3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
2BH3A 1W2MA 3BITA 2GZ5A 1WN1A 1QXYA 3MR1A 2BWVA 1XGOA 3OOOA 4JUQA 4U6CA 3RVAA 2GU7A 2NQ7A 2P98A 4ZWUA 1KQ9A 4PNCA 3L7GA 2G6PA 2Q92A 2GU5A 1YW8A 5FCHA 1C23A 3IG4A 2P99A 2BB7A 4FO8A 2ZSGA 1MATA 3L24A 1C21A 3FMRA 4FLLA 2GTXA 1R5GA 1QZYA 4IKTA 4U73A 3BIQA 5CE6A 1WBQA 2BWUA 1C22A 2NQ6A 2GGBA 3PKBA 5E2CA 3PN9A 4S2RP 4FLIA 2BWXA 3PKDA 4IKSA 5D6FA 1XGNA 4KM3A 2GG2A 5CNXA 2B3KA 4U1BA 4IF7A 4U70A 3IL0A 1N51A 1M35A 5CDVA 1XNZA 4S01A 2BWTA 2GU6A 3MATA 1WL6A 2V3XA 4A6VA 1JAWA 3CB6A 3FMQA 1XGMA 2GU4A 2DFIA 2BHCA 4FUKA 4RZZA 1QXWA 2Q8KA 5FCFA 2IW2A 5JI6A 2Q94A 3MX6A 4RZYA 4ZNGA 4OOKA 1WLRA 1YW7A 2B3HA 5JFRA 3PKCA 5CIKA 4Z7MA 3Q6DA 4U6EA 4FO7A 1Y1NA 5CDLA 3O5VA 2B3LA 4U71A 2GG5A 4U6ZA 3QOCA 4S00A 4RGZ1 2GGCA 2Q95A 4ZWOA 1C24A 2GG7A 1BOAA 1C27A 1KP0A 4U6WA 2BHAA 2EA2A 2OAZA 1KQ0A 1R58A 1QXZA 4U69A 2GA2A 3CTZA 4A6WA 4IU6A 2GG9A 4HXXA 2BN7A 4R60A 3I7MA 5D6EA 1WL9A 1B6AA 1WY2A 1R5HA 3PKAA 2EA4A 5CLSA 4FKCA 1CHMA 2OKNA 3PEBA 3TB5A 4FLJA 4IDYA 4U75A 1O0XA 2ADUA 4IPAA 1YVMA 2Q93A 1YJ3A 2V6CA 5CDEA 2Q96A 1A16A 2BHDA 2BWSA 4B28A 4IECA 4EGEA 2GG8A 2GG0A 4QR8A 2MATA 3IU9A 1WKMA 2EVMA 2BWWA 4IKUA 4FLKA 2BHBA 2V3YA 3RORA 4U76A 1BN5A 3IU7A 5JHUA 2P9AA 3OVKA 4IKRA 4MATA 4S2TP 1PV9A 2BWYA 4U6JA 2GG3A 3D27A 3S6BA 3PKEA 4ZWPA 2EVCA 2HOWA 3BIPA 5E5BA 1YW9A 2V3ZA 3IU8A 1B59A 2EVOA 1W7VA 3CB5A 3FM3A 1XGSA 3TAVA 4PV4A
chains in the Genus database with same CATH superfamily
2BH3A 1W2MA 3BITA 2GZ5A 1WN1A 1QXYA 3MR1A 2BWVA 1XGOA 3OOOA 4JUQA 4U6CA 3RVAA 2GU7A 2NQ7A 2P98A 4ZWUA 1KQ9A 4PNCA 3L7GA 2G6PA 2Q92A 2GU5A 1YW8A 5FCHA 1C23A 3IG4A 2P99A 2BB7A 4FO8A 2ZSGA 1MATA 3L24A 1C21A 3FMRA 4FLLA 2GTXA 1R5GA 1QZYA 4IKTA 4U73A 3BIQA 5CE6A 1WBQA 2BWUA 1C22A 2NQ6A 2GGBA 3PKBA 5E2CA 3PN9A 4S2RP 4FLIA 2BWXA 3PKDA 4IKSA 5D6FA 1XGNA 4KM3A 2GG2A 5CNXA 2B3KA 4U1BA 4IF7A 4U70A 3IL0A 1N51A 1M35A 5CDVA 1XNZA 4S01A 2BWTA 2GU6A 3MATA 1WL6A 2V3XA 4A6VA 1JAWA 3CB6A 3FMQA 1XGMA 2GU4A 2DFIA 2BHCA 4FUKA 4RZZA 1QXWA 2Q8KA 5FCFA 2IW2A 5JI6A 2Q94A 3MX6A 4RZYA 4ZNGA 4OOKA 1WLRA 1YW7A 2B3HA 5JFRA 3PKCA 5CIKA 4Z7MA 3Q6DA 4U6EA 4FO7A 1Y1NA 5CDLA 3O5VA 2B3LA 4U71A 2GG5A 4U6ZA 3QOCA 4S00A 4RGZ1 2GGCA 2Q95A 4ZWOA 1C24A 2GG7A 1BOAA 1C27A 1KP0A 4U6WA 2BHAA 2EA2A 2OAZA 1KQ0A 1R58A 1QXZA 4U69A 2GA2A 3CTZA 4A6WA 4IU6A 2GG9A 4HXXA 2BN7A 4R60A 3I7MA 5D6EA 1WL9A 1B6AA 1WY2A 1R5HA 3PKAA 2EA4A 5CLSA 4FKCA 1CHMA 2OKNA 3PEBA 3TB5A 4FLJA 4IDYA 4U75A 1O0XA 2ADUA 4IPAA 1YVMA 2Q93A 1YJ3A 2V6CA 5CDEA 2Q96A 1A16A 2BHDA 2BWSA 4B28A 4IECA 4EGEA 2GG8A 2GG0A 4QR8A 2MATA 3IU9A 1WKMA 2EVMA 2BWWA 4IKUA 4FLKA 2BHBA 2V3YA 3RORA 4U76A 1BN5A 3IU7A 5JHUA 2P9AA 3OVKA 4IKRA 4MATA 4S2TP 1PV9A 2BWYA 4U6JA 2GG3A 3D27A 3S6BA 3PKEA 4ZWPA 2EVCA 2HOWA 3BIPA 5E5BA 1YW9A 2V3ZA 3IU8A 1B59A 2EVOA 1W7VA 3CB5A 3FM3A 1XGSA 3TAVA 4PV4A
chains in the Genus database with same CATH topology
2BH3A 1W2MA 3BITA 2GZ5A 1WN1A 1QXYA 3MR1A 2BWVA 1XGOA 3OOOA 4JUQA 4U6CA 3RVAA 2GU7A 2NQ7A 2P98A 4ZWUA 1KQ9A 4PNCA 3L7GA 2G6PA 2Q92A 2GU5A 1YW8A 5FCHA 1C23A 3IG4A 2P99A 2BB7A 4FO8A 2ZSGA 1MATA 3L24A 1C21A 3FMRA 4FLLA 2GTXA 1R5GA 1QZYA 4IKTA 4U73A 3BIQA 5CE6A 1WBQA 2BWUA 1C22A 2NQ6A 2GGBA 3PKBA 5E2CA 3PN9A 4S2RP 4FLIA 2BWXA 3PKDA 4IKSA 5D6FA 1XGNA 4KM3A 2GG2A 5CNXA 2B3KA 4U1BA 4IF7A 4U70A 3IL0A 1N51A 1M35A 5CDVA 1XNZA 4S01A 2BWTA 2GU6A 3MATA 1WL6A 2V3XA 4A6VA 1JAWA 3CB6A 3FMQA 1XGMA 2GU4A 2DFIA 2BHCA 4FUKA 4RZZA 1QXWA 2Q8KA 5FCFA 2IW2A 5JI6A 2Q94A 3MX6A 4RZYA 4ZNGA 4OOKA 1WLRA 1YW7A 2B3HA 5JFRA 3PKCA 5CIKA 4Z7MA 3Q6DA 4U6EA 4FO7A 1Y1NA 5CDLA 3O5VA 2B3LA 4U71A 2GG5A 4U6ZA 3QOCA 4S00A 4RGZ1 2GGCA 2Q95A 4ZWOA 1C24A 2GG7A 1BOAA 1C27A 1KP0A 4U6WA 2BHAA 2EA2A 2OAZA 1KQ0A 1R58A 1QXZA 4U69A 2GA2A 3CTZA 4A6WA 4IU6A 2GG9A 4HXXA 2BN7A 4R60A 3I7MA 5D6EA 1WL9A 1B6AA 1WY2A 1R5HA 3PKAA 2EA4A 5CLSA 4FKCA 1CHMA 2OKNA 3PEBA 3TB5A 4FLJA 4IDYA 4U75A 1O0XA 2ADUA 4IPAA 1YVMA 2Q93A 1YJ3A 2V6CA 5CDEA 2Q96A 1A16A 2BHDA 2BWSA 4B28A 4IECA 4EGEA 2GG8A 2GG0A 4QR8A 2MATA 3IU9A 1WKMA 2EVMA 2BWWA 4IKUA 4FLKA 2BHBA 2V3YA 3RORA 4U76A 1BN5A 3IU7A 5JHUA 2P9AA 3OVKA 4IKRA 4MATA 4S2TP 1PV9A 2BWYA 4U6JA 2GG3A 3D27A 3S6BA 3PKEA 4ZWPA 2EVCA 2HOWA 3BIPA 5E5BA 1YW9A 2V3ZA 3IU8A 1B59A 2EVOA 1W7VA 3CB5A 3FM3A 1XGSA 3TAVA 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH3 A;  1W2M A;  3BIT A;  2GZ5 A;  1WN1 A;  1QXY A;  3MR1 A;  2BWV A;  1XGO A;  3OOO A;  4JUQ A;  4U6C A;  3RVA A;  2GU7 A;  2NQ7 A;  2P98 A;  4ZWU A;  1KQ9 A;  4PNC A;  3L7G A;  2G6P A;  2Q92 A;  2GU5 A;  1YW8 A;  5FCH A;  1C23 A;  3IG4 A;  2P99 A;  2BB7 A;  4FO8 A;  2ZSG A;  1MAT A;  3L24 A;  1C21 A;  3FMR A;  4FLL A;  2GTX A;  1R5G A;  1QZY A;  4IKT A;  4U73 A;  3BIQ A;  5CE6 A;  1WBQ A;  2BWU A;  1C22 A;  2NQ6 A;  2GGB A;  3PKB A;  5E2C A;  3PN9 A;  4S2R P;  4FLI A;  2BWX A;  3PKD A;  4IKS A;  5D6F A;  1XGN A;  4KM3 A;  2GG2 A;  5CNX A;  2B3K A;  4U1B A;  4IF7 A;  4U70 A;  3IL0 A;  1N51 A;  1M35 A;  5CDV A;  1XNZ A;  4S01 A;  2BWT A;  2GU6 A;  3MAT A;  1WL6 A;  2V3X A;  4A6V A;  1JAW A;  3CB6 A;  3FMQ A;  1XGM A;  2GU4 A;  2DFI A;  2BHC A;  4FUK A;  4RZZ A;  1QXW A;  2Q8K A;  5FCF A;  2IW2 A;  5JI6 A;  2Q94 A;  3MX6 A;  4RZY A;  4ZNG A;  4OOK A;  1WLR A;  1YW7 A;  2B3H A;  5JFR A;  3PKC A;  5CIK A;  4Z7M A;  3Q6D A;  4U6E A;  4FO7 A;  1Y1N A;  5CDL A;  3O5V A;  2B3L A;  4U71 A;  2GG5 A;  4U6Z A;  3QOC A;  4S00 A;  4RGZ 1;  2GGC A;  2Q95 A;  4ZWO A;  1C24 A;  2GG7 A;  1BOA A;  1C27 A;  1KP0 A;  4U6W A;  2BHA A;  2EA2 A;  2OAZ A;  1KQ0 A;  1R58 A;  1QXZ A;  4U69 A;  2GA2 A;  3CTZ A;  4A6W A;  4IU6 A;  2GG9 A;  4HXX A;  2BN7 A;  4R60 A;  3I7M A;  5D6E A;  1WL9 A;  1B6A A;  1WY2 A;  1R5H A;  3PKA A;  2EA4 A;  5CLS A;  4FKC A;  1CHM A;  2OKN A;  3PEB A;  3TB5 A;  4FLJ A;  4IDY A;  4U75 A;  1O0X A;  2ADU A;  4IPA A;  1YVM A;  2Q93 A;  1YJ3 A;  2V6C A;  5CDE A;  2Q96 A;  1A16 A;  2BHD A;  2BWS A;  4B28 A;  4IEC A;  4EGE A;  2GG8 A;  2GG0 A;  4QR8 A;  2MAT A;  3IU9 A;  1WKM A;  2EVM A;  2BWW A;  4IKU A;  4FLK A;  2BHB A;  2V3Y A;  3ROR A;  4U76 A;  1BN5 A;  3IU7 A;  5JHU A;  2P9A A;  3OVK A;  4IKR A;  4MAT A;  4S2T P;  1PV9 A;  2BWY A;  4U6J A;  2GG3 A;  3D27 A;  3S6B A;  3PKE A;  4ZWP A;  2EVC A;  2HOW A;  3BIP A;  5E5B A;  1YW9 A;  2V3Z A;  3IU8 A;  1B59 A;  2EVO A;  1W7V A;  3CB5 A;  3FM3 A;  1XGS A;  3TAV A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 2BH3 A;  1W2M A;  3BIT A;  2GZ5 A;  1WN1 A;  1QXY A;  3MR1 A;  2BWV A;  1XGO A;  3OOO A;  4JUQ A;  4U6C A;  3RVA A;  2GU7 A;  2NQ7 A;  2P98 A;  4ZWU A;  1KQ9 A;  4PNC A;  3L7G A;  2G6P A;  2Q92 A;  2GU5 A;  1YW8 A;  5FCH A;  1C23 A;  3IG4 A;  2P99 A;  2BB7 A;  4FO8 A;  2ZSG A;  1MAT A;  3L24 A;  1C21 A;  3FMR A;  4FLL A;  2GTX A;  1R5G A;  1QZY A;  4IKT A;  4U73 A;  3BIQ A;  5CE6 A;  1WBQ A;  2BWU A;  1C22 A;  2NQ6 A;  2GGB A;  3PKB A;  5E2C A;  3PN9 A;  4S2R P;  4FLI A;  2BWX A;  3PKD A;  4IKS A;  5D6F A;  1XGN A;  4KM3 A;  2GG2 A;  5CNX A;  2B3K A;  4U1B A;  4IF7 A;  4U70 A;  3IL0 A;  1N51 A;  1M35 A;  5CDV A;  1XNZ A;  4S01 A;  2BWT A;  2GU6 A;  3MAT A;  1WL6 A;  2V3X A;  4A6V A;  1JAW A;  3CB6 A;  3FMQ A;  1XGM A;  2GU4 A;  2DFI A;  2BHC A;  4FUK A;  4RZZ A;  1QXW A;  2Q8K A;  5FCF A;  2IW2 A;  5JI6 A;  2Q94 A;  3MX6 A;  4RZY A;  4ZNG A;  4OOK A;  1WLR A;  1YW7 A;  2B3H A;  5JFR A;  3PKC A;  5CIK A;  4Z7M A;  3Q6D A;  4U6E A;  4FO7 A;  1Y1N A;  5CDL A;  3O5V A;  2B3L A;  4U71 A;  2GG5 A;  4U6Z A;  3QOC A;  4S00 A;  4RGZ 1;  2GGC A;  2Q95 A;  4ZWO A;  1C24 A;  2GG7 A;  1BOA A;  1C27 A;  1KP0 A;  4U6W A;  2BHA A;  2EA2 A;  2OAZ A;  1KQ0 A;  1R58 A;  1QXZ A;  4U69 A;  2GA2 A;  3CTZ A;  4A6W A;  4IU6 A;  2GG9 A;  4HXX A;  2BN7 A;  4R60 A;  3I7M A;  5D6E A;  1WL9 A;  1B6A A;  1WY2 A;  1R5H A;  3PKA A;  2EA4 A;  5CLS A;  4FKC A;  1CHM A;  2OKN A;  3PEB A;  3TB5 A;  4FLJ A;  4IDY A;  4U75 A;  1O0X A;  2ADU A;  4IPA A;  1YVM A;  2Q93 A;  1YJ3 A;  2V6C A;  5CDE A;  2Q96 A;  1A16 A;  2BHD A;  2BWS A;  4B28 A;  4IEC A;  4EGE A;  2GG8 A;  2GG0 A;  4QR8 A;  2MAT A;  3IU9 A;  1WKM A;  2EVM A;  2BWW A;  4IKU A;  4FLK A;  2BHB A;  2V3Y A;  3ROR A;  4U76 A;  1BN5 A;  3IU7 A;  5JHU A;  2P9A A;  3OVK A;  4IKR A;  4MAT A;  4S2T P;  1PV9 A;  2BWY A;  4U6J A;  2GG3 A;  3D27 A;  3S6B A;  3PKE A;  4ZWP A;  2EVC A;  2HOW A;  3BIP A;  5E5B A;  1YW9 A;  2V3Z A;  3IU8 A;  1B59 A;  2EVO A;  1W7V A;  3CB5 A;  3FM3 A;  1XGS A;  3TAV A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 2BH3 A;  1W2M A;  3BIT A;  2GZ5 A;  1WN1 A;  1QXY A;  3MR1 A;  2BWV A;  1XGO A;  3OOO A;  4JUQ A;  4U6C A;  3RVA A;  2GU7 A;  2NQ7 A;  2P98 A;  4ZWU A;  1KQ9 A;  4PNC A;  3L7G A;  2G6P A;  2Q92 A;  2GU5 A;  1YW8 A;  5FCH A;  1C23 A;  3IG4 A;  2P99 A;  2BB7 A;  4FO8 A;  2ZSG A;  1MAT A;  3L24 A;  1C21 A;  3FMR A;  4FLL A;  2GTX A;  1R5G A;  1QZY A;  4IKT A;  4U73 A;  3BIQ A;  5CE6 A;  1WBQ A;  2BWU A;  1C22 A;  2NQ6 A;  2GGB A;  3PKB A;  5E2C A;  3PN9 A;  4S2R P;  4FLI A;  2BWX A;  3PKD A;  4IKS A;  5D6F A;  1XGN A;  4KM3 A;  2GG2 A;  5CNX A;  2B3K A;  4U1B A;  4IF7 A;  4U70 A;  3IL0 A;  1N51 A;  1M35 A;  5CDV A;  1XNZ A;  4S01 A;  2BWT A;  2GU6 A;  3MAT A;  1WL6 A;  2V3X A;  4A6V A;  1JAW A;  3CB6 A;  3FMQ A;  1XGM A;  2GU4 A;  2DFI A;  2BHC A;  4FUK A;  4RZZ A;  1QXW A;  2Q8K A;  5FCF A;  2IW2 A;  5JI6 A;  2Q94 A;  3MX6 A;  4RZY A;  4ZNG A;  4OOK A;  1WLR A;  1YW7 A;  2B3H A;  5JFR A;  3PKC A;  5CIK A;  4Z7M A;  3Q6D A;  4U6E A;  4FO7 A;  1Y1N A;  5CDL A;  3O5V A;  2B3L A;  4U71 A;  2GG5 A;  4U6Z A;  3QOC A;  4S00 A;  4RGZ 1;  2GGC A;  2Q95 A;  4ZWO A;  1C24 A;  2GG7 A;  1BOA A;  1C27 A;  1KP0 A;  4U6W A;  2BHA A;  2EA2 A;  2OAZ A;  1KQ0 A;  1R58 A;  1QXZ A;  4U69 A;  2GA2 A;  3CTZ A;  4A6W A;  4IU6 A;  2GG9 A;  4HXX A;  2BN7 A;  4R60 A;  3I7M A;  5D6E A;  1WL9 A;  1B6A A;  1WY2 A;  1R5H A;  3PKA A;  2EA4 A;  5CLS A;  4FKC A;  1CHM A;  2OKN A;  3PEB A;  3TB5 A;  4FLJ A;  4IDY A;  4U75 A;  1O0X A;  2ADU A;  4IPA A;  1YVM A;  2Q93 A;  1YJ3 A;  2V6C A;  5CDE A;  2Q96 A;  1A16 A;  2BHD A;  2BWS A;  4B28 A;  4IEC A;  4EGE A;  2GG8 A;  2GG0 A;  4QR8 A;  2MAT A;  3IU9 A;  1WKM A;  2EVM A;  2BWW A;  4IKU A;  4FLK A;  2BHB A;  2V3Y A;  3ROR A;  4U76 A;  1BN5 A;  3IU7 A;  5JHU A;  2P9A A;  3OVK A;  4IKR A;  4MAT A;  4S2T P;  1PV9 A;  2BWY A;  4U6J A;  2GG3 A;  3D27 A;  3S6B A;  3PKE A;  4ZWP A;  2EVC A;  2HOW A;  3BIP A;  5E5B A;  1YW9 A;  2V3Z A;  3IU8 A;  1B59 A;  2EVO A;  1W7V A;  3CB5 A;  3FM3 A;  1XGS A;  3TAV A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...