4RGZ1

Crystal structure of recombinant prolidase from thermococcus sibiricus at p21221 spacegroup
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
367
Chain Sequence
GSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of recombinant prolidase from Thermococcus sibiricus in space group P21221.
pubmed doi rcsb
source organism Thermococcus sibiricus mm 739
molecule tags Hydrolase
total genus 106
structure length 367
sequence length 367
chains with identical sequence A, N, e
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00557 Peptidase_M24 Metallopeptidase family M24
1 PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4rgz101
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4rgz102
2HOWA 1W7VA 2ZSGA 4A6WA 1YW7A 3Q6DA 2V6CA 2MATA 4U70A 5JFRA 1CHMA 2EVOA 1WY2A 2GG7A 2G6PA 1WBQA 2GG9A 2BH3A 4ZNGA 4FLIA 4FUKA 2BN7A 3OVKA 2GGBA 4U6ZA 4FO8A 1YJ3A 4QR8A 2GGCA 3O5VA 2GA2A 5FCHA 1M35A 4IDYA 2BWTA 4S00A 3PKCA 4RGZ1 2Q96A 4PV4A 2V3XA 4IF7A 1QZYA 4FKCA 4FLKA 5CDLA 1YW8A 3D27A 4IPAA 1Y1NA 3PKBA 2BHDA 1C27A 3IG4A 5D6FA 2GZ5A 1BN5A 1W2MA 2Q94A 1C24A 1QXWA 1R5HA 2V3ZA 4EGEA 3IU8A 3PN9A 3L7GA 2BHBA 3RVAA 4HXXA 3MR1A 4ZWPA 1BOAA 2GU6A 1XNZA 1XGSA 4MATA 1WN1A 4PNCA 3L24A 2GG2A 3TB5A 4R60A 1YW9A 2DFIA 3FMRA 2EA4A 4B28A 2BWVA 3QOCA 1JAWA 4FLJA 1R5GA 1KQ0A 2GU7A 4U1BA 4IKUA 4U73A 2BWYA 4RZYA 2GG3A 3TAVA 2V3YA 5D6EA 4ZWUA 1O0XA 4U76A 1KP0A 3PKEA 4IKTA 5JHUA 5E5BA 2BB7A 4IECA 2GG0A 4OOKA 3BIQA 4U6CA 1C22A 3PKAA 1XGOA 4JUQA 2NQ7A 2Q8KA 1C23A 3CTZA 2OAZA 2BWSA 2BHAA 2P9AA 2Q95A 4U6WA 2BWWA 3CB6A 1MATA 2EVMA 2Q92A 2GU5A 3I7MA 1B59A 1N51A 1QXZA 2EA2A 2NQ6A 2B3HA 2GG5A 5CDEA 4A6VA 1WLRA 4U6EA 2GU4A 3FM3A 5FCFA 1XGNA 2P99A 5CNXA 4ZWOA 1YVMA 5JI6A 4KM3A 1PV9A 1WL9A 1QXYA 1KQ9A 3IU9A 3RORA 2GG8A 5CIKA 1WL6A 4S2RP 2GTXA 2EVCA 3IU7A 2BHCA 4U71A 2P98A 2B3LA 4IKSA 3BITA 5E2CA 1XGMA 3MX6A 3IL0A 4Z7MA 1R58A 2BWUA 2OKNA 1B6AA 4U6JA 3BIPA 1A16A 2B3KA 4U69A 3CB5A 5CE6A 1C21A 4IKRA 4S01A 5CDVA 4U75A 3S6BA 5CLSA 3OOOA 3PEBA 3PKDA 4FO7A 4IU6A 2BWXA 3MATA 4FLLA 2ADUA 1WKMA 4RZZA 2Q93A 3FMQA 4S2TP 2IW2A
chains in the Genus database with same CATH superfamily
2HOWA 1W7VA 2ZSGA 4A6WA 1YW7A 3Q6DA 2V6CA 2MATA 4U70A 5JFRA 1CHMA 2EVOA 1WY2A 2GG7A 2G6PA 1WBQA 2GG9A 2BH3A 4ZNGA 4FLIA 4FUKA 2BN7A 3OVKA 2GGBA 4U6ZA 4FO8A 1YJ3A 4QR8A 2GGCA 3O5VA 2GA2A 5FCHA 1M35A 4IDYA 2BWTA 4S00A 3PKCA 4RGZ1 2Q96A 4PV4A 2V3XA 4IF7A 1QZYA 4FKCA 4FLKA 5CDLA 1YW8A 3D27A 4IPAA 1Y1NA 3PKBA 2BHDA 1C27A 3IG4A 5D6FA 2GZ5A 1BN5A 1W2MA 2Q94A 1C24A 1QXWA 1R5HA 2V3ZA 4EGEA 3IU8A 3PN9A 3L7GA 2BHBA 3RVAA 4HXXA 3MR1A 4ZWPA 1BOAA 2GU6A 1XNZA 1XGSA 4MATA 1WN1A 4PNCA 3L24A 2GG2A 3TB5A 4R60A 1YW9A 2DFIA 3FMRA 2EA4A 4B28A 2BWVA 3QOCA 1JAWA 4FLJA 1R5GA 1KQ0A 2GU7A 4U1BA 4IKUA 4U73A 2BWYA 4RZYA 2GG3A 3TAVA 2V3YA 5D6EA 4ZWUA 1O0XA 4U76A 1KP0A 3PKEA 4IKTA 5JHUA 5E5BA 2BB7A 4IECA 2GG0A 4OOKA 3BIQA 4U6CA 1C22A 3PKAA 1XGOA 4JUQA 2NQ7A 2Q8KA 1C23A 3CTZA 2OAZA 2BWSA 2BHAA 2P9AA 2Q95A 4U6WA 2BWWA 3CB6A 1MATA 2EVMA 2Q92A 2GU5A 3I7MA 1B59A 1N51A 1QXZA 2EA2A 2NQ6A 2B3HA 2GG5A 5CDEA 4A6VA 1WLRA 4U6EA 2GU4A 3FM3A 5FCFA 1XGNA 2P99A 5CNXA 4ZWOA 1YVMA 5JI6A 4KM3A 1PV9A 1WL9A 1QXYA 1KQ9A 3IU9A 3RORA 2GG8A 5CIKA 1WL6A 4S2RP 2GTXA 2EVCA 3IU7A 2BHCA 4U71A 2P98A 2B3LA 4IKSA 3BITA 5E2CA 1XGMA 3MX6A 3IL0A 4Z7MA 1R58A 2BWUA 2OKNA 1B6AA 4U6JA 3BIPA 1A16A 2B3KA 4U69A 3CB5A 5CE6A 1C21A 4IKRA 4S01A 5CDVA 4U75A 3S6BA 5CLSA 3OOOA 3PEBA 3PKDA 4FO7A 4IU6A 2BWXA 3MATA 4FLLA 2ADUA 1WKMA 4RZZA 2Q93A 3FMQA 4S2TP 2IW2A
chains in the Genus database with same CATH topology
2HOWA 1W7VA 2ZSGA 4A6WA 1YW7A 3Q6DA 2V6CA 2MATA 4U70A 5JFRA 1CHMA 2EVOA 1WY2A 2GG7A 2G6PA 1WBQA 2GG9A 2BH3A 4ZNGA 4FLIA 4FUKA 2BN7A 3OVKA 2GGBA 4U6ZA 4FO8A 1YJ3A 4QR8A 2GGCA 3O5VA 2GA2A 5FCHA 1M35A 4IDYA 2BWTA 4S00A 3PKCA 4RGZ1 2Q96A 4PV4A 2V3XA 4IF7A 1QZYA 4FKCA 4FLKA 5CDLA 1YW8A 3D27A 4IPAA 1Y1NA 3PKBA 2BHDA 1C27A 3IG4A 5D6FA 2GZ5A 1BN5A 1W2MA 2Q94A 1C24A 1QXWA 1R5HA 2V3ZA 4EGEA 3IU8A 3PN9A 3L7GA 2BHBA 3RVAA 4HXXA 3MR1A 4ZWPA 1BOAA 2GU6A 1XNZA 1XGSA 4MATA 1WN1A 4PNCA 3L24A 2GG2A 3TB5A 4R60A 1YW9A 2DFIA 3FMRA 2EA4A 4B28A 2BWVA 3QOCA 1JAWA 4FLJA 1R5GA 1KQ0A 2GU7A 4U1BA 4IKUA 4U73A 2BWYA 4RZYA 2GG3A 3TAVA 2V3YA 5D6EA 4ZWUA 1O0XA 4U76A 1KP0A 3PKEA 4IKTA 5JHUA 5E5BA 2BB7A 4IECA 2GG0A 4OOKA 3BIQA 4U6CA 1C22A 3PKAA 1XGOA 4JUQA 2NQ7A 2Q8KA 1C23A 3CTZA 2OAZA 2BWSA 2BHAA 2P9AA 2Q95A 4U6WA 2BWWA 3CB6A 1MATA 2EVMA 2Q92A 2GU5A 3I7MA 1B59A 1N51A 1QXZA 2EA2A 2NQ6A 2B3HA 2GG5A 5CDEA 4A6VA 1WLRA 4U6EA 2GU4A 3FM3A 5FCFA 1XGNA 2P99A 5CNXA 4ZWOA 1YVMA 5JI6A 4KM3A 1PV9A 1WL9A 1QXYA 1KQ9A 3IU9A 3RORA 2GG8A 5CIKA 1WL6A 4S2RP 2GTXA 2EVCA 3IU7A 2BHCA 4U71A 2P98A 2B3LA 4IKSA 3BITA 5E2CA 1XGMA 3MX6A 3IL0A 4Z7MA 1R58A 2BWUA 2OKNA 1B6AA 4U6JA 3BIPA 1A16A 2B3KA 4U69A 3CB5A 5CE6A 1C21A 4IKRA 4S01A 5CDVA 4U75A 3S6BA 5CLSA 3OOOA 3PEBA 3PKDA 4FO7A 4IU6A 2BWXA 3MATA 4FLLA 2ADUA 1WKMA 4RZZA 2Q93A 3FMQA 4S2TP 2IW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOW A;  1W7V A;  2ZSG A;  4A6W A;  1YW7 A;  3Q6D A;  2V6C A;  2MAT A;  4U70 A;  5JFR A;  1CHM A;  2EVO A;  1WY2 A;  2GG7 A;  2G6P A;  1WBQ A;  2GG9 A;  2BH3 A;  4ZNG A;  4FLI A;  4FUK A;  2BN7 A;  3OVK A;  2GGB A;  4U6Z A;  4FO8 A;  1YJ3 A;  4QR8 A;  2GGC A;  3O5V A;  2GA2 A;  5FCH A;  1M35 A;  4IDY A;  2BWT A;  4S00 A;  3PKC A;  4RGZ 1;  2Q96 A;  4PV4 A;  2V3X A;  4IF7 A;  1QZY A;  4FKC A;  4FLK A;  5CDL A;  1YW8 A;  3D27 A;  4IPA A;  1Y1N A;  3PKB A;  2BHD A;  1C27 A;  3IG4 A;  5D6F A;  2GZ5 A;  1BN5 A;  1W2M A;  2Q94 A;  1C24 A;  1QXW A;  1R5H A;  2V3Z A;  4EGE A;  3IU8 A;  3PN9 A;  3L7G A;  2BHB A;  3RVA A;  4HXX A;  3MR1 A;  4ZWP A;  1BOA A;  2GU6 A;  1XNZ A;  1XGS A;  4MAT A;  1WN1 A;  4PNC A;  3L24 A;  2GG2 A;  3TB5 A;  4R60 A;  1YW9 A;  2DFI A;  3FMR A;  2EA4 A;  4B28 A;  2BWV A;  3QOC A;  1JAW A;  4FLJ A;  1R5G A;  1KQ0 A;  2GU7 A;  4U1B A;  4IKU A;  4U73 A;  2BWY A;  4RZY A;  2GG3 A;  3TAV A;  2V3Y A;  5D6E A;  4ZWU A;  1O0X A;  4U76 A;  1KP0 A;  3PKE A;  4IKT A;  5JHU A;  5E5B A;  2BB7 A;  4IEC A;  2GG0 A;  4OOK A;  3BIQ A;  4U6C A;  1C22 A;  3PKA A;  1XGO A;  4JUQ A;  2NQ7 A;  2Q8K A;  1C23 A;  3CTZ A;  2OAZ A;  2BWS A;  2BHA A;  2P9A A;  2Q95 A;  4U6W A;  2BWW A;  3CB6 A;  1MAT A;  2EVM A;  2Q92 A;  2GU5 A;  3I7M A;  1B59 A;  1N51 A;  1QXZ A;  2EA2 A;  2NQ6 A;  2B3H A;  2GG5 A;  5CDE A;  4A6V A;  1WLR A;  4U6E A;  2GU4 A;  3FM3 A;  5FCF A;  1XGN A;  2P99 A;  5CNX A;  4ZWO A;  1YVM A;  5JI6 A;  4KM3 A;  1PV9 A;  1WL9 A;  1QXY A;  1KQ9 A;  3IU9 A;  3ROR A;  2GG8 A;  5CIK A;  1WL6 A;  4S2R P;  2GTX A;  2EVC A;  3IU7 A;  2BHC A;  4U71 A;  2P98 A;  2B3L A;  4IKS A;  3BIT A;  5E2C A;  1XGM A;  3MX6 A;  3IL0 A;  4Z7M A;  1R58 A;  2BWU A;  2OKN A;  1B6A A;  4U6J A;  3BIP A;  1A16 A;  2B3K A;  4U69 A;  3CB5 A;  5CE6 A;  1C21 A;  4IKR A;  4S01 A;  5CDV A;  4U75 A;  3S6B A;  5CLS A;  3OOO A;  3PEB A;  3PKD A;  4FO7 A;  4IU6 A;  2BWX A;  3MAT A;  4FLL A;  2ADU A;  1WKM A;  4RZZ A;  2Q93 A;  3FMQ A;  4S2T P;  2IW2 A; 
#chains in the Genus database with same CATH topology
 2HOW A;  1W7V A;  2ZSG A;  4A6W A;  1YW7 A;  3Q6D A;  2V6C A;  2MAT A;  4U70 A;  5JFR A;  1CHM A;  2EVO A;  1WY2 A;  2GG7 A;  2G6P A;  1WBQ A;  2GG9 A;  2BH3 A;  4ZNG A;  4FLI A;  4FUK A;  2BN7 A;  3OVK A;  2GGB A;  4U6Z A;  4FO8 A;  1YJ3 A;  4QR8 A;  2GGC A;  3O5V A;  2GA2 A;  5FCH A;  1M35 A;  4IDY A;  2BWT A;  4S00 A;  3PKC A;  4RGZ 1;  2Q96 A;  4PV4 A;  2V3X A;  4IF7 A;  1QZY A;  4FKC A;  4FLK A;  5CDL A;  1YW8 A;  3D27 A;  4IPA A;  1Y1N A;  3PKB A;  2BHD A;  1C27 A;  3IG4 A;  5D6F A;  2GZ5 A;  1BN5 A;  1W2M A;  2Q94 A;  1C24 A;  1QXW A;  1R5H A;  2V3Z A;  4EGE A;  3IU8 A;  3PN9 A;  3L7G A;  2BHB A;  3RVA A;  4HXX A;  3MR1 A;  4ZWP A;  1BOA A;  2GU6 A;  1XNZ A;  1XGS A;  4MAT A;  1WN1 A;  4PNC A;  3L24 A;  2GG2 A;  3TB5 A;  4R60 A;  1YW9 A;  2DFI A;  3FMR A;  2EA4 A;  4B28 A;  2BWV A;  3QOC A;  1JAW A;  4FLJ A;  1R5G A;  1KQ0 A;  2GU7 A;  4U1B A;  4IKU A;  4U73 A;  2BWY A;  4RZY A;  2GG3 A;  3TAV A;  2V3Y A;  5D6E A;  4ZWU A;  1O0X A;  4U76 A;  1KP0 A;  3PKE A;  4IKT A;  5JHU A;  5E5B A;  2BB7 A;  4IEC A;  2GG0 A;  4OOK A;  3BIQ A;  4U6C A;  1C22 A;  3PKA A;  1XGO A;  4JUQ A;  2NQ7 A;  2Q8K A;  1C23 A;  3CTZ A;  2OAZ A;  2BWS A;  2BHA A;  2P9A A;  2Q95 A;  4U6W A;  2BWW A;  3CB6 A;  1MAT A;  2EVM A;  2Q92 A;  2GU5 A;  3I7M A;  1B59 A;  1N51 A;  1QXZ A;  2EA2 A;  2NQ6 A;  2B3H A;  2GG5 A;  5CDE A;  4A6V A;  1WLR A;  4U6E A;  2GU4 A;  3FM3 A;  5FCF A;  1XGN A;  2P99 A;  5CNX A;  4ZWO A;  1YVM A;  5JI6 A;  4KM3 A;  1PV9 A;  1WL9 A;  1QXY A;  1KQ9 A;  3IU9 A;  3ROR A;  2GG8 A;  5CIK A;  1WL6 A;  4S2R P;  2GTX A;  2EVC A;  3IU7 A;  2BHC A;  4U71 A;  2P98 A;  2B3L A;  4IKS A;  3BIT A;  5E2C A;  1XGM A;  3MX6 A;  3IL0 A;  4Z7M A;  1R58 A;  2BWU A;  2OKN A;  1B6A A;  4U6J A;  3BIP A;  1A16 A;  2B3K A;  4U69 A;  3CB5 A;  5CE6 A;  1C21 A;  4IKR A;  4S01 A;  5CDV A;  4U75 A;  3S6B A;  5CLS A;  3OOO A;  3PEB A;  3PKD A;  4FO7 A;  4IU6 A;  2BWX A;  3MAT A;  4FLL A;  2ADU A;  1WKM A;  4RZZ A;  2Q93 A;  3FMQ A;  4S2T P;  2IW2 A; 
#chains in the Genus database with same CATH homology
 2HOW A;  1W7V A;  2ZSG A;  4A6W A;  1YW7 A;  3Q6D A;  2V6C A;  2MAT A;  4U70 A;  5JFR A;  1CHM A;  2EVO A;  1WY2 A;  2GG7 A;  2G6P A;  1WBQ A;  2GG9 A;  2BH3 A;  4ZNG A;  4FLI A;  4FUK A;  2BN7 A;  3OVK A;  2GGB A;  4U6Z A;  4FO8 A;  1YJ3 A;  4QR8 A;  2GGC A;  3O5V A;  2GA2 A;  5FCH A;  1M35 A;  4IDY A;  2BWT A;  4S00 A;  3PKC A;  4RGZ 1;  2Q96 A;  4PV4 A;  2V3X A;  4IF7 A;  1QZY A;  4FKC A;  4FLK A;  5CDL A;  1YW8 A;  3D27 A;  4IPA A;  1Y1N A;  3PKB A;  2BHD A;  1C27 A;  3IG4 A;  5D6F A;  2GZ5 A;  1BN5 A;  1W2M A;  2Q94 A;  1C24 A;  1QXW A;  1R5H A;  2V3Z A;  4EGE A;  3IU8 A;  3PN9 A;  3L7G A;  2BHB A;  3RVA A;  4HXX A;  3MR1 A;  4ZWP A;  1BOA A;  2GU6 A;  1XNZ A;  1XGS A;  4MAT A;  1WN1 A;  4PNC A;  3L24 A;  2GG2 A;  3TB5 A;  4R60 A;  1YW9 A;  2DFI A;  3FMR A;  2EA4 A;  4B28 A;  2BWV A;  3QOC A;  1JAW A;  4FLJ A;  1R5G A;  1KQ0 A;  2GU7 A;  4U1B A;  4IKU A;  4U73 A;  2BWY A;  4RZY A;  2GG3 A;  3TAV A;  2V3Y A;  5D6E A;  4ZWU A;  1O0X A;  4U76 A;  1KP0 A;  3PKE A;  4IKT A;  5JHU A;  5E5B A;  2BB7 A;  4IEC A;  2GG0 A;  4OOK A;  3BIQ A;  4U6C A;  1C22 A;  3PKA A;  1XGO A;  4JUQ A;  2NQ7 A;  2Q8K A;  1C23 A;  3CTZ A;  2OAZ A;  2BWS A;  2BHA A;  2P9A A;  2Q95 A;  4U6W A;  2BWW A;  3CB6 A;  1MAT A;  2EVM A;  2Q92 A;  2GU5 A;  3I7M A;  1B59 A;  1N51 A;  1QXZ A;  2EA2 A;  2NQ6 A;  2B3H A;  2GG5 A;  5CDE A;  4A6V A;  1WLR A;  4U6E A;  2GU4 A;  3FM3 A;  5FCF A;  1XGN A;  2P99 A;  5CNX A;  4ZWO A;  1YVM A;  5JI6 A;  4KM3 A;  1PV9 A;  1WL9 A;  1QXY A;  1KQ9 A;  3IU9 A;  3ROR A;  2GG8 A;  5CIK A;  1WL6 A;  4S2R P;  2GTX A;  2EVC A;  3IU7 A;  2BHC A;  4U71 A;  2P98 A;  2B3L A;  4IKS A;  3BIT A;  5E2C A;  1XGM A;  3MX6 A;  3IL0 A;  4Z7M A;  1R58 A;  2BWU A;  2OKN A;  1B6A A;  4U6J A;  3BIP A;  1A16 A;  2B3K A;  4U69 A;  3CB5 A;  5CE6 A;  1C21 A;  4IKR A;  4S01 A;  5CDV A;  4U75 A;  3S6B A;  5CLS A;  3OOO A;  3PEB A;  3PKD A;  4FO7 A;  4IU6 A;  2BWX A;  3MAT A;  4FLL A;  2ADU A;  1WKM A;  4RZZ A;  2Q93 A;  3FMQ A;  4S2T P;  2IW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...