2HOWA

Dipeptidase (ph0974) from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 356aa long hypothetical dipeptidase
publication title Dipeptidase (PH0974) from Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2howA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2howA02
1YW7A 2BWTA 2NQ6A 4IF7A 5CDLA 2OAZA 2BWVA 3CB5A 3PEBA 2EA2A 4ZWPA 1KQ9A 4IECA 2GU5A 1QXZA 1W2MA 5FCFA 1XGOA 2P99A 4OOKA 1A16A 1QXYA 2BHDA 2GG7A 3D27A 1B59A 4IKRA 2BHAA 4U1BA 4ZWUA 1YW9A 1WL9A 4ZNGA 1BOAA 1WBQA 1CHMA 1WKMA 4S2TP 3I7MA 2V3ZA 4Z7MA 5CE6A 1XGMA 4U6CA 3IU9A 3Q6DA 4HXXA 2G6PA 5JI6A 3CTZA 2BWXA 2BHCA 3IU8A 3MX6A 4U71A 5D6FA 3TB5A 5JHUA 1XGSA 5D6EA 5JFRA 4S01A 3FM3A 2Q92A 1XNZA 2OKNA 1B6AA 1N51A 5E5BA 1KQ0A 3PN9A 2GG5A 1M35A 2GG3A 1WY2A 1YVMA 3PKDA 2BN7A 5CDVA 3PKAA 4U70A 4S00A 4U6EA 4KM3A 2ADUA 2ZSGA 4B28A 4U73A 4QR8A 1Y1NA 3S6BA 2EVCA 5E2CA 2HOWA 2BH3A 1BN5A 2B3LA 2NQ7A 1WL6A 1W7VA 1R58A 1YJ3A 2Q8KA 2BWWA 1MATA 3QOCA 4U6JA 2BB7A 4PV4A 4PNCA 1XGNA 3L24A 2GU7A 4FKCA 2GZ5A 2P98A 2P9AA 3TAVA 3RVAA 2B3HA 4A6WA 2GU6A 1R5GA 4FLKA 4U75A 5CNXA 3IL0A 4U6ZA 3RORA 3BIQA 5CIKA 5FCHA 4EGEA 2GG9A 2GG2A 4IKUA 4S2RP 2BWUA 3OOOA 2V3YA 2GTXA 2BWSA 2EVOA 2EVMA 2B3KA 2GG0A 4FLIA 4IPAA 1WN1A 4MATA 3MR1A 1QXWA 2Q93A 4FUKA 3BITA 4IU6A 1YW8A 2GU4A 4U76A 3FMRA 2MATA 4RGZ1 1R5HA 4U6WA 1PV9A 3OVKA 3CB6A 3FMQA 4A6VA 4R60A 1C22A 1QZYA 1C21A 2GA2A 2GG8A 1KP0A 3MATA 5CDEA 4RZYA 1JAWA 3IG4A 2Q95A 1C27A 4IDYA 2BHBA 3L7GA 2BWYA 2GGCA 4ZWOA 2GGBA 1C23A 4IKSA 4IKTA 2Q94A 3BIPA 2Q96A 3PKBA 4FO8A 4U69A 4FLLA 4RZZA 4FO7A 4FLJA 3O5VA 1O0XA 3PKCA 4JUQA 2DFIA 5CLSA 1C24A 2V3XA 2EA4A 2IW2A 3IU7A 3PKEA 1WLRA 2V6CA
chains in the Genus database with same CATH superfamily
1YW7A 2BWTA 2NQ6A 4IF7A 5CDLA 2OAZA 2BWVA 3CB5A 3PEBA 2EA2A 4ZWPA 1KQ9A 4IECA 2GU5A 1QXZA 1W2MA 5FCFA 1XGOA 2P99A 4OOKA 1A16A 1QXYA 2BHDA 2GG7A 3D27A 1B59A 4IKRA 2BHAA 4U1BA 4ZWUA 1YW9A 1WL9A 4ZNGA 1BOAA 1WBQA 1CHMA 1WKMA 4S2TP 3I7MA 2V3ZA 4Z7MA 5CE6A 1XGMA 4U6CA 3IU9A 3Q6DA 4HXXA 2G6PA 5JI6A 3CTZA 2BWXA 2BHCA 3IU8A 3MX6A 4U71A 5D6FA 3TB5A 5JHUA 1XGSA 5D6EA 5JFRA 4S01A 3FM3A 2Q92A 1XNZA 2OKNA 1B6AA 1N51A 5E5BA 1KQ0A 3PN9A 2GG5A 1M35A 2GG3A 1WY2A 1YVMA 3PKDA 2BN7A 5CDVA 3PKAA 4U70A 4S00A 4U6EA 4KM3A 2ADUA 2ZSGA 4B28A 4U73A 4QR8A 1Y1NA 3S6BA 2EVCA 5E2CA 2HOWA 2BH3A 1BN5A 2B3LA 2NQ7A 1WL6A 1W7VA 1R58A 1YJ3A 2Q8KA 2BWWA 1MATA 3QOCA 4U6JA 2BB7A 4PV4A 4PNCA 1XGNA 3L24A 2GU7A 4FKCA 2GZ5A 2P98A 2P9AA 3TAVA 3RVAA 2B3HA 4A6WA 2GU6A 1R5GA 4FLKA 4U75A 5CNXA 3IL0A 4U6ZA 3RORA 3BIQA 5CIKA 5FCHA 4EGEA 2GG9A 2GG2A 4IKUA 4S2RP 2BWUA 3OOOA 2V3YA 2GTXA 2BWSA 2EVOA 2EVMA 2B3KA 2GG0A 4FLIA 4IPAA 1WN1A 4MATA 3MR1A 1QXWA 2Q93A 4FUKA 3BITA 4IU6A 1YW8A 2GU4A 4U76A 3FMRA 2MATA 4RGZ1 1R5HA 4U6WA 1PV9A 3OVKA 3CB6A 3FMQA 4A6VA 4R60A 1C22A 1QZYA 1C21A 2GA2A 2GG8A 1KP0A 3MATA 5CDEA 4RZYA 1JAWA 3IG4A 2Q95A 1C27A 4IDYA 2BHBA 3L7GA 2BWYA 2GGCA 4ZWOA 2GGBA 1C23A 4IKSA 4IKTA 2Q94A 3BIPA 2Q96A 3PKBA 4FO8A 4U69A 4FLLA 4RZZA 4FO7A 4FLJA 3O5VA 1O0XA 3PKCA 4JUQA 2DFIA 5CLSA 1C24A 2V3XA 2EA4A 2IW2A 3IU7A 3PKEA 1WLRA 2V6CA
chains in the Genus database with same CATH topology
1YW7A 2BWTA 2NQ6A 4IF7A 5CDLA 2OAZA 2BWVA 3CB5A 3PEBA 2EA2A 4ZWPA 1KQ9A 4IECA 2GU5A 1QXZA 1W2MA 5FCFA 1XGOA 2P99A 4OOKA 1A16A 1QXYA 2BHDA 2GG7A 3D27A 1B59A 4IKRA 2BHAA 4U1BA 4ZWUA 1YW9A 1WL9A 4ZNGA 1BOAA 1WBQA 1CHMA 1WKMA 4S2TP 3I7MA 2V3ZA 4Z7MA 5CE6A 1XGMA 4U6CA 3IU9A 3Q6DA 4HXXA 2G6PA 5JI6A 3CTZA 2BWXA 2BHCA 3IU8A 3MX6A 4U71A 5D6FA 3TB5A 5JHUA 1XGSA 5D6EA 5JFRA 4S01A 3FM3A 2Q92A 1XNZA 2OKNA 1B6AA 1N51A 5E5BA 1KQ0A 3PN9A 2GG5A 1M35A 2GG3A 1WY2A 1YVMA 3PKDA 2BN7A 5CDVA 3PKAA 4U70A 4S00A 4U6EA 4KM3A 2ADUA 2ZSGA 4B28A 4U73A 4QR8A 1Y1NA 3S6BA 2EVCA 5E2CA 2HOWA 2BH3A 1BN5A 2B3LA 2NQ7A 1WL6A 1W7VA 1R58A 1YJ3A 2Q8KA 2BWWA 1MATA 3QOCA 4U6JA 2BB7A 4PV4A 4PNCA 1XGNA 3L24A 2GU7A 4FKCA 2GZ5A 2P98A 2P9AA 3TAVA 3RVAA 2B3HA 4A6WA 2GU6A 1R5GA 4FLKA 4U75A 5CNXA 3IL0A 4U6ZA 3RORA 3BIQA 5CIKA 5FCHA 4EGEA 2GG9A 2GG2A 4IKUA 4S2RP 2BWUA 3OOOA 2V3YA 2GTXA 2BWSA 2EVOA 2EVMA 2B3KA 2GG0A 4FLIA 4IPAA 1WN1A 4MATA 3MR1A 1QXWA 2Q93A 4FUKA 3BITA 4IU6A 1YW8A 2GU4A 4U76A 3FMRA 2MATA 4RGZ1 1R5HA 4U6WA 1PV9A 3OVKA 3CB6A 3FMQA 4A6VA 4R60A 1C22A 1QZYA 1C21A 2GA2A 2GG8A 1KP0A 3MATA 5CDEA 4RZYA 1JAWA 3IG4A 2Q95A 1C27A 4IDYA 2BHBA 3L7GA 2BWYA 2GGCA 4ZWOA 2GGBA 1C23A 4IKSA 4IKTA 2Q94A 3BIPA 2Q96A 3PKBA 4FO8A 4U69A 4FLLA 4RZZA 4FO7A 4FLJA 3O5VA 1O0XA 3PKCA 4JUQA 2DFIA 5CLSA 1C24A 2V3XA 2EA4A 2IW2A 3IU7A 3PKEA 1WLRA 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  2BWT A;  2NQ6 A;  4IF7 A;  5CDL A;  2OAZ A;  2BWV A;  3CB5 A;  3PEB A;  2EA2 A;  4ZWP A;  1KQ9 A;  4IEC A;  2GU5 A;  1QXZ A;  1W2M A;  5FCF A;  1XGO A;  2P99 A;  4OOK A;  1A16 A;  1QXY A;  2BHD A;  2GG7 A;  3D27 A;  1B59 A;  4IKR A;  2BHA A;  4U1B A;  4ZWU A;  1YW9 A;  1WL9 A;  4ZNG A;  1BOA A;  1WBQ A;  1CHM A;  1WKM A;  4S2T P;  3I7M A;  2V3Z A;  4Z7M A;  5CE6 A;  1XGM A;  4U6C A;  3IU9 A;  3Q6D A;  4HXX A;  2G6P A;  5JI6 A;  3CTZ A;  2BWX A;  2BHC A;  3IU8 A;  3MX6 A;  4U71 A;  5D6F A;  3TB5 A;  5JHU A;  1XGS A;  5D6E A;  5JFR A;  4S01 A;  3FM3 A;  2Q92 A;  1XNZ A;  2OKN A;  1B6A A;  1N51 A;  5E5B A;  1KQ0 A;  3PN9 A;  2GG5 A;  1M35 A;  2GG3 A;  1WY2 A;  1YVM A;  3PKD A;  2BN7 A;  5CDV A;  3PKA A;  4U70 A;  4S00 A;  4U6E A;  4KM3 A;  2ADU A;  2ZSG A;  4B28 A;  4U73 A;  4QR8 A;  1Y1N A;  3S6B A;  2EVC A;  5E2C A;  2HOW A;  2BH3 A;  1BN5 A;  2B3L A;  2NQ7 A;  1WL6 A;  1W7V A;  1R58 A;  1YJ3 A;  2Q8K A;  2BWW A;  1MAT A;  3QOC A;  4U6J A;  2BB7 A;  4PV4 A;  4PNC A;  1XGN A;  3L24 A;  2GU7 A;  4FKC A;  2GZ5 A;  2P98 A;  2P9A A;  3TAV A;  3RVA A;  2B3H A;  4A6W A;  2GU6 A;  1R5G A;  4FLK A;  4U75 A;  5CNX A;  3IL0 A;  4U6Z A;  3ROR A;  3BIQ A;  5CIK A;  5FCH A;  4EGE A;  2GG9 A;  2GG2 A;  4IKU A;  4S2R P;  2BWU A;  3OOO A;  2V3Y A;  2GTX A;  2BWS A;  2EVO A;  2EVM A;  2B3K A;  2GG0 A;  4FLI A;  4IPA A;  1WN1 A;  4MAT A;  3MR1 A;  1QXW A;  2Q93 A;  4FUK A;  3BIT A;  4IU6 A;  1YW8 A;  2GU4 A;  4U76 A;  3FMR A;  2MAT A;  4RGZ 1;  1R5H A;  4U6W A;  1PV9 A;  3OVK A;  3CB6 A;  3FMQ A;  4A6V A;  4R60 A;  1C22 A;  1QZY A;  1C21 A;  2GA2 A;  2GG8 A;  1KP0 A;  3MAT A;  5CDE A;  4RZY A;  1JAW A;  3IG4 A;  2Q95 A;  1C27 A;  4IDY A;  2BHB A;  3L7G A;  2BWY A;  2GGC A;  4ZWO A;  2GGB A;  1C23 A;  4IKS A;  4IKT A;  2Q94 A;  3BIP A;  2Q96 A;  3PKB A;  4FO8 A;  4U69 A;  4FLL A;  4RZZ A;  4FO7 A;  4FLJ A;  3O5V A;  1O0X A;  3PKC A;  4JUQ A;  2DFI A;  5CLS A;  1C24 A;  2V3X A;  2EA4 A;  2IW2 A;  3IU7 A;  3PKE A;  1WLR A;  2V6C A; 
#chains in the Genus database with same CATH topology
 1YW7 A;  2BWT A;  2NQ6 A;  4IF7 A;  5CDL A;  2OAZ A;  2BWV A;  3CB5 A;  3PEB A;  2EA2 A;  4ZWP A;  1KQ9 A;  4IEC A;  2GU5 A;  1QXZ A;  1W2M A;  5FCF A;  1XGO A;  2P99 A;  4OOK A;  1A16 A;  1QXY A;  2BHD A;  2GG7 A;  3D27 A;  1B59 A;  4IKR A;  2BHA A;  4U1B A;  4ZWU A;  1YW9 A;  1WL9 A;  4ZNG A;  1BOA A;  1WBQ A;  1CHM A;  1WKM A;  4S2T P;  3I7M A;  2V3Z A;  4Z7M A;  5CE6 A;  1XGM A;  4U6C A;  3IU9 A;  3Q6D A;  4HXX A;  2G6P A;  5JI6 A;  3CTZ A;  2BWX A;  2BHC A;  3IU8 A;  3MX6 A;  4U71 A;  5D6F A;  3TB5 A;  5JHU A;  1XGS A;  5D6E A;  5JFR A;  4S01 A;  3FM3 A;  2Q92 A;  1XNZ A;  2OKN A;  1B6A A;  1N51 A;  5E5B A;  1KQ0 A;  3PN9 A;  2GG5 A;  1M35 A;  2GG3 A;  1WY2 A;  1YVM A;  3PKD A;  2BN7 A;  5CDV A;  3PKA A;  4U70 A;  4S00 A;  4U6E A;  4KM3 A;  2ADU A;  2ZSG A;  4B28 A;  4U73 A;  4QR8 A;  1Y1N A;  3S6B A;  2EVC A;  5E2C A;  2HOW A;  2BH3 A;  1BN5 A;  2B3L A;  2NQ7 A;  1WL6 A;  1W7V A;  1R58 A;  1YJ3 A;  2Q8K A;  2BWW A;  1MAT A;  3QOC A;  4U6J A;  2BB7 A;  4PV4 A;  4PNC A;  1XGN A;  3L24 A;  2GU7 A;  4FKC A;  2GZ5 A;  2P98 A;  2P9A A;  3TAV A;  3RVA A;  2B3H A;  4A6W A;  2GU6 A;  1R5G A;  4FLK A;  4U75 A;  5CNX A;  3IL0 A;  4U6Z A;  3ROR A;  3BIQ A;  5CIK A;  5FCH A;  4EGE A;  2GG9 A;  2GG2 A;  4IKU A;  4S2R P;  2BWU A;  3OOO A;  2V3Y A;  2GTX A;  2BWS A;  2EVO A;  2EVM A;  2B3K A;  2GG0 A;  4FLI A;  4IPA A;  1WN1 A;  4MAT A;  3MR1 A;  1QXW A;  2Q93 A;  4FUK A;  3BIT A;  4IU6 A;  1YW8 A;  2GU4 A;  4U76 A;  3FMR A;  2MAT A;  4RGZ 1;  1R5H A;  4U6W A;  1PV9 A;  3OVK A;  3CB6 A;  3FMQ A;  4A6V A;  4R60 A;  1C22 A;  1QZY A;  1C21 A;  2GA2 A;  2GG8 A;  1KP0 A;  3MAT A;  5CDE A;  4RZY A;  1JAW A;  3IG4 A;  2Q95 A;  1C27 A;  4IDY A;  2BHB A;  3L7G A;  2BWY A;  2GGC A;  4ZWO A;  2GGB A;  1C23 A;  4IKS A;  4IKT A;  2Q94 A;  3BIP A;  2Q96 A;  3PKB A;  4FO8 A;  4U69 A;  4FLL A;  4RZZ A;  4FO7 A;  4FLJ A;  3O5V A;  1O0X A;  3PKC A;  4JUQ A;  2DFI A;  5CLS A;  1C24 A;  2V3X A;  2EA4 A;  2IW2 A;  3IU7 A;  3PKE A;  1WLR A;  2V6C A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  2BWT A;  2NQ6 A;  4IF7 A;  5CDL A;  2OAZ A;  2BWV A;  3CB5 A;  3PEB A;  2EA2 A;  4ZWP A;  1KQ9 A;  4IEC A;  2GU5 A;  1QXZ A;  1W2M A;  5FCF A;  1XGO A;  2P99 A;  4OOK A;  1A16 A;  1QXY A;  2BHD A;  2GG7 A;  3D27 A;  1B59 A;  4IKR A;  2BHA A;  4U1B A;  4ZWU A;  1YW9 A;  1WL9 A;  4ZNG A;  1BOA A;  1WBQ A;  1CHM A;  1WKM A;  4S2T P;  3I7M A;  2V3Z A;  4Z7M A;  5CE6 A;  1XGM A;  4U6C A;  3IU9 A;  3Q6D A;  4HXX A;  2G6P A;  5JI6 A;  3CTZ A;  2BWX A;  2BHC A;  3IU8 A;  3MX6 A;  4U71 A;  5D6F A;  3TB5 A;  5JHU A;  1XGS A;  5D6E A;  5JFR A;  4S01 A;  3FM3 A;  2Q92 A;  1XNZ A;  2OKN A;  1B6A A;  1N51 A;  5E5B A;  1KQ0 A;  3PN9 A;  2GG5 A;  1M35 A;  2GG3 A;  1WY2 A;  1YVM A;  3PKD A;  2BN7 A;  5CDV A;  3PKA A;  4U70 A;  4S00 A;  4U6E A;  4KM3 A;  2ADU A;  2ZSG A;  4B28 A;  4U73 A;  4QR8 A;  1Y1N A;  3S6B A;  2EVC A;  5E2C A;  2HOW A;  2BH3 A;  1BN5 A;  2B3L A;  2NQ7 A;  1WL6 A;  1W7V A;  1R58 A;  1YJ3 A;  2Q8K A;  2BWW A;  1MAT A;  3QOC A;  4U6J A;  2BB7 A;  4PV4 A;  4PNC A;  1XGN A;  3L24 A;  2GU7 A;  4FKC A;  2GZ5 A;  2P98 A;  2P9A A;  3TAV A;  3RVA A;  2B3H A;  4A6W A;  2GU6 A;  1R5G A;  4FLK A;  4U75 A;  5CNX A;  3IL0 A;  4U6Z A;  3ROR A;  3BIQ A;  5CIK A;  5FCH A;  4EGE A;  2GG9 A;  2GG2 A;  4IKU A;  4S2R P;  2BWU A;  3OOO A;  2V3Y A;  2GTX A;  2BWS A;  2EVO A;  2EVM A;  2B3K A;  2GG0 A;  4FLI A;  4IPA A;  1WN1 A;  4MAT A;  3MR1 A;  1QXW A;  2Q93 A;  4FUK A;  3BIT A;  4IU6 A;  1YW8 A;  2GU4 A;  4U76 A;  3FMR A;  2MAT A;  4RGZ 1;  1R5H A;  4U6W A;  1PV9 A;  3OVK A;  3CB6 A;  3FMQ A;  4A6V A;  4R60 A;  1C22 A;  1QZY A;  1C21 A;  2GA2 A;  2GG8 A;  1KP0 A;  3MAT A;  5CDE A;  4RZY A;  1JAW A;  3IG4 A;  2Q95 A;  1C27 A;  4IDY A;  2BHB A;  3L7G A;  2BWY A;  2GGC A;  4ZWO A;  2GGB A;  1C23 A;  4IKS A;  4IKT A;  2Q94 A;  3BIP A;  2Q96 A;  3PKB A;  4FO8 A;  4U69 A;  4FLL A;  4RZZ A;  4FO7 A;  4FLJ A;  3O5V A;  1O0X A;  3PKC A;  4JUQ A;  2DFI A;  5CLS A;  1C24 A;  2V3X A;  2EA4 A;  2IW2 A;  3IU7 A;  3PKE A;  1WLR A;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...