2V3YA

His361ala escherichia coli aminopeptidase p in complex with product
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 158
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3yA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3yA02
4RZYA 1N51A 4S01A 5CE6A 1QXWA 1XNZA 1XGSA 1WLRA 1A16A 3I7MA 3FMRA 2HOWA 1O0XA 2GG0A 4FKCA 5E2CA 4MATA 1C21A 5CIKA 2BWWA 1BN5A 2GG2A 3BIQA 4R60A 4IU6A 2BH3A 5CDEA 2P99A 2NQ7A 2NQ6A 2GGBA 2OAZA 1WN1A 3PKBA 2EVCA 3IU7A 3CB6A 3OVKA 5FCFA 3TAVA 4U6WA 3L24A 2P98A 5FCHA 1WL9A 4PNCA 2BWTA 3PKAA 2GU7A 1C22A 2V3ZA 4PV4A 1XGOA 3FM3A 3PKDA 4U6JA 3S6BA 1Y1NA 1YVMA 3MR1A 2EVOA 2IW2A 2Q93A 4IKSA 3PKEA 5D6EA 2BWUA 3Q6DA 2ZSGA 2GG3A 4B28A 3D27A 1C23A 2DFIA 3IU8A 2EA4A 5JFRA 5JHUA 4FLJA 1QZYA 1WKMA 2Q94A 1YW7A 2GG9A 2Q95A 2BWYA 1C27A 1C24A 4IF7A 2V6CA 4OOKA 1R5HA 1M35A 1W7VA 3IG4A 1BOAA 1QXZA 2V3YA 4U71A 3OOOA 1WY2A 1R5GA 5D6FA 2BWSA 4U6CA 3CTZA 3O5VA 4ZWUA 2Q96A 1JAWA 1CHMA 4IKUA 3PEBA 3IU9A 2BWVA 3L7GA 1QXYA 4A6WA 3BIPA 2BN7A 3MATA 4FLKA 4HXXA 4ZWOA 4EGEA 4FLIA 5CDVA 4FUKA 3TB5A 2B3KA 4IECA 4RGZ1 4U76A 4U69A 2G6PA 2B3HA 2GG8A 2BWXA 2MATA 3IL0A 3QOCA 5CDLA 4U6EA 5CLSA 1YW8A 3FMQA 1XGMA 3CB5A 4JUQA 5E5BA 4U73A 5JI6A 2GU4A 1WL6A 2BHCA 1YJ3A 3PKCA 2EA2A 4FO8A 4Z7MA 2GTXA 2GG7A 2V3XA 4IKTA 4U1BA 1W2MA 2BHBA 2GGCA 4QR8A 2BHDA 4FO7A 2P9AA 4U6ZA 3MX6A 2GU6A 4IKRA 4KM3A 2Q8KA 1KQ0A 1YW9A 1KP0A 1B6AA 4RZZA 1PV9A 4S2RP 2BB7A 1XGNA 4U70A 2EVMA 4IDYA 4ZNGA 2BHAA 4A6VA 4FLLA 2GG5A 2GU5A 1R58A 4S00A 2Q92A 4U75A 3PN9A 4IPAA 5CNXA 1B59A 4S2TP 2ADUA 2B3LA 1KQ9A 2OKNA 3RORA 1MATA 2GA2A 4ZWPA 1WBQA 3RVAA 3BITA 2GZ5A
chains in the Genus database with same CATH superfamily
4RZYA 1N51A 4S01A 5CE6A 1QXWA 1XNZA 1XGSA 1WLRA 1A16A 3I7MA 3FMRA 2HOWA 1O0XA 2GG0A 4FKCA 5E2CA 4MATA 1C21A 5CIKA 2BWWA 1BN5A 2GG2A 3BIQA 4R60A 4IU6A 2BH3A 5CDEA 2P99A 2NQ7A 2NQ6A 2GGBA 2OAZA 1WN1A 3PKBA 2EVCA 3IU7A 3CB6A 3OVKA 5FCFA 3TAVA 4U6WA 3L24A 2P98A 5FCHA 1WL9A 4PNCA 2BWTA 3PKAA 2GU7A 1C22A 2V3ZA 4PV4A 1XGOA 3FM3A 3PKDA 4U6JA 3S6BA 1Y1NA 1YVMA 3MR1A 2EVOA 2IW2A 2Q93A 4IKSA 3PKEA 5D6EA 2BWUA 3Q6DA 2ZSGA 2GG3A 4B28A 3D27A 1C23A 2DFIA 3IU8A 2EA4A 5JFRA 5JHUA 4FLJA 1QZYA 1WKMA 2Q94A 1YW7A 2GG9A 2Q95A 2BWYA 1C27A 1C24A 4IF7A 2V6CA 4OOKA 1R5HA 1M35A 1W7VA 3IG4A 1BOAA 1QXZA 2V3YA 4U71A 3OOOA 1WY2A 1R5GA 5D6FA 2BWSA 4U6CA 3CTZA 3O5VA 4ZWUA 2Q96A 1JAWA 1CHMA 4IKUA 3PEBA 3IU9A 2BWVA 3L7GA 1QXYA 4A6WA 3BIPA 2BN7A 3MATA 4FLKA 4HXXA 4ZWOA 4EGEA 4FLIA 5CDVA 4FUKA 3TB5A 2B3KA 4IECA 4RGZ1 4U76A 4U69A 2G6PA 2B3HA 2GG8A 2BWXA 2MATA 3IL0A 3QOCA 5CDLA 4U6EA 5CLSA 1YW8A 3FMQA 1XGMA 3CB5A 4JUQA 5E5BA 4U73A 5JI6A 2GU4A 1WL6A 2BHCA 1YJ3A 3PKCA 2EA2A 4FO8A 4Z7MA 2GTXA 2GG7A 2V3XA 4IKTA 4U1BA 1W2MA 2BHBA 2GGCA 4QR8A 2BHDA 4FO7A 2P9AA 4U6ZA 3MX6A 2GU6A 4IKRA 4KM3A 2Q8KA 1KQ0A 1YW9A 1KP0A 1B6AA 4RZZA 1PV9A 4S2RP 2BB7A 1XGNA 4U70A 2EVMA 4IDYA 4ZNGA 2BHAA 4A6VA 4FLLA 2GG5A 2GU5A 1R58A 4S00A 2Q92A 4U75A 3PN9A 4IPAA 5CNXA 1B59A 4S2TP 2ADUA 2B3LA 1KQ9A 2OKNA 3RORA 1MATA 2GA2A 4ZWPA 1WBQA 3RVAA 3BITA 2GZ5A
chains in the Genus database with same CATH topology
4RZYA 1N51A 4S01A 5CE6A 1QXWA 1XNZA 1XGSA 1WLRA 1A16A 3I7MA 3FMRA 2HOWA 1O0XA 2GG0A 4FKCA 5E2CA 4MATA 1C21A 5CIKA 2BWWA 1BN5A 2GG2A 3BIQA 4R60A 4IU6A 2BH3A 5CDEA 2P99A 2NQ7A 2NQ6A 2GGBA 2OAZA 1WN1A 3PKBA 2EVCA 3IU7A 3CB6A 3OVKA 5FCFA 3TAVA 4U6WA 3L24A 2P98A 5FCHA 1WL9A 4PNCA 2BWTA 3PKAA 2GU7A 1C22A 2V3ZA 4PV4A 1XGOA 3FM3A 3PKDA 4U6JA 3S6BA 1Y1NA 1YVMA 3MR1A 2EVOA 2IW2A 2Q93A 4IKSA 3PKEA 5D6EA 2BWUA 3Q6DA 2ZSGA 2GG3A 4B28A 3D27A 1C23A 2DFIA 3IU8A 2EA4A 5JFRA 5JHUA 4FLJA 1QZYA 1WKMA 2Q94A 1YW7A 2GG9A 2Q95A 2BWYA 1C27A 1C24A 4IF7A 2V6CA 4OOKA 1R5HA 1M35A 1W7VA 3IG4A 1BOAA 1QXZA 2V3YA 4U71A 3OOOA 1WY2A 1R5GA 5D6FA 2BWSA 4U6CA 3CTZA 3O5VA 4ZWUA 2Q96A 1JAWA 1CHMA 4IKUA 3PEBA 3IU9A 2BWVA 3L7GA 1QXYA 4A6WA 3BIPA 2BN7A 3MATA 4FLKA 4HXXA 4ZWOA 4EGEA 4FLIA 5CDVA 4FUKA 3TB5A 2B3KA 4IECA 4RGZ1 4U76A 4U69A 2G6PA 2B3HA 2GG8A 2BWXA 2MATA 3IL0A 3QOCA 5CDLA 4U6EA 5CLSA 1YW8A 3FMQA 1XGMA 3CB5A 4JUQA 5E5BA 4U73A 5JI6A 2GU4A 1WL6A 2BHCA 1YJ3A 3PKCA 2EA2A 4FO8A 4Z7MA 2GTXA 2GG7A 2V3XA 4IKTA 4U1BA 1W2MA 2BHBA 2GGCA 4QR8A 2BHDA 4FO7A 2P9AA 4U6ZA 3MX6A 2GU6A 4IKRA 4KM3A 2Q8KA 1KQ0A 1YW9A 1KP0A 1B6AA 4RZZA 1PV9A 4S2RP 2BB7A 1XGNA 4U70A 2EVMA 4IDYA 4ZNGA 2BHAA 4A6VA 4FLLA 2GG5A 2GU5A 1R58A 4S00A 2Q92A 4U75A 3PN9A 4IPAA 5CNXA 1B59A 4S2TP 2ADUA 2B3LA 1KQ9A 2OKNA 3RORA 1MATA 2GA2A 4ZWPA 1WBQA 3RVAA 3BITA 2GZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZY A;  1N51 A;  4S01 A;  5CE6 A;  1QXW A;  1XNZ A;  1XGS A;  1WLR A;  1A16 A;  3I7M A;  3FMR A;  2HOW A;  1O0X A;  2GG0 A;  4FKC A;  5E2C A;  4MAT A;  1C21 A;  5CIK A;  2BWW A;  1BN5 A;  2GG2 A;  3BIQ A;  4R60 A;  4IU6 A;  2BH3 A;  5CDE A;  2P99 A;  2NQ7 A;  2NQ6 A;  2GGB A;  2OAZ A;  1WN1 A;  3PKB A;  2EVC A;  3IU7 A;  3CB6 A;  3OVK A;  5FCF A;  3TAV A;  4U6W A;  3L24 A;  2P98 A;  5FCH A;  1WL9 A;  4PNC A;  2BWT A;  3PKA A;  2GU7 A;  1C22 A;  2V3Z A;  4PV4 A;  1XGO A;  3FM3 A;  3PKD A;  4U6J A;  3S6B A;  1Y1N A;  1YVM A;  3MR1 A;  2EVO A;  2IW2 A;  2Q93 A;  4IKS A;  3PKE A;  5D6E A;  2BWU A;  3Q6D A;  2ZSG A;  2GG3 A;  4B28 A;  3D27 A;  1C23 A;  2DFI A;  3IU8 A;  2EA4 A;  5JFR A;  5JHU A;  4FLJ A;  1QZY A;  1WKM A;  2Q94 A;  1YW7 A;  2GG9 A;  2Q95 A;  2BWY A;  1C27 A;  1C24 A;  4IF7 A;  2V6C A;  4OOK A;  1R5H A;  1M35 A;  1W7V A;  3IG4 A;  1BOA A;  1QXZ A;  2V3Y A;  4U71 A;  3OOO A;  1WY2 A;  1R5G A;  5D6F A;  2BWS A;  4U6C A;  3CTZ A;  3O5V A;  4ZWU A;  2Q96 A;  1JAW A;  1CHM A;  4IKU A;  3PEB A;  3IU9 A;  2BWV A;  3L7G A;  1QXY A;  4A6W A;  3BIP A;  2BN7 A;  3MAT A;  4FLK A;  4HXX A;  4ZWO A;  4EGE A;  4FLI A;  5CDV A;  4FUK A;  3TB5 A;  2B3K A;  4IEC A;  4RGZ 1;  4U76 A;  4U69 A;  2G6P A;  2B3H A;  2GG8 A;  2BWX A;  2MAT A;  3IL0 A;  3QOC A;  5CDL A;  4U6E A;  5CLS A;  1YW8 A;  3FMQ A;  1XGM A;  3CB5 A;  4JUQ A;  5E5B A;  4U73 A;  5JI6 A;  2GU4 A;  1WL6 A;  2BHC A;  1YJ3 A;  3PKC A;  2EA2 A;  4FO8 A;  4Z7M A;  2GTX A;  2GG7 A;  2V3X A;  4IKT A;  4U1B A;  1W2M A;  2BHB A;  2GGC A;  4QR8 A;  2BHD A;  4FO7 A;  2P9A A;  4U6Z A;  3MX6 A;  2GU6 A;  4IKR A;  4KM3 A;  2Q8K A;  1KQ0 A;  1YW9 A;  1KP0 A;  1B6A A;  4RZZ A;  1PV9 A;  4S2R P;  2BB7 A;  1XGN A;  4U70 A;  2EVM A;  4IDY A;  4ZNG A;  2BHA A;  4A6V A;  4FLL A;  2GG5 A;  2GU5 A;  1R58 A;  4S00 A;  2Q92 A;  4U75 A;  3PN9 A;  4IPA A;  5CNX A;  1B59 A;  4S2T P;  2ADU A;  2B3L A;  1KQ9 A;  2OKN A;  3ROR A;  1MAT A;  2GA2 A;  4ZWP A;  1WBQ A;  3RVA A;  3BIT A;  2GZ5 A; 
#chains in the Genus database with same CATH topology
 4RZY A;  1N51 A;  4S01 A;  5CE6 A;  1QXW A;  1XNZ A;  1XGS A;  1WLR A;  1A16 A;  3I7M A;  3FMR A;  2HOW A;  1O0X A;  2GG0 A;  4FKC A;  5E2C A;  4MAT A;  1C21 A;  5CIK A;  2BWW A;  1BN5 A;  2GG2 A;  3BIQ A;  4R60 A;  4IU6 A;  2BH3 A;  5CDE A;  2P99 A;  2NQ7 A;  2NQ6 A;  2GGB A;  2OAZ A;  1WN1 A;  3PKB A;  2EVC A;  3IU7 A;  3CB6 A;  3OVK A;  5FCF A;  3TAV A;  4U6W A;  3L24 A;  2P98 A;  5FCH A;  1WL9 A;  4PNC A;  2BWT A;  3PKA A;  2GU7 A;  1C22 A;  2V3Z A;  4PV4 A;  1XGO A;  3FM3 A;  3PKD A;  4U6J A;  3S6B A;  1Y1N A;  1YVM A;  3MR1 A;  2EVO A;  2IW2 A;  2Q93 A;  4IKS A;  3PKE A;  5D6E A;  2BWU A;  3Q6D A;  2ZSG A;  2GG3 A;  4B28 A;  3D27 A;  1C23 A;  2DFI A;  3IU8 A;  2EA4 A;  5JFR A;  5JHU A;  4FLJ A;  1QZY A;  1WKM A;  2Q94 A;  1YW7 A;  2GG9 A;  2Q95 A;  2BWY A;  1C27 A;  1C24 A;  4IF7 A;  2V6C A;  4OOK A;  1R5H A;  1M35 A;  1W7V A;  3IG4 A;  1BOA A;  1QXZ A;  2V3Y A;  4U71 A;  3OOO A;  1WY2 A;  1R5G A;  5D6F A;  2BWS A;  4U6C A;  3CTZ A;  3O5V A;  4ZWU A;  2Q96 A;  1JAW A;  1CHM A;  4IKU A;  3PEB A;  3IU9 A;  2BWV A;  3L7G A;  1QXY A;  4A6W A;  3BIP A;  2BN7 A;  3MAT A;  4FLK A;  4HXX A;  4ZWO A;  4EGE A;  4FLI A;  5CDV A;  4FUK A;  3TB5 A;  2B3K A;  4IEC A;  4RGZ 1;  4U76 A;  4U69 A;  2G6P A;  2B3H A;  2GG8 A;  2BWX A;  2MAT A;  3IL0 A;  3QOC A;  5CDL A;  4U6E A;  5CLS A;  1YW8 A;  3FMQ A;  1XGM A;  3CB5 A;  4JUQ A;  5E5B A;  4U73 A;  5JI6 A;  2GU4 A;  1WL6 A;  2BHC A;  1YJ3 A;  3PKC A;  2EA2 A;  4FO8 A;  4Z7M A;  2GTX A;  2GG7 A;  2V3X A;  4IKT A;  4U1B A;  1W2M A;  2BHB A;  2GGC A;  4QR8 A;  2BHD A;  4FO7 A;  2P9A A;  4U6Z A;  3MX6 A;  2GU6 A;  4IKR A;  4KM3 A;  2Q8K A;  1KQ0 A;  1YW9 A;  1KP0 A;  1B6A A;  4RZZ A;  1PV9 A;  4S2R P;  2BB7 A;  1XGN A;  4U70 A;  2EVM A;  4IDY A;  4ZNG A;  2BHA A;  4A6V A;  4FLL A;  2GG5 A;  2GU5 A;  1R58 A;  4S00 A;  2Q92 A;  4U75 A;  3PN9 A;  4IPA A;  5CNX A;  1B59 A;  4S2T P;  2ADU A;  2B3L A;  1KQ9 A;  2OKN A;  3ROR A;  1MAT A;  2GA2 A;  4ZWP A;  1WBQ A;  3RVA A;  3BIT A;  2GZ5 A; 
#chains in the Genus database with same CATH homology
 4RZY A;  1N51 A;  4S01 A;  5CE6 A;  1QXW A;  1XNZ A;  1XGS A;  1WLR A;  1A16 A;  3I7M A;  3FMR A;  2HOW A;  1O0X A;  2GG0 A;  4FKC A;  5E2C A;  4MAT A;  1C21 A;  5CIK A;  2BWW A;  1BN5 A;  2GG2 A;  3BIQ A;  4R60 A;  4IU6 A;  2BH3 A;  5CDE A;  2P99 A;  2NQ7 A;  2NQ6 A;  2GGB A;  2OAZ A;  1WN1 A;  3PKB A;  2EVC A;  3IU7 A;  3CB6 A;  3OVK A;  5FCF A;  3TAV A;  4U6W A;  3L24 A;  2P98 A;  5FCH A;  1WL9 A;  4PNC A;  2BWT A;  3PKA A;  2GU7 A;  1C22 A;  2V3Z A;  4PV4 A;  1XGO A;  3FM3 A;  3PKD A;  4U6J A;  3S6B A;  1Y1N A;  1YVM A;  3MR1 A;  2EVO A;  2IW2 A;  2Q93 A;  4IKS A;  3PKE A;  5D6E A;  2BWU A;  3Q6D A;  2ZSG A;  2GG3 A;  4B28 A;  3D27 A;  1C23 A;  2DFI A;  3IU8 A;  2EA4 A;  5JFR A;  5JHU A;  4FLJ A;  1QZY A;  1WKM A;  2Q94 A;  1YW7 A;  2GG9 A;  2Q95 A;  2BWY A;  1C27 A;  1C24 A;  4IF7 A;  2V6C A;  4OOK A;  1R5H A;  1M35 A;  1W7V A;  3IG4 A;  1BOA A;  1QXZ A;  2V3Y A;  4U71 A;  3OOO A;  1WY2 A;  1R5G A;  5D6F A;  2BWS A;  4U6C A;  3CTZ A;  3O5V A;  4ZWU A;  2Q96 A;  1JAW A;  1CHM A;  4IKU A;  3PEB A;  3IU9 A;  2BWV A;  3L7G A;  1QXY A;  4A6W A;  3BIP A;  2BN7 A;  3MAT A;  4FLK A;  4HXX A;  4ZWO A;  4EGE A;  4FLI A;  5CDV A;  4FUK A;  3TB5 A;  2B3K A;  4IEC A;  4RGZ 1;  4U76 A;  4U69 A;  2G6P A;  2B3H A;  2GG8 A;  2BWX A;  2MAT A;  3IL0 A;  3QOC A;  5CDL A;  4U6E A;  5CLS A;  1YW8 A;  3FMQ A;  1XGM A;  3CB5 A;  4JUQ A;  5E5B A;  4U73 A;  5JI6 A;  2GU4 A;  1WL6 A;  2BHC A;  1YJ3 A;  3PKC A;  2EA2 A;  4FO8 A;  4Z7M A;  2GTX A;  2GG7 A;  2V3X A;  4IKT A;  4U1B A;  1W2M A;  2BHB A;  2GGC A;  4QR8 A;  2BHD A;  4FO7 A;  2P9A A;  4U6Z A;  3MX6 A;  2GU6 A;  4IKR A;  4KM3 A;  2Q8K A;  1KQ0 A;  1YW9 A;  1KP0 A;  1B6A A;  4RZZ A;  1PV9 A;  4S2R P;  2BB7 A;  1XGN A;  4U70 A;  2EVM A;  4IDY A;  4ZNG A;  2BHA A;  4A6V A;  4FLL A;  2GG5 A;  2GU5 A;  1R58 A;  4S00 A;  2Q92 A;  4U75 A;  3PN9 A;  4IPA A;  5CNX A;  1B59 A;  4S2T P;  2ADU A;  2B3L A;  1KQ9 A;  2OKN A;  3ROR A;  1MAT A;  2GA2 A;  4ZWP A;  1WBQ A;  3RVA A;  3BIT A;  2GZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...