2V3YA

His361ala escherichia coli aminopeptidase p in complex with product
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
total genus 158
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3yA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3yA02
3IU9A 1N51A 1C24A 4FLJA 4IPAA 3IU8A 2GG7A 3PKAA 4U6JA 2GU5A 1YW8A 1C21A 4IKSA 3IL0A 2NQ7A 4EGEA 4U73A 4FLLA 1CHMA 2EVCA 2B3HA 2IW2A 1YW7A 2V3ZA 2MATA 1WLRA 2B3KA 2DFIA 2BHDA 2GG3A 5FCHA 2GG2A 3PKDA 2BHBA 5CE6A 3TB5A 5JFRA 2EVOA 2GU6A 2GG9A 1W2MA 4IECA 4U6EA 5FCFA 1WN1A 3FMQA 4A6VA 1WY2A 5D6EA 1B59A 2NQ6A 4Z7MA 2Q94A 1BOAA 2BWYA 3MX6A 4ZWUA 1C22A 5CDVA 3FM3A 4RZYA 1WBQA 3CB5A 3BIPA 4RGZ1 4S2RP 2GZ5A 2Q93A 3FMRA 4IDYA 4IF7A 4U70A 1WL9A 4B28A 1KP0A 1O0XA 1JAWA 1R5HA 1XGNA 2GGBA 2GU7A 2Q8KA 1A16A 2V3YA 2GG8A 1W7VA 2BWSA 3L24A 2EA4A 3S6BA 4FUKA 4U6CA 3PKBA 4PNCA 3I7MA 4FO7A 3L7GA 4MATA 1QXZA 3RORA 2BWWA 2HOWA 3Q6DA 4S2TP 3PN9A 4FO8A 4U1BA 2GG5A 2ADUA 1R58A 3IU7A 3BIQA 5CNXA 4IKTA 1PV9A 2BWXA 2Q96A 4OOKA 5JI6A 2P98A 4ZWPA 2P9AA 4U69A 4RZZA 2OKNA 1YJ3A 2EA2A 1XGOA 3MATA 2BHCA 3IG4A 2GG0A 4U6WA 2GU4A 5CLSA 2ZSGA 1YVMA 5CDLA 1XGSA 2BHAA 1M35A 2BWTA 1MATA 4U71A 4A6WA 2BWVA 3QOCA 1XNZA 4U75A 3CB6A 1YW9A 4ZNGA 4JUQA 4QR8A 3MR1A 1QZYA 3TAVA 4U6ZA 5JHUA 1QXYA 1WL6A 2GA2A 3O5VA 5E5BA 1KQ0A 4FLIA 1WKMA 2V6CA 4PV4A 4FKCA 2BN7A 1C27A 1BN5A 2OAZA 4S00A 3PKCA 3BITA 4R60A 4IKUA 2BWUA 4IU6A 2BH3A 2BB7A 2GTXA 3OOOA 2V3XA 1KQ9A 3CTZA 4S01A 4HXXA 2B3LA 2Q92A 3OVKA 2GGCA 4U76A 3PKEA 1R5GA 1Y1NA 4FLKA 1C23A 3PEBA 2EVMA 3D27A 4IKRA 5D6FA 5E2CA 2G6PA 3RVAA 4KM3A 2P99A 1QXWA 2Q95A 5CDEA 1B6AA 1XGMA 4ZWOA 5CIKA
chains in the Genus database with same CATH superfamily
3IU9A 1N51A 1C24A 4FLJA 4IPAA 3IU8A 2GG7A 3PKAA 4U6JA 2GU5A 1YW8A 1C21A 4IKSA 3IL0A 2NQ7A 4EGEA 4U73A 4FLLA 1CHMA 2EVCA 2B3HA 2IW2A 1YW7A 2V3ZA 2MATA 1WLRA 2B3KA 2DFIA 2BHDA 2GG3A 5FCHA 2GG2A 3PKDA 2BHBA 5CE6A 3TB5A 5JFRA 2EVOA 2GU6A 2GG9A 1W2MA 4IECA 4U6EA 5FCFA 1WN1A 3FMQA 4A6VA 1WY2A 5D6EA 1B59A 2NQ6A 4Z7MA 2Q94A 1BOAA 2BWYA 3MX6A 4ZWUA 1C22A 5CDVA 3FM3A 4RZYA 1WBQA 3CB5A 3BIPA 4RGZ1 4S2RP 2GZ5A 2Q93A 3FMRA 4IDYA 4IF7A 4U70A 1WL9A 4B28A 1KP0A 1O0XA 1JAWA 1R5HA 1XGNA 2GGBA 2GU7A 2Q8KA 1A16A 2V3YA 2GG8A 1W7VA 2BWSA 3L24A 2EA4A 3S6BA 4FUKA 4U6CA 3PKBA 4PNCA 3I7MA 4FO7A 3L7GA 4MATA 1QXZA 3RORA 2BWWA 2HOWA 3Q6DA 4S2TP 3PN9A 4FO8A 4U1BA 2GG5A 2ADUA 1R58A 3IU7A 3BIQA 5CNXA 4IKTA 1PV9A 2BWXA 2Q96A 4OOKA 5JI6A 2P98A 4ZWPA 2P9AA 4U69A 4RZZA 2OKNA 1YJ3A 2EA2A 1XGOA 3MATA 2BHCA 3IG4A 2GG0A 4U6WA 2GU4A 5CLSA 2ZSGA 1YVMA 5CDLA 1XGSA 2BHAA 1M35A 2BWTA 1MATA 4U71A 4A6WA 2BWVA 3QOCA 1XNZA 4U75A 3CB6A 1YW9A 4ZNGA 4JUQA 4QR8A 3MR1A 1QZYA 3TAVA 4U6ZA 5JHUA 1QXYA 1WL6A 2GA2A 3O5VA 5E5BA 1KQ0A 4FLIA 1WKMA 2V6CA 4PV4A 4FKCA 2BN7A 1C27A 1BN5A 2OAZA 4S00A 3PKCA 3BITA 4R60A 4IKUA 2BWUA 4IU6A 2BH3A 2BB7A 2GTXA 3OOOA 2V3XA 1KQ9A 3CTZA 4S01A 4HXXA 2B3LA 2Q92A 3OVKA 2GGCA 4U76A 3PKEA 1R5GA 1Y1NA 4FLKA 1C23A 3PEBA 2EVMA 3D27A 4IKRA 5D6FA 5E2CA 2G6PA 3RVAA 4KM3A 2P99A 1QXWA 2Q95A 5CDEA 1B6AA 1XGMA 4ZWOA 5CIKA
chains in the Genus database with same CATH topology
3IU9A 1N51A 1C24A 4FLJA 4IPAA 3IU8A 2GG7A 3PKAA 4U6JA 2GU5A 1YW8A 1C21A 4IKSA 3IL0A 2NQ7A 4EGEA 4U73A 4FLLA 1CHMA 2EVCA 2B3HA 2IW2A 1YW7A 2V3ZA 2MATA 1WLRA 2B3KA 2DFIA 2BHDA 2GG3A 5FCHA 2GG2A 3PKDA 2BHBA 5CE6A 3TB5A 5JFRA 2EVOA 2GU6A 2GG9A 1W2MA 4IECA 4U6EA 5FCFA 1WN1A 3FMQA 4A6VA 1WY2A 5D6EA 1B59A 2NQ6A 4Z7MA 2Q94A 1BOAA 2BWYA 3MX6A 4ZWUA 1C22A 5CDVA 3FM3A 4RZYA 1WBQA 3CB5A 3BIPA 4RGZ1 4S2RP 2GZ5A 2Q93A 3FMRA 4IDYA 4IF7A 4U70A 1WL9A 4B28A 1KP0A 1O0XA 1JAWA 1R5HA 1XGNA 2GGBA 2GU7A 2Q8KA 1A16A 2V3YA 2GG8A 1W7VA 2BWSA 3L24A 2EA4A 3S6BA 4FUKA 4U6CA 3PKBA 4PNCA 3I7MA 4FO7A 3L7GA 4MATA 1QXZA 3RORA 2BWWA 2HOWA 3Q6DA 4S2TP 3PN9A 4FO8A 4U1BA 2GG5A 2ADUA 1R58A 3IU7A 3BIQA 5CNXA 4IKTA 1PV9A 2BWXA 2Q96A 4OOKA 5JI6A 2P98A 4ZWPA 2P9AA 4U69A 4RZZA 2OKNA 1YJ3A 2EA2A 1XGOA 3MATA 2BHCA 3IG4A 2GG0A 4U6WA 2GU4A 5CLSA 2ZSGA 1YVMA 5CDLA 1XGSA 2BHAA 1M35A 2BWTA 1MATA 4U71A 4A6WA 2BWVA 3QOCA 1XNZA 4U75A 3CB6A 1YW9A 4ZNGA 4JUQA 4QR8A 3MR1A 1QZYA 3TAVA 4U6ZA 5JHUA 1QXYA 1WL6A 2GA2A 3O5VA 5E5BA 1KQ0A 4FLIA 1WKMA 2V6CA 4PV4A 4FKCA 2BN7A 1C27A 1BN5A 2OAZA 4S00A 3PKCA 3BITA 4R60A 4IKUA 2BWUA 4IU6A 2BH3A 2BB7A 2GTXA 3OOOA 2V3XA 1KQ9A 3CTZA 4S01A 4HXXA 2B3LA 2Q92A 3OVKA 2GGCA 4U76A 3PKEA 1R5GA 1Y1NA 4FLKA 1C23A 3PEBA 2EVMA 3D27A 4IKRA 5D6FA 5E2CA 2G6PA 3RVAA 4KM3A 2P99A 1QXWA 2Q95A 5CDEA 1B6AA 1XGMA 4ZWOA 5CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU9 A;  1N51 A;  1C24 A;  4FLJ A;  4IPA A;  3IU8 A;  2GG7 A;  3PKA A;  4U6J A;  2GU5 A;  1YW8 A;  1C21 A;  4IKS A;  3IL0 A;  2NQ7 A;  4EGE A;  4U73 A;  4FLL A;  1CHM A;  2EVC A;  2B3H A;  2IW2 A;  1YW7 A;  2V3Z A;  2MAT A;  1WLR A;  2B3K A;  2DFI A;  2BHD A;  2GG3 A;  5FCH A;  2GG2 A;  3PKD A;  2BHB A;  5CE6 A;  3TB5 A;  5JFR A;  2EVO A;  2GU6 A;  2GG9 A;  1W2M A;  4IEC A;  4U6E A;  5FCF A;  1WN1 A;  3FMQ A;  4A6V A;  1WY2 A;  5D6E A;  1B59 A;  2NQ6 A;  4Z7M A;  2Q94 A;  1BOA A;  2BWY A;  3MX6 A;  4ZWU A;  1C22 A;  5CDV A;  3FM3 A;  4RZY A;  1WBQ A;  3CB5 A;  3BIP A;  4RGZ 1;  4S2R P;  2GZ5 A;  2Q93 A;  3FMR A;  4IDY A;  4IF7 A;  4U70 A;  1WL9 A;  4B28 A;  1KP0 A;  1O0X A;  1JAW A;  1R5H A;  1XGN A;  2GGB A;  2GU7 A;  2Q8K A;  1A16 A;  2V3Y A;  2GG8 A;  1W7V A;  2BWS A;  3L24 A;  2EA4 A;  3S6B A;  4FUK A;  4U6C A;  3PKB A;  4PNC A;  3I7M A;  4FO7 A;  3L7G A;  4MAT A;  1QXZ A;  3ROR A;  2BWW A;  2HOW A;  3Q6D A;  4S2T P;  3PN9 A;  4FO8 A;  4U1B A;  2GG5 A;  2ADU A;  1R58 A;  3IU7 A;  3BIQ A;  5CNX A;  4IKT A;  1PV9 A;  2BWX A;  2Q96 A;  4OOK A;  5JI6 A;  2P98 A;  4ZWP A;  2P9A A;  4U69 A;  4RZZ A;  2OKN A;  1YJ3 A;  2EA2 A;  1XGO A;  3MAT A;  2BHC A;  3IG4 A;  2GG0 A;  4U6W A;  2GU4 A;  5CLS A;  2ZSG A;  1YVM A;  5CDL A;  1XGS A;  2BHA A;  1M35 A;  2BWT A;  1MAT A;  4U71 A;  4A6W A;  2BWV A;  3QOC A;  1XNZ A;  4U75 A;  3CB6 A;  1YW9 A;  4ZNG A;  4JUQ A;  4QR8 A;  3MR1 A;  1QZY A;  3TAV A;  4U6Z A;  5JHU A;  1QXY A;  1WL6 A;  2GA2 A;  3O5V A;  5E5B A;  1KQ0 A;  4FLI A;  1WKM A;  2V6C A;  4PV4 A;  4FKC A;  2BN7 A;  1C27 A;  1BN5 A;  2OAZ A;  4S00 A;  3PKC A;  3BIT A;  4R60 A;  4IKU A;  2BWU A;  4IU6 A;  2BH3 A;  2BB7 A;  2GTX A;  3OOO A;  2V3X A;  1KQ9 A;  3CTZ A;  4S01 A;  4HXX A;  2B3L A;  2Q92 A;  3OVK A;  2GGC A;  4U76 A;  3PKE A;  1R5G A;  1Y1N A;  4FLK A;  1C23 A;  3PEB A;  2EVM A;  3D27 A;  4IKR A;  5D6F A;  5E2C A;  2G6P A;  3RVA A;  4KM3 A;  2P99 A;  1QXW A;  2Q95 A;  5CDE A;  1B6A A;  1XGM A;  4ZWO A;  5CIK A; 
#chains in the Genus database with same CATH topology
 3IU9 A;  1N51 A;  1C24 A;  4FLJ A;  4IPA A;  3IU8 A;  2GG7 A;  3PKA A;  4U6J A;  2GU5 A;  1YW8 A;  1C21 A;  4IKS A;  3IL0 A;  2NQ7 A;  4EGE A;  4U73 A;  4FLL A;  1CHM A;  2EVC A;  2B3H A;  2IW2 A;  1YW7 A;  2V3Z A;  2MAT A;  1WLR A;  2B3K A;  2DFI A;  2BHD A;  2GG3 A;  5FCH A;  2GG2 A;  3PKD A;  2BHB A;  5CE6 A;  3TB5 A;  5JFR A;  2EVO A;  2GU6 A;  2GG9 A;  1W2M A;  4IEC A;  4U6E A;  5FCF A;  1WN1 A;  3FMQ A;  4A6V A;  1WY2 A;  5D6E A;  1B59 A;  2NQ6 A;  4Z7M A;  2Q94 A;  1BOA A;  2BWY A;  3MX6 A;  4ZWU A;  1C22 A;  5CDV A;  3FM3 A;  4RZY A;  1WBQ A;  3CB5 A;  3BIP A;  4RGZ 1;  4S2R P;  2GZ5 A;  2Q93 A;  3FMR A;  4IDY A;  4IF7 A;  4U70 A;  1WL9 A;  4B28 A;  1KP0 A;  1O0X A;  1JAW A;  1R5H A;  1XGN A;  2GGB A;  2GU7 A;  2Q8K A;  1A16 A;  2V3Y A;  2GG8 A;  1W7V A;  2BWS A;  3L24 A;  2EA4 A;  3S6B A;  4FUK A;  4U6C A;  3PKB A;  4PNC A;  3I7M A;  4FO7 A;  3L7G A;  4MAT A;  1QXZ A;  3ROR A;  2BWW A;  2HOW A;  3Q6D A;  4S2T P;  3PN9 A;  4FO8 A;  4U1B A;  2GG5 A;  2ADU A;  1R58 A;  3IU7 A;  3BIQ A;  5CNX A;  4IKT A;  1PV9 A;  2BWX A;  2Q96 A;  4OOK A;  5JI6 A;  2P98 A;  4ZWP A;  2P9A A;  4U69 A;  4RZZ A;  2OKN A;  1YJ3 A;  2EA2 A;  1XGO A;  3MAT A;  2BHC A;  3IG4 A;  2GG0 A;  4U6W A;  2GU4 A;  5CLS A;  2ZSG A;  1YVM A;  5CDL A;  1XGS A;  2BHA A;  1M35 A;  2BWT A;  1MAT A;  4U71 A;  4A6W A;  2BWV A;  3QOC A;  1XNZ A;  4U75 A;  3CB6 A;  1YW9 A;  4ZNG A;  4JUQ A;  4QR8 A;  3MR1 A;  1QZY A;  3TAV A;  4U6Z A;  5JHU A;  1QXY A;  1WL6 A;  2GA2 A;  3O5V A;  5E5B A;  1KQ0 A;  4FLI A;  1WKM A;  2V6C A;  4PV4 A;  4FKC A;  2BN7 A;  1C27 A;  1BN5 A;  2OAZ A;  4S00 A;  3PKC A;  3BIT A;  4R60 A;  4IKU A;  2BWU A;  4IU6 A;  2BH3 A;  2BB7 A;  2GTX A;  3OOO A;  2V3X A;  1KQ9 A;  3CTZ A;  4S01 A;  4HXX A;  2B3L A;  2Q92 A;  3OVK A;  2GGC A;  4U76 A;  3PKE A;  1R5G A;  1Y1N A;  4FLK A;  1C23 A;  3PEB A;  2EVM A;  3D27 A;  4IKR A;  5D6F A;  5E2C A;  2G6P A;  3RVA A;  4KM3 A;  2P99 A;  1QXW A;  2Q95 A;  5CDE A;  1B6A A;  1XGM A;  4ZWO A;  5CIK A; 
#chains in the Genus database with same CATH homology
 3IU9 A;  1N51 A;  1C24 A;  4FLJ A;  4IPA A;  3IU8 A;  2GG7 A;  3PKA A;  4U6J A;  2GU5 A;  1YW8 A;  1C21 A;  4IKS A;  3IL0 A;  2NQ7 A;  4EGE A;  4U73 A;  4FLL A;  1CHM A;  2EVC A;  2B3H A;  2IW2 A;  1YW7 A;  2V3Z A;  2MAT A;  1WLR A;  2B3K A;  2DFI A;  2BHD A;  2GG3 A;  5FCH A;  2GG2 A;  3PKD A;  2BHB A;  5CE6 A;  3TB5 A;  5JFR A;  2EVO A;  2GU6 A;  2GG9 A;  1W2M A;  4IEC A;  4U6E A;  5FCF A;  1WN1 A;  3FMQ A;  4A6V A;  1WY2 A;  5D6E A;  1B59 A;  2NQ6 A;  4Z7M A;  2Q94 A;  1BOA A;  2BWY A;  3MX6 A;  4ZWU A;  1C22 A;  5CDV A;  3FM3 A;  4RZY A;  1WBQ A;  3CB5 A;  3BIP A;  4RGZ 1;  4S2R P;  2GZ5 A;  2Q93 A;  3FMR A;  4IDY A;  4IF7 A;  4U70 A;  1WL9 A;  4B28 A;  1KP0 A;  1O0X A;  1JAW A;  1R5H A;  1XGN A;  2GGB A;  2GU7 A;  2Q8K A;  1A16 A;  2V3Y A;  2GG8 A;  1W7V A;  2BWS A;  3L24 A;  2EA4 A;  3S6B A;  4FUK A;  4U6C A;  3PKB A;  4PNC A;  3I7M A;  4FO7 A;  3L7G A;  4MAT A;  1QXZ A;  3ROR A;  2BWW A;  2HOW A;  3Q6D A;  4S2T P;  3PN9 A;  4FO8 A;  4U1B A;  2GG5 A;  2ADU A;  1R58 A;  3IU7 A;  3BIQ A;  5CNX A;  4IKT A;  1PV9 A;  2BWX A;  2Q96 A;  4OOK A;  5JI6 A;  2P98 A;  4ZWP A;  2P9A A;  4U69 A;  4RZZ A;  2OKN A;  1YJ3 A;  2EA2 A;  1XGO A;  3MAT A;  2BHC A;  3IG4 A;  2GG0 A;  4U6W A;  2GU4 A;  5CLS A;  2ZSG A;  1YVM A;  5CDL A;  1XGS A;  2BHA A;  1M35 A;  2BWT A;  1MAT A;  4U71 A;  4A6W A;  2BWV A;  3QOC A;  1XNZ A;  4U75 A;  3CB6 A;  1YW9 A;  4ZNG A;  4JUQ A;  4QR8 A;  3MR1 A;  1QZY A;  3TAV A;  4U6Z A;  5JHU A;  1QXY A;  1WL6 A;  2GA2 A;  3O5V A;  5E5B A;  1KQ0 A;  4FLI A;  1WKM A;  2V6C A;  4PV4 A;  4FKC A;  2BN7 A;  1C27 A;  1BN5 A;  2OAZ A;  4S00 A;  3PKC A;  3BIT A;  4R60 A;  4IKU A;  2BWU A;  4IU6 A;  2BH3 A;  2BB7 A;  2GTX A;  3OOO A;  2V3X A;  1KQ9 A;  3CTZ A;  4S01 A;  4HXX A;  2B3L A;  2Q92 A;  3OVK A;  2GGC A;  4U76 A;  3PKE A;  1R5G A;  1Y1N A;  4FLK A;  1C23 A;  3PEB A;  2EVM A;  3D27 A;  4IKR A;  5D6F A;  5E2C A;  2G6P A;  3RVA A;  4KM3 A;  2P99 A;  1QXW A;  2Q95 A;  5CDE A;  1B6A A;  1XGM A;  4ZWO A;  5CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...