2V3YA

His361ala escherichia coli aminopeptidase p in complex with product
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 158
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3yA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3yA02
2P98A 2BWTA 2V3YA 1WY2A 4FLKA 4EGEA 4U6WA 3FMRA 5E2CA 1KQ9A 1YW8A 2GZ5A 1WBQA 4S00A 4IKUA 2Q96A 1R5HA 4FLLA 1KP0A 2OKNA 5CDLA 2GU7A 4IKSA 1XGSA 2ADUA 2Q94A 1YW9A 3IU8A 3PN9A 2B3KA 4OOKA 4U6CA 3CTZA 4U70A 4HXXA 1N51A 3OOOA 2EVMA 1C22A 3IG4A 2P9AA 4U73A 1B6AA 2NQ7A 3BIPA 2GU6A 5JHUA 1WL9A 2BWVA 2EVCA 4IECA 1MATA 4FUKA 1BOAA 3D27A 2BWXA 4QR8A 4U6EA 2BWYA 2GGBA 3IU7A 1PV9A 4FO8A 2BHDA 4IPAA 4FLIA 1C23A 2BHCA 2GU4A 2GG8A 1XGNA 2GG0A 3L7GA 2Q93A 1R5GA 4ZNGA 3CB5A 4U71A 1WKMA 3QOCA 4R60A 1QZYA 3CB6A 2BHAA 2EVOA 2BWWA 5JI6A 3FMQA 5FCHA 2GTXA 2Q8KA 2MATA 3MX6A 4U6ZA 4S2RP 2V3XA 3PKAA 3FM3A 4S01A 4B28A 2GGCA 1Y1NA 4FLJA 2BWSA 2G6PA 4ZWOA 1C27A 1YW7A 5CLSA 1JAWA 1WLRA 1QXZA 2B3HA 4IKTA 3RORA 3PKCA 4PNCA 2GU5A 2GG3A 4IF7A 4U1BA 2GA2A 4MATA 1C21A 5CIKA 2DFIA 4JUQA 2B3LA 2BH3A 1XNZA 4S2TP 4A6WA 3PEBA 2OAZA 2GG2A 3MATA 4RGZ1 2Q95A 2GG7A 2BN7A 1CHMA 2BHBA 3IU9A 5CDVA 4ZWPA 1W2MA 2GG5A 4U76A 5FCFA 2EA2A 1M35A 3IL0A 1XGOA 3TAVA 1C24A 3O5VA 1QXWA 4IU6A 2BB7A 5CE6A 2NQ6A 4A6VA 5D6FA 1WL6A 2Q92A 4Z7MA 5E5BA 1A16A 3RVAA 1BN5A 4KM3A 1KQ0A 3L24A 1O0XA 1YVMA 2P99A 3PKEA 4FO7A 4U69A 4U75A 5D6EA 2IW2A 1W7VA 2ZSGA 3OVKA 4RZZA 1YJ3A 2GG9A 5JFRA 1QXYA 4IKRA 3S6BA 3I7MA 2BWUA 2HOWA 1B59A 1XGMA 4U6JA 4IDYA 2EA4A 3PKDA 4PV4A 3Q6DA 3BITA 5CDEA 3TB5A 1WN1A 3BIQA 2V6CA 3PKBA 4FKCA 5CNXA 4RZYA 4ZWUA 3MR1A 1R58A 2V3ZA
chains in the Genus database with same CATH superfamily
2P98A 2BWTA 2V3YA 1WY2A 4FLKA 4EGEA 4U6WA 3FMRA 5E2CA 1KQ9A 1YW8A 2GZ5A 1WBQA 4S00A 4IKUA 2Q96A 1R5HA 4FLLA 1KP0A 2OKNA 5CDLA 2GU7A 4IKSA 1XGSA 2ADUA 2Q94A 1YW9A 3IU8A 3PN9A 2B3KA 4OOKA 4U6CA 3CTZA 4U70A 4HXXA 1N51A 3OOOA 2EVMA 1C22A 3IG4A 2P9AA 4U73A 1B6AA 2NQ7A 3BIPA 2GU6A 5JHUA 1WL9A 2BWVA 2EVCA 4IECA 1MATA 4FUKA 1BOAA 3D27A 2BWXA 4QR8A 4U6EA 2BWYA 2GGBA 3IU7A 1PV9A 4FO8A 2BHDA 4IPAA 4FLIA 1C23A 2BHCA 2GU4A 2GG8A 1XGNA 2GG0A 3L7GA 2Q93A 1R5GA 4ZNGA 3CB5A 4U71A 1WKMA 3QOCA 4R60A 1QZYA 3CB6A 2BHAA 2EVOA 2BWWA 5JI6A 3FMQA 5FCHA 2GTXA 2Q8KA 2MATA 3MX6A 4U6ZA 4S2RP 2V3XA 3PKAA 3FM3A 4S01A 4B28A 2GGCA 1Y1NA 4FLJA 2BWSA 2G6PA 4ZWOA 1C27A 1YW7A 5CLSA 1JAWA 1WLRA 1QXZA 2B3HA 4IKTA 3RORA 3PKCA 4PNCA 2GU5A 2GG3A 4IF7A 4U1BA 2GA2A 4MATA 1C21A 5CIKA 2DFIA 4JUQA 2B3LA 2BH3A 1XNZA 4S2TP 4A6WA 3PEBA 2OAZA 2GG2A 3MATA 4RGZ1 2Q95A 2GG7A 2BN7A 1CHMA 2BHBA 3IU9A 5CDVA 4ZWPA 1W2MA 2GG5A 4U76A 5FCFA 2EA2A 1M35A 3IL0A 1XGOA 3TAVA 1C24A 3O5VA 1QXWA 4IU6A 2BB7A 5CE6A 2NQ6A 4A6VA 5D6FA 1WL6A 2Q92A 4Z7MA 5E5BA 1A16A 3RVAA 1BN5A 4KM3A 1KQ0A 3L24A 1O0XA 1YVMA 2P99A 3PKEA 4FO7A 4U69A 4U75A 5D6EA 2IW2A 1W7VA 2ZSGA 3OVKA 4RZZA 1YJ3A 2GG9A 5JFRA 1QXYA 4IKRA 3S6BA 3I7MA 2BWUA 2HOWA 1B59A 1XGMA 4U6JA 4IDYA 2EA4A 3PKDA 4PV4A 3Q6DA 3BITA 5CDEA 3TB5A 1WN1A 3BIQA 2V6CA 3PKBA 4FKCA 5CNXA 4RZYA 4ZWUA 3MR1A 1R58A 2V3ZA
chains in the Genus database with same CATH topology
2P98A 2BWTA 2V3YA 1WY2A 4FLKA 4EGEA 4U6WA 3FMRA 5E2CA 1KQ9A 1YW8A 2GZ5A 1WBQA 4S00A 4IKUA 2Q96A 1R5HA 4FLLA 1KP0A 2OKNA 5CDLA 2GU7A 4IKSA 1XGSA 2ADUA 2Q94A 1YW9A 3IU8A 3PN9A 2B3KA 4OOKA 4U6CA 3CTZA 4U70A 4HXXA 1N51A 3OOOA 2EVMA 1C22A 3IG4A 2P9AA 4U73A 1B6AA 2NQ7A 3BIPA 2GU6A 5JHUA 1WL9A 2BWVA 2EVCA 4IECA 1MATA 4FUKA 1BOAA 3D27A 2BWXA 4QR8A 4U6EA 2BWYA 2GGBA 3IU7A 1PV9A 4FO8A 2BHDA 4IPAA 4FLIA 1C23A 2BHCA 2GU4A 2GG8A 1XGNA 2GG0A 3L7GA 2Q93A 1R5GA 4ZNGA 3CB5A 4U71A 1WKMA 3QOCA 4R60A 1QZYA 3CB6A 2BHAA 2EVOA 2BWWA 5JI6A 3FMQA 5FCHA 2GTXA 2Q8KA 2MATA 3MX6A 4U6ZA 4S2RP 2V3XA 3PKAA 3FM3A 4S01A 4B28A 2GGCA 1Y1NA 4FLJA 2BWSA 2G6PA 4ZWOA 1C27A 1YW7A 5CLSA 1JAWA 1WLRA 1QXZA 2B3HA 4IKTA 3RORA 3PKCA 4PNCA 2GU5A 2GG3A 4IF7A 4U1BA 2GA2A 4MATA 1C21A 5CIKA 2DFIA 4JUQA 2B3LA 2BH3A 1XNZA 4S2TP 4A6WA 3PEBA 2OAZA 2GG2A 3MATA 4RGZ1 2Q95A 2GG7A 2BN7A 1CHMA 2BHBA 3IU9A 5CDVA 4ZWPA 1W2MA 2GG5A 4U76A 5FCFA 2EA2A 1M35A 3IL0A 1XGOA 3TAVA 1C24A 3O5VA 1QXWA 4IU6A 2BB7A 5CE6A 2NQ6A 4A6VA 5D6FA 1WL6A 2Q92A 4Z7MA 5E5BA 1A16A 3RVAA 1BN5A 4KM3A 1KQ0A 3L24A 1O0XA 1YVMA 2P99A 3PKEA 4FO7A 4U69A 4U75A 5D6EA 2IW2A 1W7VA 2ZSGA 3OVKA 4RZZA 1YJ3A 2GG9A 5JFRA 1QXYA 4IKRA 3S6BA 3I7MA 2BWUA 2HOWA 1B59A 1XGMA 4U6JA 4IDYA 2EA4A 3PKDA 4PV4A 3Q6DA 3BITA 5CDEA 3TB5A 1WN1A 3BIQA 2V6CA 3PKBA 4FKCA 5CNXA 4RZYA 4ZWUA 3MR1A 1R58A 2V3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P98 A;  2BWT A;  2V3Y A;  1WY2 A;  4FLK A;  4EGE A;  4U6W A;  3FMR A;  5E2C A;  1KQ9 A;  1YW8 A;  2GZ5 A;  1WBQ A;  4S00 A;  4IKU A;  2Q96 A;  1R5H A;  4FLL A;  1KP0 A;  2OKN A;  5CDL A;  2GU7 A;  4IKS A;  1XGS A;  2ADU A;  2Q94 A;  1YW9 A;  3IU8 A;  3PN9 A;  2B3K A;  4OOK A;  4U6C A;  3CTZ A;  4U70 A;  4HXX A;  1N51 A;  3OOO A;  2EVM A;  1C22 A;  3IG4 A;  2P9A A;  4U73 A;  1B6A A;  2NQ7 A;  3BIP A;  2GU6 A;  5JHU A;  1WL9 A;  2BWV A;  2EVC A;  4IEC A;  1MAT A;  4FUK A;  1BOA A;  3D27 A;  2BWX A;  4QR8 A;  4U6E A;  2BWY A;  2GGB A;  3IU7 A;  1PV9 A;  4FO8 A;  2BHD A;  4IPA A;  4FLI A;  1C23 A;  2BHC A;  2GU4 A;  2GG8 A;  1XGN A;  2GG0 A;  3L7G A;  2Q93 A;  1R5G A;  4ZNG A;  3CB5 A;  4U71 A;  1WKM A;  3QOC A;  4R60 A;  1QZY A;  3CB6 A;  2BHA A;  2EVO A;  2BWW A;  5JI6 A;  3FMQ A;  5FCH A;  2GTX A;  2Q8K A;  2MAT A;  3MX6 A;  4U6Z A;  4S2R P;  2V3X A;  3PKA A;  3FM3 A;  4S01 A;  4B28 A;  2GGC A;  1Y1N A;  4FLJ A;  2BWS A;  2G6P A;  4ZWO A;  1C27 A;  1YW7 A;  5CLS A;  1JAW A;  1WLR A;  1QXZ A;  2B3H A;  4IKT A;  3ROR A;  3PKC A;  4PNC A;  2GU5 A;  2GG3 A;  4IF7 A;  4U1B A;  2GA2 A;  4MAT A;  1C21 A;  5CIK A;  2DFI A;  4JUQ A;  2B3L A;  2BH3 A;  1XNZ A;  4S2T P;  4A6W A;  3PEB A;  2OAZ A;  2GG2 A;  3MAT A;  4RGZ 1;  2Q95 A;  2GG7 A;  2BN7 A;  1CHM A;  2BHB A;  3IU9 A;  5CDV A;  4ZWP A;  1W2M A;  2GG5 A;  4U76 A;  5FCF A;  2EA2 A;  1M35 A;  3IL0 A;  1XGO A;  3TAV A;  1C24 A;  3O5V A;  1QXW A;  4IU6 A;  2BB7 A;  5CE6 A;  2NQ6 A;  4A6V A;  5D6F A;  1WL6 A;  2Q92 A;  4Z7M A;  5E5B A;  1A16 A;  3RVA A;  1BN5 A;  4KM3 A;  1KQ0 A;  3L24 A;  1O0X A;  1YVM A;  2P99 A;  3PKE A;  4FO7 A;  4U69 A;  4U75 A;  5D6E A;  2IW2 A;  1W7V A;  2ZSG A;  3OVK A;  4RZZ A;  1YJ3 A;  2GG9 A;  5JFR A;  1QXY A;  4IKR A;  3S6B A;  3I7M A;  2BWU A;  2HOW A;  1B59 A;  1XGM A;  4U6J A;  4IDY A;  2EA4 A;  3PKD A;  4PV4 A;  3Q6D A;  3BIT A;  5CDE A;  3TB5 A;  1WN1 A;  3BIQ A;  2V6C A;  3PKB A;  4FKC A;  5CNX A;  4RZY A;  4ZWU A;  3MR1 A;  1R58 A;  2V3Z A; 
#chains in the Genus database with same CATH topology
 2P98 A;  2BWT A;  2V3Y A;  1WY2 A;  4FLK A;  4EGE A;  4U6W A;  3FMR A;  5E2C A;  1KQ9 A;  1YW8 A;  2GZ5 A;  1WBQ A;  4S00 A;  4IKU A;  2Q96 A;  1R5H A;  4FLL A;  1KP0 A;  2OKN A;  5CDL A;  2GU7 A;  4IKS A;  1XGS A;  2ADU A;  2Q94 A;  1YW9 A;  3IU8 A;  3PN9 A;  2B3K A;  4OOK A;  4U6C A;  3CTZ A;  4U70 A;  4HXX A;  1N51 A;  3OOO A;  2EVM A;  1C22 A;  3IG4 A;  2P9A A;  4U73 A;  1B6A A;  2NQ7 A;  3BIP A;  2GU6 A;  5JHU A;  1WL9 A;  2BWV A;  2EVC A;  4IEC A;  1MAT A;  4FUK A;  1BOA A;  3D27 A;  2BWX A;  4QR8 A;  4U6E A;  2BWY A;  2GGB A;  3IU7 A;  1PV9 A;  4FO8 A;  2BHD A;  4IPA A;  4FLI A;  1C23 A;  2BHC A;  2GU4 A;  2GG8 A;  1XGN A;  2GG0 A;  3L7G A;  2Q93 A;  1R5G A;  4ZNG A;  3CB5 A;  4U71 A;  1WKM A;  3QOC A;  4R60 A;  1QZY A;  3CB6 A;  2BHA A;  2EVO A;  2BWW A;  5JI6 A;  3FMQ A;  5FCH A;  2GTX A;  2Q8K A;  2MAT A;  3MX6 A;  4U6Z A;  4S2R P;  2V3X A;  3PKA A;  3FM3 A;  4S01 A;  4B28 A;  2GGC A;  1Y1N A;  4FLJ A;  2BWS A;  2G6P A;  4ZWO A;  1C27 A;  1YW7 A;  5CLS A;  1JAW A;  1WLR A;  1QXZ A;  2B3H A;  4IKT A;  3ROR A;  3PKC A;  4PNC A;  2GU5 A;  2GG3 A;  4IF7 A;  4U1B A;  2GA2 A;  4MAT A;  1C21 A;  5CIK A;  2DFI A;  4JUQ A;  2B3L A;  2BH3 A;  1XNZ A;  4S2T P;  4A6W A;  3PEB A;  2OAZ A;  2GG2 A;  3MAT A;  4RGZ 1;  2Q95 A;  2GG7 A;  2BN7 A;  1CHM A;  2BHB A;  3IU9 A;  5CDV A;  4ZWP A;  1W2M A;  2GG5 A;  4U76 A;  5FCF A;  2EA2 A;  1M35 A;  3IL0 A;  1XGO A;  3TAV A;  1C24 A;  3O5V A;  1QXW A;  4IU6 A;  2BB7 A;  5CE6 A;  2NQ6 A;  4A6V A;  5D6F A;  1WL6 A;  2Q92 A;  4Z7M A;  5E5B A;  1A16 A;  3RVA A;  1BN5 A;  4KM3 A;  1KQ0 A;  3L24 A;  1O0X A;  1YVM A;  2P99 A;  3PKE A;  4FO7 A;  4U69 A;  4U75 A;  5D6E A;  2IW2 A;  1W7V A;  2ZSG A;  3OVK A;  4RZZ A;  1YJ3 A;  2GG9 A;  5JFR A;  1QXY A;  4IKR A;  3S6B A;  3I7M A;  2BWU A;  2HOW A;  1B59 A;  1XGM A;  4U6J A;  4IDY A;  2EA4 A;  3PKD A;  4PV4 A;  3Q6D A;  3BIT A;  5CDE A;  3TB5 A;  1WN1 A;  3BIQ A;  2V6C A;  3PKB A;  4FKC A;  5CNX A;  4RZY A;  4ZWU A;  3MR1 A;  1R58 A;  2V3Z A; 
#chains in the Genus database with same CATH homology
 2P98 A;  2BWT A;  2V3Y A;  1WY2 A;  4FLK A;  4EGE A;  4U6W A;  3FMR A;  5E2C A;  1KQ9 A;  1YW8 A;  2GZ5 A;  1WBQ A;  4S00 A;  4IKU A;  2Q96 A;  1R5H A;  4FLL A;  1KP0 A;  2OKN A;  5CDL A;  2GU7 A;  4IKS A;  1XGS A;  2ADU A;  2Q94 A;  1YW9 A;  3IU8 A;  3PN9 A;  2B3K A;  4OOK A;  4U6C A;  3CTZ A;  4U70 A;  4HXX A;  1N51 A;  3OOO A;  2EVM A;  1C22 A;  3IG4 A;  2P9A A;  4U73 A;  1B6A A;  2NQ7 A;  3BIP A;  2GU6 A;  5JHU A;  1WL9 A;  2BWV A;  2EVC A;  4IEC A;  1MAT A;  4FUK A;  1BOA A;  3D27 A;  2BWX A;  4QR8 A;  4U6E A;  2BWY A;  2GGB A;  3IU7 A;  1PV9 A;  4FO8 A;  2BHD A;  4IPA A;  4FLI A;  1C23 A;  2BHC A;  2GU4 A;  2GG8 A;  1XGN A;  2GG0 A;  3L7G A;  2Q93 A;  1R5G A;  4ZNG A;  3CB5 A;  4U71 A;  1WKM A;  3QOC A;  4R60 A;  1QZY A;  3CB6 A;  2BHA A;  2EVO A;  2BWW A;  5JI6 A;  3FMQ A;  5FCH A;  2GTX A;  2Q8K A;  2MAT A;  3MX6 A;  4U6Z A;  4S2R P;  2V3X A;  3PKA A;  3FM3 A;  4S01 A;  4B28 A;  2GGC A;  1Y1N A;  4FLJ A;  2BWS A;  2G6P A;  4ZWO A;  1C27 A;  1YW7 A;  5CLS A;  1JAW A;  1WLR A;  1QXZ A;  2B3H A;  4IKT A;  3ROR A;  3PKC A;  4PNC A;  2GU5 A;  2GG3 A;  4IF7 A;  4U1B A;  2GA2 A;  4MAT A;  1C21 A;  5CIK A;  2DFI A;  4JUQ A;  2B3L A;  2BH3 A;  1XNZ A;  4S2T P;  4A6W A;  3PEB A;  2OAZ A;  2GG2 A;  3MAT A;  4RGZ 1;  2Q95 A;  2GG7 A;  2BN7 A;  1CHM A;  2BHB A;  3IU9 A;  5CDV A;  4ZWP A;  1W2M A;  2GG5 A;  4U76 A;  5FCF A;  2EA2 A;  1M35 A;  3IL0 A;  1XGO A;  3TAV A;  1C24 A;  3O5V A;  1QXW A;  4IU6 A;  2BB7 A;  5CE6 A;  2NQ6 A;  4A6V A;  5D6F A;  1WL6 A;  2Q92 A;  4Z7M A;  5E5B A;  1A16 A;  3RVA A;  1BN5 A;  4KM3 A;  1KQ0 A;  3L24 A;  1O0X A;  1YVM A;  2P99 A;  3PKE A;  4FO7 A;  4U69 A;  4U75 A;  5D6E A;  2IW2 A;  1W7V A;  2ZSG A;  3OVK A;  4RZZ A;  1YJ3 A;  2GG9 A;  5JFR A;  1QXY A;  4IKR A;  3S6B A;  3I7M A;  2BWU A;  2HOW A;  1B59 A;  1XGM A;  4U6J A;  4IDY A;  2EA4 A;  3PKD A;  4PV4 A;  3Q6D A;  3BIT A;  5CDE A;  3TB5 A;  1WN1 A;  3BIQ A;  2V6C A;  3PKB A;  4FKC A;  5CNX A;  4RZY A;  4ZWU A;  3MR1 A;  1R58 A;  2V3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...