5E2CA

Crystal structure of n-terminal domain of cytoplasmic peptidase pepq from mycobacterium tuberculosis h37rv
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGALEGKNTELVRASGTVESLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-terminal domain of cytoplasmic peptidase PepQ from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Hydrolase
molecule keywords Xaa-Pro dipeptidase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e2cA00
3IG4A 5E2CA 5E5BA 2BHCA 3O5VA 4R60A 4RGZ1 2BWWA 3OVKA 5CDLA 1W2MA 1WBQA 4ZWPA 5CDVA 3Q6DA 3L7GA 4EGEA 3BIQA 2BWTA 1WY2A 3L24A 5FCHA 5FCFA 2BWXA 1PV9A 2BWSA 2BN7A 3CB5A 5CIKA 4ZWOA 2BHDA 4FKCA 2BWUA 2OKNA 4QR8A 5CDEA 3I7MA 2V3ZA 3CB6A 3PN9A 4S00A 2V3YA 4S2TP 5CE6A 1WN1A 3CTZA 4PV4A 4S2RP 3OOOA 4ZWUA 1WL9A 2ZSGA 5CNXA 1WLRA 2BHAA 1WL6A 1N51A 3PEBA 2BHBA 1M35A 1A16A 1CHMA 2V3XA 1JAWA 2BWVA 3BITA 3IL0A 2IW2A 4ZNGA 2BH3A 1W7VA 4RZYA 2HOWA 4S01A 4RZZA 3QOCA 3RVAA 3BIPA 4B28A 1KP0A 2BWYA
chains in the Genus database with same CATH superfamily
3IG4A 5E2CA 5E5BA 2BHCA 3O5VA 4R60A 4RGZ1 2BWWA 3OVKA 5CDLA 1W2MA 1WBQA 4ZWPA 5CDVA 3Q6DA 3L7GA 4EGEA 3BIQA 2BWTA 1WY2A 3L24A 5FCHA 5FCFA 2BWXA 1PV9A 2BWSA 2BN7A 3CB5A 5CIKA 4ZWOA 2BHDA 4FKCA 2BWUA 2OKNA 4QR8A 5CDEA 3I7MA 2V3ZA 3CB6A 3PN9A 4S00A 2V3YA 4S2TP 5CE6A 1WN1A 3CTZA 4PV4A 4S2RP 3OOOA 4ZWUA 1WL9A 2ZSGA 5CNXA 1WLRA 2BHAA 1WL6A 1N51A 3PEBA 2BHBA 1M35A 1A16A 1CHMA 2V3XA 1JAWA 2BWVA 3BITA 3IL0A 2IW2A 4ZNGA 2BH3A 1W7VA 4RZYA 2HOWA 4S01A 4RZZA 3QOCA 3RVAA 3BIPA 4B28A 1KP0A 2BWYA
chains in the Genus database with same CATH topology
3IG4A 5E2CA 5E5BA 2BHCA 3O5VA 4R60A 4RGZ1 2BWWA 3OVKA 5CDLA 1W2MA 1WBQA 4ZWPA 5CDVA 3Q6DA 3L7GA 4EGEA 3BIQA 2BWTA 1WY2A 3L24A 5FCHA 5FCFA 2BWXA 1PV9A 2BWSA 2BN7A 3CB5A 5CIKA 4ZWOA 2BHDA 4FKCA 2BWUA 2OKNA 4QR8A 5CDEA 3I7MA 2V3ZA 3CB6A 3PN9A 4S00A 2V3YA 4S2TP 5CE6A 1WN1A 3CTZA 4PV4A 4S2RP 3OOOA 4ZWUA 1WL9A 2ZSGA 5CNXA 1WLRA 2BHAA 1WL6A 1N51A 3PEBA 2BHBA 1M35A 1A16A 1CHMA 2V3XA 1JAWA 2BWVA 3BITA 3IL0A 2IW2A 4ZNGA 2BH3A 1W7VA 4RZYA 2HOWA 4S01A 4RZZA 3QOCA 3RVAA 3BIPA 4B28A 1KP0A 2BWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG4 A;  5E2C A;  5E5B A;  2BHC A;  3O5V A;  4R60 A;  4RGZ 1;  2BWW A;  3OVK A;  5CDL A;  1W2M A;  1WBQ A;  4ZWP A;  5CDV A;  3Q6D A;  3L7G A;  4EGE A;  3BIQ A;  2BWT A;  1WY2 A;  3L24 A;  5FCH A;  5FCF A;  2BWX A;  1PV9 A;  2BWS A;  2BN7 A;  3CB5 A;  5CIK A;  4ZWO A;  2BHD A;  4FKC A;  2BWU A;  2OKN A;  4QR8 A;  5CDE A;  3I7M A;  2V3Z A;  3CB6 A;  3PN9 A;  4S00 A;  2V3Y A;  4S2T P;  5CE6 A;  1WN1 A;  3CTZ A;  4PV4 A;  4S2R P;  3OOO A;  4ZWU A;  1WL9 A;  2ZSG A;  5CNX A;  1WLR A;  2BHA A;  1WL6 A;  1N51 A;  3PEB A;  2BHB A;  1M35 A;  1A16 A;  1CHM A;  2V3X A;  1JAW A;  2BWV A;  3BIT A;  3IL0 A;  2IW2 A;  4ZNG A;  2BH3 A;  1W7V A;  4RZY A;  2HOW A;  4S01 A;  4RZZ A;  3QOC A;  3RVA A;  3BIP A;  4B28 A;  1KP0 A;  2BWY A; 
#chains in the Genus database with same CATH topology
 3IG4 A;  5E2C A;  5E5B A;  2BHC A;  3O5V A;  4R60 A;  4RGZ 1;  2BWW A;  3OVK A;  5CDL A;  1W2M A;  1WBQ A;  4ZWP A;  5CDV A;  3Q6D A;  3L7G A;  4EGE A;  3BIQ A;  2BWT A;  1WY2 A;  3L24 A;  5FCH A;  5FCF A;  2BWX A;  1PV9 A;  2BWS A;  2BN7 A;  3CB5 A;  5CIK A;  4ZWO A;  2BHD A;  4FKC A;  2BWU A;  2OKN A;  4QR8 A;  5CDE A;  3I7M A;  2V3Z A;  3CB6 A;  3PN9 A;  4S00 A;  2V3Y A;  4S2T P;  5CE6 A;  1WN1 A;  3CTZ A;  4PV4 A;  4S2R P;  3OOO A;  4ZWU A;  1WL9 A;  2ZSG A;  5CNX A;  1WLR A;  2BHA A;  1WL6 A;  1N51 A;  3PEB A;  2BHB A;  1M35 A;  1A16 A;  1CHM A;  2V3X A;  1JAW A;  2BWV A;  3BIT A;  3IL0 A;  2IW2 A;  4ZNG A;  2BH3 A;  1W7V A;  4RZY A;  2HOW A;  4S01 A;  4RZZ A;  3QOC A;  3RVA A;  3BIP A;  4B28 A;  1KP0 A;  2BWY A; 
#chains in the Genus database with same CATH homology
 3IG4 A;  5E2C A;  5E5B A;  2BHC A;  3O5V A;  4R60 A;  4RGZ 1;  2BWW A;  3OVK A;  5CDL A;  1W2M A;  1WBQ A;  4ZWP A;  5CDV A;  3Q6D A;  3L7G A;  4EGE A;  3BIQ A;  2BWT A;  1WY2 A;  3L24 A;  5FCH A;  5FCF A;  2BWX A;  1PV9 A;  2BWS A;  2BN7 A;  3CB5 A;  5CIK A;  4ZWO A;  2BHD A;  4FKC A;  2BWU A;  2OKN A;  4QR8 A;  5CDE A;  3I7M A;  2V3Z A;  3CB6 A;  3PN9 A;  4S00 A;  2V3Y A;  4S2T P;  5CE6 A;  1WN1 A;  3CTZ A;  4PV4 A;  4S2R P;  3OOO A;  4ZWU A;  1WL9 A;  2ZSG A;  5CNX A;  1WLR A;  2BHA A;  1WL6 A;  1N51 A;  3PEB A;  2BHB A;  1M35 A;  1A16 A;  1CHM A;  2V3X A;  1JAW A;  2BWV A;  3BIT A;  3IL0 A;  2IW2 A;  4ZNG A;  2BH3 A;  1W7V A;  4RZY A;  2HOW A;  4S01 A;  4RZZ A;  3QOC A;  3RVA A;  3BIP A;  4B28 A;  1KP0 A;  2BWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...