5E2CA

Crystal structure of n-terminal domain of cytoplasmic peptidase pepq from mycobacterium tuberculosis h37rv
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGALEGKNTELVRASGTVESLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-Pro dipeptidase
publication title Crystal structure of N-terminal domain of cytoplasmic peptidase PepQ from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
total genus 41
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e2cA00
5FCFA 3CTZA 5E5BA 1WBQA 3CB5A 1A16A 4S01A 2BWWA 2BWSA 1KP0A 4ZWPA 2BWUA 5CDLA 3CB6A 4S00A 3PEBA 4QR8A 1CHMA 1PV9A 3O5VA 3BIQA 5CDEA 2OKNA 3OVKA 2BHBA 2BWYA 4PV4A 3I7MA 2V3YA 5E2CA 3RVAA 3OOOA 3BIPA 4ZNGA 5CIKA 2V3XA 3L7GA 1W7VA 1JAWA 2IW2A 4RZYA 3BITA 4RGZ1 4ZWOA 4ZWUA 1WLRA 1WL6A 1W2MA 4S2RP 1M35A 2BHCA 1WY2A 3IG4A 4S2TP 2BN7A 2ZSGA 5CDVA 4RZZA 5FCHA 2V3ZA 2BH3A 1WN1A 3Q6DA 5CE6A 2HOWA 2BHAA 4EGEA 1N51A 3QOCA 3L24A 2BWXA 3PN9A 4R60A 4B28A 2BWVA 2BHDA 3IL0A 4FKCA 2BWTA 5CNXA 1WL9A
chains in the Genus database with same CATH superfamily
5FCFA 3CTZA 5E5BA 1WBQA 3CB5A 1A16A 4S01A 2BWWA 2BWSA 1KP0A 4ZWPA 2BWUA 5CDLA 3CB6A 4S00A 3PEBA 4QR8A 1CHMA 1PV9A 3O5VA 3BIQA 5CDEA 2OKNA 3OVKA 2BHBA 2BWYA 4PV4A 3I7MA 2V3YA 5E2CA 3RVAA 3OOOA 3BIPA 4ZNGA 5CIKA 2V3XA 3L7GA 1W7VA 1JAWA 2IW2A 4RZYA 3BITA 4RGZ1 4ZWOA 4ZWUA 1WLRA 1WL6A 1W2MA 4S2RP 1M35A 2BHCA 1WY2A 3IG4A 4S2TP 2BN7A 2ZSGA 5CDVA 4RZZA 5FCHA 2V3ZA 2BH3A 1WN1A 3Q6DA 5CE6A 2HOWA 2BHAA 4EGEA 1N51A 3QOCA 3L24A 2BWXA 3PN9A 4R60A 4B28A 2BWVA 2BHDA 3IL0A 4FKCA 2BWTA 5CNXA 1WL9A
chains in the Genus database with same CATH topology
5FCFA 3CTZA 5E5BA 1WBQA 3CB5A 1A16A 4S01A 2BWWA 2BWSA 1KP0A 4ZWPA 2BWUA 5CDLA 3CB6A 4S00A 3PEBA 4QR8A 1CHMA 1PV9A 3O5VA 3BIQA 5CDEA 2OKNA 3OVKA 2BHBA 2BWYA 4PV4A 3I7MA 2V3YA 5E2CA 3RVAA 3OOOA 3BIPA 4ZNGA 5CIKA 2V3XA 3L7GA 1W7VA 1JAWA 2IW2A 4RZYA 3BITA 4RGZ1 4ZWOA 4ZWUA 1WLRA 1WL6A 1W2MA 4S2RP 1M35A 2BHCA 1WY2A 3IG4A 4S2TP 2BN7A 2ZSGA 5CDVA 4RZZA 5FCHA 2V3ZA 2BH3A 1WN1A 3Q6DA 5CE6A 2HOWA 2BHAA 4EGEA 1N51A 3QOCA 3L24A 2BWXA 3PN9A 4R60A 4B28A 2BWVA 2BHDA 3IL0A 4FKCA 2BWTA 5CNXA 1WL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCF A;  3CTZ A;  5E5B A;  1WBQ A;  3CB5 A;  1A16 A;  4S01 A;  2BWW A;  2BWS A;  1KP0 A;  4ZWP A;  2BWU A;  5CDL A;  3CB6 A;  4S00 A;  3PEB A;  4QR8 A;  1CHM A;  1PV9 A;  3O5V A;  3BIQ A;  5CDE A;  2OKN A;  3OVK A;  2BHB A;  2BWY A;  4PV4 A;  3I7M A;  2V3Y A;  5E2C A;  3RVA A;  3OOO A;  3BIP A;  4ZNG A;  5CIK A;  2V3X A;  3L7G A;  1W7V A;  1JAW A;  2IW2 A;  4RZY A;  3BIT A;  4RGZ 1;  4ZWO A;  4ZWU A;  1WLR A;  1WL6 A;  1W2M A;  4S2R P;  1M35 A;  2BHC A;  1WY2 A;  3IG4 A;  4S2T P;  2BN7 A;  2ZSG A;  5CDV A;  4RZZ A;  5FCH A;  2V3Z A;  2BH3 A;  1WN1 A;  3Q6D A;  5CE6 A;  2HOW A;  2BHA A;  4EGE A;  1N51 A;  3QOC A;  3L24 A;  2BWX A;  3PN9 A;  4R60 A;  4B28 A;  2BWV A;  2BHD A;  3IL0 A;  4FKC A;  2BWT A;  5CNX A;  1WL9 A; 
#chains in the Genus database with same CATH topology
 5FCF A;  3CTZ A;  5E5B A;  1WBQ A;  3CB5 A;  1A16 A;  4S01 A;  2BWW A;  2BWS A;  1KP0 A;  4ZWP A;  2BWU A;  5CDL A;  3CB6 A;  4S00 A;  3PEB A;  4QR8 A;  1CHM A;  1PV9 A;  3O5V A;  3BIQ A;  5CDE A;  2OKN A;  3OVK A;  2BHB A;  2BWY A;  4PV4 A;  3I7M A;  2V3Y A;  5E2C A;  3RVA A;  3OOO A;  3BIP A;  4ZNG A;  5CIK A;  2V3X A;  3L7G A;  1W7V A;  1JAW A;  2IW2 A;  4RZY A;  3BIT A;  4RGZ 1;  4ZWO A;  4ZWU A;  1WLR A;  1WL6 A;  1W2M A;  4S2R P;  1M35 A;  2BHC A;  1WY2 A;  3IG4 A;  4S2T P;  2BN7 A;  2ZSG A;  5CDV A;  4RZZ A;  5FCH A;  2V3Z A;  2BH3 A;  1WN1 A;  3Q6D A;  5CE6 A;  2HOW A;  2BHA A;  4EGE A;  1N51 A;  3QOC A;  3L24 A;  2BWX A;  3PN9 A;  4R60 A;  4B28 A;  2BWV A;  2BHD A;  3IL0 A;  4FKC A;  2BWT A;  5CNX A;  1WL9 A; 
#chains in the Genus database with same CATH homology
 5FCF A;  3CTZ A;  5E5B A;  1WBQ A;  3CB5 A;  1A16 A;  4S01 A;  2BWW A;  2BWS A;  1KP0 A;  4ZWP A;  2BWU A;  5CDL A;  3CB6 A;  4S00 A;  3PEB A;  4QR8 A;  1CHM A;  1PV9 A;  3O5V A;  3BIQ A;  5CDE A;  2OKN A;  3OVK A;  2BHB A;  2BWY A;  4PV4 A;  3I7M A;  2V3Y A;  5E2C A;  3RVA A;  3OOO A;  3BIP A;  4ZNG A;  5CIK A;  2V3X A;  3L7G A;  1W7V A;  1JAW A;  2IW2 A;  4RZY A;  3BIT A;  4RGZ 1;  4ZWO A;  4ZWU A;  1WLR A;  1WL6 A;  1W2M A;  4S2R P;  1M35 A;  2BHC A;  1WY2 A;  3IG4 A;  4S2T P;  2BN7 A;  2ZSG A;  5CDV A;  4RZZ A;  5FCH A;  2V3Z A;  2BH3 A;  1WN1 A;  3Q6D A;  5CE6 A;  2HOW A;  2BHA A;  4EGE A;  1N51 A;  3QOC A;  3L24 A;  2BWX A;  3PN9 A;  4R60 A;  4B28 A;  2BWV A;  2BHD A;  3IL0 A;  4FKC A;  2BWT A;  5CNX A;  1WL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...