3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
b'NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
3IU9A 3RVAA 2GG0A 5CDLA 1WL9A 2MATA 1C27A 2Q95A 4U6WA 4ZNGA 1C23A 2G6PA 4IPAA 1A16A 4PV4A 2V3XA 3I7MA 4RZZA 5FCHA 3FMQA 3IU7A 3BIQA 1XNZA 4A6WA 2BWWA 3RORA 4PNCA 1B6AA 4A6VA 1B59A 3FM3A 3D27A 4IKUA 4FUKA 2GU6A 1PV9A 5D6FA 2EA4A 2GG2A 4FLKA 1XGOA 5CE6A 1MATA 4KM3A 1KP0A 3TB5A 2GGBA 4U6ZA 4U6JA 1M35A 5CDVA 4U76A 5E2CA 3MX6A 1KQ9A 2B3HA 1XGNA 2EVCA 4IECA 4MATA 2GA2A 4FLLA 1WKMA 5FCFA 2P9AA 2BB7A 4U70A 3CB6A 2BWTA 2GG5A 1C22A 2EVMA 4U69A 3QOCA 2GG3A 2Q92A 4R60A 2GTXA 3OVKA 4B28A 1XGSA 2OAZA 1XGMA 4S2RP 4OOKA 1YW7A 1QXYA 4S2TP 4FLJA 5CNXA 1YJ3A 5E5BA 2Q96A 1BN5A 4FLIA 3TAVA 2BH3A 2BWUA 1WY2A 3OOOA 4RGZ1 4S01A 3PKEA 1W7VA 3PKBA 4U6EA 2OKNA 4Z7MA 2BWSA 3CTZA 2GG7A 1W2MA 3S6BA 1JAWA 4U71A 3MATA 2BHBA 2ZSGA 5CIKA 2EA2A 2GG9A 1R5HA 2GU5A 2P99A 3PEBA 1YVMA 1WLRA 3Q6DA 1QZYA 3MR1A 4IF7A 2V3ZA 4U75A 5JHUA 1C24A 5JI6A 1YW8A 4JUQA 3BITA 1YW9A 1QXZA 5CDEA 2ADUA 1WL6A 2GGCA 2GG8A 3BIPA 2B3LA 1R5GA 4IU6A 4S00A 3FMRA 2BWXA 4ZWOA 1R58A 2V6CA 4ZWUA 1WBQA 2GU7A 3PKAA 3IU8A 4IDYA 2Q8KA 1O0XA 3CB5A 2B3KA 2NQ6A 1QXWA 2NQ7A 1C21A 2V3YA 3O5VA 4IKRA 2BHCA 4FKCA 2BHDA 4FO7A 4ZWPA 4HXXA 2BWVA 2BN7A 2P98A 3PKCA 3L7GA 2HOWA 2IW2A 3IG4A 3L24A 3PKDA 4QR8A 2GU4A 1CHMA 3PN9A 4FO8A 2GZ5A 1BOAA 2DFIA 4U73A 1WN1A 4IKTA 4U1BA 2BHAA 1N51A 2BWYA 5JFRA 1KQ0A 5CLSA 5D6EA 1Y1NA 4U6CA 4IKSA 2EVOA 2Q94A 3IL0A 4RZYA 2Q93A 4EGEA
chains in the Genus database with same CATH superfamily
3IU9A 3RVAA 2GG0A 5CDLA 1WL9A 2MATA 1C27A 2Q95A 4U6WA 4ZNGA 1C23A 2G6PA 4IPAA 1A16A 4PV4A 2V3XA 3I7MA 4RZZA 5FCHA 3FMQA 3IU7A 3BIQA 1XNZA 4A6WA 2BWWA 3RORA 4PNCA 1B6AA 4A6VA 1B59A 3FM3A 3D27A 4IKUA 4FUKA 2GU6A 1PV9A 5D6FA 2EA4A 2GG2A 4FLKA 1XGOA 5CE6A 1MATA 4KM3A 1KP0A 3TB5A 2GGBA 4U6ZA 4U6JA 1M35A 5CDVA 4U76A 5E2CA 3MX6A 1KQ9A 2B3HA 1XGNA 2EVCA 4IECA 4MATA 2GA2A 4FLLA 1WKMA 5FCFA 2P9AA 2BB7A 4U70A 3CB6A 2BWTA 2GG5A 1C22A 2EVMA 4U69A 3QOCA 2GG3A 2Q92A 4R60A 2GTXA 3OVKA 4B28A 1XGSA 2OAZA 1XGMA 4S2RP 4OOKA 1YW7A 1QXYA 4S2TP 4FLJA 5CNXA 1YJ3A 5E5BA 2Q96A 1BN5A 4FLIA 3TAVA 2BH3A 2BWUA 1WY2A 3OOOA 4RGZ1 4S01A 3PKEA 1W7VA 3PKBA 4U6EA 2OKNA 4Z7MA 2BWSA 3CTZA 2GG7A 1W2MA 3S6BA 1JAWA 4U71A 3MATA 2BHBA 2ZSGA 5CIKA 2EA2A 2GG9A 1R5HA 2GU5A 2P99A 3PEBA 1YVMA 1WLRA 3Q6DA 1QZYA 3MR1A 4IF7A 2V3ZA 4U75A 5JHUA 1C24A 5JI6A 1YW8A 4JUQA 3BITA 1YW9A 1QXZA 5CDEA 2ADUA 1WL6A 2GGCA 2GG8A 3BIPA 2B3LA 1R5GA 4IU6A 4S00A 3FMRA 2BWXA 4ZWOA 1R58A 2V6CA 4ZWUA 1WBQA 2GU7A 3PKAA 3IU8A 4IDYA 2Q8KA 1O0XA 3CB5A 2B3KA 2NQ6A 1QXWA 2NQ7A 1C21A 2V3YA 3O5VA 4IKRA 2BHCA 4FKCA 2BHDA 4FO7A 4ZWPA 4HXXA 2BWVA 2BN7A 2P98A 3PKCA 3L7GA 2HOWA 2IW2A 3IG4A 3L24A 3PKDA 4QR8A 2GU4A 1CHMA 3PN9A 4FO8A 2GZ5A 1BOAA 2DFIA 4U73A 1WN1A 4IKTA 4U1BA 2BHAA 1N51A 2BWYA 5JFRA 1KQ0A 5CLSA 5D6EA 1Y1NA 4U6CA 4IKSA 2EVOA 2Q94A 3IL0A 4RZYA 2Q93A 4EGEA
chains in the Genus database with same CATH topology
3IU9A 3RVAA 2GG0A 5CDLA 1WL9A 2MATA 1C27A 2Q95A 4U6WA 4ZNGA 1C23A 2G6PA 4IPAA 1A16A 4PV4A 2V3XA 3I7MA 4RZZA 5FCHA 3FMQA 3IU7A 3BIQA 1XNZA 4A6WA 2BWWA 3RORA 4PNCA 1B6AA 4A6VA 1B59A 3FM3A 3D27A 4IKUA 4FUKA 2GU6A 1PV9A 5D6FA 2EA4A 2GG2A 4FLKA 1XGOA 5CE6A 1MATA 4KM3A 1KP0A 3TB5A 2GGBA 4U6ZA 4U6JA 1M35A 5CDVA 4U76A 5E2CA 3MX6A 1KQ9A 2B3HA 1XGNA 2EVCA 4IECA 4MATA 2GA2A 4FLLA 1WKMA 5FCFA 2P9AA 2BB7A 4U70A 3CB6A 2BWTA 2GG5A 1C22A 2EVMA 4U69A 3QOCA 2GG3A 2Q92A 4R60A 2GTXA 3OVKA 4B28A 1XGSA 2OAZA 1XGMA 4S2RP 4OOKA 1YW7A 1QXYA 4S2TP 4FLJA 5CNXA 1YJ3A 5E5BA 2Q96A 1BN5A 4FLIA 3TAVA 2BH3A 2BWUA 1WY2A 3OOOA 4RGZ1 4S01A 3PKEA 1W7VA 3PKBA 4U6EA 2OKNA 4Z7MA 2BWSA 3CTZA 2GG7A 1W2MA 3S6BA 1JAWA 4U71A 3MATA 2BHBA 2ZSGA 5CIKA 2EA2A 2GG9A 1R5HA 2GU5A 2P99A 3PEBA 1YVMA 1WLRA 3Q6DA 1QZYA 3MR1A 4IF7A 2V3ZA 4U75A 5JHUA 1C24A 5JI6A 1YW8A 4JUQA 3BITA 1YW9A 1QXZA 5CDEA 2ADUA 1WL6A 2GGCA 2GG8A 3BIPA 2B3LA 1R5GA 4IU6A 4S00A 3FMRA 2BWXA 4ZWOA 1R58A 2V6CA 4ZWUA 1WBQA 2GU7A 3PKAA 3IU8A 4IDYA 2Q8KA 1O0XA 3CB5A 2B3KA 2NQ6A 1QXWA 2NQ7A 1C21A 2V3YA 3O5VA 4IKRA 2BHCA 4FKCA 2BHDA 4FO7A 4ZWPA 4HXXA 2BWVA 2BN7A 2P98A 3PKCA 3L7GA 2HOWA 2IW2A 3IG4A 3L24A 3PKDA 4QR8A 2GU4A 1CHMA 3PN9A 4FO8A 2GZ5A 1BOAA 2DFIA 4U73A 1WN1A 4IKTA 4U1BA 2BHAA 1N51A 2BWYA 5JFRA 1KQ0A 5CLSA 5D6EA 1Y1NA 4U6CA 4IKSA 2EVOA 2Q94A 3IL0A 4RZYA 2Q93A 4EGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU9 A;  3RVA A;  2GG0 A;  5CDL A;  1WL9 A;  2MAT A;  1C27 A;  2Q95 A;  4U6W A;  4ZNG A;  1C23 A;  2G6P A;  4IPA A;  1A16 A;  4PV4 A;  2V3X A;  3I7M A;  4RZZ A;  5FCH A;  3FMQ A;  3IU7 A;  3BIQ A;  1XNZ A;  4A6W A;  2BWW A;  3ROR A;  4PNC A;  1B6A A;  4A6V A;  1B59 A;  3FM3 A;  3D27 A;  4IKU A;  4FUK A;  2GU6 A;  1PV9 A;  5D6F A;  2EA4 A;  2GG2 A;  4FLK A;  1XGO A;  5CE6 A;  1MAT A;  4KM3 A;  1KP0 A;  3TB5 A;  2GGB A;  4U6Z A;  4U6J A;  1M35 A;  5CDV A;  4U76 A;  5E2C A;  3MX6 A;  1KQ9 A;  2B3H A;  1XGN A;  2EVC A;  4IEC A;  4MAT A;  2GA2 A;  4FLL A;  1WKM A;  5FCF A;  2P9A A;  2BB7 A;  4U70 A;  3CB6 A;  2BWT A;  2GG5 A;  1C22 A;  2EVM A;  4U69 A;  3QOC A;  2GG3 A;  2Q92 A;  4R60 A;  2GTX A;  3OVK A;  4B28 A;  1XGS A;  2OAZ A;  1XGM A;  4S2R P;  4OOK A;  1YW7 A;  1QXY A;  4S2T P;  4FLJ A;  5CNX A;  1YJ3 A;  5E5B A;  2Q96 A;  1BN5 A;  4FLI A;  3TAV A;  2BH3 A;  2BWU A;  1WY2 A;  3OOO A;  4RGZ 1;  4S01 A;  3PKE A;  1W7V A;  3PKB A;  4U6E A;  2OKN A;  4Z7M A;  2BWS A;  3CTZ A;  2GG7 A;  1W2M A;  3S6B A;  1JAW A;  4U71 A;  3MAT A;  2BHB A;  2ZSG A;  5CIK A;  2EA2 A;  2GG9 A;  1R5H A;  2GU5 A;  2P99 A;  3PEB A;  1YVM A;  1WLR A;  3Q6D A;  1QZY A;  3MR1 A;  4IF7 A;  2V3Z A;  4U75 A;  5JHU A;  1C24 A;  5JI6 A;  1YW8 A;  4JUQ A;  3BIT A;  1YW9 A;  1QXZ A;  5CDE A;  2ADU A;  1WL6 A;  2GGC A;  2GG8 A;  3BIP A;  2B3L A;  1R5G A;  4IU6 A;  4S00 A;  3FMR A;  2BWX A;  4ZWO A;  1R58 A;  2V6C A;  4ZWU A;  1WBQ A;  2GU7 A;  3PKA A;  3IU8 A;  4IDY A;  2Q8K A;  1O0X A;  3CB5 A;  2B3K A;  2NQ6 A;  1QXW A;  2NQ7 A;  1C21 A;  2V3Y A;  3O5V A;  4IKR A;  2BHC A;  4FKC A;  2BHD A;  4FO7 A;  4ZWP A;  4HXX A;  2BWV A;  2BN7 A;  2P98 A;  3PKC A;  3L7G A;  2HOW A;  2IW2 A;  3IG4 A;  3L24 A;  3PKD A;  4QR8 A;  2GU4 A;  1CHM A;  3PN9 A;  4FO8 A;  2GZ5 A;  1BOA A;  2DFI A;  4U73 A;  1WN1 A;  4IKT A;  4U1B A;  2BHA A;  1N51 A;  2BWY A;  5JFR A;  1KQ0 A;  5CLS A;  5D6E A;  1Y1N A;  4U6C A;  4IKS A;  2EVO A;  2Q94 A;  3IL0 A;  4RZY A;  2Q93 A;  4EGE A; 
#chains in the Genus database with same CATH topology
 3IU9 A;  3RVA A;  2GG0 A;  5CDL A;  1WL9 A;  2MAT A;  1C27 A;  2Q95 A;  4U6W A;  4ZNG A;  1C23 A;  2G6P A;  4IPA A;  1A16 A;  4PV4 A;  2V3X A;  3I7M A;  4RZZ A;  5FCH A;  3FMQ A;  3IU7 A;  3BIQ A;  1XNZ A;  4A6W A;  2BWW A;  3ROR A;  4PNC A;  1B6A A;  4A6V A;  1B59 A;  3FM3 A;  3D27 A;  4IKU A;  4FUK A;  2GU6 A;  1PV9 A;  5D6F A;  2EA4 A;  2GG2 A;  4FLK A;  1XGO A;  5CE6 A;  1MAT A;  4KM3 A;  1KP0 A;  3TB5 A;  2GGB A;  4U6Z A;  4U6J A;  1M35 A;  5CDV A;  4U76 A;  5E2C A;  3MX6 A;  1KQ9 A;  2B3H A;  1XGN A;  2EVC A;  4IEC A;  4MAT A;  2GA2 A;  4FLL A;  1WKM A;  5FCF A;  2P9A A;  2BB7 A;  4U70 A;  3CB6 A;  2BWT A;  2GG5 A;  1C22 A;  2EVM A;  4U69 A;  3QOC A;  2GG3 A;  2Q92 A;  4R60 A;  2GTX A;  3OVK A;  4B28 A;  1XGS A;  2OAZ A;  1XGM A;  4S2R P;  4OOK A;  1YW7 A;  1QXY A;  4S2T P;  4FLJ A;  5CNX A;  1YJ3 A;  5E5B A;  2Q96 A;  1BN5 A;  4FLI A;  3TAV A;  2BH3 A;  2BWU A;  1WY2 A;  3OOO A;  4RGZ 1;  4S01 A;  3PKE A;  1W7V A;  3PKB A;  4U6E A;  2OKN A;  4Z7M A;  2BWS A;  3CTZ A;  2GG7 A;  1W2M A;  3S6B A;  1JAW A;  4U71 A;  3MAT A;  2BHB A;  2ZSG A;  5CIK A;  2EA2 A;  2GG9 A;  1R5H A;  2GU5 A;  2P99 A;  3PEB A;  1YVM A;  1WLR A;  3Q6D A;  1QZY A;  3MR1 A;  4IF7 A;  2V3Z A;  4U75 A;  5JHU A;  1C24 A;  5JI6 A;  1YW8 A;  4JUQ A;  3BIT A;  1YW9 A;  1QXZ A;  5CDE A;  2ADU A;  1WL6 A;  2GGC A;  2GG8 A;  3BIP A;  2B3L A;  1R5G A;  4IU6 A;  4S00 A;  3FMR A;  2BWX A;  4ZWO A;  1R58 A;  2V6C A;  4ZWU A;  1WBQ A;  2GU7 A;  3PKA A;  3IU8 A;  4IDY A;  2Q8K A;  1O0X A;  3CB5 A;  2B3K A;  2NQ6 A;  1QXW A;  2NQ7 A;  1C21 A;  2V3Y A;  3O5V A;  4IKR A;  2BHC A;  4FKC A;  2BHD A;  4FO7 A;  4ZWP A;  4HXX A;  2BWV A;  2BN7 A;  2P98 A;  3PKC A;  3L7G A;  2HOW A;  2IW2 A;  3IG4 A;  3L24 A;  3PKD A;  4QR8 A;  2GU4 A;  1CHM A;  3PN9 A;  4FO8 A;  2GZ5 A;  1BOA A;  2DFI A;  4U73 A;  1WN1 A;  4IKT A;  4U1B A;  2BHA A;  1N51 A;  2BWY A;  5JFR A;  1KQ0 A;  5CLS A;  5D6E A;  1Y1N A;  4U6C A;  4IKS A;  2EVO A;  2Q94 A;  3IL0 A;  4RZY A;  2Q93 A;  4EGE A; 
#chains in the Genus database with same CATH homology
 3IU9 A;  3RVA A;  2GG0 A;  5CDL A;  1WL9 A;  2MAT A;  1C27 A;  2Q95 A;  4U6W A;  4ZNG A;  1C23 A;  2G6P A;  4IPA A;  1A16 A;  4PV4 A;  2V3X A;  3I7M A;  4RZZ A;  5FCH A;  3FMQ A;  3IU7 A;  3BIQ A;  1XNZ A;  4A6W A;  2BWW A;  3ROR A;  4PNC A;  1B6A A;  4A6V A;  1B59 A;  3FM3 A;  3D27 A;  4IKU A;  4FUK A;  2GU6 A;  1PV9 A;  5D6F A;  2EA4 A;  2GG2 A;  4FLK A;  1XGO A;  5CE6 A;  1MAT A;  4KM3 A;  1KP0 A;  3TB5 A;  2GGB A;  4U6Z A;  4U6J A;  1M35 A;  5CDV A;  4U76 A;  5E2C A;  3MX6 A;  1KQ9 A;  2B3H A;  1XGN A;  2EVC A;  4IEC A;  4MAT A;  2GA2 A;  4FLL A;  1WKM A;  5FCF A;  2P9A A;  2BB7 A;  4U70 A;  3CB6 A;  2BWT A;  2GG5 A;  1C22 A;  2EVM A;  4U69 A;  3QOC A;  2GG3 A;  2Q92 A;  4R60 A;  2GTX A;  3OVK A;  4B28 A;  1XGS A;  2OAZ A;  1XGM A;  4S2R P;  4OOK A;  1YW7 A;  1QXY A;  4S2T P;  4FLJ A;  5CNX A;  1YJ3 A;  5E5B A;  2Q96 A;  1BN5 A;  4FLI A;  3TAV A;  2BH3 A;  2BWU A;  1WY2 A;  3OOO A;  4RGZ 1;  4S01 A;  3PKE A;  1W7V A;  3PKB A;  4U6E A;  2OKN A;  4Z7M A;  2BWS A;  3CTZ A;  2GG7 A;  1W2M A;  3S6B A;  1JAW A;  4U71 A;  3MAT A;  2BHB A;  2ZSG A;  5CIK A;  2EA2 A;  2GG9 A;  1R5H A;  2GU5 A;  2P99 A;  3PEB A;  1YVM A;  1WLR A;  3Q6D A;  1QZY A;  3MR1 A;  4IF7 A;  2V3Z A;  4U75 A;  5JHU A;  1C24 A;  5JI6 A;  1YW8 A;  4JUQ A;  3BIT A;  1YW9 A;  1QXZ A;  5CDE A;  2ADU A;  1WL6 A;  2GGC A;  2GG8 A;  3BIP A;  2B3L A;  1R5G A;  4IU6 A;  4S00 A;  3FMR A;  2BWX A;  4ZWO A;  1R58 A;  2V6C A;  4ZWU A;  1WBQ A;  2GU7 A;  3PKA A;  3IU8 A;  4IDY A;  2Q8K A;  1O0X A;  3CB5 A;  2B3K A;  2NQ6 A;  1QXW A;  2NQ7 A;  1C21 A;  2V3Y A;  3O5V A;  4IKR A;  2BHC A;  4FKC A;  2BHD A;  4FO7 A;  4ZWP A;  4HXX A;  2BWV A;  2BN7 A;  2P98 A;  3PKC A;  3L7G A;  2HOW A;  2IW2 A;  3IG4 A;  3L24 A;  3PKD A;  4QR8 A;  2GU4 A;  1CHM A;  3PN9 A;  4FO8 A;  2GZ5 A;  1BOA A;  2DFI A;  4U73 A;  1WN1 A;  4IKT A;  4U1B A;  2BHA A;  1N51 A;  2BWY A;  5JFR A;  1KQ0 A;  5CLS A;  5D6E A;  1Y1N A;  4U6C A;  4IKS A;  2EVO A;  2Q94 A;  3IL0 A;  4RZY A;  2Q93 A;  4EGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...