4RGZ1

Crystal structure of recombinant prolidase from thermococcus sibiricus at p21221 spacegroup
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
367
Chain Sequence
GSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of recombinant prolidase from Thermococcus sibiricus in space group P21221.
pubmed doi rcsb
source organism Thermococcus sibiricus mm 739
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 106
structure length 367
sequence length 367
chains with identical sequence A, N, e
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00557 Peptidase_M24 Metallopeptidase family M24
1 PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4rgz101
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4rgz102
4R60A 1WL9A 3OOOA 1PV9A 5FCFA 1KQ9A 4FO7A 3PKAA 1WBQA 2GG2A 2Q94A 2EVCA 2V3ZA 3S6BA 2EVMA 3PEBA 1C27A 1R5HA 4IECA 2GG0A 1C24A 2GGCA 2BWVA 4FLKA 4S00A 4ZWUA 2EVOA 4IKRA 3L7GA 4ZWPA 3I7MA 2BWUA 2V6CA 4IKTA 3L24A 4S2TP 1XNZA 1MATA 2B3KA 4IDYA 1C22A 3RORA 3PKBA 1WN1A 2GG8A 4U6EA 4S2RP 4U69A 2GU7A 2BHCA 2DFIA 3TAVA 4S01A 3FM3A 1WKMA 2ZSGA 4U70A 4U75A 2P9AA 2GG5A 5CIKA 4FUKA 4PV4A 1N51A 1QZYA 2BWXA 1QXWA 2BN7A 1WL6A 3FMQA 3IU8A 1XGNA 1YW8A 2Q96A 1B59A 5FCHA 2IW2A 3IG4A 4FO8A 5CE6A 5CDEA 3PKDA 1W2MA 1WLRA 5JI6A 1QXYA 2BHDA 1XGOA 3PKEA 2NQ7A 4KM3A 2B3HA 3FMRA 4IKUA 1YW9A 2G6PA 4FLLA 2BWSA 3TB5A 4U6CA 4ZWOA 1YW7A 3BIQA 2GG9A 2GTXA 1QXZA 1CHMA 4RZYA 1C21A 3MATA 3BIPA 5D6EA 1O0XA 2BWTA 4U6JA 4ZNGA 3CB5A 5CDVA 4FKCA 1WY2A 4QR8A 5CDLA 3MX6A 3MR1A 4FLJA 2NQ6A 4MATA 2B3LA 3QOCA 4B28A 2Q93A 4IKSA 3Q6DA 2BWYA 4U1BA 2OAZA 2MATA 3PKCA 1BOAA 4U76A 2V3YA 4EGEA 2GU4A 1C23A 3IU7A 1JAWA 2P98A 4U6WA 2BH3A 4OOKA 1BN5A 1YJ3A 2V3XA 5CNXA 2EA2A 1R58A 2GU6A 4PNCA 2Q8KA 4IU6A 4Z7MA 2BHBA 5E5BA 4U73A 4U71A 2Q92A 1XGMA 3O5VA 2Q95A 4FLIA 2GU5A 4A6WA 4A6VA 1KP0A 1A16A 4RGZ1 4HXXA 2HOWA 1YVMA 1KQ0A 1R5GA 5D6FA 2GZ5A 1W7VA 5JFRA 1XGSA 4RZZA 2EA4A 3CB6A 2BB7A 4U6ZA 2OKNA 3IL0A 2GGBA 2ADUA 5CLSA 2BWWA 3CTZA 2GA2A 4IF7A 5JHUA 3BITA 4JUQA 3OVKA 4IPAA 1M35A 1B6AA 2GG7A 1Y1NA 3D27A 3IU9A 2P99A 3PN9A 3RVAA 5E2CA 2GG3A 2BHAA
chains in the Genus database with same CATH superfamily
4R60A 1WL9A 3OOOA 1PV9A 5FCFA 1KQ9A 4FO7A 3PKAA 1WBQA 2GG2A 2Q94A 2EVCA 2V3ZA 3S6BA 2EVMA 3PEBA 1C27A 1R5HA 4IECA 2GG0A 1C24A 2GGCA 2BWVA 4FLKA 4S00A 4ZWUA 2EVOA 4IKRA 3L7GA 4ZWPA 3I7MA 2BWUA 2V6CA 4IKTA 3L24A 4S2TP 1XNZA 1MATA 2B3KA 4IDYA 1C22A 3RORA 3PKBA 1WN1A 2GG8A 4U6EA 4S2RP 4U69A 2GU7A 2BHCA 2DFIA 3TAVA 4S01A 3FM3A 1WKMA 2ZSGA 4U70A 4U75A 2P9AA 2GG5A 5CIKA 4FUKA 4PV4A 1N51A 1QZYA 2BWXA 1QXWA 2BN7A 1WL6A 3FMQA 3IU8A 1XGNA 1YW8A 2Q96A 1B59A 5FCHA 2IW2A 3IG4A 4FO8A 5CE6A 5CDEA 3PKDA 1W2MA 1WLRA 5JI6A 1QXYA 2BHDA 1XGOA 3PKEA 2NQ7A 4KM3A 2B3HA 3FMRA 4IKUA 1YW9A 2G6PA 4FLLA 2BWSA 3TB5A 4U6CA 4ZWOA 1YW7A 3BIQA 2GG9A 2GTXA 1QXZA 1CHMA 4RZYA 1C21A 3MATA 3BIPA 5D6EA 1O0XA 2BWTA 4U6JA 4ZNGA 3CB5A 5CDVA 4FKCA 1WY2A 4QR8A 5CDLA 3MX6A 3MR1A 4FLJA 2NQ6A 4MATA 2B3LA 3QOCA 4B28A 2Q93A 4IKSA 3Q6DA 2BWYA 4U1BA 2OAZA 2MATA 3PKCA 1BOAA 4U76A 2V3YA 4EGEA 2GU4A 1C23A 3IU7A 1JAWA 2P98A 4U6WA 2BH3A 4OOKA 1BN5A 1YJ3A 2V3XA 5CNXA 2EA2A 1R58A 2GU6A 4PNCA 2Q8KA 4IU6A 4Z7MA 2BHBA 5E5BA 4U73A 4U71A 2Q92A 1XGMA 3O5VA 2Q95A 4FLIA 2GU5A 4A6WA 4A6VA 1KP0A 1A16A 4RGZ1 4HXXA 2HOWA 1YVMA 1KQ0A 1R5GA 5D6FA 2GZ5A 1W7VA 5JFRA 1XGSA 4RZZA 2EA4A 3CB6A 2BB7A 4U6ZA 2OKNA 3IL0A 2GGBA 2ADUA 5CLSA 2BWWA 3CTZA 2GA2A 4IF7A 5JHUA 3BITA 4JUQA 3OVKA 4IPAA 1M35A 1B6AA 2GG7A 1Y1NA 3D27A 3IU9A 2P99A 3PN9A 3RVAA 5E2CA 2GG3A 2BHAA
chains in the Genus database with same CATH topology
4R60A 1WL9A 3OOOA 1PV9A 5FCFA 1KQ9A 4FO7A 3PKAA 1WBQA 2GG2A 2Q94A 2EVCA 2V3ZA 3S6BA 2EVMA 3PEBA 1C27A 1R5HA 4IECA 2GG0A 1C24A 2GGCA 2BWVA 4FLKA 4S00A 4ZWUA 2EVOA 4IKRA 3L7GA 4ZWPA 3I7MA 2BWUA 2V6CA 4IKTA 3L24A 4S2TP 1XNZA 1MATA 2B3KA 4IDYA 1C22A 3RORA 3PKBA 1WN1A 2GG8A 4U6EA 4S2RP 4U69A 2GU7A 2BHCA 2DFIA 3TAVA 4S01A 3FM3A 1WKMA 2ZSGA 4U70A 4U75A 2P9AA 2GG5A 5CIKA 4FUKA 4PV4A 1N51A 1QZYA 2BWXA 1QXWA 2BN7A 1WL6A 3FMQA 3IU8A 1XGNA 1YW8A 2Q96A 1B59A 5FCHA 2IW2A 3IG4A 4FO8A 5CE6A 5CDEA 3PKDA 1W2MA 1WLRA 5JI6A 1QXYA 2BHDA 1XGOA 3PKEA 2NQ7A 4KM3A 2B3HA 3FMRA 4IKUA 1YW9A 2G6PA 4FLLA 2BWSA 3TB5A 4U6CA 4ZWOA 1YW7A 3BIQA 2GG9A 2GTXA 1QXZA 1CHMA 4RZYA 1C21A 3MATA 3BIPA 5D6EA 1O0XA 2BWTA 4U6JA 4ZNGA 3CB5A 5CDVA 4FKCA 1WY2A 4QR8A 5CDLA 3MX6A 3MR1A 4FLJA 2NQ6A 4MATA 2B3LA 3QOCA 4B28A 2Q93A 4IKSA 3Q6DA 2BWYA 4U1BA 2OAZA 2MATA 3PKCA 1BOAA 4U76A 2V3YA 4EGEA 2GU4A 1C23A 3IU7A 1JAWA 2P98A 4U6WA 2BH3A 4OOKA 1BN5A 1YJ3A 2V3XA 5CNXA 2EA2A 1R58A 2GU6A 4PNCA 2Q8KA 4IU6A 4Z7MA 2BHBA 5E5BA 4U73A 4U71A 2Q92A 1XGMA 3O5VA 2Q95A 4FLIA 2GU5A 4A6WA 4A6VA 1KP0A 1A16A 4RGZ1 4HXXA 2HOWA 1YVMA 1KQ0A 1R5GA 5D6FA 2GZ5A 1W7VA 5JFRA 1XGSA 4RZZA 2EA4A 3CB6A 2BB7A 4U6ZA 2OKNA 3IL0A 2GGBA 2ADUA 5CLSA 2BWWA 3CTZA 2GA2A 4IF7A 5JHUA 3BITA 4JUQA 3OVKA 4IPAA 1M35A 1B6AA 2GG7A 1Y1NA 3D27A 3IU9A 2P99A 3PN9A 3RVAA 5E2CA 2GG3A 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  1WL9 A;  3OOO A;  1PV9 A;  5FCF A;  1KQ9 A;  4FO7 A;  3PKA A;  1WBQ A;  2GG2 A;  2Q94 A;  2EVC A;  2V3Z A;  3S6B A;  2EVM A;  3PEB A;  1C27 A;  1R5H A;  4IEC A;  2GG0 A;  1C24 A;  2GGC A;  2BWV A;  4FLK A;  4S00 A;  4ZWU A;  2EVO A;  4IKR A;  3L7G A;  4ZWP A;  3I7M A;  2BWU A;  2V6C A;  4IKT A;  3L24 A;  4S2T P;  1XNZ A;  1MAT A;  2B3K A;  4IDY A;  1C22 A;  3ROR A;  3PKB A;  1WN1 A;  2GG8 A;  4U6E A;  4S2R P;  4U69 A;  2GU7 A;  2BHC A;  2DFI A;  3TAV A;  4S01 A;  3FM3 A;  1WKM A;  2ZSG A;  4U70 A;  4U75 A;  2P9A A;  2GG5 A;  5CIK A;  4FUK A;  4PV4 A;  1N51 A;  1QZY A;  2BWX A;  1QXW A;  2BN7 A;  1WL6 A;  3FMQ A;  3IU8 A;  1XGN A;  1YW8 A;  2Q96 A;  1B59 A;  5FCH A;  2IW2 A;  3IG4 A;  4FO8 A;  5CE6 A;  5CDE A;  3PKD A;  1W2M A;  1WLR A;  5JI6 A;  1QXY A;  2BHD A;  1XGO A;  3PKE A;  2NQ7 A;  4KM3 A;  2B3H A;  3FMR A;  4IKU A;  1YW9 A;  2G6P A;  4FLL A;  2BWS A;  3TB5 A;  4U6C A;  4ZWO A;  1YW7 A;  3BIQ A;  2GG9 A;  2GTX A;  1QXZ A;  1CHM A;  4RZY A;  1C21 A;  3MAT A;  3BIP A;  5D6E A;  1O0X A;  2BWT A;  4U6J A;  4ZNG A;  3CB5 A;  5CDV A;  4FKC A;  1WY2 A;  4QR8 A;  5CDL A;  3MX6 A;  3MR1 A;  4FLJ A;  2NQ6 A;  4MAT A;  2B3L A;  3QOC A;  4B28 A;  2Q93 A;  4IKS A;  3Q6D A;  2BWY A;  4U1B A;  2OAZ A;  2MAT A;  3PKC A;  1BOA A;  4U76 A;  2V3Y A;  4EGE A;  2GU4 A;  1C23 A;  3IU7 A;  1JAW A;  2P98 A;  4U6W A;  2BH3 A;  4OOK A;  1BN5 A;  1YJ3 A;  2V3X A;  5CNX A;  2EA2 A;  1R58 A;  2GU6 A;  4PNC A;  2Q8K A;  4IU6 A;  4Z7M A;  2BHB A;  5E5B A;  4U73 A;  4U71 A;  2Q92 A;  1XGM A;  3O5V A;  2Q95 A;  4FLI A;  2GU5 A;  4A6W A;  4A6V A;  1KP0 A;  1A16 A;  4RGZ 1;  4HXX A;  2HOW A;  1YVM A;  1KQ0 A;  1R5G A;  5D6F A;  2GZ5 A;  1W7V A;  5JFR A;  1XGS A;  4RZZ A;  2EA4 A;  3CB6 A;  2BB7 A;  4U6Z A;  2OKN A;  3IL0 A;  2GGB A;  2ADU A;  5CLS A;  2BWW A;  3CTZ A;  2GA2 A;  4IF7 A;  5JHU A;  3BIT A;  4JUQ A;  3OVK A;  4IPA A;  1M35 A;  1B6A A;  2GG7 A;  1Y1N A;  3D27 A;  3IU9 A;  2P99 A;  3PN9 A;  3RVA A;  5E2C A;  2GG3 A;  2BHA A; 
#chains in the Genus database with same CATH topology
 4R60 A;  1WL9 A;  3OOO A;  1PV9 A;  5FCF A;  1KQ9 A;  4FO7 A;  3PKA A;  1WBQ A;  2GG2 A;  2Q94 A;  2EVC A;  2V3Z A;  3S6B A;  2EVM A;  3PEB A;  1C27 A;  1R5H A;  4IEC A;  2GG0 A;  1C24 A;  2GGC A;  2BWV A;  4FLK A;  4S00 A;  4ZWU A;  2EVO A;  4IKR A;  3L7G A;  4ZWP A;  3I7M A;  2BWU A;  2V6C A;  4IKT A;  3L24 A;  4S2T P;  1XNZ A;  1MAT A;  2B3K A;  4IDY A;  1C22 A;  3ROR A;  3PKB A;  1WN1 A;  2GG8 A;  4U6E A;  4S2R P;  4U69 A;  2GU7 A;  2BHC A;  2DFI A;  3TAV A;  4S01 A;  3FM3 A;  1WKM A;  2ZSG A;  4U70 A;  4U75 A;  2P9A A;  2GG5 A;  5CIK A;  4FUK A;  4PV4 A;  1N51 A;  1QZY A;  2BWX A;  1QXW A;  2BN7 A;  1WL6 A;  3FMQ A;  3IU8 A;  1XGN A;  1YW8 A;  2Q96 A;  1B59 A;  5FCH A;  2IW2 A;  3IG4 A;  4FO8 A;  5CE6 A;  5CDE A;  3PKD A;  1W2M A;  1WLR A;  5JI6 A;  1QXY A;  2BHD A;  1XGO A;  3PKE A;  2NQ7 A;  4KM3 A;  2B3H A;  3FMR A;  4IKU A;  1YW9 A;  2G6P A;  4FLL A;  2BWS A;  3TB5 A;  4U6C A;  4ZWO A;  1YW7 A;  3BIQ A;  2GG9 A;  2GTX A;  1QXZ A;  1CHM A;  4RZY A;  1C21 A;  3MAT A;  3BIP A;  5D6E A;  1O0X A;  2BWT A;  4U6J A;  4ZNG A;  3CB5 A;  5CDV A;  4FKC A;  1WY2 A;  4QR8 A;  5CDL A;  3MX6 A;  3MR1 A;  4FLJ A;  2NQ6 A;  4MAT A;  2B3L A;  3QOC A;  4B28 A;  2Q93 A;  4IKS A;  3Q6D A;  2BWY A;  4U1B A;  2OAZ A;  2MAT A;  3PKC A;  1BOA A;  4U76 A;  2V3Y A;  4EGE A;  2GU4 A;  1C23 A;  3IU7 A;  1JAW A;  2P98 A;  4U6W A;  2BH3 A;  4OOK A;  1BN5 A;  1YJ3 A;  2V3X A;  5CNX A;  2EA2 A;  1R58 A;  2GU6 A;  4PNC A;  2Q8K A;  4IU6 A;  4Z7M A;  2BHB A;  5E5B A;  4U73 A;  4U71 A;  2Q92 A;  1XGM A;  3O5V A;  2Q95 A;  4FLI A;  2GU5 A;  4A6W A;  4A6V A;  1KP0 A;  1A16 A;  4RGZ 1;  4HXX A;  2HOW A;  1YVM A;  1KQ0 A;  1R5G A;  5D6F A;  2GZ5 A;  1W7V A;  5JFR A;  1XGS A;  4RZZ A;  2EA4 A;  3CB6 A;  2BB7 A;  4U6Z A;  2OKN A;  3IL0 A;  2GGB A;  2ADU A;  5CLS A;  2BWW A;  3CTZ A;  2GA2 A;  4IF7 A;  5JHU A;  3BIT A;  4JUQ A;  3OVK A;  4IPA A;  1M35 A;  1B6A A;  2GG7 A;  1Y1N A;  3D27 A;  3IU9 A;  2P99 A;  3PN9 A;  3RVA A;  5E2C A;  2GG3 A;  2BHA A; 
#chains in the Genus database with same CATH homology
 4R60 A;  1WL9 A;  3OOO A;  1PV9 A;  5FCF A;  1KQ9 A;  4FO7 A;  3PKA A;  1WBQ A;  2GG2 A;  2Q94 A;  2EVC A;  2V3Z A;  3S6B A;  2EVM A;  3PEB A;  1C27 A;  1R5H A;  4IEC A;  2GG0 A;  1C24 A;  2GGC A;  2BWV A;  4FLK A;  4S00 A;  4ZWU A;  2EVO A;  4IKR A;  3L7G A;  4ZWP A;  3I7M A;  2BWU A;  2V6C A;  4IKT A;  3L24 A;  4S2T P;  1XNZ A;  1MAT A;  2B3K A;  4IDY A;  1C22 A;  3ROR A;  3PKB A;  1WN1 A;  2GG8 A;  4U6E A;  4S2R P;  4U69 A;  2GU7 A;  2BHC A;  2DFI A;  3TAV A;  4S01 A;  3FM3 A;  1WKM A;  2ZSG A;  4U70 A;  4U75 A;  2P9A A;  2GG5 A;  5CIK A;  4FUK A;  4PV4 A;  1N51 A;  1QZY A;  2BWX A;  1QXW A;  2BN7 A;  1WL6 A;  3FMQ A;  3IU8 A;  1XGN A;  1YW8 A;  2Q96 A;  1B59 A;  5FCH A;  2IW2 A;  3IG4 A;  4FO8 A;  5CE6 A;  5CDE A;  3PKD A;  1W2M A;  1WLR A;  5JI6 A;  1QXY A;  2BHD A;  1XGO A;  3PKE A;  2NQ7 A;  4KM3 A;  2B3H A;  3FMR A;  4IKU A;  1YW9 A;  2G6P A;  4FLL A;  2BWS A;  3TB5 A;  4U6C A;  4ZWO A;  1YW7 A;  3BIQ A;  2GG9 A;  2GTX A;  1QXZ A;  1CHM A;  4RZY A;  1C21 A;  3MAT A;  3BIP A;  5D6E A;  1O0X A;  2BWT A;  4U6J A;  4ZNG A;  3CB5 A;  5CDV A;  4FKC A;  1WY2 A;  4QR8 A;  5CDL A;  3MX6 A;  3MR1 A;  4FLJ A;  2NQ6 A;  4MAT A;  2B3L A;  3QOC A;  4B28 A;  2Q93 A;  4IKS A;  3Q6D A;  2BWY A;  4U1B A;  2OAZ A;  2MAT A;  3PKC A;  1BOA A;  4U76 A;  2V3Y A;  4EGE A;  2GU4 A;  1C23 A;  3IU7 A;  1JAW A;  2P98 A;  4U6W A;  2BH3 A;  4OOK A;  1BN5 A;  1YJ3 A;  2V3X A;  5CNX A;  2EA2 A;  1R58 A;  2GU6 A;  4PNC A;  2Q8K A;  4IU6 A;  4Z7M A;  2BHB A;  5E5B A;  4U73 A;  4U71 A;  2Q92 A;  1XGM A;  3O5V A;  2Q95 A;  4FLI A;  2GU5 A;  4A6W A;  4A6V A;  1KP0 A;  1A16 A;  4RGZ 1;  4HXX A;  2HOW A;  1YVM A;  1KQ0 A;  1R5G A;  5D6F A;  2GZ5 A;  1W7V A;  5JFR A;  1XGS A;  4RZZ A;  2EA4 A;  3CB6 A;  2BB7 A;  4U6Z A;  2OKN A;  3IL0 A;  2GGB A;  2ADU A;  5CLS A;  2BWW A;  3CTZ A;  2GA2 A;  4IF7 A;  5JHU A;  3BIT A;  4JUQ A;  3OVK A;  4IPA A;  1M35 A;  1B6A A;  2GG7 A;  1Y1N A;  3D27 A;  3IU9 A;  2P99 A;  3PN9 A;  3RVA A;  5E2C A;  2GG3 A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...