1JAWA

Aminopeptidase p from e. coli low ph form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWYGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Proline peptidase
total genus 151
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1jawA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1jawA02
3QOCA 4U6ZA 1WBQA 2GU7A 2ADUA 4ZNGA 1W2MA 2EVCA 3O5VA 3TAVA 5FCHA 4S2TP 2P9AA 4FO8A 2BWUA 5FCFA 4A6WA 1C24A 2GG0A 3RORA 1MATA 5D6FA 2EVMA 4IKRA 1C27A 4U6WA 4U6CA 2HOWA 1B59A 3FMQA 1CHMA 1PV9A 2BWWA 2GGCA 2GA2A 1YVMA 2NQ7A 2EA2A 4B28A 5CIKA 4RZZA 2P99A 1N51A 5D6EA 2B3LA 4MATA 1WN1A 3I7MA 4IPAA 3CB5A 1WL6A 4S00A 2GU5A 4IKSA 1M35A 4ZWPA 4RGZ1 3OOOA 1WY2A 1O0XA 5CNXA 1YJ3A 2Q93A 4FUKA 2DFIA 3CTZA 1R5GA 2G6PA 2GTXA 2GU4A 2NQ6A 4FO7A 4IKUA 4PNCA 2Q94A 4U6JA 4JUQA 2B3HA 2IW2A 1BOAA 4PV4A 3IL0A 1QXWA 4FLJA 3L7GA 1YW9A 5CLSA 2BB7A 1A16A 5E2CA 3PN9A 4A6VA 2BHAA 2Q96A 4RZYA 1QXZA 3RVAA 2EVOA 4IKTA 1KQ9A 4FLKA 3BITA 3IG4A 2BWVA 2V3ZA 2GG8A 5CDEA 3BIPA 3CB6A 3FM3A 3D27A 2EA4A 3PEBA 3IU8A 3BIQA 5E5BA 2ZSGA 4U71A 4ZWUA 3MATA 1WLRA 4EGEA 2MATA 1C22A 1QZYA 5CDLA 1WKMA 2B3KA 2BWSA 3PKEA 2Q95A 4U69A 4U6EA 2BWYA 4IECA 4QR8A 2BN7A 5JFRA 2P98A 3MR1A 4U76A 2OKNA 2GG9A 4ZWOA 2GG7A 1XNZA 2OAZA 1QXYA 1R58A 3PKAA 3PKCA 3PKBA 4U75A 1XGOA 4U1BA 2GG5A 4S01A 2GGBA 2BWTA 3TB5A 3MX6A 4IDYA 1XGSA 2BHDA 5CDVA 4OOKA 3PKDA 5CE6A 3S6BA 4KM3A 2Q8KA 2BWXA 4Z7MA 3Q6DA 1YW7A 1BN5A 4FLLA 4FKCA 2V6CA 1KQ0A 1XGMA 4IU6A 4U73A 2BHBA 2V3XA 1W7VA 4S2RP 1C23A 1XGNA 4IF7A 4U70A 4FLIA 5JI6A 3IU9A 4HXXA 4R60A 1WL9A 2GG3A 1Y1NA 2GZ5A 2Q92A 1KP0A 2BH3A 3FMRA 1B6AA 2GU6A 2V3YA 1JAWA 1R5HA 1YW8A 2GG2A 3IU7A 3L24A 2BHCA 5JHUA 1C21A 3OVKA
chains in the Genus database with same CATH superfamily
3QOCA 4U6ZA 1WBQA 2GU7A 2ADUA 4ZNGA 1W2MA 2EVCA 3O5VA 3TAVA 5FCHA 4S2TP 2P9AA 4FO8A 2BWUA 5FCFA 4A6WA 1C24A 2GG0A 3RORA 1MATA 5D6FA 2EVMA 4IKRA 1C27A 4U6WA 4U6CA 2HOWA 1B59A 3FMQA 1CHMA 1PV9A 2BWWA 2GGCA 2GA2A 1YVMA 2NQ7A 2EA2A 4B28A 5CIKA 4RZZA 2P99A 1N51A 5D6EA 2B3LA 4MATA 1WN1A 3I7MA 4IPAA 3CB5A 1WL6A 4S00A 2GU5A 4IKSA 1M35A 4ZWPA 4RGZ1 3OOOA 1WY2A 1O0XA 5CNXA 1YJ3A 2Q93A 4FUKA 2DFIA 3CTZA 1R5GA 2G6PA 2GTXA 2GU4A 2NQ6A 4FO7A 4IKUA 4PNCA 2Q94A 4U6JA 4JUQA 2B3HA 2IW2A 1BOAA 4PV4A 3IL0A 1QXWA 4FLJA 3L7GA 1YW9A 5CLSA 2BB7A 1A16A 5E2CA 3PN9A 4A6VA 2BHAA 2Q96A 4RZYA 1QXZA 3RVAA 2EVOA 4IKTA 1KQ9A 4FLKA 3BITA 3IG4A 2BWVA 2V3ZA 2GG8A 5CDEA 3BIPA 3CB6A 3FM3A 3D27A 2EA4A 3PEBA 3IU8A 3BIQA 5E5BA 2ZSGA 4U71A 4ZWUA 3MATA 1WLRA 4EGEA 2MATA 1C22A 1QZYA 5CDLA 1WKMA 2B3KA 2BWSA 3PKEA 2Q95A 4U69A 4U6EA 2BWYA 4IECA 4QR8A 2BN7A 5JFRA 2P98A 3MR1A 4U76A 2OKNA 2GG9A 4ZWOA 2GG7A 1XNZA 2OAZA 1QXYA 1R58A 3PKAA 3PKCA 3PKBA 4U75A 1XGOA 4U1BA 2GG5A 4S01A 2GGBA 2BWTA 3TB5A 3MX6A 4IDYA 1XGSA 2BHDA 5CDVA 4OOKA 3PKDA 5CE6A 3S6BA 4KM3A 2Q8KA 2BWXA 4Z7MA 3Q6DA 1YW7A 1BN5A 4FLLA 4FKCA 2V6CA 1KQ0A 1XGMA 4IU6A 4U73A 2BHBA 2V3XA 1W7VA 4S2RP 1C23A 1XGNA 4IF7A 4U70A 4FLIA 5JI6A 3IU9A 4HXXA 4R60A 1WL9A 2GG3A 1Y1NA 2GZ5A 2Q92A 1KP0A 2BH3A 3FMRA 1B6AA 2GU6A 2V3YA 1JAWA 1R5HA 1YW8A 2GG2A 3IU7A 3L24A 2BHCA 5JHUA 1C21A 3OVKA
chains in the Genus database with same CATH topology
3QOCA 4U6ZA 1WBQA 2GU7A 2ADUA 4ZNGA 1W2MA 2EVCA 3O5VA 3TAVA 5FCHA 4S2TP 2P9AA 4FO8A 2BWUA 5FCFA 4A6WA 1C24A 2GG0A 3RORA 1MATA 5D6FA 2EVMA 4IKRA 1C27A 4U6WA 4U6CA 2HOWA 1B59A 3FMQA 1CHMA 1PV9A 2BWWA 2GGCA 2GA2A 1YVMA 2NQ7A 2EA2A 4B28A 5CIKA 4RZZA 2P99A 1N51A 5D6EA 2B3LA 4MATA 1WN1A 3I7MA 4IPAA 3CB5A 1WL6A 4S00A 2GU5A 4IKSA 1M35A 4ZWPA 4RGZ1 3OOOA 1WY2A 1O0XA 5CNXA 1YJ3A 2Q93A 4FUKA 2DFIA 3CTZA 1R5GA 2G6PA 2GTXA 2GU4A 2NQ6A 4FO7A 4IKUA 4PNCA 2Q94A 4U6JA 4JUQA 2B3HA 2IW2A 1BOAA 4PV4A 3IL0A 1QXWA 4FLJA 3L7GA 1YW9A 5CLSA 2BB7A 1A16A 5E2CA 3PN9A 4A6VA 2BHAA 2Q96A 4RZYA 1QXZA 3RVAA 2EVOA 4IKTA 1KQ9A 4FLKA 3BITA 3IG4A 2BWVA 2V3ZA 2GG8A 5CDEA 3BIPA 3CB6A 3FM3A 3D27A 2EA4A 3PEBA 3IU8A 3BIQA 5E5BA 2ZSGA 4U71A 4ZWUA 3MATA 1WLRA 4EGEA 2MATA 1C22A 1QZYA 5CDLA 1WKMA 2B3KA 2BWSA 3PKEA 2Q95A 4U69A 4U6EA 2BWYA 4IECA 4QR8A 2BN7A 5JFRA 2P98A 3MR1A 4U76A 2OKNA 2GG9A 4ZWOA 2GG7A 1XNZA 2OAZA 1QXYA 1R58A 3PKAA 3PKCA 3PKBA 4U75A 1XGOA 4U1BA 2GG5A 4S01A 2GGBA 2BWTA 3TB5A 3MX6A 4IDYA 1XGSA 2BHDA 5CDVA 4OOKA 3PKDA 5CE6A 3S6BA 4KM3A 2Q8KA 2BWXA 4Z7MA 3Q6DA 1YW7A 1BN5A 4FLLA 4FKCA 2V6CA 1KQ0A 1XGMA 4IU6A 4U73A 2BHBA 2V3XA 1W7VA 4S2RP 1C23A 1XGNA 4IF7A 4U70A 4FLIA 5JI6A 3IU9A 4HXXA 4R60A 1WL9A 2GG3A 1Y1NA 2GZ5A 2Q92A 1KP0A 2BH3A 3FMRA 1B6AA 2GU6A 2V3YA 1JAWA 1R5HA 1YW8A 2GG2A 3IU7A 3L24A 2BHCA 5JHUA 1C21A 3OVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOC A;  4U6Z A;  1WBQ A;  2GU7 A;  2ADU A;  4ZNG A;  1W2M A;  2EVC A;  3O5V A;  3TAV A;  5FCH A;  4S2T P;  2P9A A;  4FO8 A;  2BWU A;  5FCF A;  4A6W A;  1C24 A;  2GG0 A;  3ROR A;  1MAT A;  5D6F A;  2EVM A;  4IKR A;  1C27 A;  4U6W A;  4U6C A;  2HOW A;  1B59 A;  3FMQ A;  1CHM A;  1PV9 A;  2BWW A;  2GGC A;  2GA2 A;  1YVM A;  2NQ7 A;  2EA2 A;  4B28 A;  5CIK A;  4RZZ A;  2P99 A;  1N51 A;  5D6E A;  2B3L A;  4MAT A;  1WN1 A;  3I7M A;  4IPA A;  3CB5 A;  1WL6 A;  4S00 A;  2GU5 A;  4IKS A;  1M35 A;  4ZWP A;  4RGZ 1;  3OOO A;  1WY2 A;  1O0X A;  5CNX A;  1YJ3 A;  2Q93 A;  4FUK A;  2DFI A;  3CTZ A;  1R5G A;  2G6P A;  2GTX A;  2GU4 A;  2NQ6 A;  4FO7 A;  4IKU A;  4PNC A;  2Q94 A;  4U6J A;  4JUQ A;  2B3H A;  2IW2 A;  1BOA A;  4PV4 A;  3IL0 A;  1QXW A;  4FLJ A;  3L7G A;  1YW9 A;  5CLS A;  2BB7 A;  1A16 A;  5E2C A;  3PN9 A;  4A6V A;  2BHA A;  2Q96 A;  4RZY A;  1QXZ A;  3RVA A;  2EVO A;  4IKT A;  1KQ9 A;  4FLK A;  3BIT A;  3IG4 A;  2BWV A;  2V3Z A;  2GG8 A;  5CDE A;  3BIP A;  3CB6 A;  3FM3 A;  3D27 A;  2EA4 A;  3PEB A;  3IU8 A;  3BIQ A;  5E5B A;  2ZSG A;  4U71 A;  4ZWU A;  3MAT A;  1WLR A;  4EGE A;  2MAT A;  1C22 A;  1QZY A;  5CDL A;  1WKM A;  2B3K A;  2BWS A;  3PKE A;  2Q95 A;  4U69 A;  4U6E A;  2BWY A;  4IEC A;  4QR8 A;  2BN7 A;  5JFR A;  2P98 A;  3MR1 A;  4U76 A;  2OKN A;  2GG9 A;  4ZWO A;  2GG7 A;  1XNZ A;  2OAZ A;  1QXY A;  1R58 A;  3PKA A;  3PKC A;  3PKB A;  4U75 A;  1XGO A;  4U1B A;  2GG5 A;  4S01 A;  2GGB A;  2BWT A;  3TB5 A;  3MX6 A;  4IDY A;  1XGS A;  2BHD A;  5CDV A;  4OOK A;  3PKD A;  5CE6 A;  3S6B A;  4KM3 A;  2Q8K A;  2BWX A;  4Z7M A;  3Q6D A;  1YW7 A;  1BN5 A;  4FLL A;  4FKC A;  2V6C A;  1KQ0 A;  1XGM A;  4IU6 A;  4U73 A;  2BHB A;  2V3X A;  1W7V A;  4S2R P;  1C23 A;  1XGN A;  4IF7 A;  4U70 A;  4FLI A;  5JI6 A;  3IU9 A;  4HXX A;  4R60 A;  1WL9 A;  2GG3 A;  1Y1N A;  2GZ5 A;  2Q92 A;  1KP0 A;  2BH3 A;  3FMR A;  1B6A A;  2GU6 A;  2V3Y A;  1JAW A;  1R5H A;  1YW8 A;  2GG2 A;  3IU7 A;  3L24 A;  2BHC A;  5JHU A;  1C21 A;  3OVK A; 
#chains in the Genus database with same CATH topology
 3QOC A;  4U6Z A;  1WBQ A;  2GU7 A;  2ADU A;  4ZNG A;  1W2M A;  2EVC A;  3O5V A;  3TAV A;  5FCH A;  4S2T P;  2P9A A;  4FO8 A;  2BWU A;  5FCF A;  4A6W A;  1C24 A;  2GG0 A;  3ROR A;  1MAT A;  5D6F A;  2EVM A;  4IKR A;  1C27 A;  4U6W A;  4U6C A;  2HOW A;  1B59 A;  3FMQ A;  1CHM A;  1PV9 A;  2BWW A;  2GGC A;  2GA2 A;  1YVM A;  2NQ7 A;  2EA2 A;  4B28 A;  5CIK A;  4RZZ A;  2P99 A;  1N51 A;  5D6E A;  2B3L A;  4MAT A;  1WN1 A;  3I7M A;  4IPA A;  3CB5 A;  1WL6 A;  4S00 A;  2GU5 A;  4IKS A;  1M35 A;  4ZWP A;  4RGZ 1;  3OOO A;  1WY2 A;  1O0X A;  5CNX A;  1YJ3 A;  2Q93 A;  4FUK A;  2DFI A;  3CTZ A;  1R5G A;  2G6P A;  2GTX A;  2GU4 A;  2NQ6 A;  4FO7 A;  4IKU A;  4PNC A;  2Q94 A;  4U6J A;  4JUQ A;  2B3H A;  2IW2 A;  1BOA A;  4PV4 A;  3IL0 A;  1QXW A;  4FLJ A;  3L7G A;  1YW9 A;  5CLS A;  2BB7 A;  1A16 A;  5E2C A;  3PN9 A;  4A6V A;  2BHA A;  2Q96 A;  4RZY A;  1QXZ A;  3RVA A;  2EVO A;  4IKT A;  1KQ9 A;  4FLK A;  3BIT A;  3IG4 A;  2BWV A;  2V3Z A;  2GG8 A;  5CDE A;  3BIP A;  3CB6 A;  3FM3 A;  3D27 A;  2EA4 A;  3PEB A;  3IU8 A;  3BIQ A;  5E5B A;  2ZSG A;  4U71 A;  4ZWU A;  3MAT A;  1WLR A;  4EGE A;  2MAT A;  1C22 A;  1QZY A;  5CDL A;  1WKM A;  2B3K A;  2BWS A;  3PKE A;  2Q95 A;  4U69 A;  4U6E A;  2BWY A;  4IEC A;  4QR8 A;  2BN7 A;  5JFR A;  2P98 A;  3MR1 A;  4U76 A;  2OKN A;  2GG9 A;  4ZWO A;  2GG7 A;  1XNZ A;  2OAZ A;  1QXY A;  1R58 A;  3PKA A;  3PKC A;  3PKB A;  4U75 A;  1XGO A;  4U1B A;  2GG5 A;  4S01 A;  2GGB A;  2BWT A;  3TB5 A;  3MX6 A;  4IDY A;  1XGS A;  2BHD A;  5CDV A;  4OOK A;  3PKD A;  5CE6 A;  3S6B A;  4KM3 A;  2Q8K A;  2BWX A;  4Z7M A;  3Q6D A;  1YW7 A;  1BN5 A;  4FLL A;  4FKC A;  2V6C A;  1KQ0 A;  1XGM A;  4IU6 A;  4U73 A;  2BHB A;  2V3X A;  1W7V A;  4S2R P;  1C23 A;  1XGN A;  4IF7 A;  4U70 A;  4FLI A;  5JI6 A;  3IU9 A;  4HXX A;  4R60 A;  1WL9 A;  2GG3 A;  1Y1N A;  2GZ5 A;  2Q92 A;  1KP0 A;  2BH3 A;  3FMR A;  1B6A A;  2GU6 A;  2V3Y A;  1JAW A;  1R5H A;  1YW8 A;  2GG2 A;  3IU7 A;  3L24 A;  2BHC A;  5JHU A;  1C21 A;  3OVK A; 
#chains in the Genus database with same CATH homology
 3QOC A;  4U6Z A;  1WBQ A;  2GU7 A;  2ADU A;  4ZNG A;  1W2M A;  2EVC A;  3O5V A;  3TAV A;  5FCH A;  4S2T P;  2P9A A;  4FO8 A;  2BWU A;  5FCF A;  4A6W A;  1C24 A;  2GG0 A;  3ROR A;  1MAT A;  5D6F A;  2EVM A;  4IKR A;  1C27 A;  4U6W A;  4U6C A;  2HOW A;  1B59 A;  3FMQ A;  1CHM A;  1PV9 A;  2BWW A;  2GGC A;  2GA2 A;  1YVM A;  2NQ7 A;  2EA2 A;  4B28 A;  5CIK A;  4RZZ A;  2P99 A;  1N51 A;  5D6E A;  2B3L A;  4MAT A;  1WN1 A;  3I7M A;  4IPA A;  3CB5 A;  1WL6 A;  4S00 A;  2GU5 A;  4IKS A;  1M35 A;  4ZWP A;  4RGZ 1;  3OOO A;  1WY2 A;  1O0X A;  5CNX A;  1YJ3 A;  2Q93 A;  4FUK A;  2DFI A;  3CTZ A;  1R5G A;  2G6P A;  2GTX A;  2GU4 A;  2NQ6 A;  4FO7 A;  4IKU A;  4PNC A;  2Q94 A;  4U6J A;  4JUQ A;  2B3H A;  2IW2 A;  1BOA A;  4PV4 A;  3IL0 A;  1QXW A;  4FLJ A;  3L7G A;  1YW9 A;  5CLS A;  2BB7 A;  1A16 A;  5E2C A;  3PN9 A;  4A6V A;  2BHA A;  2Q96 A;  4RZY A;  1QXZ A;  3RVA A;  2EVO A;  4IKT A;  1KQ9 A;  4FLK A;  3BIT A;  3IG4 A;  2BWV A;  2V3Z A;  2GG8 A;  5CDE A;  3BIP A;  3CB6 A;  3FM3 A;  3D27 A;  2EA4 A;  3PEB A;  3IU8 A;  3BIQ A;  5E5B A;  2ZSG A;  4U71 A;  4ZWU A;  3MAT A;  1WLR A;  4EGE A;  2MAT A;  1C22 A;  1QZY A;  5CDL A;  1WKM A;  2B3K A;  2BWS A;  3PKE A;  2Q95 A;  4U69 A;  4U6E A;  2BWY A;  4IEC A;  4QR8 A;  2BN7 A;  5JFR A;  2P98 A;  3MR1 A;  4U76 A;  2OKN A;  2GG9 A;  4ZWO A;  2GG7 A;  1XNZ A;  2OAZ A;  1QXY A;  1R58 A;  3PKA A;  3PKC A;  3PKB A;  4U75 A;  1XGO A;  4U1B A;  2GG5 A;  4S01 A;  2GGB A;  2BWT A;  3TB5 A;  3MX6 A;  4IDY A;  1XGS A;  2BHD A;  5CDV A;  4OOK A;  3PKD A;  5CE6 A;  3S6B A;  4KM3 A;  2Q8K A;  2BWX A;  4Z7M A;  3Q6D A;  1YW7 A;  1BN5 A;  4FLL A;  4FKC A;  2V6C A;  1KQ0 A;  1XGM A;  4IU6 A;  4U73 A;  2BHB A;  2V3X A;  1W7V A;  4S2R P;  1C23 A;  1XGN A;  4IF7 A;  4U70 A;  4FLI A;  5JI6 A;  3IU9 A;  4HXX A;  4R60 A;  1WL9 A;  2GG3 A;  1Y1N A;  2GZ5 A;  2Q92 A;  1KP0 A;  2BH3 A;  3FMR A;  1B6A A;  2GU6 A;  2V3Y A;  1JAW A;  1R5H A;  1YW8 A;  2GG2 A;  3IU7 A;  3L24 A;  2BHC A;  5JHU A;  1C21 A;  3OVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...