2HOWA

Dipeptidase (ph0974) from pyrococcus horikoshii ot3
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
356
structure length
356
Chain Sequence
b'MRLEKFIHLLGERGFDGALISPGTNLYYLTGLRLHEVGERLAILAVSAEGDYRFLAPSLYENVVNNFPATFWHDGENPYAKLREILEELGISKGRILIEDTMRADWLIGIMKLGKFTFQPLSSLIKELRMIKDKEEVKMMEHASRIADKVFEEILTWDLIGMKERELALKIELLIRELSDGIAFEPIVASGENAANPHHEPGERKIRKGDIIILDYGARWKGYCSDITRTIGLGELDERLVKIYEVVKDAQESAFKAVREGIKAKDVDSRAREVISKAGYGEYFIHRTGHGLGLDVHEEPYIGPDGEVILKNGMTFTIEPGIYVPGLGGVRIEDDIVVDEGKGRRLTKAERELIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 356aa long hypothetical dipeptidase
publication title Dipeptidase (PH0974) from Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 124
structure length 356
sequence length 356
chains with identical sequence B
ec nomenclature ec 3.4.-.-:
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2howA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2howA02
1C21A 2ZSGA 1QZYA 2GU6A 3MX6A 1PV9A 4IDYA 5CIKA 3FMRA 1R5GA 5CNXA 1QXYA 2EVCA 4U6JA 4Z7MA 4A6WA 2OKNA 2Q8KA 2V3XA 2G6PA 4IU6A 5FCHA 2GG5A 5JI6A 2OAZA 2EVMA 3FM3A 2BHDA 3RVAA 5CDVA 4R60A 2MATA 2DFIA 4A6VA 3BIQA 2Q92A 2ADUA 3CB5A 2GU5A 3OOOA 1YJ3A 3O5VA 4U71A 4FUKA 1C24A 2P9AA 1R5HA 1WLRA 4U75A 4IKUA 1CHMA 4IPAA 1QXWA 3IG4A 3OVKA 3BITA 3IL0A 1XGSA 4U73A 1WL9A 4HXXA 1M35A 4ZWOA 2V6CA 3QOCA 1KQ9A 4MATA 4KM3A 4U6EA 1A16A 4ZWPA 1BN5A 1B6AA 4U6ZA 3IU8A 1R58A 2HOWA 3I7MA 2Q95A 4S2RP 2GG3A 2Q93A 2EA2A 2BH3A 2GTXA 2BWTA 5E2CA 4S2TP 2BWWA 2GG7A 2Q94A 4RZYA 5D6FA 2EA4A 2GZ5A 3CB6A 4U6CA 3PN9A 4U70A 3TAVA 4ZWUA 1XGMA 4U76A 3PKBA 5JHUA 4OOKA 2NQ7A 2BWYA 1WKMA 5D6EA 3CTZA 4FKCA 3PKDA 3FMQA 2GG8A 2IW2A 2BHCA 1YW8A 1BOAA 1XGNA 2P98A 4EGEA 4FLJA 1WL6A 2Q96A 1C23A 1B59A 2V3ZA 4RZZA 5CDEA 2V3YA 1YVMA 2B3LA 2P99A 4FLKA 2BWUA 4PV4A 1N51A 1O0XA 3PKEA 1KQ0A 3PKAA 4PNCA 4B28A 1MATA 5CLSA 3S6BA 2B3HA 4IKRA 4QR8A 1XGOA 1KP0A 3MR1A 2GU7A 2BWVA 2GGBA 1W2MA 5FCFA 2BHBA 2GG0A 3IU9A 2EVOA 3RORA 4IF7A 1C27A 5CDLA 4FO8A 5E5BA 1XNZA 4FO7A 4S01A 2BHAA 2GG9A 2GU4A 3PKCA 5JFRA 2GA2A 1YW9A 3L7GA 4S00A 1YW7A 2GG2A 2GGCA 4JUQA 4U1BA 4U69A 1WY2A 3MATA 3BIPA 1W7VA 1C22A 1JAWA 4RGZ1 4IKTA 2B3KA 4FLIA 3PEBA 3IU7A 3D27A 4IECA 4U6WA 3Q6DA 4ZNGA 2BB7A 1QXZA 3TB5A 2NQ6A 1WBQA 1Y1NA 1WN1A 2BWSA 4IKSA 3L24A 5CE6A 4FLLA 2BWXA 2BN7A
chains in the Genus database with same CATH superfamily
1C21A 2ZSGA 1QZYA 2GU6A 3MX6A 1PV9A 4IDYA 5CIKA 3FMRA 1R5GA 5CNXA 1QXYA 2EVCA 4U6JA 4Z7MA 4A6WA 2OKNA 2Q8KA 2V3XA 2G6PA 4IU6A 5FCHA 2GG5A 5JI6A 2OAZA 2EVMA 3FM3A 2BHDA 3RVAA 5CDVA 4R60A 2MATA 2DFIA 4A6VA 3BIQA 2Q92A 2ADUA 3CB5A 2GU5A 3OOOA 1YJ3A 3O5VA 4U71A 4FUKA 1C24A 2P9AA 1R5HA 1WLRA 4U75A 4IKUA 1CHMA 4IPAA 1QXWA 3IG4A 3OVKA 3BITA 3IL0A 1XGSA 4U73A 1WL9A 4HXXA 1M35A 4ZWOA 2V6CA 3QOCA 1KQ9A 4MATA 4KM3A 4U6EA 1A16A 4ZWPA 1BN5A 1B6AA 4U6ZA 3IU8A 1R58A 2HOWA 3I7MA 2Q95A 4S2RP 2GG3A 2Q93A 2EA2A 2BH3A 2GTXA 2BWTA 5E2CA 4S2TP 2BWWA 2GG7A 2Q94A 4RZYA 5D6FA 2EA4A 2GZ5A 3CB6A 4U6CA 3PN9A 4U70A 3TAVA 4ZWUA 1XGMA 4U76A 3PKBA 5JHUA 4OOKA 2NQ7A 2BWYA 1WKMA 5D6EA 3CTZA 4FKCA 3PKDA 3FMQA 2GG8A 2IW2A 2BHCA 1YW8A 1BOAA 1XGNA 2P98A 4EGEA 4FLJA 1WL6A 2Q96A 1C23A 1B59A 2V3ZA 4RZZA 5CDEA 2V3YA 1YVMA 2B3LA 2P99A 4FLKA 2BWUA 4PV4A 1N51A 1O0XA 3PKEA 1KQ0A 3PKAA 4PNCA 4B28A 1MATA 5CLSA 3S6BA 2B3HA 4IKRA 4QR8A 1XGOA 1KP0A 3MR1A 2GU7A 2BWVA 2GGBA 1W2MA 5FCFA 2BHBA 2GG0A 3IU9A 2EVOA 3RORA 4IF7A 1C27A 5CDLA 4FO8A 5E5BA 1XNZA 4FO7A 4S01A 2BHAA 2GG9A 2GU4A 3PKCA 5JFRA 2GA2A 1YW9A 3L7GA 4S00A 1YW7A 2GG2A 2GGCA 4JUQA 4U1BA 4U69A 1WY2A 3MATA 3BIPA 1W7VA 1C22A 1JAWA 4RGZ1 4IKTA 2B3KA 4FLIA 3PEBA 3IU7A 3D27A 4IECA 4U6WA 3Q6DA 4ZNGA 2BB7A 1QXZA 3TB5A 2NQ6A 1WBQA 1Y1NA 1WN1A 2BWSA 4IKSA 3L24A 5CE6A 4FLLA 2BWXA 2BN7A
chains in the Genus database with same CATH topology
1C21A 2ZSGA 1QZYA 2GU6A 3MX6A 1PV9A 4IDYA 5CIKA 3FMRA 1R5GA 5CNXA 1QXYA 2EVCA 4U6JA 4Z7MA 4A6WA 2OKNA 2Q8KA 2V3XA 2G6PA 4IU6A 5FCHA 2GG5A 5JI6A 2OAZA 2EVMA 3FM3A 2BHDA 3RVAA 5CDVA 4R60A 2MATA 2DFIA 4A6VA 3BIQA 2Q92A 2ADUA 3CB5A 2GU5A 3OOOA 1YJ3A 3O5VA 4U71A 4FUKA 1C24A 2P9AA 1R5HA 1WLRA 4U75A 4IKUA 1CHMA 4IPAA 1QXWA 3IG4A 3OVKA 3BITA 3IL0A 1XGSA 4U73A 1WL9A 4HXXA 1M35A 4ZWOA 2V6CA 3QOCA 1KQ9A 4MATA 4KM3A 4U6EA 1A16A 4ZWPA 1BN5A 1B6AA 4U6ZA 3IU8A 1R58A 2HOWA 3I7MA 2Q95A 4S2RP 2GG3A 2Q93A 2EA2A 2BH3A 2GTXA 2BWTA 5E2CA 4S2TP 2BWWA 2GG7A 2Q94A 4RZYA 5D6FA 2EA4A 2GZ5A 3CB6A 4U6CA 3PN9A 4U70A 3TAVA 4ZWUA 1XGMA 4U76A 3PKBA 5JHUA 4OOKA 2NQ7A 2BWYA 1WKMA 5D6EA 3CTZA 4FKCA 3PKDA 3FMQA 2GG8A 2IW2A 2BHCA 1YW8A 1BOAA 1XGNA 2P98A 4EGEA 4FLJA 1WL6A 2Q96A 1C23A 1B59A 2V3ZA 4RZZA 5CDEA 2V3YA 1YVMA 2B3LA 2P99A 4FLKA 2BWUA 4PV4A 1N51A 1O0XA 3PKEA 1KQ0A 3PKAA 4PNCA 4B28A 1MATA 5CLSA 3S6BA 2B3HA 4IKRA 4QR8A 1XGOA 1KP0A 3MR1A 2GU7A 2BWVA 2GGBA 1W2MA 5FCFA 2BHBA 2GG0A 3IU9A 2EVOA 3RORA 4IF7A 1C27A 5CDLA 4FO8A 5E5BA 1XNZA 4FO7A 4S01A 2BHAA 2GG9A 2GU4A 3PKCA 5JFRA 2GA2A 1YW9A 3L7GA 4S00A 1YW7A 2GG2A 2GGCA 4JUQA 4U1BA 4U69A 1WY2A 3MATA 3BIPA 1W7VA 1C22A 1JAWA 4RGZ1 4IKTA 2B3KA 4FLIA 3PEBA 3IU7A 3D27A 4IECA 4U6WA 3Q6DA 4ZNGA 2BB7A 1QXZA 3TB5A 2NQ6A 1WBQA 1Y1NA 1WN1A 2BWSA 4IKSA 3L24A 5CE6A 4FLLA 2BWXA 2BN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  2ZSG A;  1QZY A;  2GU6 A;  3MX6 A;  1PV9 A;  4IDY A;  5CIK A;  3FMR A;  1R5G A;  5CNX A;  1QXY A;  2EVC A;  4U6J A;  4Z7M A;  4A6W A;  2OKN A;  2Q8K A;  2V3X A;  2G6P A;  4IU6 A;  5FCH A;  2GG5 A;  5JI6 A;  2OAZ A;  2EVM A;  3FM3 A;  2BHD A;  3RVA A;  5CDV A;  4R60 A;  2MAT A;  2DFI A;  4A6V A;  3BIQ A;  2Q92 A;  2ADU A;  3CB5 A;  2GU5 A;  3OOO A;  1YJ3 A;  3O5V A;  4U71 A;  4FUK A;  1C24 A;  2P9A A;  1R5H A;  1WLR A;  4U75 A;  4IKU A;  1CHM A;  4IPA A;  1QXW A;  3IG4 A;  3OVK A;  3BIT A;  3IL0 A;  1XGS A;  4U73 A;  1WL9 A;  4HXX A;  1M35 A;  4ZWO A;  2V6C A;  3QOC A;  1KQ9 A;  4MAT A;  4KM3 A;  4U6E A;  1A16 A;  4ZWP A;  1BN5 A;  1B6A A;  4U6Z A;  3IU8 A;  1R58 A;  2HOW A;  3I7M A;  2Q95 A;  4S2R P;  2GG3 A;  2Q93 A;  2EA2 A;  2BH3 A;  2GTX A;  2BWT A;  5E2C A;  4S2T P;  2BWW A;  2GG7 A;  2Q94 A;  4RZY A;  5D6F A;  2EA4 A;  2GZ5 A;  3CB6 A;  4U6C A;  3PN9 A;  4U70 A;  3TAV A;  4ZWU A;  1XGM A;  4U76 A;  3PKB A;  5JHU A;  4OOK A;  2NQ7 A;  2BWY A;  1WKM A;  5D6E A;  3CTZ A;  4FKC A;  3PKD A;  3FMQ A;  2GG8 A;  2IW2 A;  2BHC A;  1YW8 A;  1BOA A;  1XGN A;  2P98 A;  4EGE A;  4FLJ A;  1WL6 A;  2Q96 A;  1C23 A;  1B59 A;  2V3Z A;  4RZZ A;  5CDE A;  2V3Y A;  1YVM A;  2B3L A;  2P99 A;  4FLK A;  2BWU A;  4PV4 A;  1N51 A;  1O0X A;  3PKE A;  1KQ0 A;  3PKA A;  4PNC A;  4B28 A;  1MAT A;  5CLS A;  3S6B A;  2B3H A;  4IKR A;  4QR8 A;  1XGO A;  1KP0 A;  3MR1 A;  2GU7 A;  2BWV A;  2GGB A;  1W2M A;  5FCF A;  2BHB A;  2GG0 A;  3IU9 A;  2EVO A;  3ROR A;  4IF7 A;  1C27 A;  5CDL A;  4FO8 A;  5E5B A;  1XNZ A;  4FO7 A;  4S01 A;  2BHA A;  2GG9 A;  2GU4 A;  3PKC A;  5JFR A;  2GA2 A;  1YW9 A;  3L7G A;  4S00 A;  1YW7 A;  2GG2 A;  2GGC A;  4JUQ A;  4U1B A;  4U69 A;  1WY2 A;  3MAT A;  3BIP A;  1W7V A;  1C22 A;  1JAW A;  4RGZ 1;  4IKT A;  2B3K A;  4FLI A;  3PEB A;  3IU7 A;  3D27 A;  4IEC A;  4U6W A;  3Q6D A;  4ZNG A;  2BB7 A;  1QXZ A;  3TB5 A;  2NQ6 A;  1WBQ A;  1Y1N A;  1WN1 A;  2BWS A;  4IKS A;  3L24 A;  5CE6 A;  4FLL A;  2BWX A;  2BN7 A; 
#chains in the Genus database with same CATH topology
 1C21 A;  2ZSG A;  1QZY A;  2GU6 A;  3MX6 A;  1PV9 A;  4IDY A;  5CIK A;  3FMR A;  1R5G A;  5CNX A;  1QXY A;  2EVC A;  4U6J A;  4Z7M A;  4A6W A;  2OKN A;  2Q8K A;  2V3X A;  2G6P A;  4IU6 A;  5FCH A;  2GG5 A;  5JI6 A;  2OAZ A;  2EVM A;  3FM3 A;  2BHD A;  3RVA A;  5CDV A;  4R60 A;  2MAT A;  2DFI A;  4A6V A;  3BIQ A;  2Q92 A;  2ADU A;  3CB5 A;  2GU5 A;  3OOO A;  1YJ3 A;  3O5V A;  4U71 A;  4FUK A;  1C24 A;  2P9A A;  1R5H A;  1WLR A;  4U75 A;  4IKU A;  1CHM A;  4IPA A;  1QXW A;  3IG4 A;  3OVK A;  3BIT A;  3IL0 A;  1XGS A;  4U73 A;  1WL9 A;  4HXX A;  1M35 A;  4ZWO A;  2V6C A;  3QOC A;  1KQ9 A;  4MAT A;  4KM3 A;  4U6E A;  1A16 A;  4ZWP A;  1BN5 A;  1B6A A;  4U6Z A;  3IU8 A;  1R58 A;  2HOW A;  3I7M A;  2Q95 A;  4S2R P;  2GG3 A;  2Q93 A;  2EA2 A;  2BH3 A;  2GTX A;  2BWT A;  5E2C A;  4S2T P;  2BWW A;  2GG7 A;  2Q94 A;  4RZY A;  5D6F A;  2EA4 A;  2GZ5 A;  3CB6 A;  4U6C A;  3PN9 A;  4U70 A;  3TAV A;  4ZWU A;  1XGM A;  4U76 A;  3PKB A;  5JHU A;  4OOK A;  2NQ7 A;  2BWY A;  1WKM A;  5D6E A;  3CTZ A;  4FKC A;  3PKD A;  3FMQ A;  2GG8 A;  2IW2 A;  2BHC A;  1YW8 A;  1BOA A;  1XGN A;  2P98 A;  4EGE A;  4FLJ A;  1WL6 A;  2Q96 A;  1C23 A;  1B59 A;  2V3Z A;  4RZZ A;  5CDE A;  2V3Y A;  1YVM A;  2B3L A;  2P99 A;  4FLK A;  2BWU A;  4PV4 A;  1N51 A;  1O0X A;  3PKE A;  1KQ0 A;  3PKA A;  4PNC A;  4B28 A;  1MAT A;  5CLS A;  3S6B A;  2B3H A;  4IKR A;  4QR8 A;  1XGO A;  1KP0 A;  3MR1 A;  2GU7 A;  2BWV A;  2GGB A;  1W2M A;  5FCF A;  2BHB A;  2GG0 A;  3IU9 A;  2EVO A;  3ROR A;  4IF7 A;  1C27 A;  5CDL A;  4FO8 A;  5E5B A;  1XNZ A;  4FO7 A;  4S01 A;  2BHA A;  2GG9 A;  2GU4 A;  3PKC A;  5JFR A;  2GA2 A;  1YW9 A;  3L7G A;  4S00 A;  1YW7 A;  2GG2 A;  2GGC A;  4JUQ A;  4U1B A;  4U69 A;  1WY2 A;  3MAT A;  3BIP A;  1W7V A;  1C22 A;  1JAW A;  4RGZ 1;  4IKT A;  2B3K A;  4FLI A;  3PEB A;  3IU7 A;  3D27 A;  4IEC A;  4U6W A;  3Q6D A;  4ZNG A;  2BB7 A;  1QXZ A;  3TB5 A;  2NQ6 A;  1WBQ A;  1Y1N A;  1WN1 A;  2BWS A;  4IKS A;  3L24 A;  5CE6 A;  4FLL A;  2BWX A;  2BN7 A; 
#chains in the Genus database with same CATH homology
 1C21 A;  2ZSG A;  1QZY A;  2GU6 A;  3MX6 A;  1PV9 A;  4IDY A;  5CIK A;  3FMR A;  1R5G A;  5CNX A;  1QXY A;  2EVC A;  4U6J A;  4Z7M A;  4A6W A;  2OKN A;  2Q8K A;  2V3X A;  2G6P A;  4IU6 A;  5FCH A;  2GG5 A;  5JI6 A;  2OAZ A;  2EVM A;  3FM3 A;  2BHD A;  3RVA A;  5CDV A;  4R60 A;  2MAT A;  2DFI A;  4A6V A;  3BIQ A;  2Q92 A;  2ADU A;  3CB5 A;  2GU5 A;  3OOO A;  1YJ3 A;  3O5V A;  4U71 A;  4FUK A;  1C24 A;  2P9A A;  1R5H A;  1WLR A;  4U75 A;  4IKU A;  1CHM A;  4IPA A;  1QXW A;  3IG4 A;  3OVK A;  3BIT A;  3IL0 A;  1XGS A;  4U73 A;  1WL9 A;  4HXX A;  1M35 A;  4ZWO A;  2V6C A;  3QOC A;  1KQ9 A;  4MAT A;  4KM3 A;  4U6E A;  1A16 A;  4ZWP A;  1BN5 A;  1B6A A;  4U6Z A;  3IU8 A;  1R58 A;  2HOW A;  3I7M A;  2Q95 A;  4S2R P;  2GG3 A;  2Q93 A;  2EA2 A;  2BH3 A;  2GTX A;  2BWT A;  5E2C A;  4S2T P;  2BWW A;  2GG7 A;  2Q94 A;  4RZY A;  5D6F A;  2EA4 A;  2GZ5 A;  3CB6 A;  4U6C A;  3PN9 A;  4U70 A;  3TAV A;  4ZWU A;  1XGM A;  4U76 A;  3PKB A;  5JHU A;  4OOK A;  2NQ7 A;  2BWY A;  1WKM A;  5D6E A;  3CTZ A;  4FKC A;  3PKD A;  3FMQ A;  2GG8 A;  2IW2 A;  2BHC A;  1YW8 A;  1BOA A;  1XGN A;  2P98 A;  4EGE A;  4FLJ A;  1WL6 A;  2Q96 A;  1C23 A;  1B59 A;  2V3Z A;  4RZZ A;  5CDE A;  2V3Y A;  1YVM A;  2B3L A;  2P99 A;  4FLK A;  2BWU A;  4PV4 A;  1N51 A;  1O0X A;  3PKE A;  1KQ0 A;  3PKA A;  4PNC A;  4B28 A;  1MAT A;  5CLS A;  3S6B A;  2B3H A;  4IKR A;  4QR8 A;  1XGO A;  1KP0 A;  3MR1 A;  2GU7 A;  2BWV A;  2GGB A;  1W2M A;  5FCF A;  2BHB A;  2GG0 A;  3IU9 A;  2EVO A;  3ROR A;  4IF7 A;  1C27 A;  5CDL A;  4FO8 A;  5E5B A;  1XNZ A;  4FO7 A;  4S01 A;  2BHA A;  2GG9 A;  2GU4 A;  3PKC A;  5JFR A;  2GA2 A;  1YW9 A;  3L7G A;  4S00 A;  1YW7 A;  2GG2 A;  2GGC A;  4JUQ A;  4U1B A;  4U69 A;  1WY2 A;  3MAT A;  3BIP A;  1W7V A;  1C22 A;  1JAW A;  4RGZ 1;  4IKT A;  2B3K A;  4FLI A;  3PEB A;  3IU7 A;  3D27 A;  4IEC A;  4U6W A;  3Q6D A;  4ZNG A;  2BB7 A;  1QXZ A;  3TB5 A;  2NQ6 A;  1WBQ A;  1Y1N A;  1WN1 A;  2BWS A;  4IKS A;  3L24 A;  5CE6 A;  4FLL A;  2BWX A;  2BN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...