2HOWA

Dipeptidase (ph0974) from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 356aa long hypothetical dipeptidase
publication title Dipeptidase (PH0974) from Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2howA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2howA02
4KM3A 5CDEA 2P9AA 2BN7A 2GGBA 5D6EA 2B3HA 5CE6A 4U6WA 4ZNGA 2BWUA 2B3KA 2EVMA 3PEBA 2GGCA 2GA2A 1A16A 5CDLA 1QZYA 3MATA 1QXZA 3CTZA 1W2MA 2Q95A 4OOKA 3PKBA 1QXYA 4R60A 4U6ZA 3IU8A 5JI6A 4U1BA 3O5VA 1KP0A 1W7VA 4S2TP 2Q92A 1YJ3A 1XGOA 4IU6A 4IKUA 5CDVA 3PKEA 1WLRA 4ZWUA 4FO7A 4U6JA 2BHBA 4IKSA 4A6WA 3RVAA 2ADUA 4RZYA 1M35A 2BHDA 2GG5A 3PKCA 4IKRA 1CHMA 3L24A 5FCFA 5E5BA 3Q6DA 4ZWOA 1BN5A 2BWVA 2BWWA 2BHAA 2Q96A 2GU6A 4PV4A 2B3LA 2OKNA 2GG3A 4U71A 3D27A 4S2RP 1XGMA 1WL9A 2MATA 3FMQA 4FLKA 4MATA 1B59A 3TAVA 3FM3A 1C24A 4FLIA 1KQ0A 2IW2A 4IECA 4IF7A 4QR8A 5CLSA 1Y1NA 3I7MA 1KQ9A 1R58A 1YVMA 2GTXA 2GU5A 2V6CA 4U69A 2EA2A 3MX6A 1WN1A 2V3YA 2BWSA 5FCHA 4FLJA 4PNCA 2Q94A 3S6BA 1XNZA 1XGSA 3OVKA 5JHUA 4FLLA 5CIKA 3CB6A 1O0XA 1WKMA 2GU7A 3IL0A 1YW9A 2GG2A 2NQ7A 5JFRA 4RZZA 1C27A 5CNXA 1B6AA 4EGEA 2GG0A 1R5GA 2BWTA 1R5HA 1C21A 2V3ZA 3L7GA 2G6PA 2P99A 3BITA 3BIQA 4HXXA 3PKDA 2BH3A 2EVOA 4FO8A 5D6FA 1JAWA 1MATA 3FMRA 3MR1A 2EA4A 3TB5A 4Z7MA 1WL6A 2EVCA 3IU9A 4IDYA 3PN9A 4FKCA 1C22A 1YW8A 2GG7A 2BWYA 4U73A 1XGNA 2ZSGA 1C23A 2NQ6A 2BHCA 1QXWA 2DFIA 4IPAA 4U76A 2GG8A 3QOCA 4U75A 2HOWA 3CB5A 2V3XA 4RGZ1 3IG4A 3OOOA 4B28A 2GG9A 2GU4A 1YW7A 2Q93A 4A6VA 4FUKA 3RORA 4JUQA 3IU7A 1PV9A 3BIPA 4S01A 4U6EA 4U6CA 2BB7A 1WBQA 2BWXA 2OAZA 4U70A 1BOAA 3PKAA 2Q8KA 1WY2A 4S00A 5E2CA 4ZWPA 4IKTA 2P98A 1N51A 2GZ5A
chains in the Genus database with same CATH superfamily
4KM3A 5CDEA 2P9AA 2BN7A 2GGBA 5D6EA 2B3HA 5CE6A 4U6WA 4ZNGA 2BWUA 2B3KA 2EVMA 3PEBA 2GGCA 2GA2A 1A16A 5CDLA 1QZYA 3MATA 1QXZA 3CTZA 1W2MA 2Q95A 4OOKA 3PKBA 1QXYA 4R60A 4U6ZA 3IU8A 5JI6A 4U1BA 3O5VA 1KP0A 1W7VA 4S2TP 2Q92A 1YJ3A 1XGOA 4IU6A 4IKUA 5CDVA 3PKEA 1WLRA 4ZWUA 4FO7A 4U6JA 2BHBA 4IKSA 4A6WA 3RVAA 2ADUA 4RZYA 1M35A 2BHDA 2GG5A 3PKCA 4IKRA 1CHMA 3L24A 5FCFA 5E5BA 3Q6DA 4ZWOA 1BN5A 2BWVA 2BWWA 2BHAA 2Q96A 2GU6A 4PV4A 2B3LA 2OKNA 2GG3A 4U71A 3D27A 4S2RP 1XGMA 1WL9A 2MATA 3FMQA 4FLKA 4MATA 1B59A 3TAVA 3FM3A 1C24A 4FLIA 1KQ0A 2IW2A 4IECA 4IF7A 4QR8A 5CLSA 1Y1NA 3I7MA 1KQ9A 1R58A 1YVMA 2GTXA 2GU5A 2V6CA 4U69A 2EA2A 3MX6A 1WN1A 2V3YA 2BWSA 5FCHA 4FLJA 4PNCA 2Q94A 3S6BA 1XNZA 1XGSA 3OVKA 5JHUA 4FLLA 5CIKA 3CB6A 1O0XA 1WKMA 2GU7A 3IL0A 1YW9A 2GG2A 2NQ7A 5JFRA 4RZZA 1C27A 5CNXA 1B6AA 4EGEA 2GG0A 1R5GA 2BWTA 1R5HA 1C21A 2V3ZA 3L7GA 2G6PA 2P99A 3BITA 3BIQA 4HXXA 3PKDA 2BH3A 2EVOA 4FO8A 5D6FA 1JAWA 1MATA 3FMRA 3MR1A 2EA4A 3TB5A 4Z7MA 1WL6A 2EVCA 3IU9A 4IDYA 3PN9A 4FKCA 1C22A 1YW8A 2GG7A 2BWYA 4U73A 1XGNA 2ZSGA 1C23A 2NQ6A 2BHCA 1QXWA 2DFIA 4IPAA 4U76A 2GG8A 3QOCA 4U75A 2HOWA 3CB5A 2V3XA 4RGZ1 3IG4A 3OOOA 4B28A 2GG9A 2GU4A 1YW7A 2Q93A 4A6VA 4FUKA 3RORA 4JUQA 3IU7A 1PV9A 3BIPA 4S01A 4U6EA 4U6CA 2BB7A 1WBQA 2BWXA 2OAZA 4U70A 1BOAA 3PKAA 2Q8KA 1WY2A 4S00A 5E2CA 4ZWPA 4IKTA 2P98A 1N51A 2GZ5A
chains in the Genus database with same CATH topology
4KM3A 5CDEA 2P9AA 2BN7A 2GGBA 5D6EA 2B3HA 5CE6A 4U6WA 4ZNGA 2BWUA 2B3KA 2EVMA 3PEBA 2GGCA 2GA2A 1A16A 5CDLA 1QZYA 3MATA 1QXZA 3CTZA 1W2MA 2Q95A 4OOKA 3PKBA 1QXYA 4R60A 4U6ZA 3IU8A 5JI6A 4U1BA 3O5VA 1KP0A 1W7VA 4S2TP 2Q92A 1YJ3A 1XGOA 4IU6A 4IKUA 5CDVA 3PKEA 1WLRA 4ZWUA 4FO7A 4U6JA 2BHBA 4IKSA 4A6WA 3RVAA 2ADUA 4RZYA 1M35A 2BHDA 2GG5A 3PKCA 4IKRA 1CHMA 3L24A 5FCFA 5E5BA 3Q6DA 4ZWOA 1BN5A 2BWVA 2BWWA 2BHAA 2Q96A 2GU6A 4PV4A 2B3LA 2OKNA 2GG3A 4U71A 3D27A 4S2RP 1XGMA 1WL9A 2MATA 3FMQA 4FLKA 4MATA 1B59A 3TAVA 3FM3A 1C24A 4FLIA 1KQ0A 2IW2A 4IECA 4IF7A 4QR8A 5CLSA 1Y1NA 3I7MA 1KQ9A 1R58A 1YVMA 2GTXA 2GU5A 2V6CA 4U69A 2EA2A 3MX6A 1WN1A 2V3YA 2BWSA 5FCHA 4FLJA 4PNCA 2Q94A 3S6BA 1XNZA 1XGSA 3OVKA 5JHUA 4FLLA 5CIKA 3CB6A 1O0XA 1WKMA 2GU7A 3IL0A 1YW9A 2GG2A 2NQ7A 5JFRA 4RZZA 1C27A 5CNXA 1B6AA 4EGEA 2GG0A 1R5GA 2BWTA 1R5HA 1C21A 2V3ZA 3L7GA 2G6PA 2P99A 3BITA 3BIQA 4HXXA 3PKDA 2BH3A 2EVOA 4FO8A 5D6FA 1JAWA 1MATA 3FMRA 3MR1A 2EA4A 3TB5A 4Z7MA 1WL6A 2EVCA 3IU9A 4IDYA 3PN9A 4FKCA 1C22A 1YW8A 2GG7A 2BWYA 4U73A 1XGNA 2ZSGA 1C23A 2NQ6A 2BHCA 1QXWA 2DFIA 4IPAA 4U76A 2GG8A 3QOCA 4U75A 2HOWA 3CB5A 2V3XA 4RGZ1 3IG4A 3OOOA 4B28A 2GG9A 2GU4A 1YW7A 2Q93A 4A6VA 4FUKA 3RORA 4JUQA 3IU7A 1PV9A 3BIPA 4S01A 4U6EA 4U6CA 2BB7A 1WBQA 2BWXA 2OAZA 4U70A 1BOAA 3PKAA 2Q8KA 1WY2A 4S00A 5E2CA 4ZWPA 4IKTA 2P98A 1N51A 2GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM3 A;  5CDE A;  2P9A A;  2BN7 A;  2GGB A;  5D6E A;  2B3H A;  5CE6 A;  4U6W A;  4ZNG A;  2BWU A;  2B3K A;  2EVM A;  3PEB A;  2GGC A;  2GA2 A;  1A16 A;  5CDL A;  1QZY A;  3MAT A;  1QXZ A;  3CTZ A;  1W2M A;  2Q95 A;  4OOK A;  3PKB A;  1QXY A;  4R60 A;  4U6Z A;  3IU8 A;  5JI6 A;  4U1B A;  3O5V A;  1KP0 A;  1W7V A;  4S2T P;  2Q92 A;  1YJ3 A;  1XGO A;  4IU6 A;  4IKU A;  5CDV A;  3PKE A;  1WLR A;  4ZWU A;  4FO7 A;  4U6J A;  2BHB A;  4IKS A;  4A6W A;  3RVA A;  2ADU A;  4RZY A;  1M35 A;  2BHD A;  2GG5 A;  3PKC A;  4IKR A;  1CHM A;  3L24 A;  5FCF A;  5E5B A;  3Q6D A;  4ZWO A;  1BN5 A;  2BWV A;  2BWW A;  2BHA A;  2Q96 A;  2GU6 A;  4PV4 A;  2B3L A;  2OKN A;  2GG3 A;  4U71 A;  3D27 A;  4S2R P;  1XGM A;  1WL9 A;  2MAT A;  3FMQ A;  4FLK A;  4MAT A;  1B59 A;  3TAV A;  3FM3 A;  1C24 A;  4FLI A;  1KQ0 A;  2IW2 A;  4IEC A;  4IF7 A;  4QR8 A;  5CLS A;  1Y1N A;  3I7M A;  1KQ9 A;  1R58 A;  1YVM A;  2GTX A;  2GU5 A;  2V6C A;  4U69 A;  2EA2 A;  3MX6 A;  1WN1 A;  2V3Y A;  2BWS A;  5FCH A;  4FLJ A;  4PNC A;  2Q94 A;  3S6B A;  1XNZ A;  1XGS A;  3OVK A;  5JHU A;  4FLL A;  5CIK A;  3CB6 A;  1O0X A;  1WKM A;  2GU7 A;  3IL0 A;  1YW9 A;  2GG2 A;  2NQ7 A;  5JFR A;  4RZZ A;  1C27 A;  5CNX A;  1B6A A;  4EGE A;  2GG0 A;  1R5G A;  2BWT A;  1R5H A;  1C21 A;  2V3Z A;  3L7G A;  2G6P A;  2P99 A;  3BIT A;  3BIQ A;  4HXX A;  3PKD A;  2BH3 A;  2EVO A;  4FO8 A;  5D6F A;  1JAW A;  1MAT A;  3FMR A;  3MR1 A;  2EA4 A;  3TB5 A;  4Z7M A;  1WL6 A;  2EVC A;  3IU9 A;  4IDY A;  3PN9 A;  4FKC A;  1C22 A;  1YW8 A;  2GG7 A;  2BWY A;  4U73 A;  1XGN A;  2ZSG A;  1C23 A;  2NQ6 A;  2BHC A;  1QXW A;  2DFI A;  4IPA A;  4U76 A;  2GG8 A;  3QOC A;  4U75 A;  2HOW A;  3CB5 A;  2V3X A;  4RGZ 1;  3IG4 A;  3OOO A;  4B28 A;  2GG9 A;  2GU4 A;  1YW7 A;  2Q93 A;  4A6V A;  4FUK A;  3ROR A;  4JUQ A;  3IU7 A;  1PV9 A;  3BIP A;  4S01 A;  4U6E A;  4U6C A;  2BB7 A;  1WBQ A;  2BWX A;  2OAZ A;  4U70 A;  1BOA A;  3PKA A;  2Q8K A;  1WY2 A;  4S00 A;  5E2C A;  4ZWP A;  4IKT A;  2P98 A;  1N51 A;  2GZ5 A; 
#chains in the Genus database with same CATH topology
 4KM3 A;  5CDE A;  2P9A A;  2BN7 A;  2GGB A;  5D6E A;  2B3H A;  5CE6 A;  4U6W A;  4ZNG A;  2BWU A;  2B3K A;  2EVM A;  3PEB A;  2GGC A;  2GA2 A;  1A16 A;  5CDL A;  1QZY A;  3MAT A;  1QXZ A;  3CTZ A;  1W2M A;  2Q95 A;  4OOK A;  3PKB A;  1QXY A;  4R60 A;  4U6Z A;  3IU8 A;  5JI6 A;  4U1B A;  3O5V A;  1KP0 A;  1W7V A;  4S2T P;  2Q92 A;  1YJ3 A;  1XGO A;  4IU6 A;  4IKU A;  5CDV A;  3PKE A;  1WLR A;  4ZWU A;  4FO7 A;  4U6J A;  2BHB A;  4IKS A;  4A6W A;  3RVA A;  2ADU A;  4RZY A;  1M35 A;  2BHD A;  2GG5 A;  3PKC A;  4IKR A;  1CHM A;  3L24 A;  5FCF A;  5E5B A;  3Q6D A;  4ZWO A;  1BN5 A;  2BWV A;  2BWW A;  2BHA A;  2Q96 A;  2GU6 A;  4PV4 A;  2B3L A;  2OKN A;  2GG3 A;  4U71 A;  3D27 A;  4S2R P;  1XGM A;  1WL9 A;  2MAT A;  3FMQ A;  4FLK A;  4MAT A;  1B59 A;  3TAV A;  3FM3 A;  1C24 A;  4FLI A;  1KQ0 A;  2IW2 A;  4IEC A;  4IF7 A;  4QR8 A;  5CLS A;  1Y1N A;  3I7M A;  1KQ9 A;  1R58 A;  1YVM A;  2GTX A;  2GU5 A;  2V6C A;  4U69 A;  2EA2 A;  3MX6 A;  1WN1 A;  2V3Y A;  2BWS A;  5FCH A;  4FLJ A;  4PNC A;  2Q94 A;  3S6B A;  1XNZ A;  1XGS A;  3OVK A;  5JHU A;  4FLL A;  5CIK A;  3CB6 A;  1O0X A;  1WKM A;  2GU7 A;  3IL0 A;  1YW9 A;  2GG2 A;  2NQ7 A;  5JFR A;  4RZZ A;  1C27 A;  5CNX A;  1B6A A;  4EGE A;  2GG0 A;  1R5G A;  2BWT A;  1R5H A;  1C21 A;  2V3Z A;  3L7G A;  2G6P A;  2P99 A;  3BIT A;  3BIQ A;  4HXX A;  3PKD A;  2BH3 A;  2EVO A;  4FO8 A;  5D6F A;  1JAW A;  1MAT A;  3FMR A;  3MR1 A;  2EA4 A;  3TB5 A;  4Z7M A;  1WL6 A;  2EVC A;  3IU9 A;  4IDY A;  3PN9 A;  4FKC A;  1C22 A;  1YW8 A;  2GG7 A;  2BWY A;  4U73 A;  1XGN A;  2ZSG A;  1C23 A;  2NQ6 A;  2BHC A;  1QXW A;  2DFI A;  4IPA A;  4U76 A;  2GG8 A;  3QOC A;  4U75 A;  2HOW A;  3CB5 A;  2V3X A;  4RGZ 1;  3IG4 A;  3OOO A;  4B28 A;  2GG9 A;  2GU4 A;  1YW7 A;  2Q93 A;  4A6V A;  4FUK A;  3ROR A;  4JUQ A;  3IU7 A;  1PV9 A;  3BIP A;  4S01 A;  4U6E A;  4U6C A;  2BB7 A;  1WBQ A;  2BWX A;  2OAZ A;  4U70 A;  1BOA A;  3PKA A;  2Q8K A;  1WY2 A;  4S00 A;  5E2C A;  4ZWP A;  4IKT A;  2P98 A;  1N51 A;  2GZ5 A; 
#chains in the Genus database with same CATH homology
 4KM3 A;  5CDE A;  2P9A A;  2BN7 A;  2GGB A;  5D6E A;  2B3H A;  5CE6 A;  4U6W A;  4ZNG A;  2BWU A;  2B3K A;  2EVM A;  3PEB A;  2GGC A;  2GA2 A;  1A16 A;  5CDL A;  1QZY A;  3MAT A;  1QXZ A;  3CTZ A;  1W2M A;  2Q95 A;  4OOK A;  3PKB A;  1QXY A;  4R60 A;  4U6Z A;  3IU8 A;  5JI6 A;  4U1B A;  3O5V A;  1KP0 A;  1W7V A;  4S2T P;  2Q92 A;  1YJ3 A;  1XGO A;  4IU6 A;  4IKU A;  5CDV A;  3PKE A;  1WLR A;  4ZWU A;  4FO7 A;  4U6J A;  2BHB A;  4IKS A;  4A6W A;  3RVA A;  2ADU A;  4RZY A;  1M35 A;  2BHD A;  2GG5 A;  3PKC A;  4IKR A;  1CHM A;  3L24 A;  5FCF A;  5E5B A;  3Q6D A;  4ZWO A;  1BN5 A;  2BWV A;  2BWW A;  2BHA A;  2Q96 A;  2GU6 A;  4PV4 A;  2B3L A;  2OKN A;  2GG3 A;  4U71 A;  3D27 A;  4S2R P;  1XGM A;  1WL9 A;  2MAT A;  3FMQ A;  4FLK A;  4MAT A;  1B59 A;  3TAV A;  3FM3 A;  1C24 A;  4FLI A;  1KQ0 A;  2IW2 A;  4IEC A;  4IF7 A;  4QR8 A;  5CLS A;  1Y1N A;  3I7M A;  1KQ9 A;  1R58 A;  1YVM A;  2GTX A;  2GU5 A;  2V6C A;  4U69 A;  2EA2 A;  3MX6 A;  1WN1 A;  2V3Y A;  2BWS A;  5FCH A;  4FLJ A;  4PNC A;  2Q94 A;  3S6B A;  1XNZ A;  1XGS A;  3OVK A;  5JHU A;  4FLL A;  5CIK A;  3CB6 A;  1O0X A;  1WKM A;  2GU7 A;  3IL0 A;  1YW9 A;  2GG2 A;  2NQ7 A;  5JFR A;  4RZZ A;  1C27 A;  5CNX A;  1B6A A;  4EGE A;  2GG0 A;  1R5G A;  2BWT A;  1R5H A;  1C21 A;  2V3Z A;  3L7G A;  2G6P A;  2P99 A;  3BIT A;  3BIQ A;  4HXX A;  3PKD A;  2BH3 A;  2EVO A;  4FO8 A;  5D6F A;  1JAW A;  1MAT A;  3FMR A;  3MR1 A;  2EA4 A;  3TB5 A;  4Z7M A;  1WL6 A;  2EVC A;  3IU9 A;  4IDY A;  3PN9 A;  4FKC A;  1C22 A;  1YW8 A;  2GG7 A;  2BWY A;  4U73 A;  1XGN A;  2ZSG A;  1C23 A;  2NQ6 A;  2BHC A;  1QXW A;  2DFI A;  4IPA A;  4U76 A;  2GG8 A;  3QOC A;  4U75 A;  2HOW A;  3CB5 A;  2V3X A;  4RGZ 1;  3IG4 A;  3OOO A;  4B28 A;  2GG9 A;  2GU4 A;  1YW7 A;  2Q93 A;  4A6V A;  4FUK A;  3ROR A;  4JUQ A;  3IU7 A;  1PV9 A;  3BIP A;  4S01 A;  4U6E A;  4U6C A;  2BB7 A;  1WBQ A;  2BWX A;  2OAZ A;  4U70 A;  1BOA A;  3PKA A;  2Q8K A;  1WY2 A;  4S00 A;  5E2C A;  4ZWP A;  4IKT A;  2P98 A;  1N51 A;  2GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...