3BIQA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
443
structure length
441
Chain Sequence
NIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDSKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 161
structure length 441
sequence length 443
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3biqA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3biqA02
2BWUA 4U6JA 2Q92A 3PKEA 4IPAA 3BIPA 2GG9A 4B28A 3FMRA 2GU5A 4A6WA 1B6AA 5D6FA 2GG5A 4IKSA 1PV9A 4IDYA 1XGNA 4ZWOA 1KQ9A 2HOWA 1W2MA 5FCHA 1BN5A 2B3HA 4FUKA 2OAZA 4KM3A 1R58A 1C23A 1C22A 2NQ7A 2EA2A 2GTXA 5CNXA 4R60A 4Z7MA 4U69A 4EGEA 1B59A 3MATA 4S00A 4FLIA 2BHBA 1QXYA 4RGZ1 2G6PA 5E2CA 4IU6A 1JAWA 5CDEA 2ZSGA 4ZNGA 4IKTA 4IECA 3QOCA 4U73A 4FLJA 5JI6A 4U1BA 3BITA 5FCFA 3OOOA 3PKCA 1C24A 2GU7A 1QXZA 2BWYA 4U70A 3IU9A 2ADUA 4U6ZA 5D6EA 1WL6A 4MATA 5JHUA 2BWXA 4ZWPA 2GG8A 2V6CA 1WLRA 2DFIA 2GZ5A 5CIKA 1N51A 4S2TP 1R5GA 1WKMA 3PKDA 3BIQA 3TAVA 2BN7A 2BWVA 4U71A 5CDLA 1YJ3A 4S2RP 3L7GA 4IF7A 4PNCA 1Y1NA 1WBQA 2P9AA 2IW2A 3PKBA 4IKUA 2B3LA 2P98A 2Q96A 4OOKA 1CHMA 1KP0A 2GG3A 2V3YA 3O5VA 4U6CA 3S6BA 5JFRA 3IL0A 1YW8A 2B3KA 3RORA 1O0XA 5CE6A 2EA4A 4RZZA 4S01A 4JUQA 5CDVA 2GG0A 2P99A 1WL9A 2EVMA 1YW9A 2BWWA 3L24A 3IG4A 3RVAA 2EVCA 2NQ6A 4ZWUA 2BHDA 2V3ZA 1XGOA 1R5HA 1XGMA 3FMQA 4HXXA 3IU8A 4A6VA 1WN1A 2GGBA 2GU4A 2BWSA 2GG7A 2Q93A 2EVOA 1BOAA 5E5BA 3D27A 3TB5A 1YVMA 3CB6A 4U76A 2GA2A 1QXWA 1XNZA 3PN9A 4FO8A 3Q6DA 3MR1A 3MX6A 3CTZA 4QR8A 1YW7A 1KQ0A 4FLLA 3PEBA 2OKNA 1MATA 3IU7A 4FLKA 4RZYA 4U75A 1W7VA 2BHAA 2GGCA 1WY2A 2GG2A 2Q94A 1A16A 4FKCA 2V3XA 4U6WA 2GU6A 1M35A 3CB5A 2Q8KA 2BWTA 3OVKA 3I7MA 1C27A 1QZYA 3FM3A 5CLSA 2BB7A 2MATA 2Q95A 4IKRA 2BH3A 2BHCA 1C21A 1XGSA 4FO7A 4PV4A 3PKAA 4U6EA
chains in the Genus database with same CATH superfamily
2BWUA 4U6JA 2Q92A 3PKEA 4IPAA 3BIPA 2GG9A 4B28A 3FMRA 2GU5A 4A6WA 1B6AA 5D6FA 2GG5A 4IKSA 1PV9A 4IDYA 1XGNA 4ZWOA 1KQ9A 2HOWA 1W2MA 5FCHA 1BN5A 2B3HA 4FUKA 2OAZA 4KM3A 1R58A 1C23A 1C22A 2NQ7A 2EA2A 2GTXA 5CNXA 4R60A 4Z7MA 4U69A 4EGEA 1B59A 3MATA 4S00A 4FLIA 2BHBA 1QXYA 4RGZ1 2G6PA 5E2CA 4IU6A 1JAWA 5CDEA 2ZSGA 4ZNGA 4IKTA 4IECA 3QOCA 4U73A 4FLJA 5JI6A 4U1BA 3BITA 5FCFA 3OOOA 3PKCA 1C24A 2GU7A 1QXZA 2BWYA 4U70A 3IU9A 2ADUA 4U6ZA 5D6EA 1WL6A 4MATA 5JHUA 2BWXA 4ZWPA 2GG8A 2V6CA 1WLRA 2DFIA 2GZ5A 5CIKA 1N51A 4S2TP 1R5GA 1WKMA 3PKDA 3BIQA 3TAVA 2BN7A 2BWVA 4U71A 5CDLA 1YJ3A 4S2RP 3L7GA 4IF7A 4PNCA 1Y1NA 1WBQA 2P9AA 2IW2A 3PKBA 4IKUA 2B3LA 2P98A 2Q96A 4OOKA 1CHMA 1KP0A 2GG3A 2V3YA 3O5VA 4U6CA 3S6BA 5JFRA 3IL0A 1YW8A 2B3KA 3RORA 1O0XA 5CE6A 2EA4A 4RZZA 4S01A 4JUQA 5CDVA 2GG0A 2P99A 1WL9A 2EVMA 1YW9A 2BWWA 3L24A 3IG4A 3RVAA 2EVCA 2NQ6A 4ZWUA 2BHDA 2V3ZA 1XGOA 1R5HA 1XGMA 3FMQA 4HXXA 3IU8A 4A6VA 1WN1A 2GGBA 2GU4A 2BWSA 2GG7A 2Q93A 2EVOA 1BOAA 5E5BA 3D27A 3TB5A 1YVMA 3CB6A 4U76A 2GA2A 1QXWA 1XNZA 3PN9A 4FO8A 3Q6DA 3MR1A 3MX6A 3CTZA 4QR8A 1YW7A 1KQ0A 4FLLA 3PEBA 2OKNA 1MATA 3IU7A 4FLKA 4RZYA 4U75A 1W7VA 2BHAA 2GGCA 1WY2A 2GG2A 2Q94A 1A16A 4FKCA 2V3XA 4U6WA 2GU6A 1M35A 3CB5A 2Q8KA 2BWTA 3OVKA 3I7MA 1C27A 1QZYA 3FM3A 5CLSA 2BB7A 2MATA 2Q95A 4IKRA 2BH3A 2BHCA 1C21A 1XGSA 4FO7A 4PV4A 3PKAA 4U6EA
chains in the Genus database with same CATH topology
2BWUA 4U6JA 2Q92A 3PKEA 4IPAA 3BIPA 2GG9A 4B28A 3FMRA 2GU5A 4A6WA 1B6AA 5D6FA 2GG5A 4IKSA 1PV9A 4IDYA 1XGNA 4ZWOA 1KQ9A 2HOWA 1W2MA 5FCHA 1BN5A 2B3HA 4FUKA 2OAZA 4KM3A 1R58A 1C23A 1C22A 2NQ7A 2EA2A 2GTXA 5CNXA 4R60A 4Z7MA 4U69A 4EGEA 1B59A 3MATA 4S00A 4FLIA 2BHBA 1QXYA 4RGZ1 2G6PA 5E2CA 4IU6A 1JAWA 5CDEA 2ZSGA 4ZNGA 4IKTA 4IECA 3QOCA 4U73A 4FLJA 5JI6A 4U1BA 3BITA 5FCFA 3OOOA 3PKCA 1C24A 2GU7A 1QXZA 2BWYA 4U70A 3IU9A 2ADUA 4U6ZA 5D6EA 1WL6A 4MATA 5JHUA 2BWXA 4ZWPA 2GG8A 2V6CA 1WLRA 2DFIA 2GZ5A 5CIKA 1N51A 4S2TP 1R5GA 1WKMA 3PKDA 3BIQA 3TAVA 2BN7A 2BWVA 4U71A 5CDLA 1YJ3A 4S2RP 3L7GA 4IF7A 4PNCA 1Y1NA 1WBQA 2P9AA 2IW2A 3PKBA 4IKUA 2B3LA 2P98A 2Q96A 4OOKA 1CHMA 1KP0A 2GG3A 2V3YA 3O5VA 4U6CA 3S6BA 5JFRA 3IL0A 1YW8A 2B3KA 3RORA 1O0XA 5CE6A 2EA4A 4RZZA 4S01A 4JUQA 5CDVA 2GG0A 2P99A 1WL9A 2EVMA 1YW9A 2BWWA 3L24A 3IG4A 3RVAA 2EVCA 2NQ6A 4ZWUA 2BHDA 2V3ZA 1XGOA 1R5HA 1XGMA 3FMQA 4HXXA 3IU8A 4A6VA 1WN1A 2GGBA 2GU4A 2BWSA 2GG7A 2Q93A 2EVOA 1BOAA 5E5BA 3D27A 3TB5A 1YVMA 3CB6A 4U76A 2GA2A 1QXWA 1XNZA 3PN9A 4FO8A 3Q6DA 3MR1A 3MX6A 3CTZA 4QR8A 1YW7A 1KQ0A 4FLLA 3PEBA 2OKNA 1MATA 3IU7A 4FLKA 4RZYA 4U75A 1W7VA 2BHAA 2GGCA 1WY2A 2GG2A 2Q94A 1A16A 4FKCA 2V3XA 4U6WA 2GU6A 1M35A 3CB5A 2Q8KA 2BWTA 3OVKA 3I7MA 1C27A 1QZYA 3FM3A 5CLSA 2BB7A 2MATA 2Q95A 4IKRA 2BH3A 2BHCA 1C21A 1XGSA 4FO7A 4PV4A 3PKAA 4U6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  4U6J A;  2Q92 A;  3PKE A;  4IPA A;  3BIP A;  2GG9 A;  4B28 A;  3FMR A;  2GU5 A;  4A6W A;  1B6A A;  5D6F A;  2GG5 A;  4IKS A;  1PV9 A;  4IDY A;  1XGN A;  4ZWO A;  1KQ9 A;  2HOW A;  1W2M A;  5FCH A;  1BN5 A;  2B3H A;  4FUK A;  2OAZ A;  4KM3 A;  1R58 A;  1C23 A;  1C22 A;  2NQ7 A;  2EA2 A;  2GTX A;  5CNX A;  4R60 A;  4Z7M A;  4U69 A;  4EGE A;  1B59 A;  3MAT A;  4S00 A;  4FLI A;  2BHB A;  1QXY A;  4RGZ 1;  2G6P A;  5E2C A;  4IU6 A;  1JAW A;  5CDE A;  2ZSG A;  4ZNG A;  4IKT A;  4IEC A;  3QOC A;  4U73 A;  4FLJ A;  5JI6 A;  4U1B A;  3BIT A;  5FCF A;  3OOO A;  3PKC A;  1C24 A;  2GU7 A;  1QXZ A;  2BWY A;  4U70 A;  3IU9 A;  2ADU A;  4U6Z A;  5D6E A;  1WL6 A;  4MAT A;  5JHU A;  2BWX A;  4ZWP A;  2GG8 A;  2V6C A;  1WLR A;  2DFI A;  2GZ5 A;  5CIK A;  1N51 A;  4S2T P;  1R5G A;  1WKM A;  3PKD A;  3BIQ A;  3TAV A;  2BN7 A;  2BWV A;  4U71 A;  5CDL A;  1YJ3 A;  4S2R P;  3L7G A;  4IF7 A;  4PNC A;  1Y1N A;  1WBQ A;  2P9A A;  2IW2 A;  3PKB A;  4IKU A;  2B3L A;  2P98 A;  2Q96 A;  4OOK A;  1CHM A;  1KP0 A;  2GG3 A;  2V3Y A;  3O5V A;  4U6C A;  3S6B A;  5JFR A;  3IL0 A;  1YW8 A;  2B3K A;  3ROR A;  1O0X A;  5CE6 A;  2EA4 A;  4RZZ A;  4S01 A;  4JUQ A;  5CDV A;  2GG0 A;  2P99 A;  1WL9 A;  2EVM A;  1YW9 A;  2BWW A;  3L24 A;  3IG4 A;  3RVA A;  2EVC A;  2NQ6 A;  4ZWU A;  2BHD A;  2V3Z A;  1XGO A;  1R5H A;  1XGM A;  3FMQ A;  4HXX A;  3IU8 A;  4A6V A;  1WN1 A;  2GGB A;  2GU4 A;  2BWS A;  2GG7 A;  2Q93 A;  2EVO A;  1BOA A;  5E5B A;  3D27 A;  3TB5 A;  1YVM A;  3CB6 A;  4U76 A;  2GA2 A;  1QXW A;  1XNZ A;  3PN9 A;  4FO8 A;  3Q6D A;  3MR1 A;  3MX6 A;  3CTZ A;  4QR8 A;  1YW7 A;  1KQ0 A;  4FLL A;  3PEB A;  2OKN A;  1MAT A;  3IU7 A;  4FLK A;  4RZY A;  4U75 A;  1W7V A;  2BHA A;  2GGC A;  1WY2 A;  2GG2 A;  2Q94 A;  1A16 A;  4FKC A;  2V3X A;  4U6W A;  2GU6 A;  1M35 A;  3CB5 A;  2Q8K A;  2BWT A;  3OVK A;  3I7M A;  1C27 A;  1QZY A;  3FM3 A;  5CLS A;  2BB7 A;  2MAT A;  2Q95 A;  4IKR A;  2BH3 A;  2BHC A;  1C21 A;  1XGS A;  4FO7 A;  4PV4 A;  3PKA A;  4U6E A; 
#chains in the Genus database with same CATH topology
 2BWU A;  4U6J A;  2Q92 A;  3PKE A;  4IPA A;  3BIP A;  2GG9 A;  4B28 A;  3FMR A;  2GU5 A;  4A6W A;  1B6A A;  5D6F A;  2GG5 A;  4IKS A;  1PV9 A;  4IDY A;  1XGN A;  4ZWO A;  1KQ9 A;  2HOW A;  1W2M A;  5FCH A;  1BN5 A;  2B3H A;  4FUK A;  2OAZ A;  4KM3 A;  1R58 A;  1C23 A;  1C22 A;  2NQ7 A;  2EA2 A;  2GTX A;  5CNX A;  4R60 A;  4Z7M A;  4U69 A;  4EGE A;  1B59 A;  3MAT A;  4S00 A;  4FLI A;  2BHB A;  1QXY A;  4RGZ 1;  2G6P A;  5E2C A;  4IU6 A;  1JAW A;  5CDE A;  2ZSG A;  4ZNG A;  4IKT A;  4IEC A;  3QOC A;  4U73 A;  4FLJ A;  5JI6 A;  4U1B A;  3BIT A;  5FCF A;  3OOO A;  3PKC A;  1C24 A;  2GU7 A;  1QXZ A;  2BWY A;  4U70 A;  3IU9 A;  2ADU A;  4U6Z A;  5D6E A;  1WL6 A;  4MAT A;  5JHU A;  2BWX A;  4ZWP A;  2GG8 A;  2V6C A;  1WLR A;  2DFI A;  2GZ5 A;  5CIK A;  1N51 A;  4S2T P;  1R5G A;  1WKM A;  3PKD A;  3BIQ A;  3TAV A;  2BN7 A;  2BWV A;  4U71 A;  5CDL A;  1YJ3 A;  4S2R P;  3L7G A;  4IF7 A;  4PNC A;  1Y1N A;  1WBQ A;  2P9A A;  2IW2 A;  3PKB A;  4IKU A;  2B3L A;  2P98 A;  2Q96 A;  4OOK A;  1CHM A;  1KP0 A;  2GG3 A;  2V3Y A;  3O5V A;  4U6C A;  3S6B A;  5JFR A;  3IL0 A;  1YW8 A;  2B3K A;  3ROR A;  1O0X A;  5CE6 A;  2EA4 A;  4RZZ A;  4S01 A;  4JUQ A;  5CDV A;  2GG0 A;  2P99 A;  1WL9 A;  2EVM A;  1YW9 A;  2BWW A;  3L24 A;  3IG4 A;  3RVA A;  2EVC A;  2NQ6 A;  4ZWU A;  2BHD A;  2V3Z A;  1XGO A;  1R5H A;  1XGM A;  3FMQ A;  4HXX A;  3IU8 A;  4A6V A;  1WN1 A;  2GGB A;  2GU4 A;  2BWS A;  2GG7 A;  2Q93 A;  2EVO A;  1BOA A;  5E5B A;  3D27 A;  3TB5 A;  1YVM A;  3CB6 A;  4U76 A;  2GA2 A;  1QXW A;  1XNZ A;  3PN9 A;  4FO8 A;  3Q6D A;  3MR1 A;  3MX6 A;  3CTZ A;  4QR8 A;  1YW7 A;  1KQ0 A;  4FLL A;  3PEB A;  2OKN A;  1MAT A;  3IU7 A;  4FLK A;  4RZY A;  4U75 A;  1W7V A;  2BHA A;  2GGC A;  1WY2 A;  2GG2 A;  2Q94 A;  1A16 A;  4FKC A;  2V3X A;  4U6W A;  2GU6 A;  1M35 A;  3CB5 A;  2Q8K A;  2BWT A;  3OVK A;  3I7M A;  1C27 A;  1QZY A;  3FM3 A;  5CLS A;  2BB7 A;  2MAT A;  2Q95 A;  4IKR A;  2BH3 A;  2BHC A;  1C21 A;  1XGS A;  4FO7 A;  4PV4 A;  3PKA A;  4U6E A; 
#chains in the Genus database with same CATH homology
 2BWU A;  4U6J A;  2Q92 A;  3PKE A;  4IPA A;  3BIP A;  2GG9 A;  4B28 A;  3FMR A;  2GU5 A;  4A6W A;  1B6A A;  5D6F A;  2GG5 A;  4IKS A;  1PV9 A;  4IDY A;  1XGN A;  4ZWO A;  1KQ9 A;  2HOW A;  1W2M A;  5FCH A;  1BN5 A;  2B3H A;  4FUK A;  2OAZ A;  4KM3 A;  1R58 A;  1C23 A;  1C22 A;  2NQ7 A;  2EA2 A;  2GTX A;  5CNX A;  4R60 A;  4Z7M A;  4U69 A;  4EGE A;  1B59 A;  3MAT A;  4S00 A;  4FLI A;  2BHB A;  1QXY A;  4RGZ 1;  2G6P A;  5E2C A;  4IU6 A;  1JAW A;  5CDE A;  2ZSG A;  4ZNG A;  4IKT A;  4IEC A;  3QOC A;  4U73 A;  4FLJ A;  5JI6 A;  4U1B A;  3BIT A;  5FCF A;  3OOO A;  3PKC A;  1C24 A;  2GU7 A;  1QXZ A;  2BWY A;  4U70 A;  3IU9 A;  2ADU A;  4U6Z A;  5D6E A;  1WL6 A;  4MAT A;  5JHU A;  2BWX A;  4ZWP A;  2GG8 A;  2V6C A;  1WLR A;  2DFI A;  2GZ5 A;  5CIK A;  1N51 A;  4S2T P;  1R5G A;  1WKM A;  3PKD A;  3BIQ A;  3TAV A;  2BN7 A;  2BWV A;  4U71 A;  5CDL A;  1YJ3 A;  4S2R P;  3L7G A;  4IF7 A;  4PNC A;  1Y1N A;  1WBQ A;  2P9A A;  2IW2 A;  3PKB A;  4IKU A;  2B3L A;  2P98 A;  2Q96 A;  4OOK A;  1CHM A;  1KP0 A;  2GG3 A;  2V3Y A;  3O5V A;  4U6C A;  3S6B A;  5JFR A;  3IL0 A;  1YW8 A;  2B3K A;  3ROR A;  1O0X A;  5CE6 A;  2EA4 A;  4RZZ A;  4S01 A;  4JUQ A;  5CDV A;  2GG0 A;  2P99 A;  1WL9 A;  2EVM A;  1YW9 A;  2BWW A;  3L24 A;  3IG4 A;  3RVA A;  2EVC A;  2NQ6 A;  4ZWU A;  2BHD A;  2V3Z A;  1XGO A;  1R5H A;  1XGM A;  3FMQ A;  4HXX A;  3IU8 A;  4A6V A;  1WN1 A;  2GGB A;  2GU4 A;  2BWS A;  2GG7 A;  2Q93 A;  2EVO A;  1BOA A;  5E5B A;  3D27 A;  3TB5 A;  1YVM A;  3CB6 A;  4U76 A;  2GA2 A;  1QXW A;  1XNZ A;  3PN9 A;  4FO8 A;  3Q6D A;  3MR1 A;  3MX6 A;  3CTZ A;  4QR8 A;  1YW7 A;  1KQ0 A;  4FLL A;  3PEB A;  2OKN A;  1MAT A;  3IU7 A;  4FLK A;  4RZY A;  4U75 A;  1W7V A;  2BHA A;  2GGC A;  1WY2 A;  2GG2 A;  2Q94 A;  1A16 A;  4FKC A;  2V3X A;  4U6W A;  2GU6 A;  1M35 A;  3CB5 A;  2Q8K A;  2BWT A;  3OVK A;  3I7M A;  1C27 A;  1QZY A;  3FM3 A;  5CLS A;  2BB7 A;  2MAT A;  2Q95 A;  4IKR A;  2BH3 A;  2BHC A;  1C21 A;  1XGS A;  4FO7 A;  4PV4 A;  3PKA A;  4U6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...