5E2CA

Crystal structure of n-terminal domain of cytoplasmic peptidase pepq from mycobacterium tuberculosis h37rv
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
b'NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGALEGKNTELVRASGTVESLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title Crystal structure of N-terminal domain of cytoplasmic peptidase PepQ from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Hydrolase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e2cA00
3PEBA 2BHDA 3QOCA 2BWXA 2V3ZA 2V3XA 4S2TP 4S01A 4S00A 4B28A 2BWSA 2BWTA 5CDLA 2BWWA 3BIQA 3CTZA 2BHCA 3I7MA 3IL0A 3L24A 2BHAA 4QR8A 1WN1A 5CDVA 3RVAA 2ZSGA 3O5VA 3CB6A 1JAWA 1WBQA 3PN9A 3Q6DA 5CE6A 1W2MA 1M35A 2HOWA 1WL6A 5E2CA 2BN7A 4S2RP 1WY2A 1N51A 4ZNGA 2OKNA 3CB5A 4RZZA 4EGEA 1WLRA 4RZYA 2BHBA 4PV4A 1PV9A 3OOOA 2BH3A 5FCHA 5FCFA 3OVKA 4FKCA 1WL9A 3BITA 5CNXA 3IG4A 1KP0A 1A16A 4ZWUA 1CHMA 5CDEA 2V3YA 1W7VA 3BIPA 2BWUA 4ZWOA 5E5BA 4ZWPA 3L7GA 2IW2A 4R60A 2BWYA 4RGZ1 2BWVA 5CIKA
chains in the Genus database with same CATH superfamily
3PEBA 2BHDA 3QOCA 2BWXA 2V3ZA 2V3XA 4S2TP 4S01A 4S00A 4B28A 2BWSA 2BWTA 5CDLA 2BWWA 3BIQA 3CTZA 2BHCA 3I7MA 3IL0A 3L24A 2BHAA 4QR8A 1WN1A 5CDVA 3RVAA 2ZSGA 3O5VA 3CB6A 1JAWA 1WBQA 3PN9A 3Q6DA 5CE6A 1W2MA 1M35A 2HOWA 1WL6A 5E2CA 2BN7A 4S2RP 1WY2A 1N51A 4ZNGA 2OKNA 3CB5A 4RZZA 4EGEA 1WLRA 4RZYA 2BHBA 4PV4A 1PV9A 3OOOA 2BH3A 5FCHA 5FCFA 3OVKA 4FKCA 1WL9A 3BITA 5CNXA 3IG4A 1KP0A 1A16A 4ZWUA 1CHMA 5CDEA 2V3YA 1W7VA 3BIPA 2BWUA 4ZWOA 5E5BA 4ZWPA 3L7GA 2IW2A 4R60A 2BWYA 4RGZ1 2BWVA 5CIKA
chains in the Genus database with same CATH topology
3PEBA 2BHDA 3QOCA 2BWXA 2V3ZA 2V3XA 4S2TP 4S01A 4S00A 4B28A 2BWSA 2BWTA 5CDLA 2BWWA 3BIQA 3CTZA 2BHCA 3I7MA 3IL0A 3L24A 2BHAA 4QR8A 1WN1A 5CDVA 3RVAA 2ZSGA 3O5VA 3CB6A 1JAWA 1WBQA 3PN9A 3Q6DA 5CE6A 1W2MA 1M35A 2HOWA 1WL6A 5E2CA 2BN7A 4S2RP 1WY2A 1N51A 4ZNGA 2OKNA 3CB5A 4RZZA 4EGEA 1WLRA 4RZYA 2BHBA 4PV4A 1PV9A 3OOOA 2BH3A 5FCHA 5FCFA 3OVKA 4FKCA 1WL9A 3BITA 5CNXA 3IG4A 1KP0A 1A16A 4ZWUA 1CHMA 5CDEA 2V3YA 1W7VA 3BIPA 2BWUA 4ZWOA 5E5BA 4ZWPA 3L7GA 2IW2A 4R60A 2BWYA 4RGZ1 2BWVA 5CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEB A;  2BHD A;  3QOC A;  2BWX A;  2V3Z A;  2V3X A;  4S2T P;  4S01 A;  4S00 A;  4B28 A;  2BWS A;  2BWT A;  5CDL A;  2BWW A;  3BIQ A;  3CTZ A;  2BHC A;  3I7M A;  3IL0 A;  3L24 A;  2BHA A;  4QR8 A;  1WN1 A;  5CDV A;  3RVA A;  2ZSG A;  3O5V A;  3CB6 A;  1JAW A;  1WBQ A;  3PN9 A;  3Q6D A;  5CE6 A;  1W2M A;  1M35 A;  2HOW A;  1WL6 A;  5E2C A;  2BN7 A;  4S2R P;  1WY2 A;  1N51 A;  4ZNG A;  2OKN A;  3CB5 A;  4RZZ A;  4EGE A;  1WLR A;  4RZY A;  2BHB A;  4PV4 A;  1PV9 A;  3OOO A;  2BH3 A;  5FCH A;  5FCF A;  3OVK A;  4FKC A;  1WL9 A;  3BIT A;  5CNX A;  3IG4 A;  1KP0 A;  1A16 A;  4ZWU A;  1CHM A;  5CDE A;  2V3Y A;  1W7V A;  3BIP A;  2BWU A;  4ZWO A;  5E5B A;  4ZWP A;  3L7G A;  2IW2 A;  4R60 A;  2BWY A;  4RGZ 1;  2BWV A;  5CIK A; 
#chains in the Genus database with same CATH topology
 3PEB A;  2BHD A;  3QOC A;  2BWX A;  2V3Z A;  2V3X A;  4S2T P;  4S01 A;  4S00 A;  4B28 A;  2BWS A;  2BWT A;  5CDL A;  2BWW A;  3BIQ A;  3CTZ A;  2BHC A;  3I7M A;  3IL0 A;  3L24 A;  2BHA A;  4QR8 A;  1WN1 A;  5CDV A;  3RVA A;  2ZSG A;  3O5V A;  3CB6 A;  1JAW A;  1WBQ A;  3PN9 A;  3Q6D A;  5CE6 A;  1W2M A;  1M35 A;  2HOW A;  1WL6 A;  5E2C A;  2BN7 A;  4S2R P;  1WY2 A;  1N51 A;  4ZNG A;  2OKN A;  3CB5 A;  4RZZ A;  4EGE A;  1WLR A;  4RZY A;  2BHB A;  4PV4 A;  1PV9 A;  3OOO A;  2BH3 A;  5FCH A;  5FCF A;  3OVK A;  4FKC A;  1WL9 A;  3BIT A;  5CNX A;  3IG4 A;  1KP0 A;  1A16 A;  4ZWU A;  1CHM A;  5CDE A;  2V3Y A;  1W7V A;  3BIP A;  2BWU A;  4ZWO A;  5E5B A;  4ZWP A;  3L7G A;  2IW2 A;  4R60 A;  2BWY A;  4RGZ 1;  2BWV A;  5CIK A; 
#chains in the Genus database with same CATH homology
 3PEB A;  2BHD A;  3QOC A;  2BWX A;  2V3Z A;  2V3X A;  4S2T P;  4S01 A;  4S00 A;  4B28 A;  2BWS A;  2BWT A;  5CDL A;  2BWW A;  3BIQ A;  3CTZ A;  2BHC A;  3I7M A;  3IL0 A;  3L24 A;  2BHA A;  4QR8 A;  1WN1 A;  5CDV A;  3RVA A;  2ZSG A;  3O5V A;  3CB6 A;  1JAW A;  1WBQ A;  3PN9 A;  3Q6D A;  5CE6 A;  1W2M A;  1M35 A;  2HOW A;  1WL6 A;  5E2C A;  2BN7 A;  4S2R P;  1WY2 A;  1N51 A;  4ZNG A;  2OKN A;  3CB5 A;  4RZZ A;  4EGE A;  1WLR A;  4RZY A;  2BHB A;  4PV4 A;  1PV9 A;  3OOO A;  2BH3 A;  5FCH A;  5FCF A;  3OVK A;  4FKC A;  1WL9 A;  3BIT A;  5CNX A;  3IG4 A;  1KP0 A;  1A16 A;  4ZWU A;  1CHM A;  5CDE A;  2V3Y A;  1W7V A;  3BIP A;  2BWU A;  4ZWO A;  5E5B A;  4ZWP A;  3L7G A;  2IW2 A;  4R60 A;  2BWY A;  4RGZ 1;  2BWV A;  5CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...