4RGZ1

Crystal structure of recombinant prolidase from thermococcus sibiricus at p21221 spacegroup
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
367
Chain Sequence
GSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of recombinant prolidase from Thermococcus sibiricus in space group P21221.
pubmed doi rcsb
source organism Thermococcus sibiricus mm 739
total genus 106
structure length 367
sequence length 367
chains with identical sequence A, N, e
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00557 Peptidase_M24 Metallopeptidase family M24
1 PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4rgz101
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4rgz102
1WN1A 2BHCA 1BN5A 3L24A 3FMRA 4S2TP 4FO8A 2GG5A 2EVMA 4IKRA 1R5GA 4U1BA 3OVKA 4Z7MA 3BIPA 5CLSA 4S01A 4ZWOA 2P99A 3MR1A 2GGCA 1PV9A 2GU4A 2BWSA 1WBQA 2V6CA 2Q96A 2BWTA 3IU7A 4U6CA 3I7MA 3PKCA 2MATA 1JAWA 2GTXA 1O0XA 1B59A 3IU8A 4IF7A 4IKTA 4MATA 1WL6A 5CE6A 4EGEA 1C23A 3TB5A 4ZWUA 5CDLA 4U71A 1B6AA 4U76A 3PKBA 2EA2A 2BH3A 2GA2A 1YVMA 5FCHA 2GG3A 4FLLA 1Y1NA 4IKSA 2ZSGA 2GG0A 1C27A 2Q93A 2HOWA 3BITA 1XGNA 4FKCA 3BIQA 2Q92A 3IU9A 3PKAA 3TAVA 1WKMA 4U6WA 3L7GA 4A6VA 2GGBA 2B3KA 4U75A 2DFIA 1WY2A 5CNXA 1R58A 1YW7A 4PV4A 4U70A 4U6EA 4A6WA 1N51A 3FM3A 1W2MA 1QXYA 1YW9A 4IU6A 3OOOA 3RORA 4RZYA 1WL9A 1BOAA 1KQ9A 1QXZA 4R60A 2EA4A 2GG2A 4IECA 2NQ6A 1XGOA 2BWXA 3MATA 2BWYA 1CHMA 2B3HA 2Q94A 3CB6A 3QOCA 4U69A 4U73A 4IDYA 3PKDA 4RGZ1 2GG8A 1XNZA 1WLRA 3S6BA 4FLJA 5E2CA 3IL0A 3CTZA 3O5VA 1XGSA 4U6JA 4FLKA 4PNCA 4HXXA 2IW2A 3CB5A 1QZYA 1YJ3A 2NQ7A 2BWUA 3RVAA 2BHBA 2BHDA 4B28A 4RZZA 2BB7A 2OAZA 2GG7A 2BWWA 4FO7A 2B3LA 4FUKA 2GU6A 2G6PA 3FMQA 4S00A 3MX6A 1KP0A 5CDVA 1M35A 1C22A 1C21A 1KQ0A 1R5HA 5CDEA 3IG4A 2V3YA 2GG9A 4ZNGA 2P9AA 1MATA 5JI6A 5FCFA 3PKEA 1XGMA 2Q8KA 2V3XA 5D6EA 2BHAA 5JFRA 4IKUA 1QXWA 2V3ZA 5D6FA 2GU7A 4JUQA 2ADUA 4S2RP 4U6ZA 5JHUA 3Q6DA 5CIKA 2Q95A 4KM3A 1YW8A 4OOKA 4QR8A 2P98A 4FLIA 1A16A 2EVOA 2GU5A 3D27A 3PN9A 3PEBA 1W7VA 2BN7A 2EVCA 2BWVA 2OKNA 5E5BA 4ZWPA 4IPAA 2GZ5A 1C24A
chains in the Genus database with same CATH superfamily
1WN1A 2BHCA 1BN5A 3L24A 3FMRA 4S2TP 4FO8A 2GG5A 2EVMA 4IKRA 1R5GA 4U1BA 3OVKA 4Z7MA 3BIPA 5CLSA 4S01A 4ZWOA 2P99A 3MR1A 2GGCA 1PV9A 2GU4A 2BWSA 1WBQA 2V6CA 2Q96A 2BWTA 3IU7A 4U6CA 3I7MA 3PKCA 2MATA 1JAWA 2GTXA 1O0XA 1B59A 3IU8A 4IF7A 4IKTA 4MATA 1WL6A 5CE6A 4EGEA 1C23A 3TB5A 4ZWUA 5CDLA 4U71A 1B6AA 4U76A 3PKBA 2EA2A 2BH3A 2GA2A 1YVMA 5FCHA 2GG3A 4FLLA 1Y1NA 4IKSA 2ZSGA 2GG0A 1C27A 2Q93A 2HOWA 3BITA 1XGNA 4FKCA 3BIQA 2Q92A 3IU9A 3PKAA 3TAVA 1WKMA 4U6WA 3L7GA 4A6VA 2GGBA 2B3KA 4U75A 2DFIA 1WY2A 5CNXA 1R58A 1YW7A 4PV4A 4U70A 4U6EA 4A6WA 1N51A 3FM3A 1W2MA 1QXYA 1YW9A 4IU6A 3OOOA 3RORA 4RZYA 1WL9A 1BOAA 1KQ9A 1QXZA 4R60A 2EA4A 2GG2A 4IECA 2NQ6A 1XGOA 2BWXA 3MATA 2BWYA 1CHMA 2B3HA 2Q94A 3CB6A 3QOCA 4U69A 4U73A 4IDYA 3PKDA 4RGZ1 2GG8A 1XNZA 1WLRA 3S6BA 4FLJA 5E2CA 3IL0A 3CTZA 3O5VA 1XGSA 4U6JA 4FLKA 4PNCA 4HXXA 2IW2A 3CB5A 1QZYA 1YJ3A 2NQ7A 2BWUA 3RVAA 2BHBA 2BHDA 4B28A 4RZZA 2BB7A 2OAZA 2GG7A 2BWWA 4FO7A 2B3LA 4FUKA 2GU6A 2G6PA 3FMQA 4S00A 3MX6A 1KP0A 5CDVA 1M35A 1C22A 1C21A 1KQ0A 1R5HA 5CDEA 3IG4A 2V3YA 2GG9A 4ZNGA 2P9AA 1MATA 5JI6A 5FCFA 3PKEA 1XGMA 2Q8KA 2V3XA 5D6EA 2BHAA 5JFRA 4IKUA 1QXWA 2V3ZA 5D6FA 2GU7A 4JUQA 2ADUA 4S2RP 4U6ZA 5JHUA 3Q6DA 5CIKA 2Q95A 4KM3A 1YW8A 4OOKA 4QR8A 2P98A 4FLIA 1A16A 2EVOA 2GU5A 3D27A 3PN9A 3PEBA 1W7VA 2BN7A 2EVCA 2BWVA 2OKNA 5E5BA 4ZWPA 4IPAA 2GZ5A 1C24A
chains in the Genus database with same CATH topology
1WN1A 2BHCA 1BN5A 3L24A 3FMRA 4S2TP 4FO8A 2GG5A 2EVMA 4IKRA 1R5GA 4U1BA 3OVKA 4Z7MA 3BIPA 5CLSA 4S01A 4ZWOA 2P99A 3MR1A 2GGCA 1PV9A 2GU4A 2BWSA 1WBQA 2V6CA 2Q96A 2BWTA 3IU7A 4U6CA 3I7MA 3PKCA 2MATA 1JAWA 2GTXA 1O0XA 1B59A 3IU8A 4IF7A 4IKTA 4MATA 1WL6A 5CE6A 4EGEA 1C23A 3TB5A 4ZWUA 5CDLA 4U71A 1B6AA 4U76A 3PKBA 2EA2A 2BH3A 2GA2A 1YVMA 5FCHA 2GG3A 4FLLA 1Y1NA 4IKSA 2ZSGA 2GG0A 1C27A 2Q93A 2HOWA 3BITA 1XGNA 4FKCA 3BIQA 2Q92A 3IU9A 3PKAA 3TAVA 1WKMA 4U6WA 3L7GA 4A6VA 2GGBA 2B3KA 4U75A 2DFIA 1WY2A 5CNXA 1R58A 1YW7A 4PV4A 4U70A 4U6EA 4A6WA 1N51A 3FM3A 1W2MA 1QXYA 1YW9A 4IU6A 3OOOA 3RORA 4RZYA 1WL9A 1BOAA 1KQ9A 1QXZA 4R60A 2EA4A 2GG2A 4IECA 2NQ6A 1XGOA 2BWXA 3MATA 2BWYA 1CHMA 2B3HA 2Q94A 3CB6A 3QOCA 4U69A 4U73A 4IDYA 3PKDA 4RGZ1 2GG8A 1XNZA 1WLRA 3S6BA 4FLJA 5E2CA 3IL0A 3CTZA 3O5VA 1XGSA 4U6JA 4FLKA 4PNCA 4HXXA 2IW2A 3CB5A 1QZYA 1YJ3A 2NQ7A 2BWUA 3RVAA 2BHBA 2BHDA 4B28A 4RZZA 2BB7A 2OAZA 2GG7A 2BWWA 4FO7A 2B3LA 4FUKA 2GU6A 2G6PA 3FMQA 4S00A 3MX6A 1KP0A 5CDVA 1M35A 1C22A 1C21A 1KQ0A 1R5HA 5CDEA 3IG4A 2V3YA 2GG9A 4ZNGA 2P9AA 1MATA 5JI6A 5FCFA 3PKEA 1XGMA 2Q8KA 2V3XA 5D6EA 2BHAA 5JFRA 4IKUA 1QXWA 2V3ZA 5D6FA 2GU7A 4JUQA 2ADUA 4S2RP 4U6ZA 5JHUA 3Q6DA 5CIKA 2Q95A 4KM3A 1YW8A 4OOKA 4QR8A 2P98A 4FLIA 1A16A 2EVOA 2GU5A 3D27A 3PN9A 3PEBA 1W7VA 2BN7A 2EVCA 2BWVA 2OKNA 5E5BA 4ZWPA 4IPAA 2GZ5A 1C24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN1 A;  2BHC A;  1BN5 A;  3L24 A;  3FMR A;  4S2T P;  4FO8 A;  2GG5 A;  2EVM A;  4IKR A;  1R5G A;  4U1B A;  3OVK A;  4Z7M A;  3BIP A;  5CLS A;  4S01 A;  4ZWO A;  2P99 A;  3MR1 A;  2GGC A;  1PV9 A;  2GU4 A;  2BWS A;  1WBQ A;  2V6C A;  2Q96 A;  2BWT A;  3IU7 A;  4U6C A;  3I7M A;  3PKC A;  2MAT A;  1JAW A;  2GTX A;  1O0X A;  1B59 A;  3IU8 A;  4IF7 A;  4IKT A;  4MAT A;  1WL6 A;  5CE6 A;  4EGE A;  1C23 A;  3TB5 A;  4ZWU A;  5CDL A;  4U71 A;  1B6A A;  4U76 A;  3PKB A;  2EA2 A;  2BH3 A;  2GA2 A;  1YVM A;  5FCH A;  2GG3 A;  4FLL A;  1Y1N A;  4IKS A;  2ZSG A;  2GG0 A;  1C27 A;  2Q93 A;  2HOW A;  3BIT A;  1XGN A;  4FKC A;  3BIQ A;  2Q92 A;  3IU9 A;  3PKA A;  3TAV A;  1WKM A;  4U6W A;  3L7G A;  4A6V A;  2GGB A;  2B3K A;  4U75 A;  2DFI A;  1WY2 A;  5CNX A;  1R58 A;  1YW7 A;  4PV4 A;  4U70 A;  4U6E A;  4A6W A;  1N51 A;  3FM3 A;  1W2M A;  1QXY A;  1YW9 A;  4IU6 A;  3OOO A;  3ROR A;  4RZY A;  1WL9 A;  1BOA A;  1KQ9 A;  1QXZ A;  4R60 A;  2EA4 A;  2GG2 A;  4IEC A;  2NQ6 A;  1XGO A;  2BWX A;  3MAT A;  2BWY A;  1CHM A;  2B3H A;  2Q94 A;  3CB6 A;  3QOC A;  4U69 A;  4U73 A;  4IDY A;  3PKD A;  4RGZ 1;  2GG8 A;  1XNZ A;  1WLR A;  3S6B A;  4FLJ A;  5E2C A;  3IL0 A;  3CTZ A;  3O5V A;  1XGS A;  4U6J A;  4FLK A;  4PNC A;  4HXX A;  2IW2 A;  3CB5 A;  1QZY A;  1YJ3 A;  2NQ7 A;  2BWU A;  3RVA A;  2BHB A;  2BHD A;  4B28 A;  4RZZ A;  2BB7 A;  2OAZ A;  2GG7 A;  2BWW A;  4FO7 A;  2B3L A;  4FUK A;  2GU6 A;  2G6P A;  3FMQ A;  4S00 A;  3MX6 A;  1KP0 A;  5CDV A;  1M35 A;  1C22 A;  1C21 A;  1KQ0 A;  1R5H A;  5CDE A;  3IG4 A;  2V3Y A;  2GG9 A;  4ZNG A;  2P9A A;  1MAT A;  5JI6 A;  5FCF A;  3PKE A;  1XGM A;  2Q8K A;  2V3X A;  5D6E A;  2BHA A;  5JFR A;  4IKU A;  1QXW A;  2V3Z A;  5D6F A;  2GU7 A;  4JUQ A;  2ADU A;  4S2R P;  4U6Z A;  5JHU A;  3Q6D A;  5CIK A;  2Q95 A;  4KM3 A;  1YW8 A;  4OOK A;  4QR8 A;  2P98 A;  4FLI A;  1A16 A;  2EVO A;  2GU5 A;  3D27 A;  3PN9 A;  3PEB A;  1W7V A;  2BN7 A;  2EVC A;  2BWV A;  2OKN A;  5E5B A;  4ZWP A;  4IPA A;  2GZ5 A;  1C24 A; 
#chains in the Genus database with same CATH topology
 1WN1 A;  2BHC A;  1BN5 A;  3L24 A;  3FMR A;  4S2T P;  4FO8 A;  2GG5 A;  2EVM A;  4IKR A;  1R5G A;  4U1B A;  3OVK A;  4Z7M A;  3BIP A;  5CLS A;  4S01 A;  4ZWO A;  2P99 A;  3MR1 A;  2GGC A;  1PV9 A;  2GU4 A;  2BWS A;  1WBQ A;  2V6C A;  2Q96 A;  2BWT A;  3IU7 A;  4U6C A;  3I7M A;  3PKC A;  2MAT A;  1JAW A;  2GTX A;  1O0X A;  1B59 A;  3IU8 A;  4IF7 A;  4IKT A;  4MAT A;  1WL6 A;  5CE6 A;  4EGE A;  1C23 A;  3TB5 A;  4ZWU A;  5CDL A;  4U71 A;  1B6A A;  4U76 A;  3PKB A;  2EA2 A;  2BH3 A;  2GA2 A;  1YVM A;  5FCH A;  2GG3 A;  4FLL A;  1Y1N A;  4IKS A;  2ZSG A;  2GG0 A;  1C27 A;  2Q93 A;  2HOW A;  3BIT A;  1XGN A;  4FKC A;  3BIQ A;  2Q92 A;  3IU9 A;  3PKA A;  3TAV A;  1WKM A;  4U6W A;  3L7G A;  4A6V A;  2GGB A;  2B3K A;  4U75 A;  2DFI A;  1WY2 A;  5CNX A;  1R58 A;  1YW7 A;  4PV4 A;  4U70 A;  4U6E A;  4A6W A;  1N51 A;  3FM3 A;  1W2M A;  1QXY A;  1YW9 A;  4IU6 A;  3OOO A;  3ROR A;  4RZY A;  1WL9 A;  1BOA A;  1KQ9 A;  1QXZ A;  4R60 A;  2EA4 A;  2GG2 A;  4IEC A;  2NQ6 A;  1XGO A;  2BWX A;  3MAT A;  2BWY A;  1CHM A;  2B3H A;  2Q94 A;  3CB6 A;  3QOC A;  4U69 A;  4U73 A;  4IDY A;  3PKD A;  4RGZ 1;  2GG8 A;  1XNZ A;  1WLR A;  3S6B A;  4FLJ A;  5E2C A;  3IL0 A;  3CTZ A;  3O5V A;  1XGS A;  4U6J A;  4FLK A;  4PNC A;  4HXX A;  2IW2 A;  3CB5 A;  1QZY A;  1YJ3 A;  2NQ7 A;  2BWU A;  3RVA A;  2BHB A;  2BHD A;  4B28 A;  4RZZ A;  2BB7 A;  2OAZ A;  2GG7 A;  2BWW A;  4FO7 A;  2B3L A;  4FUK A;  2GU6 A;  2G6P A;  3FMQ A;  4S00 A;  3MX6 A;  1KP0 A;  5CDV A;  1M35 A;  1C22 A;  1C21 A;  1KQ0 A;  1R5H A;  5CDE A;  3IG4 A;  2V3Y A;  2GG9 A;  4ZNG A;  2P9A A;  1MAT A;  5JI6 A;  5FCF A;  3PKE A;  1XGM A;  2Q8K A;  2V3X A;  5D6E A;  2BHA A;  5JFR A;  4IKU A;  1QXW A;  2V3Z A;  5D6F A;  2GU7 A;  4JUQ A;  2ADU A;  4S2R P;  4U6Z A;  5JHU A;  3Q6D A;  5CIK A;  2Q95 A;  4KM3 A;  1YW8 A;  4OOK A;  4QR8 A;  2P98 A;  4FLI A;  1A16 A;  2EVO A;  2GU5 A;  3D27 A;  3PN9 A;  3PEB A;  1W7V A;  2BN7 A;  2EVC A;  2BWV A;  2OKN A;  5E5B A;  4ZWP A;  4IPA A;  2GZ5 A;  1C24 A; 
#chains in the Genus database with same CATH homology
 1WN1 A;  2BHC A;  1BN5 A;  3L24 A;  3FMR A;  4S2T P;  4FO8 A;  2GG5 A;  2EVM A;  4IKR A;  1R5G A;  4U1B A;  3OVK A;  4Z7M A;  3BIP A;  5CLS A;  4S01 A;  4ZWO A;  2P99 A;  3MR1 A;  2GGC A;  1PV9 A;  2GU4 A;  2BWS A;  1WBQ A;  2V6C A;  2Q96 A;  2BWT A;  3IU7 A;  4U6C A;  3I7M A;  3PKC A;  2MAT A;  1JAW A;  2GTX A;  1O0X A;  1B59 A;  3IU8 A;  4IF7 A;  4IKT A;  4MAT A;  1WL6 A;  5CE6 A;  4EGE A;  1C23 A;  3TB5 A;  4ZWU A;  5CDL A;  4U71 A;  1B6A A;  4U76 A;  3PKB A;  2EA2 A;  2BH3 A;  2GA2 A;  1YVM A;  5FCH A;  2GG3 A;  4FLL A;  1Y1N A;  4IKS A;  2ZSG A;  2GG0 A;  1C27 A;  2Q93 A;  2HOW A;  3BIT A;  1XGN A;  4FKC A;  3BIQ A;  2Q92 A;  3IU9 A;  3PKA A;  3TAV A;  1WKM A;  4U6W A;  3L7G A;  4A6V A;  2GGB A;  2B3K A;  4U75 A;  2DFI A;  1WY2 A;  5CNX A;  1R58 A;  1YW7 A;  4PV4 A;  4U70 A;  4U6E A;  4A6W A;  1N51 A;  3FM3 A;  1W2M A;  1QXY A;  1YW9 A;  4IU6 A;  3OOO A;  3ROR A;  4RZY A;  1WL9 A;  1BOA A;  1KQ9 A;  1QXZ A;  4R60 A;  2EA4 A;  2GG2 A;  4IEC A;  2NQ6 A;  1XGO A;  2BWX A;  3MAT A;  2BWY A;  1CHM A;  2B3H A;  2Q94 A;  3CB6 A;  3QOC A;  4U69 A;  4U73 A;  4IDY A;  3PKD A;  4RGZ 1;  2GG8 A;  1XNZ A;  1WLR A;  3S6B A;  4FLJ A;  5E2C A;  3IL0 A;  3CTZ A;  3O5V A;  1XGS A;  4U6J A;  4FLK A;  4PNC A;  4HXX A;  2IW2 A;  3CB5 A;  1QZY A;  1YJ3 A;  2NQ7 A;  2BWU A;  3RVA A;  2BHB A;  2BHD A;  4B28 A;  4RZZ A;  2BB7 A;  2OAZ A;  2GG7 A;  2BWW A;  4FO7 A;  2B3L A;  4FUK A;  2GU6 A;  2G6P A;  3FMQ A;  4S00 A;  3MX6 A;  1KP0 A;  5CDV A;  1M35 A;  1C22 A;  1C21 A;  1KQ0 A;  1R5H A;  5CDE A;  3IG4 A;  2V3Y A;  2GG9 A;  4ZNG A;  2P9A A;  1MAT A;  5JI6 A;  5FCF A;  3PKE A;  1XGM A;  2Q8K A;  2V3X A;  5D6E A;  2BHA A;  5JFR A;  4IKU A;  1QXW A;  2V3Z A;  5D6F A;  2GU7 A;  4JUQ A;  2ADU A;  4S2R P;  4U6Z A;  5JHU A;  3Q6D A;  5CIK A;  2Q95 A;  4KM3 A;  1YW8 A;  4OOK A;  4QR8 A;  2P98 A;  4FLI A;  1A16 A;  2EVO A;  2GU5 A;  3D27 A;  3PN9 A;  3PEB A;  1W7V A;  2BN7 A;  2EVC A;  2BWV A;  2OKN A;  5E5B A;  4ZWP A;  4IPA A;  2GZ5 A;  1C24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...