3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
1BN5A 3IU8A 4FO8A 4FLKA 1BOAA 4IKTA 3CTZA 4U6JA 3PKBA 2G6PA 1W7VA 4HXXA 1XNZA 5D6FA 2V3YA 2GG5A 2ADUA 2BB7A 4JUQA 2Q8KA 3PKCA 2EVMA 4FLJA 5JI6A 4A6VA 2BWUA 2BWVA 3OVKA 4U1BA 4FKCA 3MATA 3MR1A 2B3HA 1KQ9A 4U6EA 5E5BA 1QXWA 4A6WA 4S00A 3IU7A 5JFRA 4U69A 3BITA 4ZWUA 1CHMA 2B3KA 3MX6A 3RVAA 2V3ZA 4U70A 1JAWA 5CIKA 1YW9A 2BHCA 1A16A 2BWSA 4ZWOA 1WY2A 2GG2A 4KM3A 3IG4A 1XGNA 4RZYA 3CB5A 3L24A 4S2RP 1MATA 1R5HA 3PKDA 4IPAA 4S2TP 4S01A 3PKAA 5CLSA 2GU7A 3BIQA 4IKUA 3PKEA 2BHAA 1KQ0A 1XGMA 1C22A 1PV9A 1WN1A 1C23A 1XGSA 5D6EA 4U71A 1XGOA 1O0XA 4OOKA 2EVOA 4MATA 2Q95A 4RGZ1 5CDEA 2EA4A 1W2MA 4U75A 3FMQA 2P9AA 1WKMA 2GTXA 2GG8A 4EGEA 3TB5A 2HOWA 1N51A 1WLRA 4U73A 4IU6A 3O5VA 1R58A 2GGCA 3OOOA 2IW2A 2BN7A 1Y1NA 2EA2A 2DFIA 2GG0A 2GG7A 1B59A 1YW8A 3S6BA 2ZSGA 3PEBA 4PV4A 5CE6A 4IKSA 5JHUA 1M35A 1C21A 4RZZA 4PNCA 2BWXA 2BH3A 5CDLA 4Z7MA 3PN9A 1R5GA 4U76A 4IF7A 2Q94A 3Q6DA 2Q96A 4U6ZA 2OKNA 2BWYA 4U6WA 1QXYA 4FLIA 2NQ7A 1YW7A 2EVCA 1WL9A 1QXZA 2P99A 2GA2A 3IU9A 1KP0A 3RORA 2B3LA 3FM3A 2GU4A 4QR8A 1QZYA 4ZWPA 2BWWA 1C27A 3CB6A 4FLLA 1WL6A 4ZNGA 1YJ3A 4IDYA 4IKRA 3L7GA 4B28A 5E2CA 1B6AA 3IL0A 2GU5A 4U6CA 2GZ5A 2V6CA 2OAZA 1WBQA 5CNXA 2GG9A 2Q93A 2V3XA 4R60A 1C24A 2Q92A 4FUKA 3QOCA 2P98A 2MATA 4IECA 2BWTA 2GGBA 3FMRA 5CDVA 3I7MA 2NQ6A 5FCHA 3D27A 1YVMA 2GU6A 3TAVA 5FCFA 3BIPA 4FO7A 2BHBA 2BHDA 2GG3A
chains in the Genus database with same CATH superfamily
1BN5A 3IU8A 4FO8A 4FLKA 1BOAA 4IKTA 3CTZA 4U6JA 3PKBA 2G6PA 1W7VA 4HXXA 1XNZA 5D6FA 2V3YA 2GG5A 2ADUA 2BB7A 4JUQA 2Q8KA 3PKCA 2EVMA 4FLJA 5JI6A 4A6VA 2BWUA 2BWVA 3OVKA 4U1BA 4FKCA 3MATA 3MR1A 2B3HA 1KQ9A 4U6EA 5E5BA 1QXWA 4A6WA 4S00A 3IU7A 5JFRA 4U69A 3BITA 4ZWUA 1CHMA 2B3KA 3MX6A 3RVAA 2V3ZA 4U70A 1JAWA 5CIKA 1YW9A 2BHCA 1A16A 2BWSA 4ZWOA 1WY2A 2GG2A 4KM3A 3IG4A 1XGNA 4RZYA 3CB5A 3L24A 4S2RP 1MATA 1R5HA 3PKDA 4IPAA 4S2TP 4S01A 3PKAA 5CLSA 2GU7A 3BIQA 4IKUA 3PKEA 2BHAA 1KQ0A 1XGMA 1C22A 1PV9A 1WN1A 1C23A 1XGSA 5D6EA 4U71A 1XGOA 1O0XA 4OOKA 2EVOA 4MATA 2Q95A 4RGZ1 5CDEA 2EA4A 1W2MA 4U75A 3FMQA 2P9AA 1WKMA 2GTXA 2GG8A 4EGEA 3TB5A 2HOWA 1N51A 1WLRA 4U73A 4IU6A 3O5VA 1R58A 2GGCA 3OOOA 2IW2A 2BN7A 1Y1NA 2EA2A 2DFIA 2GG0A 2GG7A 1B59A 1YW8A 3S6BA 2ZSGA 3PEBA 4PV4A 5CE6A 4IKSA 5JHUA 1M35A 1C21A 4RZZA 4PNCA 2BWXA 2BH3A 5CDLA 4Z7MA 3PN9A 1R5GA 4U76A 4IF7A 2Q94A 3Q6DA 2Q96A 4U6ZA 2OKNA 2BWYA 4U6WA 1QXYA 4FLIA 2NQ7A 1YW7A 2EVCA 1WL9A 1QXZA 2P99A 2GA2A 3IU9A 1KP0A 3RORA 2B3LA 3FM3A 2GU4A 4QR8A 1QZYA 4ZWPA 2BWWA 1C27A 3CB6A 4FLLA 1WL6A 4ZNGA 1YJ3A 4IDYA 4IKRA 3L7GA 4B28A 5E2CA 1B6AA 3IL0A 2GU5A 4U6CA 2GZ5A 2V6CA 2OAZA 1WBQA 5CNXA 2GG9A 2Q93A 2V3XA 4R60A 1C24A 2Q92A 4FUKA 3QOCA 2P98A 2MATA 4IECA 2BWTA 2GGBA 3FMRA 5CDVA 3I7MA 2NQ6A 5FCHA 3D27A 1YVMA 2GU6A 3TAVA 5FCFA 3BIPA 4FO7A 2BHBA 2BHDA 2GG3A
chains in the Genus database with same CATH topology
1BN5A 3IU8A 4FO8A 4FLKA 1BOAA 4IKTA 3CTZA 4U6JA 3PKBA 2G6PA 1W7VA 4HXXA 1XNZA 5D6FA 2V3YA 2GG5A 2ADUA 2BB7A 4JUQA 2Q8KA 3PKCA 2EVMA 4FLJA 5JI6A 4A6VA 2BWUA 2BWVA 3OVKA 4U1BA 4FKCA 3MATA 3MR1A 2B3HA 1KQ9A 4U6EA 5E5BA 1QXWA 4A6WA 4S00A 3IU7A 5JFRA 4U69A 3BITA 4ZWUA 1CHMA 2B3KA 3MX6A 3RVAA 2V3ZA 4U70A 1JAWA 5CIKA 1YW9A 2BHCA 1A16A 2BWSA 4ZWOA 1WY2A 2GG2A 4KM3A 3IG4A 1XGNA 4RZYA 3CB5A 3L24A 4S2RP 1MATA 1R5HA 3PKDA 4IPAA 4S2TP 4S01A 3PKAA 5CLSA 2GU7A 3BIQA 4IKUA 3PKEA 2BHAA 1KQ0A 1XGMA 1C22A 1PV9A 1WN1A 1C23A 1XGSA 5D6EA 4U71A 1XGOA 1O0XA 4OOKA 2EVOA 4MATA 2Q95A 4RGZ1 5CDEA 2EA4A 1W2MA 4U75A 3FMQA 2P9AA 1WKMA 2GTXA 2GG8A 4EGEA 3TB5A 2HOWA 1N51A 1WLRA 4U73A 4IU6A 3O5VA 1R58A 2GGCA 3OOOA 2IW2A 2BN7A 1Y1NA 2EA2A 2DFIA 2GG0A 2GG7A 1B59A 1YW8A 3S6BA 2ZSGA 3PEBA 4PV4A 5CE6A 4IKSA 5JHUA 1M35A 1C21A 4RZZA 4PNCA 2BWXA 2BH3A 5CDLA 4Z7MA 3PN9A 1R5GA 4U76A 4IF7A 2Q94A 3Q6DA 2Q96A 4U6ZA 2OKNA 2BWYA 4U6WA 1QXYA 4FLIA 2NQ7A 1YW7A 2EVCA 1WL9A 1QXZA 2P99A 2GA2A 3IU9A 1KP0A 3RORA 2B3LA 3FM3A 2GU4A 4QR8A 1QZYA 4ZWPA 2BWWA 1C27A 3CB6A 4FLLA 1WL6A 4ZNGA 1YJ3A 4IDYA 4IKRA 3L7GA 4B28A 5E2CA 1B6AA 3IL0A 2GU5A 4U6CA 2GZ5A 2V6CA 2OAZA 1WBQA 5CNXA 2GG9A 2Q93A 2V3XA 4R60A 1C24A 2Q92A 4FUKA 3QOCA 2P98A 2MATA 4IECA 2BWTA 2GGBA 3FMRA 5CDVA 3I7MA 2NQ6A 5FCHA 3D27A 1YVMA 2GU6A 3TAVA 5FCFA 3BIPA 4FO7A 2BHBA 2BHDA 2GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN5 A;  3IU8 A;  4FO8 A;  4FLK A;  1BOA A;  4IKT A;  3CTZ A;  4U6J A;  3PKB A;  2G6P A;  1W7V A;  4HXX A;  1XNZ A;  5D6F A;  2V3Y A;  2GG5 A;  2ADU A;  2BB7 A;  4JUQ A;  2Q8K A;  3PKC A;  2EVM A;  4FLJ A;  5JI6 A;  4A6V A;  2BWU A;  2BWV A;  3OVK A;  4U1B A;  4FKC A;  3MAT A;  3MR1 A;  2B3H A;  1KQ9 A;  4U6E A;  5E5B A;  1QXW A;  4A6W A;  4S00 A;  3IU7 A;  5JFR A;  4U69 A;  3BIT A;  4ZWU A;  1CHM A;  2B3K A;  3MX6 A;  3RVA A;  2V3Z A;  4U70 A;  1JAW A;  5CIK A;  1YW9 A;  2BHC A;  1A16 A;  2BWS A;  4ZWO A;  1WY2 A;  2GG2 A;  4KM3 A;  3IG4 A;  1XGN A;  4RZY A;  3CB5 A;  3L24 A;  4S2R P;  1MAT A;  1R5H A;  3PKD A;  4IPA A;  4S2T P;  4S01 A;  3PKA A;  5CLS A;  2GU7 A;  3BIQ A;  4IKU A;  3PKE A;  2BHA A;  1KQ0 A;  1XGM A;  1C22 A;  1PV9 A;  1WN1 A;  1C23 A;  1XGS A;  5D6E A;  4U71 A;  1XGO A;  1O0X A;  4OOK A;  2EVO A;  4MAT A;  2Q95 A;  4RGZ 1;  5CDE A;  2EA4 A;  1W2M A;  4U75 A;  3FMQ A;  2P9A A;  1WKM A;  2GTX A;  2GG8 A;  4EGE A;  3TB5 A;  2HOW A;  1N51 A;  1WLR A;  4U73 A;  4IU6 A;  3O5V A;  1R58 A;  2GGC A;  3OOO A;  2IW2 A;  2BN7 A;  1Y1N A;  2EA2 A;  2DFI A;  2GG0 A;  2GG7 A;  1B59 A;  1YW8 A;  3S6B A;  2ZSG A;  3PEB A;  4PV4 A;  5CE6 A;  4IKS A;  5JHU A;  1M35 A;  1C21 A;  4RZZ A;  4PNC A;  2BWX A;  2BH3 A;  5CDL A;  4Z7M A;  3PN9 A;  1R5G A;  4U76 A;  4IF7 A;  2Q94 A;  3Q6D A;  2Q96 A;  4U6Z A;  2OKN A;  2BWY A;  4U6W A;  1QXY A;  4FLI A;  2NQ7 A;  1YW7 A;  2EVC A;  1WL9 A;  1QXZ A;  2P99 A;  2GA2 A;  3IU9 A;  1KP0 A;  3ROR A;  2B3L A;  3FM3 A;  2GU4 A;  4QR8 A;  1QZY A;  4ZWP A;  2BWW A;  1C27 A;  3CB6 A;  4FLL A;  1WL6 A;  4ZNG A;  1YJ3 A;  4IDY A;  4IKR A;  3L7G A;  4B28 A;  5E2C A;  1B6A A;  3IL0 A;  2GU5 A;  4U6C A;  2GZ5 A;  2V6C A;  2OAZ A;  1WBQ A;  5CNX A;  2GG9 A;  2Q93 A;  2V3X A;  4R60 A;  1C24 A;  2Q92 A;  4FUK A;  3QOC A;  2P98 A;  2MAT A;  4IEC A;  2BWT A;  2GGB A;  3FMR A;  5CDV A;  3I7M A;  2NQ6 A;  5FCH A;  3D27 A;  1YVM A;  2GU6 A;  3TAV A;  5FCF A;  3BIP A;  4FO7 A;  2BHB A;  2BHD A;  2GG3 A; 
#chains in the Genus database with same CATH topology
 1BN5 A;  3IU8 A;  4FO8 A;  4FLK A;  1BOA A;  4IKT A;  3CTZ A;  4U6J A;  3PKB A;  2G6P A;  1W7V A;  4HXX A;  1XNZ A;  5D6F A;  2V3Y A;  2GG5 A;  2ADU A;  2BB7 A;  4JUQ A;  2Q8K A;  3PKC A;  2EVM A;  4FLJ A;  5JI6 A;  4A6V A;  2BWU A;  2BWV A;  3OVK A;  4U1B A;  4FKC A;  3MAT A;  3MR1 A;  2B3H A;  1KQ9 A;  4U6E A;  5E5B A;  1QXW A;  4A6W A;  4S00 A;  3IU7 A;  5JFR A;  4U69 A;  3BIT A;  4ZWU A;  1CHM A;  2B3K A;  3MX6 A;  3RVA A;  2V3Z A;  4U70 A;  1JAW A;  5CIK A;  1YW9 A;  2BHC A;  1A16 A;  2BWS A;  4ZWO A;  1WY2 A;  2GG2 A;  4KM3 A;  3IG4 A;  1XGN A;  4RZY A;  3CB5 A;  3L24 A;  4S2R P;  1MAT A;  1R5H A;  3PKD A;  4IPA A;  4S2T P;  4S01 A;  3PKA A;  5CLS A;  2GU7 A;  3BIQ A;  4IKU A;  3PKE A;  2BHA A;  1KQ0 A;  1XGM A;  1C22 A;  1PV9 A;  1WN1 A;  1C23 A;  1XGS A;  5D6E A;  4U71 A;  1XGO A;  1O0X A;  4OOK A;  2EVO A;  4MAT A;  2Q95 A;  4RGZ 1;  5CDE A;  2EA4 A;  1W2M A;  4U75 A;  3FMQ A;  2P9A A;  1WKM A;  2GTX A;  2GG8 A;  4EGE A;  3TB5 A;  2HOW A;  1N51 A;  1WLR A;  4U73 A;  4IU6 A;  3O5V A;  1R58 A;  2GGC A;  3OOO A;  2IW2 A;  2BN7 A;  1Y1N A;  2EA2 A;  2DFI A;  2GG0 A;  2GG7 A;  1B59 A;  1YW8 A;  3S6B A;  2ZSG A;  3PEB A;  4PV4 A;  5CE6 A;  4IKS A;  5JHU A;  1M35 A;  1C21 A;  4RZZ A;  4PNC A;  2BWX A;  2BH3 A;  5CDL A;  4Z7M A;  3PN9 A;  1R5G A;  4U76 A;  4IF7 A;  2Q94 A;  3Q6D A;  2Q96 A;  4U6Z A;  2OKN A;  2BWY A;  4U6W A;  1QXY A;  4FLI A;  2NQ7 A;  1YW7 A;  2EVC A;  1WL9 A;  1QXZ A;  2P99 A;  2GA2 A;  3IU9 A;  1KP0 A;  3ROR A;  2B3L A;  3FM3 A;  2GU4 A;  4QR8 A;  1QZY A;  4ZWP A;  2BWW A;  1C27 A;  3CB6 A;  4FLL A;  1WL6 A;  4ZNG A;  1YJ3 A;  4IDY A;  4IKR A;  3L7G A;  4B28 A;  5E2C A;  1B6A A;  3IL0 A;  2GU5 A;  4U6C A;  2GZ5 A;  2V6C A;  2OAZ A;  1WBQ A;  5CNX A;  2GG9 A;  2Q93 A;  2V3X A;  4R60 A;  1C24 A;  2Q92 A;  4FUK A;  3QOC A;  2P98 A;  2MAT A;  4IEC A;  2BWT A;  2GGB A;  3FMR A;  5CDV A;  3I7M A;  2NQ6 A;  5FCH A;  3D27 A;  1YVM A;  2GU6 A;  3TAV A;  5FCF A;  3BIP A;  4FO7 A;  2BHB A;  2BHD A;  2GG3 A; 
#chains in the Genus database with same CATH homology
 1BN5 A;  3IU8 A;  4FO8 A;  4FLK A;  1BOA A;  4IKT A;  3CTZ A;  4U6J A;  3PKB A;  2G6P A;  1W7V A;  4HXX A;  1XNZ A;  5D6F A;  2V3Y A;  2GG5 A;  2ADU A;  2BB7 A;  4JUQ A;  2Q8K A;  3PKC A;  2EVM A;  4FLJ A;  5JI6 A;  4A6V A;  2BWU A;  2BWV A;  3OVK A;  4U1B A;  4FKC A;  3MAT A;  3MR1 A;  2B3H A;  1KQ9 A;  4U6E A;  5E5B A;  1QXW A;  4A6W A;  4S00 A;  3IU7 A;  5JFR A;  4U69 A;  3BIT A;  4ZWU A;  1CHM A;  2B3K A;  3MX6 A;  3RVA A;  2V3Z A;  4U70 A;  1JAW A;  5CIK A;  1YW9 A;  2BHC A;  1A16 A;  2BWS A;  4ZWO A;  1WY2 A;  2GG2 A;  4KM3 A;  3IG4 A;  1XGN A;  4RZY A;  3CB5 A;  3L24 A;  4S2R P;  1MAT A;  1R5H A;  3PKD A;  4IPA A;  4S2T P;  4S01 A;  3PKA A;  5CLS A;  2GU7 A;  3BIQ A;  4IKU A;  3PKE A;  2BHA A;  1KQ0 A;  1XGM A;  1C22 A;  1PV9 A;  1WN1 A;  1C23 A;  1XGS A;  5D6E A;  4U71 A;  1XGO A;  1O0X A;  4OOK A;  2EVO A;  4MAT A;  2Q95 A;  4RGZ 1;  5CDE A;  2EA4 A;  1W2M A;  4U75 A;  3FMQ A;  2P9A A;  1WKM A;  2GTX A;  2GG8 A;  4EGE A;  3TB5 A;  2HOW A;  1N51 A;  1WLR A;  4U73 A;  4IU6 A;  3O5V A;  1R58 A;  2GGC A;  3OOO A;  2IW2 A;  2BN7 A;  1Y1N A;  2EA2 A;  2DFI A;  2GG0 A;  2GG7 A;  1B59 A;  1YW8 A;  3S6B A;  2ZSG A;  3PEB A;  4PV4 A;  5CE6 A;  4IKS A;  5JHU A;  1M35 A;  1C21 A;  4RZZ A;  4PNC A;  2BWX A;  2BH3 A;  5CDL A;  4Z7M A;  3PN9 A;  1R5G A;  4U76 A;  4IF7 A;  2Q94 A;  3Q6D A;  2Q96 A;  4U6Z A;  2OKN A;  2BWY A;  4U6W A;  1QXY A;  4FLI A;  2NQ7 A;  1YW7 A;  2EVC A;  1WL9 A;  1QXZ A;  2P99 A;  2GA2 A;  3IU9 A;  1KP0 A;  3ROR A;  2B3L A;  3FM3 A;  2GU4 A;  4QR8 A;  1QZY A;  4ZWP A;  2BWW A;  1C27 A;  3CB6 A;  4FLL A;  1WL6 A;  4ZNG A;  1YJ3 A;  4IDY A;  4IKR A;  3L7G A;  4B28 A;  5E2C A;  1B6A A;  3IL0 A;  2GU5 A;  4U6C A;  2GZ5 A;  2V6C A;  2OAZ A;  1WBQ A;  5CNX A;  2GG9 A;  2Q93 A;  2V3X A;  4R60 A;  1C24 A;  2Q92 A;  4FUK A;  3QOC A;  2P98 A;  2MAT A;  4IEC A;  2BWT A;  2GGB A;  3FMR A;  5CDV A;  3I7M A;  2NQ6 A;  5FCH A;  3D27 A;  1YVM A;  2GU6 A;  3TAV A;  5FCF A;  3BIP A;  4FO7 A;  2BHB A;  2BHD A;  2GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...