1MATA 1C22A 3TAVA 4U6ZA 3OVKA 4U1BA 1WL9A 1YW9A 5CDVA 3PN9A 4S00A 4S2RP 2NQ6A 1WY2A 1C21A 3PEBA 1KP0A 4ZWUA 2Q95A 4MATA 3CB6A 4IPAA 4U6WA 2EA4A 3PKEA 3FMQA 5FCHA 1QZYA 2GU5A 2GG8A 1W2MA 4IDYA 4U70A 3BIPA 2B3HA 3MATA 1WLRA 1YVMA 2ZSGA 3RVAA 4FO7A 4ZWOA 1C27A 3IU8A 1WL6A 4IKSA 5CIKA 4U6CA 3Q6DA 2GG2A 1QXZA 4Z7MA 3TB5A 1A16A 2DFIA 1W7VA 3CB5A 2P99A 5JHUA 2BWTA 2GGBA 1QXYA 2BWVA 2Q93A 2HOWA 1XNZA 4R60A 4FLKA 1KQ0A 2BH3A 4OOKA 1CHMA 4U6EA 2BHCA 4U6JA 4JUQA 2GZ5A 2BWUA 4FKCA 5CE6A 2V3YA 1R5HA 2GG0A 3MR1A 1R58A 4FUKA 2Q96A 3PKBA 3IU7A 5FCFA 3IG4A 2BWSA 5E2CA 3MX6A 2GGCA 2BB7A 2GG9A 4A6VA 5CDEA 3BITA 4PNCA 4U76A 2Q94A 2EA2A 4EGEA 1M35A 2BHBA 4IECA 3IL0A 2EVCA 2ADUA 4IKUA 2BHAA 1JAWA
chains in the Genus database with same CATH topology
3BIQA 1WBQA 3I7MA 1XGOA 1O0XA 4A6WA 1Y1NA 2BWYA 4IKRA 2GTXA 4IKTA 1WKMA 3PKDA 5D6EA 2NQ7A 2BN7A 1QXWA 2B3LA 2GU7A 3FMRA 4S2TP 3RORA 5E5BA 4RGZ1 4IU6A 2GU4A 2Q92A 1C24A 3L7GA 2G6PA 1R5GA 5D6FA 3S6BA 4B28A 3FM3A 3IU9A 1BOAA 1YW8A 4FLLA 5CLSA 4S01A 5JI6A 2V6CA 2EVMA 4ZWPA 1BN5A 2MATA 5CDLA 2GU6A 2BWXA 2IW2A 3PKAA 2V3ZA 4RZZA 4PV4A 2GA2A 3PKCA 4U71A 5CNXA 2P9AA 4FLJA 4U75A 5JFRA 1YJ3A 3OOOA 2GG3A 3CTZA 4U69A 1B6AA 2EVOA 4IF7A 4KM3A 1B59A 2OAZA 1YW7A 2BHDA 3O5VA 2P98A 4FO8A 2BWWA 1XGNA 4FLIA 2OKNA 4QR8A 4U73A 2Q8KA 2V3XA 2GG5A 1XGMA 4HXXA 1KQ9A 3QOCA 2GG7A 3D27A 1C23A 3L24A 2B3KA 1N51A 1PV9A 1WN1A 4RZYA 4ZNGA 1XGSA 1MATA 1C22A 3TAVA 4U6ZA 3OVKA 4U1BA 1WL9A 1YW9A 5CDVA 3PN9A 4S00A 4S2RP 2NQ6A 1WY2A 1C21A 3PEBA 1KP0A 4ZWUA 2Q95A 4MATA 3CB6A 4IPAA 4U6WA 2EA4A 3PKEA 3FMQA 5FCHA 1QZYA 2GU5A 2GG8A 1W2MA 4IDYA 4U70A 3BIPA 2B3HA 3MATA 1WLRA 1YVMA 2ZSGA 3RVAA 4FO7A 4ZWOA 1C27A 3IU8A 1WL6A 4IKSA 5CIKA 4U6CA 3Q6DA 2GG2A 1QXZA 4Z7MA 3TB5A 1A16A 2DFIA 1W7VA 3CB5A 2P99A 5JHUA 2BWTA 2GGBA 1QXYA 2BWVA 2Q93A 2HOWA 1XNZA 4R60A 4FLKA 1KQ0A 2BH3A 4OOKA 1CHMA 4U6EA 2BHCA 4U6JA 4JUQA 2GZ5A 2BWUA 4FKCA 5CE6A 2V3YA 1R5HA 2GG0A 3MR1A 1R58A 4FUKA 2Q96A 3PKBA 3IU7A 5FCFA 3IG4A 2BWSA 5E2CA 3MX6A 2GGCA 2BB7A 2GG9A 4A6VA 5CDEA 3BITA 4PNCA 4U76A 2Q94A 2EA2A 4EGEA 1M35A 2BHBA 4IECA 3IL0A 2EVCA 2ADUA 4IKUA 2BHAA 1JAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  1WBQ A;  3I7M A;  1XGO A;  1O0X A;  4A6W A;  1Y1N A;  2BWY A;  4IKR A;  2GTX A;  4IKT A;  1WKM A;  3PKD A;  5D6E A;  2NQ7 A;  2BN7 A;  1QXW A;  2B3L A;  2GU7 A;  3FMR A;  4S2T P;  3ROR A;  5E5B A;  4RGZ 1;  4IU6 A;  2GU4 A;  2Q92 A;  1C24 A;  3L7G A;  2G6P A;  1R5G A;  5D6F A;  3S6B A;  4B28 A;  3FM3 A;  3IU9 A;  1BOA A;  1YW8 A;  4FLL A;  5CLS A;  4S01 A;  5JI6 A;  2V6C A;  2EVM A;  4ZWP A;  1BN5 A;  2MAT A;  5CDL A;  2GU6 A;  2BWX A;  2IW2 A;  3PKA A;  2V3Z A;  4RZZ A;  4PV4 A;  2GA2 A;  3PKC A;  4U71 A;  5CNX A;  2P9A A;  4FLJ A;  4U75 A;  5JFR A;  1YJ3 A;  3OOO A;  2GG3 A;  3CTZ A;  4U69 A;  1B6A A;  2EVO A;  4IF7 A;  4KM3 A;  1B59 A;  2OAZ A;  1YW7 A;  2BHD A;  3O5V A;  2P98 A;  4FO8 A;  2BWW A;  1XGN A;  4FLI A;  2OKN A;  4QR8 A;  4U73 A;  2Q8K A;  2V3X A;  2GG5 A;  1XGM A;  4HXX A;  1KQ9 A;  3QOC A;  2GG7 A;  3D27 A;  1C23 A;  3L24 A;  2B3K A;  1N51 A;  1PV9 A;  1WN1 A;  4RZY A;  4ZNG A;  1XGS A;  1MAT A;  1C22 A;  3TAV A;  4U6Z A;  3OVK A;  4U1B A;  1WL9 A;  1YW9 A;  5CDV A;  3PN9 A;  4S00 A;  4S2R P;  2NQ6 A;  1WY2 A;  1C21 A;  3PEB A;  1KP0 A;  4ZWU A;  2Q95 A;  4MAT A;  3CB6 A;  4IPA A;  4U6W A;  2EA4 A;  3PKE A;  3FMQ A;  5FCH A;  1QZY A;  2GU5 A;  2GG8 A;  1W2M A;  4IDY A;  4U70 A;  3BIP A;  2B3H A;  3MAT A;  1WLR A;  1YVM A;  2ZSG A;  3RVA A;  4FO7 A;  4ZWO A;  1C27 A;  3IU8 A;  1WL6 A;  4IKS A;  5CIK A;  4U6C A;  3Q6D A;  2GG2 A;  1QXZ A;  4Z7M A;  3TB5 A;  1A16 A;  2DFI A;  1W7V A;  3CB5 A;  2P99 A;  5JHU A;  2BWT A;  2GGB A;  1QXY A;  2BWV A;  2Q93 A;  2HOW A;  1XNZ A;  4R60 A;  4FLK A;  1KQ0 A;  2BH3 A;  4OOK A;  1CHM A;  4U6E A;  2BHC A;  4U6J A;  4JUQ A;  2GZ5 A;  2BWU A;  4FKC A;  5CE6 A;  2V3Y A;  1R5H A;  2GG0 A;  3MR1 A;  1R58 A;  4FUK A;  2Q96 A;  3PKB A;  3IU7 A;  5FCF A;  3IG4 A;  2BWS A;  5E2C A;  3MX6 A;  2GGC A;  2BB7 A;  2GG9 A;  4A6V A;  5CDE A;  3BIT A;  4PNC A;  4U76 A;  2Q94 A;  2EA2 A;  4EGE A;  1M35 A;  2BHB A;  4IEC A;  3IL0 A;  2EVC A;  2ADU A;  4IKU A;  2BHA A;  1JAW A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  1WBQ A;  3I7M A;  1XGO A;  1O0X A;  4A6W A;  1Y1N A;  2BWY A;  4IKR A;  2GTX A;  4IKT A;  1WKM A;  3PKD A;  5D6E A;  2NQ7 A;  2BN7 A;  1QXW A;  2B3L A;  2GU7 A;  3FMR A;  4S2T P;  3ROR A;  5E5B A;  4RGZ 1;  4IU6 A;  2GU4 A;  2Q92 A;  1C24 A;  3L7G A;  2G6P A;  1R5G A;  5D6F A;  3S6B A;  4B28 A;  3FM3 A;  3IU9 A;  1BOA A;  1YW8 A;  4FLL A;  5CLS A;  4S01 A;  5JI6 A;  2V6C A;  2EVM A;  4ZWP A;  1BN5 A;  2MAT A;  5CDL A;  2GU6 A;  2BWX A;  2IW2 A;  3PKA A;  2V3Z A;  4RZZ A;  4PV4 A;  2GA2 A;  3PKC A;  4U71 A;  5CNX A;  2P9A A;  4FLJ A;  4U75 A;  5JFR A;  1YJ3 A;  3OOO A;  2GG3 A;  3CTZ A;  4U69 A;  1B6A A;  2EVO A;  4IF7 A;  4KM3 A;  1B59 A;  2OAZ A;  1YW7 A;  2BHD A;  3O5V A;  2P98 A;  4FO8 A;  2BWW A;  1XGN A;  4FLI A;  2OKN A;  4QR8 A;  4U73 A;  2Q8K A;  2V3X A;  2GG5 A;  1XGM A;  4HXX A;  1KQ9 A;  3QOC A;  2GG7 A;  3D27 A;  1C23 A;  3L24 A;  2B3K A;  1N51 A;  1PV9 A;  1WN1 A;  4RZY A;  4ZNG A;  1XGS A;  1MAT A;  1C22 A;  3TAV A;  4U6Z A;  3OVK A;  4U1B A;  1WL9 A;  1YW9 A;  5CDV A;  3PN9 A;  4S00 A;  4S2R P;  2NQ6 A;  1WY2 A;  1C21 A;  3PEB A;  1KP0 A;  4ZWU A;  2Q95 A;  4MAT A;  3CB6 A;  4IPA A;  4U6W A;  2EA4 A;  3PKE A;  3FMQ A;  5FCH A;  1QZY A;  2GU5 A;  2GG8 A;  1W2M A;  4IDY A;  4U70 A;  3BIP A;  2B3H A;  3MAT A;  1WLR A;  1YVM A;  2ZSG A;  3RVA A;  4FO7 A;  4ZWO A;  1C27 A;  3IU8 A;  1WL6 A;  4IKS A;  5CIK A;  4U6C A;  3Q6D A;  2GG2 A;  1QXZ A;  4Z7M A;  3TB5 A;  1A16 A;  2DFI A;  1W7V A;  3CB5 A;  2P99 A;  5JHU A;  2BWT A;  2GGB A;  1QXY A;  2BWV A;  2Q93 A;  2HOW A;  1XNZ A;  4R60 A;  4FLK A;  1KQ0 A;  2BH3 A;  4OOK A;  1CHM A;  4U6E A;  2BHC A;  4U6J A;  4JUQ A;  2GZ5 A;  2BWU A;  4FKC A;  5CE6 A;  2V3Y A;  1R5H A;  2GG0 A;  3MR1 A;  1R58 A;  4FUK A;  2Q96 A;  3PKB A;  3IU7 A;  5FCF A;  3IG4 A;  2BWS A;  5E2C A;  3MX6 A;  2GGC A;  2BB7 A;  2GG9 A;  4A6V A;  5CDE A;  3BIT A;  4PNC A;  4U76 A;  2Q94 A;  2EA2 A;  4EGE A;  1M35 A;  2BHB A;  4IEC A;  3IL0 A;  2EVC A;  2ADU A;  4IKU A;  2BHA A;  1JAW A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  1WBQ A;  3I7M A;  1XGO A;  1O0X A;  4A6W A;  1Y1N A;  2BWY A;  4IKR A;  2GTX A;  4IKT A;  1WKM A;  3PKD A;  5D6E A;  2NQ7 A;  2BN7 A;  1QXW A;  2B3L A;  2GU7 A;  3FMR A;  4S2T P;  3ROR A;  5E5B A;  4RGZ 1;  4IU6 A;  2GU4 A;  2Q92 A;  1C24 A;  3L7G A;  2G6P A;  1R5G A;  5D6F A;  3S6B A;  4B28 A;  3FM3 A;  3IU9 A;  1BOA A;  1YW8 A;  4FLL A;  5CLS A;  4S01 A;  5JI6 A;  2V6C A;  2EVM A;  4ZWP A;  1BN5 A;  2MAT A;  5CDL A;  2GU6 A;  2BWX A;  2IW2 A;  3PKA A;  2V3Z A;  4RZZ A;  4PV4 A;  2GA2 A;  3PKC A;  4U71 A;  5CNX A;  2P9A A;  4FLJ A;  4U75 A;  5JFR A;  1YJ3 A;  3OOO A;  2GG3 A;  3CTZ A;  4U69 A;  1B6A A;  2EVO A;  4IF7 A;  4KM3 A;  1B59 A;  2OAZ A;  1YW7 A;  2BHD A;  3O5V A;  2P98 A;  4FO8 A;  2BWW A;  1XGN A;  4FLI A;  2OKN A;  4QR8 A;  4U73 A;  2Q8K A;  2V3X A;  2GG5 A;  1XGM A;  4HXX A;  1KQ9 A;  3QOC A;  2GG7 A;  3D27 A;  1C23 A;  3L24 A;  2B3K A;  1N51 A;  1PV9 A;  1WN1 A;  4RZY A;  4ZNG A;  1XGS A;  1MAT A;  1C22 A;  3TAV A;  4U6Z A;  3OVK A;  4U1B A;  1WL9 A;  1YW9 A;  5CDV A;  3PN9 A;  4S00 A;  4S2R P;  2NQ6 A;  1WY2 A;  1C21 A;  3PEB A;  1KP0 A;  4ZWU A;  2Q95 A;  4MAT A;  3CB6 A;  4IPA A;  4U6W A;  2EA4 A;  3PKE A;  3FMQ A;  5FCH A;  1QZY A;  2GU5 A;  2GG8 A;  1W2M A;  4IDY A;  4U70 A;  3BIP A;  2B3H A;  3MAT A;  1WLR A;  1YVM A;  2ZSG A;  3RVA A;  4FO7 A;  4ZWO A;  1C27 A;  3IU8 A;  1WL6 A;  4IKS A;  5CIK A;  4U6C A;  3Q6D A;  2GG2 A;  1QXZ A;  4Z7M A;  3TB5 A;  1A16 A;  2DFI A;  1W7V A;  3CB5 A;  2P99 A;  5JHU A;  2BWT A;  2GGB A;  1QXY A;  2BWV A;  2Q93 A;  2HOW A;  1XNZ A;  4R60 A;  4FLK A;  1KQ0 A;  2BH3 A;  4OOK A;  1CHM A;  4U6E A;  2BHC A;  4U6J A;  4JUQ A;  2GZ5 A;  2BWU A;  4FKC A;  5CE6 A;  2V3Y A;  1R5H A;  2GG0 A;  3MR1 A;  1R58 A;  4FUK A;  2Q96 A;  3PKB A;  3IU7 A;  5FCF A;  3IG4 A;  2BWS A;  5E2C A;  3MX6 A;  2GGC A;  2BB7 A;  2GG9 A;  4A6V A;  5CDE A;  3BIT A;  4PNC A;  4U76 A;  2Q94 A;  2EA2 A;  4EGE A;  1M35 A;  2BHB A;  4IEC A;  3IL0 A;  2EVC A;  2ADU A;  4IKU A;  2BHA A;  1JAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...