5E2CA

Crystal structure of n-terminal domain of cytoplasmic peptidase pepq from mycobacterium tuberculosis h37rv
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGALEGKNTELVRASGTVESLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title Crystal structure of N-terminal domain of cytoplasmic peptidase PepQ from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Hydrolase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e2cA00
4ZWOA 3BIQA 4ZNGA 3QOCA 3CB6A 4R60A 2ZSGA 4RZZA 2BWWA 2V3XA 4RZYA 4S2TP 4S00A 3BIPA 4PV4A 2BHAA 5CDEA 1CHMA 1PV9A 5FCFA 5CE6A 4RGZ1 5E2CA 3RVAA 2BHDA 3CTZA 3PN9A 1KP0A 4B28A 1JAWA 2HOWA 3CB5A 2BHBA 3BITA 2IW2A 5CNXA 1N51A 4S2RP 2V3YA 3OVKA 5CDVA 4ZWPA 4ZWUA 3L7GA 1W7VA 2BWSA 3PEBA 3IG4A 1WLRA 4S01A 1WBQA 1WL6A 1WL9A 2BN7A 2BWUA 1W2MA 1WY2A 2OKNA 4QR8A 2V3ZA 1WN1A 2BWYA 4EGEA 4FKCA 2BHCA 5FCHA 3OOOA 5CDLA 2BWXA 5E5BA 5CIKA 3IL0A 3Q6DA 3I7MA 1M35A 2BWVA 2BWTA 2BH3A 3O5VA 1A16A 3L24A
chains in the Genus database with same CATH superfamily
4ZWOA 3BIQA 4ZNGA 3QOCA 3CB6A 4R60A 2ZSGA 4RZZA 2BWWA 2V3XA 4RZYA 4S2TP 4S00A 3BIPA 4PV4A 2BHAA 5CDEA 1CHMA 1PV9A 5FCFA 5CE6A 4RGZ1 5E2CA 3RVAA 2BHDA 3CTZA 3PN9A 1KP0A 4B28A 1JAWA 2HOWA 3CB5A 2BHBA 3BITA 2IW2A 5CNXA 1N51A 4S2RP 2V3YA 3OVKA 5CDVA 4ZWPA 4ZWUA 3L7GA 1W7VA 2BWSA 3PEBA 3IG4A 1WLRA 4S01A 1WBQA 1WL6A 1WL9A 2BN7A 2BWUA 1W2MA 1WY2A 2OKNA 4QR8A 2V3ZA 1WN1A 2BWYA 4EGEA 4FKCA 2BHCA 5FCHA 3OOOA 5CDLA 2BWXA 5E5BA 5CIKA 3IL0A 3Q6DA 3I7MA 1M35A 2BWVA 2BWTA 2BH3A 3O5VA 1A16A 3L24A
chains in the Genus database with same CATH topology
4ZWOA 3BIQA 4ZNGA 3QOCA 3CB6A 4R60A 2ZSGA 4RZZA 2BWWA 2V3XA 4RZYA 4S2TP 4S00A 3BIPA 4PV4A 2BHAA 5CDEA 1CHMA 1PV9A 5FCFA 5CE6A 4RGZ1 5E2CA 3RVAA 2BHDA 3CTZA 3PN9A 1KP0A 4B28A 1JAWA 2HOWA 3CB5A 2BHBA 3BITA 2IW2A 5CNXA 1N51A 4S2RP 2V3YA 3OVKA 5CDVA 4ZWPA 4ZWUA 3L7GA 1W7VA 2BWSA 3PEBA 3IG4A 1WLRA 4S01A 1WBQA 1WL6A 1WL9A 2BN7A 2BWUA 1W2MA 1WY2A 2OKNA 4QR8A 2V3ZA 1WN1A 2BWYA 4EGEA 4FKCA 2BHCA 5FCHA 3OOOA 5CDLA 2BWXA 5E5BA 5CIKA 3IL0A 3Q6DA 3I7MA 1M35A 2BWVA 2BWTA 2BH3A 3O5VA 1A16A 3L24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWO A;  3BIQ A;  4ZNG A;  3QOC A;  3CB6 A;  4R60 A;  2ZSG A;  4RZZ A;  2BWW A;  2V3X A;  4RZY A;  4S2T P;  4S00 A;  3BIP A;  4PV4 A;  2BHA A;  5CDE A;  1CHM A;  1PV9 A;  5FCF A;  5CE6 A;  4RGZ 1;  5E2C A;  3RVA A;  2BHD A;  3CTZ A;  3PN9 A;  1KP0 A;  4B28 A;  1JAW A;  2HOW A;  3CB5 A;  2BHB A;  3BIT A;  2IW2 A;  5CNX A;  1N51 A;  4S2R P;  2V3Y A;  3OVK A;  5CDV A;  4ZWP A;  4ZWU A;  3L7G A;  1W7V A;  2BWS A;  3PEB A;  3IG4 A;  1WLR A;  4S01 A;  1WBQ A;  1WL6 A;  1WL9 A;  2BN7 A;  2BWU A;  1W2M A;  1WY2 A;  2OKN A;  4QR8 A;  2V3Z A;  1WN1 A;  2BWY A;  4EGE A;  4FKC A;  2BHC A;  5FCH A;  3OOO A;  5CDL A;  2BWX A;  5E5B A;  5CIK A;  3IL0 A;  3Q6D A;  3I7M A;  1M35 A;  2BWV A;  2BWT A;  2BH3 A;  3O5V A;  1A16 A;  3L24 A; 
#chains in the Genus database with same CATH topology
 4ZWO A;  3BIQ A;  4ZNG A;  3QOC A;  3CB6 A;  4R60 A;  2ZSG A;  4RZZ A;  2BWW A;  2V3X A;  4RZY A;  4S2T P;  4S00 A;  3BIP A;  4PV4 A;  2BHA A;  5CDE A;  1CHM A;  1PV9 A;  5FCF A;  5CE6 A;  4RGZ 1;  5E2C A;  3RVA A;  2BHD A;  3CTZ A;  3PN9 A;  1KP0 A;  4B28 A;  1JAW A;  2HOW A;  3CB5 A;  2BHB A;  3BIT A;  2IW2 A;  5CNX A;  1N51 A;  4S2R P;  2V3Y A;  3OVK A;  5CDV A;  4ZWP A;  4ZWU A;  3L7G A;  1W7V A;  2BWS A;  3PEB A;  3IG4 A;  1WLR A;  4S01 A;  1WBQ A;  1WL6 A;  1WL9 A;  2BN7 A;  2BWU A;  1W2M A;  1WY2 A;  2OKN A;  4QR8 A;  2V3Z A;  1WN1 A;  2BWY A;  4EGE A;  4FKC A;  2BHC A;  5FCH A;  3OOO A;  5CDL A;  2BWX A;  5E5B A;  5CIK A;  3IL0 A;  3Q6D A;  3I7M A;  1M35 A;  2BWV A;  2BWT A;  2BH3 A;  3O5V A;  1A16 A;  3L24 A; 
#chains in the Genus database with same CATH homology
 4ZWO A;  3BIQ A;  4ZNG A;  3QOC A;  3CB6 A;  4R60 A;  2ZSG A;  4RZZ A;  2BWW A;  2V3X A;  4RZY A;  4S2T P;  4S00 A;  3BIP A;  4PV4 A;  2BHA A;  5CDE A;  1CHM A;  1PV9 A;  5FCF A;  5CE6 A;  4RGZ 1;  5E2C A;  3RVA A;  2BHD A;  3CTZ A;  3PN9 A;  1KP0 A;  4B28 A;  1JAW A;  2HOW A;  3CB5 A;  2BHB A;  3BIT A;  2IW2 A;  5CNX A;  1N51 A;  4S2R P;  2V3Y A;  3OVK A;  5CDV A;  4ZWP A;  4ZWU A;  3L7G A;  1W7V A;  2BWS A;  3PEB A;  3IG4 A;  1WLR A;  4S01 A;  1WBQ A;  1WL6 A;  1WL9 A;  2BN7 A;  2BWU A;  1W2M A;  1WY2 A;  2OKN A;  4QR8 A;  2V3Z A;  1WN1 A;  2BWY A;  4EGE A;  4FKC A;  2BHC A;  5FCH A;  3OOO A;  5CDL A;  2BWX A;  5E5B A;  5CIK A;  3IL0 A;  3Q6D A;  3I7M A;  1M35 A;  2BWV A;  2BWT A;  2BH3 A;  3O5V A;  1A16 A;  3L24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...