4RGZ1

Crystal structure of recombinant prolidase from thermococcus sibiricus at p21221 spacegroup
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
367
Chain Sequence
GSMDYKRRIHKFQAHFGKKGFEGALVAPGSNFYYLTGFNPLGTLERLFVLILPSEGLLTAIAPRLYEKELEEFNGEVVLWSDSENPYKIFATKIKETFKEGEKLLIDDTMPVGVFLKAKDIFDKYSLHPISPVISELREIKDKDEIKAHKKAAEIVDKVFYRFIEGKLEGKSERELANRIEYMIKNEFGADDVSFEPIVASGPNGANPHHRPSHRKIRKGDVVIFDYGAKYLGYCSDVTRTVVVGPPSEEVKKVYEIVKEAQETAVQKVAEGIPAEVVDATARGIISKYGYGEYFIHRTGHGLGIDVHEEPYISPGNKKILKDGMVFTIEPGIYLQGKFGVRIEDDVALVDKKGIRLTNADRELITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structure of recombinant prolidase from Thermococcus sibiricus in space group P21221.
pubmed doi rcsb
source organism Thermococcus sibiricus mm 739
molecule tags Hydrolase
total genus 106
structure length 367
sequence length 367
chains with identical sequence A, N, e
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00557 Peptidase_M24 Metallopeptidase family M24
1 PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4rgz101
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4rgz102
3BIQA 4JUQA 4FO7A 1WL9A 4IDYA 3D27A 1KP0A 2V3ZA 5E2CA 4FKCA 4U6ZA 2BHCA 4S01A 1XGMA 4KM3A 5D6FA 2ZSGA 3PKCA 1KQ0A 1C24A 4S2TP 1BOAA 2BHAA 5E5BA 2B3KA 2BH3A 1W2MA 4U1BA 2GU6A 4U6WA 2GG8A 3TAVA 4IKSA 4U71A 1O0XA 2B3LA 2G6PA 2V3YA 3BITA 3PN9A 4A6VA 2BWVA 3RORA 3CB6A 4RGZ1 3L24A 4ZWUA 3FMQA 1M35A 5JFRA 3PEBA 4S2RP 4RZZA 2GG7A 1KQ9A 1A16A 1JAWA 5D6EA 4B28A 5JHUA 2GU5A 4IU6A 2OKNA 3FM3A 3PKEA 3CB5A 1YW8A 3OOOA 4FLKA 4IECA 3CTZA 1QXWA 2GU7A 1QXZA 2MATA 3O5VA 5CDVA 1N51A 1C23A 2GZ5A 1XGNA 2EVCA 2BWUA 4PV4A 2GGBA 1WKMA 2BWYA 4ZWOA 2B3HA 2DFIA 2Q96A 3IU8A 1YW9A 1XGSA 4U70A 2GTXA 2EA2A 3TB5A 4A6WA 5CDLA 2BHBA 4ZNGA 4FUKA 4RZYA 3RVAA 2Q92A 3FMRA 4R60A 2EVMA 1WBQA 2GU4A 2V3XA 3MX6A 2V6CA 1W7VA 4U75A 4OOKA 3MATA 4Z7MA 2Q93A 4PNCA 2NQ7A 4FO8A 5CIKA 1QXYA 3IL0A 3PKDA 2EA4A 2Q8KA 3PKBA 1BN5A 2P9AA 4IKRA 2IW2A 3I7MA 2Q94A 3PKAA 1CHMA 5CLSA 4U69A 2GG3A 3Q6DA 1R5HA 1YJ3A 5CNXA 2ADUA 3QOCA 5CE6A 1C22A 1WL6A 4U76A 2BWSA 2Q95A 2BHDA 2GGCA 4EGEA 2HOWA 5FCHA 4QR8A 2P99A 1R5GA 3L7GA 1PV9A 1QZYA 1R58A 2OAZA 2BWXA 3S6BA 1WLRA 4FLLA 4HXXA 1B59A 4U6EA 1WY2A 1WN1A 1XNZA 2P98A 4U6JA 2BN7A 3IU7A 4FLIA 2EVOA 5FCFA 2BWWA 2BWTA 1C27A 4U6CA 3BIPA 2NQ6A 4MATA 4IKTA 5CDEA 4ZWPA 3OVKA 1B6AA 5JI6A 1MATA 3MR1A 4IKUA 2GA2A 4IF7A 2GG0A 1XGOA 1C21A 2GG9A 3IG4A 2BB7A 4S00A 4IPAA 1YW7A 4U73A 2GG2A 2GG5A 1Y1NA 3IU9A 1YVMA 4FLJA
chains in the Genus database with same CATH superfamily
3BIQA 4JUQA 4FO7A 1WL9A 4IDYA 3D27A 1KP0A 2V3ZA 5E2CA 4FKCA 4U6ZA 2BHCA 4S01A 1XGMA 4KM3A 5D6FA 2ZSGA 3PKCA 1KQ0A 1C24A 4S2TP 1BOAA 2BHAA 5E5BA 2B3KA 2BH3A 1W2MA 4U1BA 2GU6A 4U6WA 2GG8A 3TAVA 4IKSA 4U71A 1O0XA 2B3LA 2G6PA 2V3YA 3BITA 3PN9A 4A6VA 2BWVA 3RORA 3CB6A 4RGZ1 3L24A 4ZWUA 3FMQA 1M35A 5JFRA 3PEBA 4S2RP 4RZZA 2GG7A 1KQ9A 1A16A 1JAWA 5D6EA 4B28A 5JHUA 2GU5A 4IU6A 2OKNA 3FM3A 3PKEA 3CB5A 1YW8A 3OOOA 4FLKA 4IECA 3CTZA 1QXWA 2GU7A 1QXZA 2MATA 3O5VA 5CDVA 1N51A 1C23A 2GZ5A 1XGNA 2EVCA 2BWUA 4PV4A 2GGBA 1WKMA 2BWYA 4ZWOA 2B3HA 2DFIA 2Q96A 3IU8A 1YW9A 1XGSA 4U70A 2GTXA 2EA2A 3TB5A 4A6WA 5CDLA 2BHBA 4ZNGA 4FUKA 4RZYA 3RVAA 2Q92A 3FMRA 4R60A 2EVMA 1WBQA 2GU4A 2V3XA 3MX6A 2V6CA 1W7VA 4U75A 4OOKA 3MATA 4Z7MA 2Q93A 4PNCA 2NQ7A 4FO8A 5CIKA 1QXYA 3IL0A 3PKDA 2EA4A 2Q8KA 3PKBA 1BN5A 2P9AA 4IKRA 2IW2A 3I7MA 2Q94A 3PKAA 1CHMA 5CLSA 4U69A 2GG3A 3Q6DA 1R5HA 1YJ3A 5CNXA 2ADUA 3QOCA 5CE6A 1C22A 1WL6A 4U76A 2BWSA 2Q95A 2BHDA 2GGCA 4EGEA 2HOWA 5FCHA 4QR8A 2P99A 1R5GA 3L7GA 1PV9A 1QZYA 1R58A 2OAZA 2BWXA 3S6BA 1WLRA 4FLLA 4HXXA 1B59A 4U6EA 1WY2A 1WN1A 1XNZA 2P98A 4U6JA 2BN7A 3IU7A 4FLIA 2EVOA 5FCFA 2BWWA 2BWTA 1C27A 4U6CA 3BIPA 2NQ6A 4MATA 4IKTA 5CDEA 4ZWPA 3OVKA 1B6AA 5JI6A 1MATA 3MR1A 4IKUA 2GA2A 4IF7A 2GG0A 1XGOA 1C21A 2GG9A 3IG4A 2BB7A 4S00A 4IPAA 1YW7A 4U73A 2GG2A 2GG5A 1Y1NA 3IU9A 1YVMA 4FLJA
chains in the Genus database with same CATH topology
3BIQA 4JUQA 4FO7A 1WL9A 4IDYA 3D27A 1KP0A 2V3ZA 5E2CA 4FKCA 4U6ZA 2BHCA 4S01A 1XGMA 4KM3A 5D6FA 2ZSGA 3PKCA 1KQ0A 1C24A 4S2TP 1BOAA 2BHAA 5E5BA 2B3KA 2BH3A 1W2MA 4U1BA 2GU6A 4U6WA 2GG8A 3TAVA 4IKSA 4U71A 1O0XA 2B3LA 2G6PA 2V3YA 3BITA 3PN9A 4A6VA 2BWVA 3RORA 3CB6A 4RGZ1 3L24A 4ZWUA 3FMQA 1M35A 5JFRA 3PEBA 4S2RP 4RZZA 2GG7A 1KQ9A 1A16A 1JAWA 5D6EA 4B28A 5JHUA 2GU5A 4IU6A 2OKNA 3FM3A 3PKEA 3CB5A 1YW8A 3OOOA 4FLKA 4IECA 3CTZA 1QXWA 2GU7A 1QXZA 2MATA 3O5VA 5CDVA 1N51A 1C23A 2GZ5A 1XGNA 2EVCA 2BWUA 4PV4A 2GGBA 1WKMA 2BWYA 4ZWOA 2B3HA 2DFIA 2Q96A 3IU8A 1YW9A 1XGSA 4U70A 2GTXA 2EA2A 3TB5A 4A6WA 5CDLA 2BHBA 4ZNGA 4FUKA 4RZYA 3RVAA 2Q92A 3FMRA 4R60A 2EVMA 1WBQA 2GU4A 2V3XA 3MX6A 2V6CA 1W7VA 4U75A 4OOKA 3MATA 4Z7MA 2Q93A 4PNCA 2NQ7A 4FO8A 5CIKA 1QXYA 3IL0A 3PKDA 2EA4A 2Q8KA 3PKBA 1BN5A 2P9AA 4IKRA 2IW2A 3I7MA 2Q94A 3PKAA 1CHMA 5CLSA 4U69A 2GG3A 3Q6DA 1R5HA 1YJ3A 5CNXA 2ADUA 3QOCA 5CE6A 1C22A 1WL6A 4U76A 2BWSA 2Q95A 2BHDA 2GGCA 4EGEA 2HOWA 5FCHA 4QR8A 2P99A 1R5GA 3L7GA 1PV9A 1QZYA 1R58A 2OAZA 2BWXA 3S6BA 1WLRA 4FLLA 4HXXA 1B59A 4U6EA 1WY2A 1WN1A 1XNZA 2P98A 4U6JA 2BN7A 3IU7A 4FLIA 2EVOA 5FCFA 2BWWA 2BWTA 1C27A 4U6CA 3BIPA 2NQ6A 4MATA 4IKTA 5CDEA 4ZWPA 3OVKA 1B6AA 5JI6A 1MATA 3MR1A 4IKUA 2GA2A 4IF7A 2GG0A 1XGOA 1C21A 2GG9A 3IG4A 2BB7A 4S00A 4IPAA 1YW7A 4U73A 2GG2A 2GG5A 1Y1NA 3IU9A 1YVMA 4FLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BIQ A;  4JUQ A;  4FO7 A;  1WL9 A;  4IDY A;  3D27 A;  1KP0 A;  2V3Z A;  5E2C A;  4FKC A;  4U6Z A;  2BHC A;  4S01 A;  1XGM A;  4KM3 A;  5D6F A;  2ZSG A;  3PKC A;  1KQ0 A;  1C24 A;  4S2T P;  1BOA A;  2BHA A;  5E5B A;  2B3K A;  2BH3 A;  1W2M A;  4U1B A;  2GU6 A;  4U6W A;  2GG8 A;  3TAV A;  4IKS A;  4U71 A;  1O0X A;  2B3L A;  2G6P A;  2V3Y A;  3BIT A;  3PN9 A;  4A6V A;  2BWV A;  3ROR A;  3CB6 A;  4RGZ 1;  3L24 A;  4ZWU A;  3FMQ A;  1M35 A;  5JFR A;  3PEB A;  4S2R P;  4RZZ A;  2GG7 A;  1KQ9 A;  1A16 A;  1JAW A;  5D6E A;  4B28 A;  5JHU A;  2GU5 A;  4IU6 A;  2OKN A;  3FM3 A;  3PKE A;  3CB5 A;  1YW8 A;  3OOO A;  4FLK A;  4IEC A;  3CTZ A;  1QXW A;  2GU7 A;  1QXZ A;  2MAT A;  3O5V A;  5CDV A;  1N51 A;  1C23 A;  2GZ5 A;  1XGN A;  2EVC A;  2BWU A;  4PV4 A;  2GGB A;  1WKM A;  2BWY A;  4ZWO A;  2B3H A;  2DFI A;  2Q96 A;  3IU8 A;  1YW9 A;  1XGS A;  4U70 A;  2GTX A;  2EA2 A;  3TB5 A;  4A6W A;  5CDL A;  2BHB A;  4ZNG A;  4FUK A;  4RZY A;  3RVA A;  2Q92 A;  3FMR A;  4R60 A;  2EVM A;  1WBQ A;  2GU4 A;  2V3X A;  3MX6 A;  2V6C A;  1W7V A;  4U75 A;  4OOK A;  3MAT A;  4Z7M A;  2Q93 A;  4PNC A;  2NQ7 A;  4FO8 A;  5CIK A;  1QXY A;  3IL0 A;  3PKD A;  2EA4 A;  2Q8K A;  3PKB A;  1BN5 A;  2P9A A;  4IKR A;  2IW2 A;  3I7M A;  2Q94 A;  3PKA A;  1CHM A;  5CLS A;  4U69 A;  2GG3 A;  3Q6D A;  1R5H A;  1YJ3 A;  5CNX A;  2ADU A;  3QOC A;  5CE6 A;  1C22 A;  1WL6 A;  4U76 A;  2BWS A;  2Q95 A;  2BHD A;  2GGC A;  4EGE A;  2HOW A;  5FCH A;  4QR8 A;  2P99 A;  1R5G A;  3L7G A;  1PV9 A;  1QZY A;  1R58 A;  2OAZ A;  2BWX A;  3S6B A;  1WLR A;  4FLL A;  4HXX A;  1B59 A;  4U6E A;  1WY2 A;  1WN1 A;  1XNZ A;  2P98 A;  4U6J A;  2BN7 A;  3IU7 A;  4FLI A;  2EVO A;  5FCF A;  2BWW A;  2BWT A;  1C27 A;  4U6C A;  3BIP A;  2NQ6 A;  4MAT A;  4IKT A;  5CDE A;  4ZWP A;  3OVK A;  1B6A A;  5JI6 A;  1MAT A;  3MR1 A;  4IKU A;  2GA2 A;  4IF7 A;  2GG0 A;  1XGO A;  1C21 A;  2GG9 A;  3IG4 A;  2BB7 A;  4S00 A;  4IPA A;  1YW7 A;  4U73 A;  2GG2 A;  2GG5 A;  1Y1N A;  3IU9 A;  1YVM A;  4FLJ A; 
#chains in the Genus database with same CATH topology
 3BIQ A;  4JUQ A;  4FO7 A;  1WL9 A;  4IDY A;  3D27 A;  1KP0 A;  2V3Z A;  5E2C A;  4FKC A;  4U6Z A;  2BHC A;  4S01 A;  1XGM A;  4KM3 A;  5D6F A;  2ZSG A;  3PKC A;  1KQ0 A;  1C24 A;  4S2T P;  1BOA A;  2BHA A;  5E5B A;  2B3K A;  2BH3 A;  1W2M A;  4U1B A;  2GU6 A;  4U6W A;  2GG8 A;  3TAV A;  4IKS A;  4U71 A;  1O0X A;  2B3L A;  2G6P A;  2V3Y A;  3BIT A;  3PN9 A;  4A6V A;  2BWV A;  3ROR A;  3CB6 A;  4RGZ 1;  3L24 A;  4ZWU A;  3FMQ A;  1M35 A;  5JFR A;  3PEB A;  4S2R P;  4RZZ A;  2GG7 A;  1KQ9 A;  1A16 A;  1JAW A;  5D6E A;  4B28 A;  5JHU A;  2GU5 A;  4IU6 A;  2OKN A;  3FM3 A;  3PKE A;  3CB5 A;  1YW8 A;  3OOO A;  4FLK A;  4IEC A;  3CTZ A;  1QXW A;  2GU7 A;  1QXZ A;  2MAT A;  3O5V A;  5CDV A;  1N51 A;  1C23 A;  2GZ5 A;  1XGN A;  2EVC A;  2BWU A;  4PV4 A;  2GGB A;  1WKM A;  2BWY A;  4ZWO A;  2B3H A;  2DFI A;  2Q96 A;  3IU8 A;  1YW9 A;  1XGS A;  4U70 A;  2GTX A;  2EA2 A;  3TB5 A;  4A6W A;  5CDL A;  2BHB A;  4ZNG A;  4FUK A;  4RZY A;  3RVA A;  2Q92 A;  3FMR A;  4R60 A;  2EVM A;  1WBQ A;  2GU4 A;  2V3X A;  3MX6 A;  2V6C A;  1W7V A;  4U75 A;  4OOK A;  3MAT A;  4Z7M A;  2Q93 A;  4PNC A;  2NQ7 A;  4FO8 A;  5CIK A;  1QXY A;  3IL0 A;  3PKD A;  2EA4 A;  2Q8K A;  3PKB A;  1BN5 A;  2P9A A;  4IKR A;  2IW2 A;  3I7M A;  2Q94 A;  3PKA A;  1CHM A;  5CLS A;  4U69 A;  2GG3 A;  3Q6D A;  1R5H A;  1YJ3 A;  5CNX A;  2ADU A;  3QOC A;  5CE6 A;  1C22 A;  1WL6 A;  4U76 A;  2BWS A;  2Q95 A;  2BHD A;  2GGC A;  4EGE A;  2HOW A;  5FCH A;  4QR8 A;  2P99 A;  1R5G A;  3L7G A;  1PV9 A;  1QZY A;  1R58 A;  2OAZ A;  2BWX A;  3S6B A;  1WLR A;  4FLL A;  4HXX A;  1B59 A;  4U6E A;  1WY2 A;  1WN1 A;  1XNZ A;  2P98 A;  4U6J A;  2BN7 A;  3IU7 A;  4FLI A;  2EVO A;  5FCF A;  2BWW A;  2BWT A;  1C27 A;  4U6C A;  3BIP A;  2NQ6 A;  4MAT A;  4IKT A;  5CDE A;  4ZWP A;  3OVK A;  1B6A A;  5JI6 A;  1MAT A;  3MR1 A;  4IKU A;  2GA2 A;  4IF7 A;  2GG0 A;  1XGO A;  1C21 A;  2GG9 A;  3IG4 A;  2BB7 A;  4S00 A;  4IPA A;  1YW7 A;  4U73 A;  2GG2 A;  2GG5 A;  1Y1N A;  3IU9 A;  1YVM A;  4FLJ A; 
#chains in the Genus database with same CATH homology
 3BIQ A;  4JUQ A;  4FO7 A;  1WL9 A;  4IDY A;  3D27 A;  1KP0 A;  2V3Z A;  5E2C A;  4FKC A;  4U6Z A;  2BHC A;  4S01 A;  1XGM A;  4KM3 A;  5D6F A;  2ZSG A;  3PKC A;  1KQ0 A;  1C24 A;  4S2T P;  1BOA A;  2BHA A;  5E5B A;  2B3K A;  2BH3 A;  1W2M A;  4U1B A;  2GU6 A;  4U6W A;  2GG8 A;  3TAV A;  4IKS A;  4U71 A;  1O0X A;  2B3L A;  2G6P A;  2V3Y A;  3BIT A;  3PN9 A;  4A6V A;  2BWV A;  3ROR A;  3CB6 A;  4RGZ 1;  3L24 A;  4ZWU A;  3FMQ A;  1M35 A;  5JFR A;  3PEB A;  4S2R P;  4RZZ A;  2GG7 A;  1KQ9 A;  1A16 A;  1JAW A;  5D6E A;  4B28 A;  5JHU A;  2GU5 A;  4IU6 A;  2OKN A;  3FM3 A;  3PKE A;  3CB5 A;  1YW8 A;  3OOO A;  4FLK A;  4IEC A;  3CTZ A;  1QXW A;  2GU7 A;  1QXZ A;  2MAT A;  3O5V A;  5CDV A;  1N51 A;  1C23 A;  2GZ5 A;  1XGN A;  2EVC A;  2BWU A;  4PV4 A;  2GGB A;  1WKM A;  2BWY A;  4ZWO A;  2B3H A;  2DFI A;  2Q96 A;  3IU8 A;  1YW9 A;  1XGS A;  4U70 A;  2GTX A;  2EA2 A;  3TB5 A;  4A6W A;  5CDL A;  2BHB A;  4ZNG A;  4FUK A;  4RZY A;  3RVA A;  2Q92 A;  3FMR A;  4R60 A;  2EVM A;  1WBQ A;  2GU4 A;  2V3X A;  3MX6 A;  2V6C A;  1W7V A;  4U75 A;  4OOK A;  3MAT A;  4Z7M A;  2Q93 A;  4PNC A;  2NQ7 A;  4FO8 A;  5CIK A;  1QXY A;  3IL0 A;  3PKD A;  2EA4 A;  2Q8K A;  3PKB A;  1BN5 A;  2P9A A;  4IKR A;  2IW2 A;  3I7M A;  2Q94 A;  3PKA A;  1CHM A;  5CLS A;  4U69 A;  2GG3 A;  3Q6D A;  1R5H A;  1YJ3 A;  5CNX A;  2ADU A;  3QOC A;  5CE6 A;  1C22 A;  1WL6 A;  4U76 A;  2BWS A;  2Q95 A;  2BHD A;  2GGC A;  4EGE A;  2HOW A;  5FCH A;  4QR8 A;  2P99 A;  1R5G A;  3L7G A;  1PV9 A;  1QZY A;  1R58 A;  2OAZ A;  2BWX A;  3S6B A;  1WLR A;  4FLL A;  4HXX A;  1B59 A;  4U6E A;  1WY2 A;  1WN1 A;  1XNZ A;  2P98 A;  4U6J A;  2BN7 A;  3IU7 A;  4FLI A;  2EVO A;  5FCF A;  2BWW A;  2BWT A;  1C27 A;  4U6C A;  3BIP A;  2NQ6 A;  4MAT A;  4IKT A;  5CDE A;  4ZWP A;  3OVK A;  1B6A A;  5JI6 A;  1MAT A;  3MR1 A;  4IKU A;  2GA2 A;  4IF7 A;  2GG0 A;  1XGO A;  1C21 A;  2GG9 A;  3IG4 A;  2BB7 A;  4S00 A;  4IPA A;  1YW7 A;  4U73 A;  2GG2 A;  2GG5 A;  1Y1N A;  3IU9 A;  1YVM A;  4FLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...