3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
1QZYA 1R58A 1YJ3A 2EA4A 4FO7A 2V3ZA 2ADUA 2BHAA 3BIQA 3I7MA 3PKDA 2IW2A 5JFRA 3BIPA 1BOAA 1XGSA 4IKTA 4PV4A 2GG8A 2G6PA 4RZYA 4FLLA 1WL6A 3L24A 4IDYA 4Z7MA 5E5BA 2Q8KA 2HOWA 3TAVA 4OOKA 3IU7A 4A6VA 1WLRA 1XGOA 2GTXA 3OOOA 3FMRA 4IF7A 3PN9A 3QOCA 3MR1A 4U71A 1BN5A 4FO8A 1QXWA 5JHUA 2GGBA 4U70A 4B28A 5D6EA 5CDEA 2EVOA 3Q6DA 5JI6A 4U6CA 3S6BA 3IL0A 4RZZA 3PEBA 4S01A 4U6ZA 4S2TP 2BWVA 1MATA 1WN1A 1WY2A 4IKSA 5CNXA 1XNZA 5CDVA 3IG4A 2BH3A 2NQ7A 2P9AA 2B3KA 4U69A 2OKNA 4IKRA 2GZ5A 4S2RP 4ZWOA 1QXZA 4IKUA 5CDLA 4FUKA 1XGNA 4ZWPA 2BWXA 2NQ6A 2Q93A 3PKBA 4U75A 1C24A 2Q92A 3FM3A 2GA2A 3CB5A 2GGCA 3PKEA 1JAWA 1YW7A 3PKCA 2GU4A 1YW8A 4IU6A 3BITA 5FCHA 2Q94A 4FLJA 1C22A 1Y1NA 1YW9A 2GG0A 1B6AA 2GU5A 3O5VA 5CE6A 2EVMA 2GG7A 1C21A 4KM3A 2BWWA 3OVKA 3RVAA 4FLIA 4A6WA 2Q96A 2V3YA 1KP0A 3FMQA 4U76A 2V3XA 1QXYA 2BWUA 4ZNGA 4HXXA 1CHMA 1XGMA 4PNCA 1R5GA 4R60A 2GG5A 3IU8A 1KQ9A 4JUQA 1B59A 3TB5A 4FKCA 1C23A 4U6JA 2Q95A 2BN7A 3MX6A 4U1BA 4EGEA 3D27A 1WKMA 3CB6A 5FCFA 2GG3A 2EA2A 5CLSA 2BHBA 4U6WA 1N51A 2B3LA 4S00A 1KQ0A 2BWYA 2GU6A 4ZWUA 2EVCA 4IPAA 1R5HA 1WBQA 4QR8A 1W7VA 2GG2A 2GU7A 2OAZA 3L7GA 2GG9A 4U6EA 3IU9A 5E2CA 2BWTA 1WL9A 2P99A 3MATA 4U73A 1W2MA 1C27A 5CIKA 2BB7A 2DFIA 4FLKA 2BWSA 1M35A 1O0XA 2MATA 2P98A 4RGZ1 3RORA 4MATA 3CTZA 2V6CA 2BHCA 1A16A 2BHDA 3PKAA 2ZSGA 2B3HA 4IECA 1YVMA 1PV9A 5D6FA
chains in the Genus database with same CATH superfamily
1QZYA 1R58A 1YJ3A 2EA4A 4FO7A 2V3ZA 2ADUA 2BHAA 3BIQA 3I7MA 3PKDA 2IW2A 5JFRA 3BIPA 1BOAA 1XGSA 4IKTA 4PV4A 2GG8A 2G6PA 4RZYA 4FLLA 1WL6A 3L24A 4IDYA 4Z7MA 5E5BA 2Q8KA 2HOWA 3TAVA 4OOKA 3IU7A 4A6VA 1WLRA 1XGOA 2GTXA 3OOOA 3FMRA 4IF7A 3PN9A 3QOCA 3MR1A 4U71A 1BN5A 4FO8A 1QXWA 5JHUA 2GGBA 4U70A 4B28A 5D6EA 5CDEA 2EVOA 3Q6DA 5JI6A 4U6CA 3S6BA 3IL0A 4RZZA 3PEBA 4S01A 4U6ZA 4S2TP 2BWVA 1MATA 1WN1A 1WY2A 4IKSA 5CNXA 1XNZA 5CDVA 3IG4A 2BH3A 2NQ7A 2P9AA 2B3KA 4U69A 2OKNA 4IKRA 2GZ5A 4S2RP 4ZWOA 1QXZA 4IKUA 5CDLA 4FUKA 1XGNA 4ZWPA 2BWXA 2NQ6A 2Q93A 3PKBA 4U75A 1C24A 2Q92A 3FM3A 2GA2A 3CB5A 2GGCA 3PKEA 1JAWA 1YW7A 3PKCA 2GU4A 1YW8A 4IU6A 3BITA 5FCHA 2Q94A 4FLJA 1C22A 1Y1NA 1YW9A 2GG0A 1B6AA 2GU5A 3O5VA 5CE6A 2EVMA 2GG7A 1C21A 4KM3A 2BWWA 3OVKA 3RVAA 4FLIA 4A6WA 2Q96A 2V3YA 1KP0A 3FMQA 4U76A 2V3XA 1QXYA 2BWUA 4ZNGA 4HXXA 1CHMA 1XGMA 4PNCA 1R5GA 4R60A 2GG5A 3IU8A 1KQ9A 4JUQA 1B59A 3TB5A 4FKCA 1C23A 4U6JA 2Q95A 2BN7A 3MX6A 4U1BA 4EGEA 3D27A 1WKMA 3CB6A 5FCFA 2GG3A 2EA2A 5CLSA 2BHBA 4U6WA 1N51A 2B3LA 4S00A 1KQ0A 2BWYA 2GU6A 4ZWUA 2EVCA 4IPAA 1R5HA 1WBQA 4QR8A 1W7VA 2GG2A 2GU7A 2OAZA 3L7GA 2GG9A 4U6EA 3IU9A 5E2CA 2BWTA 1WL9A 2P99A 3MATA 4U73A 1W2MA 1C27A 5CIKA 2BB7A 2DFIA 4FLKA 2BWSA 1M35A 1O0XA 2MATA 2P98A 4RGZ1 3RORA 4MATA 3CTZA 2V6CA 2BHCA 1A16A 2BHDA 3PKAA 2ZSGA 2B3HA 4IECA 1YVMA 1PV9A 5D6FA
chains in the Genus database with same CATH topology
1QZYA 1R58A 1YJ3A 2EA4A 4FO7A 2V3ZA 2ADUA 2BHAA 3BIQA 3I7MA 3PKDA 2IW2A 5JFRA 3BIPA 1BOAA 1XGSA 4IKTA 4PV4A 2GG8A 2G6PA 4RZYA 4FLLA 1WL6A 3L24A 4IDYA 4Z7MA 5E5BA 2Q8KA 2HOWA 3TAVA 4OOKA 3IU7A 4A6VA 1WLRA 1XGOA 2GTXA 3OOOA 3FMRA 4IF7A 3PN9A 3QOCA 3MR1A 4U71A 1BN5A 4FO8A 1QXWA 5JHUA 2GGBA 4U70A 4B28A 5D6EA 5CDEA 2EVOA 3Q6DA 5JI6A 4U6CA 3S6BA 3IL0A 4RZZA 3PEBA 4S01A 4U6ZA 4S2TP 2BWVA 1MATA 1WN1A 1WY2A 4IKSA 5CNXA 1XNZA 5CDVA 3IG4A 2BH3A 2NQ7A 2P9AA 2B3KA 4U69A 2OKNA 4IKRA 2GZ5A 4S2RP 4ZWOA 1QXZA 4IKUA 5CDLA 4FUKA 1XGNA 4ZWPA 2BWXA 2NQ6A 2Q93A 3PKBA 4U75A 1C24A 2Q92A 3FM3A 2GA2A 3CB5A 2GGCA 3PKEA 1JAWA 1YW7A 3PKCA 2GU4A 1YW8A 4IU6A 3BITA 5FCHA 2Q94A 4FLJA 1C22A 1Y1NA 1YW9A 2GG0A 1B6AA 2GU5A 3O5VA 5CE6A 2EVMA 2GG7A 1C21A 4KM3A 2BWWA 3OVKA 3RVAA 4FLIA 4A6WA 2Q96A 2V3YA 1KP0A 3FMQA 4U76A 2V3XA 1QXYA 2BWUA 4ZNGA 4HXXA 1CHMA 1XGMA 4PNCA 1R5GA 4R60A 2GG5A 3IU8A 1KQ9A 4JUQA 1B59A 3TB5A 4FKCA 1C23A 4U6JA 2Q95A 2BN7A 3MX6A 4U1BA 4EGEA 3D27A 1WKMA 3CB6A 5FCFA 2GG3A 2EA2A 5CLSA 2BHBA 4U6WA 1N51A 2B3LA 4S00A 1KQ0A 2BWYA 2GU6A 4ZWUA 2EVCA 4IPAA 1R5HA 1WBQA 4QR8A 1W7VA 2GG2A 2GU7A 2OAZA 3L7GA 2GG9A 4U6EA 3IU9A 5E2CA 2BWTA 1WL9A 2P99A 3MATA 4U73A 1W2MA 1C27A 5CIKA 2BB7A 2DFIA 4FLKA 2BWSA 1M35A 1O0XA 2MATA 2P98A 4RGZ1 3RORA 4MATA 3CTZA 2V6CA 2BHCA 1A16A 2BHDA 3PKAA 2ZSGA 2B3HA 4IECA 1YVMA 1PV9A 5D6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  1R58 A;  1YJ3 A;  2EA4 A;  4FO7 A;  2V3Z A;  2ADU A;  2BHA A;  3BIQ A;  3I7M A;  3PKD A;  2IW2 A;  5JFR A;  3BIP A;  1BOA A;  1XGS A;  4IKT A;  4PV4 A;  2GG8 A;  2G6P A;  4RZY A;  4FLL A;  1WL6 A;  3L24 A;  4IDY A;  4Z7M A;  5E5B A;  2Q8K A;  2HOW A;  3TAV A;  4OOK A;  3IU7 A;  4A6V A;  1WLR A;  1XGO A;  2GTX A;  3OOO A;  3FMR A;  4IF7 A;  3PN9 A;  3QOC A;  3MR1 A;  4U71 A;  1BN5 A;  4FO8 A;  1QXW A;  5JHU A;  2GGB A;  4U70 A;  4B28 A;  5D6E A;  5CDE A;  2EVO A;  3Q6D A;  5JI6 A;  4U6C A;  3S6B A;  3IL0 A;  4RZZ A;  3PEB A;  4S01 A;  4U6Z A;  4S2T P;  2BWV A;  1MAT A;  1WN1 A;  1WY2 A;  4IKS A;  5CNX A;  1XNZ A;  5CDV A;  3IG4 A;  2BH3 A;  2NQ7 A;  2P9A A;  2B3K A;  4U69 A;  2OKN A;  4IKR A;  2GZ5 A;  4S2R P;  4ZWO A;  1QXZ A;  4IKU A;  5CDL A;  4FUK A;  1XGN A;  4ZWP A;  2BWX A;  2NQ6 A;  2Q93 A;  3PKB A;  4U75 A;  1C24 A;  2Q92 A;  3FM3 A;  2GA2 A;  3CB5 A;  2GGC A;  3PKE A;  1JAW A;  1YW7 A;  3PKC A;  2GU4 A;  1YW8 A;  4IU6 A;  3BIT A;  5FCH A;  2Q94 A;  4FLJ A;  1C22 A;  1Y1N A;  1YW9 A;  2GG0 A;  1B6A A;  2GU5 A;  3O5V A;  5CE6 A;  2EVM A;  2GG7 A;  1C21 A;  4KM3 A;  2BWW A;  3OVK A;  3RVA A;  4FLI A;  4A6W A;  2Q96 A;  2V3Y A;  1KP0 A;  3FMQ A;  4U76 A;  2V3X A;  1QXY A;  2BWU A;  4ZNG A;  4HXX A;  1CHM A;  1XGM A;  4PNC A;  1R5G A;  4R60 A;  2GG5 A;  3IU8 A;  1KQ9 A;  4JUQ A;  1B59 A;  3TB5 A;  4FKC A;  1C23 A;  4U6J A;  2Q95 A;  2BN7 A;  3MX6 A;  4U1B A;  4EGE A;  3D27 A;  1WKM A;  3CB6 A;  5FCF A;  2GG3 A;  2EA2 A;  5CLS A;  2BHB A;  4U6W A;  1N51 A;  2B3L A;  4S00 A;  1KQ0 A;  2BWY A;  2GU6 A;  4ZWU A;  2EVC A;  4IPA A;  1R5H A;  1WBQ A;  4QR8 A;  1W7V A;  2GG2 A;  2GU7 A;  2OAZ A;  3L7G A;  2GG9 A;  4U6E A;  3IU9 A;  5E2C A;  2BWT A;  1WL9 A;  2P99 A;  3MAT A;  4U73 A;  1W2M A;  1C27 A;  5CIK A;  2BB7 A;  2DFI A;  4FLK A;  2BWS A;  1M35 A;  1O0X A;  2MAT A;  2P98 A;  4RGZ 1;  3ROR A;  4MAT A;  3CTZ A;  2V6C A;  2BHC A;  1A16 A;  2BHD A;  3PKA A;  2ZSG A;  2B3H A;  4IEC A;  1YVM A;  1PV9 A;  5D6F A; 
#chains in the Genus database with same CATH topology
 1QZY A;  1R58 A;  1YJ3 A;  2EA4 A;  4FO7 A;  2V3Z A;  2ADU A;  2BHA A;  3BIQ A;  3I7M A;  3PKD A;  2IW2 A;  5JFR A;  3BIP A;  1BOA A;  1XGS A;  4IKT A;  4PV4 A;  2GG8 A;  2G6P A;  4RZY A;  4FLL A;  1WL6 A;  3L24 A;  4IDY A;  4Z7M A;  5E5B A;  2Q8K A;  2HOW A;  3TAV A;  4OOK A;  3IU7 A;  4A6V A;  1WLR A;  1XGO A;  2GTX A;  3OOO A;  3FMR A;  4IF7 A;  3PN9 A;  3QOC A;  3MR1 A;  4U71 A;  1BN5 A;  4FO8 A;  1QXW A;  5JHU A;  2GGB A;  4U70 A;  4B28 A;  5D6E A;  5CDE A;  2EVO A;  3Q6D A;  5JI6 A;  4U6C A;  3S6B A;  3IL0 A;  4RZZ A;  3PEB A;  4S01 A;  4U6Z A;  4S2T P;  2BWV A;  1MAT A;  1WN1 A;  1WY2 A;  4IKS A;  5CNX A;  1XNZ A;  5CDV A;  3IG4 A;  2BH3 A;  2NQ7 A;  2P9A A;  2B3K A;  4U69 A;  2OKN A;  4IKR A;  2GZ5 A;  4S2R P;  4ZWO A;  1QXZ A;  4IKU A;  5CDL A;  4FUK A;  1XGN A;  4ZWP A;  2BWX A;  2NQ6 A;  2Q93 A;  3PKB A;  4U75 A;  1C24 A;  2Q92 A;  3FM3 A;  2GA2 A;  3CB5 A;  2GGC A;  3PKE A;  1JAW A;  1YW7 A;  3PKC A;  2GU4 A;  1YW8 A;  4IU6 A;  3BIT A;  5FCH A;  2Q94 A;  4FLJ A;  1C22 A;  1Y1N A;  1YW9 A;  2GG0 A;  1B6A A;  2GU5 A;  3O5V A;  5CE6 A;  2EVM A;  2GG7 A;  1C21 A;  4KM3 A;  2BWW A;  3OVK A;  3RVA A;  4FLI A;  4A6W A;  2Q96 A;  2V3Y A;  1KP0 A;  3FMQ A;  4U76 A;  2V3X A;  1QXY A;  2BWU A;  4ZNG A;  4HXX A;  1CHM A;  1XGM A;  4PNC A;  1R5G A;  4R60 A;  2GG5 A;  3IU8 A;  1KQ9 A;  4JUQ A;  1B59 A;  3TB5 A;  4FKC A;  1C23 A;  4U6J A;  2Q95 A;  2BN7 A;  3MX6 A;  4U1B A;  4EGE A;  3D27 A;  1WKM A;  3CB6 A;  5FCF A;  2GG3 A;  2EA2 A;  5CLS A;  2BHB A;  4U6W A;  1N51 A;  2B3L A;  4S00 A;  1KQ0 A;  2BWY A;  2GU6 A;  4ZWU A;  2EVC A;  4IPA A;  1R5H A;  1WBQ A;  4QR8 A;  1W7V A;  2GG2 A;  2GU7 A;  2OAZ A;  3L7G A;  2GG9 A;  4U6E A;  3IU9 A;  5E2C A;  2BWT A;  1WL9 A;  2P99 A;  3MAT A;  4U73 A;  1W2M A;  1C27 A;  5CIK A;  2BB7 A;  2DFI A;  4FLK A;  2BWS A;  1M35 A;  1O0X A;  2MAT A;  2P98 A;  4RGZ 1;  3ROR A;  4MAT A;  3CTZ A;  2V6C A;  2BHC A;  1A16 A;  2BHD A;  3PKA A;  2ZSG A;  2B3H A;  4IEC A;  1YVM A;  1PV9 A;  5D6F A; 
#chains in the Genus database with same CATH homology
 1QZY A;  1R58 A;  1YJ3 A;  2EA4 A;  4FO7 A;  2V3Z A;  2ADU A;  2BHA A;  3BIQ A;  3I7M A;  3PKD A;  2IW2 A;  5JFR A;  3BIP A;  1BOA A;  1XGS A;  4IKT A;  4PV4 A;  2GG8 A;  2G6P A;  4RZY A;  4FLL A;  1WL6 A;  3L24 A;  4IDY A;  4Z7M A;  5E5B A;  2Q8K A;  2HOW A;  3TAV A;  4OOK A;  3IU7 A;  4A6V A;  1WLR A;  1XGO A;  2GTX A;  3OOO A;  3FMR A;  4IF7 A;  3PN9 A;  3QOC A;  3MR1 A;  4U71 A;  1BN5 A;  4FO8 A;  1QXW A;  5JHU A;  2GGB A;  4U70 A;  4B28 A;  5D6E A;  5CDE A;  2EVO A;  3Q6D A;  5JI6 A;  4U6C A;  3S6B A;  3IL0 A;  4RZZ A;  3PEB A;  4S01 A;  4U6Z A;  4S2T P;  2BWV A;  1MAT A;  1WN1 A;  1WY2 A;  4IKS A;  5CNX A;  1XNZ A;  5CDV A;  3IG4 A;  2BH3 A;  2NQ7 A;  2P9A A;  2B3K A;  4U69 A;  2OKN A;  4IKR A;  2GZ5 A;  4S2R P;  4ZWO A;  1QXZ A;  4IKU A;  5CDL A;  4FUK A;  1XGN A;  4ZWP A;  2BWX A;  2NQ6 A;  2Q93 A;  3PKB A;  4U75 A;  1C24 A;  2Q92 A;  3FM3 A;  2GA2 A;  3CB5 A;  2GGC A;  3PKE A;  1JAW A;  1YW7 A;  3PKC A;  2GU4 A;  1YW8 A;  4IU6 A;  3BIT A;  5FCH A;  2Q94 A;  4FLJ A;  1C22 A;  1Y1N A;  1YW9 A;  2GG0 A;  1B6A A;  2GU5 A;  3O5V A;  5CE6 A;  2EVM A;  2GG7 A;  1C21 A;  4KM3 A;  2BWW A;  3OVK A;  3RVA A;  4FLI A;  4A6W A;  2Q96 A;  2V3Y A;  1KP0 A;  3FMQ A;  4U76 A;  2V3X A;  1QXY A;  2BWU A;  4ZNG A;  4HXX A;  1CHM A;  1XGM A;  4PNC A;  1R5G A;  4R60 A;  2GG5 A;  3IU8 A;  1KQ9 A;  4JUQ A;  1B59 A;  3TB5 A;  4FKC A;  1C23 A;  4U6J A;  2Q95 A;  2BN7 A;  3MX6 A;  4U1B A;  4EGE A;  3D27 A;  1WKM A;  3CB6 A;  5FCF A;  2GG3 A;  2EA2 A;  5CLS A;  2BHB A;  4U6W A;  1N51 A;  2B3L A;  4S00 A;  1KQ0 A;  2BWY A;  2GU6 A;  4ZWU A;  2EVC A;  4IPA A;  1R5H A;  1WBQ A;  4QR8 A;  1W7V A;  2GG2 A;  2GU7 A;  2OAZ A;  3L7G A;  2GG9 A;  4U6E A;  3IU9 A;  5E2C A;  2BWT A;  1WL9 A;  2P99 A;  3MAT A;  4U73 A;  1W2M A;  1C27 A;  5CIK A;  2BB7 A;  2DFI A;  4FLK A;  2BWS A;  1M35 A;  1O0X A;  2MAT A;  2P98 A;  4RGZ 1;  3ROR A;  4MAT A;  3CTZ A;  2V6C A;  2BHC A;  1A16 A;  2BHD A;  3PKA A;  2ZSG A;  2B3H A;  4IEC A;  1YVM A;  1PV9 A;  5D6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...