5E2CA

Crystal structure of n-terminal domain of cytoplasmic peptidase pepq from mycobacterium tuberculosis h37rv
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
130
structure length
130
Chain Sequence
NARRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADERDAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESHVVTVDGLDALAGALEGKNTELVRASGTVESLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro dipeptidase
publication title Crystal structure of N-terminal domain of cytoplasmic peptidase PepQ from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Hydrolase
total genus 41
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e2cA00
1KP0A 5CDVA 3CB5A 1WL6A 5E2CA 3IL0A 4RGZ1 4ZNGA 2BN7A 1WBQA 3Q6DA 2ZSGA 3QOCA 1N51A 1CHMA 3O5VA 4S01A 5FCHA 5CE6A 4S2RP 2BHCA 2V3XA 3RVAA 2BHBA 4PV4A 4RZYA 5CDLA 5CNXA 3CB6A 2BWVA 2HOWA 1WN1A 2BWXA 3OOOA 2BH3A 2IW2A 5FCFA 2V3ZA 2BWYA 3IG4A 4ZWOA 4S00A 2BWWA 4EGEA 1WY2A 1A16A 1WL9A 2BWUA 3OVKA 4RZZA 3BIQA 5CDEA 4ZWUA 5E5BA 1PV9A 3PEBA 3PN9A 2OKNA 4B28A 1M35A 3L7GA 1JAWA 5CIKA 2BWTA 3BITA 2BHDA 3CTZA 1WLRA 4QR8A 3BIPA 1W2MA 3I7MA 4R60A 4ZWPA 3L24A 1W7VA 2BWSA 4FKCA 2BHAA 4S2TP 2V3YA
chains in the Genus database with same CATH superfamily
1KP0A 5CDVA 3CB5A 1WL6A 5E2CA 3IL0A 4RGZ1 4ZNGA 2BN7A 1WBQA 3Q6DA 2ZSGA 3QOCA 1N51A 1CHMA 3O5VA 4S01A 5FCHA 5CE6A 4S2RP 2BHCA 2V3XA 3RVAA 2BHBA 4PV4A 4RZYA 5CDLA 5CNXA 3CB6A 2BWVA 2HOWA 1WN1A 2BWXA 3OOOA 2BH3A 2IW2A 5FCFA 2V3ZA 2BWYA 3IG4A 4ZWOA 4S00A 2BWWA 4EGEA 1WY2A 1A16A 1WL9A 2BWUA 3OVKA 4RZZA 3BIQA 5CDEA 4ZWUA 5E5BA 1PV9A 3PEBA 3PN9A 2OKNA 4B28A 1M35A 3L7GA 1JAWA 5CIKA 2BWTA 3BITA 2BHDA 3CTZA 1WLRA 4QR8A 3BIPA 1W2MA 3I7MA 4R60A 4ZWPA 3L24A 1W7VA 2BWSA 4FKCA 2BHAA 4S2TP 2V3YA
chains in the Genus database with same CATH topology
1KP0A 5CDVA 3CB5A 1WL6A 5E2CA 3IL0A 4RGZ1 4ZNGA 2BN7A 1WBQA 3Q6DA 2ZSGA 3QOCA 1N51A 1CHMA 3O5VA 4S01A 5FCHA 5CE6A 4S2RP 2BHCA 2V3XA 3RVAA 2BHBA 4PV4A 4RZYA 5CDLA 5CNXA 3CB6A 2BWVA 2HOWA 1WN1A 2BWXA 3OOOA 2BH3A 2IW2A 5FCFA 2V3ZA 2BWYA 3IG4A 4ZWOA 4S00A 2BWWA 4EGEA 1WY2A 1A16A 1WL9A 2BWUA 3OVKA 4RZZA 3BIQA 5CDEA 4ZWUA 5E5BA 1PV9A 3PEBA 3PN9A 2OKNA 4B28A 1M35A 3L7GA 1JAWA 5CIKA 2BWTA 3BITA 2BHDA 3CTZA 1WLRA 4QR8A 3BIPA 1W2MA 3I7MA 4R60A 4ZWPA 3L24A 1W7VA 2BWSA 4FKCA 2BHAA 4S2TP 2V3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP0 A;  5CDV A;  3CB5 A;  1WL6 A;  5E2C A;  3IL0 A;  4RGZ 1;  4ZNG A;  2BN7 A;  1WBQ A;  3Q6D A;  2ZSG A;  3QOC A;  1N51 A;  1CHM A;  3O5V A;  4S01 A;  5FCH A;  5CE6 A;  4S2R P;  2BHC A;  2V3X A;  3RVA A;  2BHB A;  4PV4 A;  4RZY A;  5CDL A;  5CNX A;  3CB6 A;  2BWV A;  2HOW A;  1WN1 A;  2BWX A;  3OOO A;  2BH3 A;  2IW2 A;  5FCF A;  2V3Z A;  2BWY A;  3IG4 A;  4ZWO A;  4S00 A;  2BWW A;  4EGE A;  1WY2 A;  1A16 A;  1WL9 A;  2BWU A;  3OVK A;  4RZZ A;  3BIQ A;  5CDE A;  4ZWU A;  5E5B A;  1PV9 A;  3PEB A;  3PN9 A;  2OKN A;  4B28 A;  1M35 A;  3L7G A;  1JAW A;  5CIK A;  2BWT A;  3BIT A;  2BHD A;  3CTZ A;  1WLR A;  4QR8 A;  3BIP A;  1W2M A;  3I7M A;  4R60 A;  4ZWP A;  3L24 A;  1W7V A;  2BWS A;  4FKC A;  2BHA A;  4S2T P;  2V3Y A; 
#chains in the Genus database with same CATH topology
 1KP0 A;  5CDV A;  3CB5 A;  1WL6 A;  5E2C A;  3IL0 A;  4RGZ 1;  4ZNG A;  2BN7 A;  1WBQ A;  3Q6D A;  2ZSG A;  3QOC A;  1N51 A;  1CHM A;  3O5V A;  4S01 A;  5FCH A;  5CE6 A;  4S2R P;  2BHC A;  2V3X A;  3RVA A;  2BHB A;  4PV4 A;  4RZY A;  5CDL A;  5CNX A;  3CB6 A;  2BWV A;  2HOW A;  1WN1 A;  2BWX A;  3OOO A;  2BH3 A;  2IW2 A;  5FCF A;  2V3Z A;  2BWY A;  3IG4 A;  4ZWO A;  4S00 A;  2BWW A;  4EGE A;  1WY2 A;  1A16 A;  1WL9 A;  2BWU A;  3OVK A;  4RZZ A;  3BIQ A;  5CDE A;  4ZWU A;  5E5B A;  1PV9 A;  3PEB A;  3PN9 A;  2OKN A;  4B28 A;  1M35 A;  3L7G A;  1JAW A;  5CIK A;  2BWT A;  3BIT A;  2BHD A;  3CTZ A;  1WLR A;  4QR8 A;  3BIP A;  1W2M A;  3I7M A;  4R60 A;  4ZWP A;  3L24 A;  1W7V A;  2BWS A;  4FKC A;  2BHA A;  4S2T P;  2V3Y A; 
#chains in the Genus database with same CATH homology
 1KP0 A;  5CDV A;  3CB5 A;  1WL6 A;  5E2C A;  3IL0 A;  4RGZ 1;  4ZNG A;  2BN7 A;  1WBQ A;  3Q6D A;  2ZSG A;  3QOC A;  1N51 A;  1CHM A;  3O5V A;  4S01 A;  5FCH A;  5CE6 A;  4S2R P;  2BHC A;  2V3X A;  3RVA A;  2BHB A;  4PV4 A;  4RZY A;  5CDL A;  5CNX A;  3CB6 A;  2BWV A;  2HOW A;  1WN1 A;  2BWX A;  3OOO A;  2BH3 A;  2IW2 A;  5FCF A;  2V3Z A;  2BWY A;  3IG4 A;  4ZWO A;  4S00 A;  2BWW A;  4EGE A;  1WY2 A;  1A16 A;  1WL9 A;  2BWU A;  3OVK A;  4RZZ A;  3BIQ A;  5CDE A;  4ZWU A;  5E5B A;  1PV9 A;  3PEB A;  3PN9 A;  2OKN A;  4B28 A;  1M35 A;  3L7G A;  1JAW A;  5CIK A;  2BWT A;  3BIT A;  2BHD A;  3CTZ A;  1WLR A;  4QR8 A;  3BIP A;  1W2M A;  3I7M A;  4R60 A;  4ZWP A;  3L24 A;  1W7V A;  2BWS A;  4FKC A;  2BHA A;  4S2T P;  2V3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...