3CTZA

Structure of human cytosolic x-prolyl aminopeptidase
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
617
structure length
617
Chain Sequence
PKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase 1
publication title Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
pubmed doi rcsb
source organism Homo sapiens
total genus 207
structure length 617
sequence length 617
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
A PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
A PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA02
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ctzA03
3FM3A 1WKMA 4IKUA 1QXYA 3BITA 5E5BA 1XGSA 1C27A 2BN7A 4S2RP 4U6CA 3OOOA 2OKNA 5CDLA 3Q6DA 3PN9A 1YW8A 5CDEA 2EVMA 4IECA 2GZ5A 2EA2A 1XGNA 4FLJA 2BB7A 5E2CA 2Q8KA 1A16A 1R5HA 2Q94A 5D6EA 1C23A 2BH3A 5CE6A 2Q93A 1WL6A 4ZWUA 5D6FA 2V3XA 2GG8A 1WY2A 5JI6A 2BHDA 1Y1NA 1XGMA 3IU7A 2GU4A 3IU9A 2MATA 5CNXA 2NQ6A 1QXWA 3FMRA 5JHUA 4S00A 4QR8A 1PV9A 2BWYA 2GG5A 2P99A 2BWSA 1JAWA 1C24A 2GG3A 2V6CA 4HXXA 3MR1A 3I7MA 2Q96A 2EA4A 2GU6A 3L24A 4ZWOA 3MX6A 4U6WA 1C21A 4S01A 1KQ9A 2BWWA 2HOWA 2GGCA 5FCFA 1B6AA 1MATA 4U6JA 1B59A 1KP0A 4RZYA 1XGOA 2Q95A 3IU8A 4FLIA 4IKSA 4U1BA 3RORA 4ZWPA 2EVCA 2P9AA 4FUKA 4U76A 4U75A 4PV4A 4FLKA 3CTZA 4IKTA 1WL9A 3S6BA 1W2MA 3PEBA 1R5GA 4FKCA 3TB5A 4U70A 3PKEA 2P98A 3O5VA 2Q92A 3PKBA 4U73A 2ADUA 4A6WA 4OOKA 4U6EA 1WBQA 1QZYA 1M35A 1BOAA 3D27A 2B3KA 2GG7A 1N51A 5JFRA 4IF7A 1WN1A 4FO8A 4IU6A 1YW9A 4R60A 2GA2A 4IDYA 4PNCA 4Z7MA 2OAZA 3PKDA 1O0XA 4FLLA 3IG4A 2V3YA 1XNZA 2G6PA 2GG0A 3TAVA 2GU7A 2IW2A 4RZZA 4JUQA 3OVKA 1R58A 3BIQA 3RVAA 4B28A 4S2TP 2B3HA 3FMQA 1C22A 3CB6A 1WLRA 1YVMA 3IL0A 1W7VA 4EGEA 1CHMA 2GGBA 2GG2A 3L7GA 3CB5A 2BHAA 2BHBA 3BIPA 4RGZ1 3QOCA 2V3ZA 2BWVA 1YJ3A 2B3LA 2EVOA 3PKAA 3PKCA 4MATA 4U69A 4A6VA 2BWUA 4U71A 2BWXA 2GG9A 2ZSGA 2DFIA 4KM3A 4U6ZA 5CIKA 5FCHA 1KQ0A 2BWTA 2NQ7A 2GTXA 2GU5A 4FO7A 4IKRA 1YW7A 1QXZA 3MATA 5CLSA 2BHCA 5CDVA 4ZNGA 4IPAA 1BN5A
chains in the Genus database with same CATH superfamily
3FM3A 1WKMA 4IKUA 1QXYA 3BITA 5E5BA 1XGSA 1C27A 2BN7A 4S2RP 4U6CA 3OOOA 2OKNA 5CDLA 3Q6DA 3PN9A 1YW8A 5CDEA 2EVMA 4IECA 2GZ5A 2EA2A 1XGNA 4FLJA 2BB7A 5E2CA 2Q8KA 1A16A 1R5HA 2Q94A 5D6EA 1C23A 2BH3A 5CE6A 2Q93A 1WL6A 4ZWUA 5D6FA 2V3XA 2GG8A 1WY2A 5JI6A 2BHDA 1Y1NA 1XGMA 3IU7A 2GU4A 3IU9A 2MATA 5CNXA 2NQ6A 1QXWA 3FMRA 5JHUA 4S00A 4QR8A 1PV9A 2BWYA 2GG5A 2P99A 2BWSA 1JAWA 1C24A 2GG3A 2V6CA 4HXXA 3MR1A 3I7MA 2Q96A 2EA4A 2GU6A 3L24A 4ZWOA 3MX6A 4U6WA 1C21A 4S01A 1KQ9A 2BWWA 2HOWA 2GGCA 5FCFA 1B6AA 1MATA 4U6JA 1B59A 1KP0A 4RZYA 1XGOA 2Q95A 3IU8A 4FLIA 4IKSA 4U1BA 3RORA 4ZWPA 2EVCA 2P9AA 4FUKA 4U76A 4U75A 4PV4A 4FLKA 3CTZA 4IKTA 1WL9A 3S6BA 1W2MA 3PEBA 1R5GA 4FKCA 3TB5A 4U70A 3PKEA 2P98A 3O5VA 2Q92A 3PKBA 4U73A 2ADUA 4A6WA 4OOKA 4U6EA 1WBQA 1QZYA 1M35A 1BOAA 3D27A 2B3KA 2GG7A 1N51A 5JFRA 4IF7A 1WN1A 4FO8A 4IU6A 1YW9A 4R60A 2GA2A 4IDYA 4PNCA 4Z7MA 2OAZA 3PKDA 1O0XA 4FLLA 3IG4A 2V3YA 1XNZA 2G6PA 2GG0A 3TAVA 2GU7A 2IW2A 4RZZA 4JUQA 3OVKA 1R58A 3BIQA 3RVAA 4B28A 4S2TP 2B3HA 3FMQA 1C22A 3CB6A 1WLRA 1YVMA 3IL0A 1W7VA 4EGEA 1CHMA 2GGBA 2GG2A 3L7GA 3CB5A 2BHAA 2BHBA 3BIPA 4RGZ1 3QOCA 2V3ZA 2BWVA 1YJ3A 2B3LA 2EVOA 3PKAA 3PKCA 4MATA 4U69A 4A6VA 2BWUA 4U71A 2BWXA 2GG9A 2ZSGA 2DFIA 4KM3A 4U6ZA 5CIKA 5FCHA 1KQ0A 2BWTA 2NQ7A 2GTXA 2GU5A 4FO7A 4IKRA 1YW7A 1QXZA 3MATA 5CLSA 2BHCA 5CDVA 4ZNGA 4IPAA 1BN5A
chains in the Genus database with same CATH topology
3FM3A 1WKMA 4IKUA 1QXYA 3BITA 5E5BA 1XGSA 1C27A 2BN7A 4S2RP 4U6CA 3OOOA 2OKNA 5CDLA 3Q6DA 3PN9A 1YW8A 5CDEA 2EVMA 4IECA 2GZ5A 2EA2A 1XGNA 4FLJA 2BB7A 5E2CA 2Q8KA 1A16A 1R5HA 2Q94A 5D6EA 1C23A 2BH3A 5CE6A 2Q93A 1WL6A 4ZWUA 5D6FA 2V3XA 2GG8A 1WY2A 5JI6A 2BHDA 1Y1NA 1XGMA 3IU7A 2GU4A 3IU9A 2MATA 5CNXA 2NQ6A 1QXWA 3FMRA 5JHUA 4S00A 4QR8A 1PV9A 2BWYA 2GG5A 2P99A 2BWSA 1JAWA 1C24A 2GG3A 2V6CA 4HXXA 3MR1A 3I7MA 2Q96A 2EA4A 2GU6A 3L24A 4ZWOA 3MX6A 4U6WA 1C21A 4S01A 1KQ9A 2BWWA 2HOWA 2GGCA 5FCFA 1B6AA 1MATA 4U6JA 1B59A 1KP0A 4RZYA 1XGOA 2Q95A 3IU8A 4FLIA 4IKSA 4U1BA 3RORA 4ZWPA 2EVCA 2P9AA 4FUKA 4U76A 4U75A 4PV4A 4FLKA 3CTZA 4IKTA 1WL9A 3S6BA 1W2MA 3PEBA 1R5GA 4FKCA 3TB5A 4U70A 3PKEA 2P98A 3O5VA 2Q92A 3PKBA 4U73A 2ADUA 4A6WA 4OOKA 4U6EA 1WBQA 1QZYA 1M35A 1BOAA 3D27A 2B3KA 2GG7A 1N51A 5JFRA 4IF7A 1WN1A 4FO8A 4IU6A 1YW9A 4R60A 2GA2A 4IDYA 4PNCA 4Z7MA 2OAZA 3PKDA 1O0XA 4FLLA 3IG4A 2V3YA 1XNZA 2G6PA 2GG0A 3TAVA 2GU7A 2IW2A 4RZZA 4JUQA 3OVKA 1R58A 3BIQA 3RVAA 4B28A 4S2TP 2B3HA 3FMQA 1C22A 3CB6A 1WLRA 1YVMA 3IL0A 1W7VA 4EGEA 1CHMA 2GGBA 2GG2A 3L7GA 3CB5A 2BHAA 2BHBA 3BIPA 4RGZ1 3QOCA 2V3ZA 2BWVA 1YJ3A 2B3LA 2EVOA 3PKAA 3PKCA 4MATA 4U69A 4A6VA 2BWUA 4U71A 2BWXA 2GG9A 2ZSGA 2DFIA 4KM3A 4U6ZA 5CIKA 5FCHA 1KQ0A 2BWTA 2NQ7A 2GTXA 2GU5A 4FO7A 4IKRA 1YW7A 1QXZA 3MATA 5CLSA 2BHCA 5CDVA 4ZNGA 4IPAA 1BN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM3 A;  1WKM A;  4IKU A;  1QXY A;  3BIT A;  5E5B A;  1XGS A;  1C27 A;  2BN7 A;  4S2R P;  4U6C A;  3OOO A;  2OKN A;  5CDL A;  3Q6D A;  3PN9 A;  1YW8 A;  5CDE A;  2EVM A;  4IEC A;  2GZ5 A;  2EA2 A;  1XGN A;  4FLJ A;  2BB7 A;  5E2C A;  2Q8K A;  1A16 A;  1R5H A;  2Q94 A;  5D6E A;  1C23 A;  2BH3 A;  5CE6 A;  2Q93 A;  1WL6 A;  4ZWU A;  5D6F A;  2V3X A;  2GG8 A;  1WY2 A;  5JI6 A;  2BHD A;  1Y1N A;  1XGM A;  3IU7 A;  2GU4 A;  3IU9 A;  2MAT A;  5CNX A;  2NQ6 A;  1QXW A;  3FMR A;  5JHU A;  4S00 A;  4QR8 A;  1PV9 A;  2BWY A;  2GG5 A;  2P99 A;  2BWS A;  1JAW A;  1C24 A;  2GG3 A;  2V6C A;  4HXX A;  3MR1 A;  3I7M A;  2Q96 A;  2EA4 A;  2GU6 A;  3L24 A;  4ZWO A;  3MX6 A;  4U6W A;  1C21 A;  4S01 A;  1KQ9 A;  2BWW A;  2HOW A;  2GGC A;  5FCF A;  1B6A A;  1MAT A;  4U6J A;  1B59 A;  1KP0 A;  4RZY A;  1XGO A;  2Q95 A;  3IU8 A;  4FLI A;  4IKS A;  4U1B A;  3ROR A;  4ZWP A;  2EVC A;  2P9A A;  4FUK A;  4U76 A;  4U75 A;  4PV4 A;  4FLK A;  3CTZ A;  4IKT A;  1WL9 A;  3S6B A;  1W2M A;  3PEB A;  1R5G A;  4FKC A;  3TB5 A;  4U70 A;  3PKE A;  2P98 A;  3O5V A;  2Q92 A;  3PKB A;  4U73 A;  2ADU A;  4A6W A;  4OOK A;  4U6E A;  1WBQ A;  1QZY A;  1M35 A;  1BOA A;  3D27 A;  2B3K A;  2GG7 A;  1N51 A;  5JFR A;  4IF7 A;  1WN1 A;  4FO8 A;  4IU6 A;  1YW9 A;  4R60 A;  2GA2 A;  4IDY A;  4PNC A;  4Z7M A;  2OAZ A;  3PKD A;  1O0X A;  4FLL A;  3IG4 A;  2V3Y A;  1XNZ A;  2G6P A;  2GG0 A;  3TAV A;  2GU7 A;  2IW2 A;  4RZZ A;  4JUQ A;  3OVK A;  1R58 A;  3BIQ A;  3RVA A;  4B28 A;  4S2T P;  2B3H A;  3FMQ A;  1C22 A;  3CB6 A;  1WLR A;  1YVM A;  3IL0 A;  1W7V A;  4EGE A;  1CHM A;  2GGB A;  2GG2 A;  3L7G A;  3CB5 A;  2BHA A;  2BHB A;  3BIP A;  4RGZ 1;  3QOC A;  2V3Z A;  2BWV A;  1YJ3 A;  2B3L A;  2EVO A;  3PKA A;  3PKC A;  4MAT A;  4U69 A;  4A6V A;  2BWU A;  4U71 A;  2BWX A;  2GG9 A;  2ZSG A;  2DFI A;  4KM3 A;  4U6Z A;  5CIK A;  5FCH A;  1KQ0 A;  2BWT A;  2NQ7 A;  2GTX A;  2GU5 A;  4FO7 A;  4IKR A;  1YW7 A;  1QXZ A;  3MAT A;  5CLS A;  2BHC A;  5CDV A;  4ZNG A;  4IPA A;  1BN5 A; 
#chains in the Genus database with same CATH topology
 3FM3 A;  1WKM A;  4IKU A;  1QXY A;  3BIT A;  5E5B A;  1XGS A;  1C27 A;  2BN7 A;  4S2R P;  4U6C A;  3OOO A;  2OKN A;  5CDL A;  3Q6D A;  3PN9 A;  1YW8 A;  5CDE A;  2EVM A;  4IEC A;  2GZ5 A;  2EA2 A;  1XGN A;  4FLJ A;  2BB7 A;  5E2C A;  2Q8K A;  1A16 A;  1R5H A;  2Q94 A;  5D6E A;  1C23 A;  2BH3 A;  5CE6 A;  2Q93 A;  1WL6 A;  4ZWU A;  5D6F A;  2V3X A;  2GG8 A;  1WY2 A;  5JI6 A;  2BHD A;  1Y1N A;  1XGM A;  3IU7 A;  2GU4 A;  3IU9 A;  2MAT A;  5CNX A;  2NQ6 A;  1QXW A;  3FMR A;  5JHU A;  4S00 A;  4QR8 A;  1PV9 A;  2BWY A;  2GG5 A;  2P99 A;  2BWS A;  1JAW A;  1C24 A;  2GG3 A;  2V6C A;  4HXX A;  3MR1 A;  3I7M A;  2Q96 A;  2EA4 A;  2GU6 A;  3L24 A;  4ZWO A;  3MX6 A;  4U6W A;  1C21 A;  4S01 A;  1KQ9 A;  2BWW A;  2HOW A;  2GGC A;  5FCF A;  1B6A A;  1MAT A;  4U6J A;  1B59 A;  1KP0 A;  4RZY A;  1XGO A;  2Q95 A;  3IU8 A;  4FLI A;  4IKS A;  4U1B A;  3ROR A;  4ZWP A;  2EVC A;  2P9A A;  4FUK A;  4U76 A;  4U75 A;  4PV4 A;  4FLK A;  3CTZ A;  4IKT A;  1WL9 A;  3S6B A;  1W2M A;  3PEB A;  1R5G A;  4FKC A;  3TB5 A;  4U70 A;  3PKE A;  2P98 A;  3O5V A;  2Q92 A;  3PKB A;  4U73 A;  2ADU A;  4A6W A;  4OOK A;  4U6E A;  1WBQ A;  1QZY A;  1M35 A;  1BOA A;  3D27 A;  2B3K A;  2GG7 A;  1N51 A;  5JFR A;  4IF7 A;  1WN1 A;  4FO8 A;  4IU6 A;  1YW9 A;  4R60 A;  2GA2 A;  4IDY A;  4PNC A;  4Z7M A;  2OAZ A;  3PKD A;  1O0X A;  4FLL A;  3IG4 A;  2V3Y A;  1XNZ A;  2G6P A;  2GG0 A;  3TAV A;  2GU7 A;  2IW2 A;  4RZZ A;  4JUQ A;  3OVK A;  1R58 A;  3BIQ A;  3RVA A;  4B28 A;  4S2T P;  2B3H A;  3FMQ A;  1C22 A;  3CB6 A;  1WLR A;  1YVM A;  3IL0 A;  1W7V A;  4EGE A;  1CHM A;  2GGB A;  2GG2 A;  3L7G A;  3CB5 A;  2BHA A;  2BHB A;  3BIP A;  4RGZ 1;  3QOC A;  2V3Z A;  2BWV A;  1YJ3 A;  2B3L A;  2EVO A;  3PKA A;  3PKC A;  4MAT A;  4U69 A;  4A6V A;  2BWU A;  4U71 A;  2BWX A;  2GG9 A;  2ZSG A;  2DFI A;  4KM3 A;  4U6Z A;  5CIK A;  5FCH A;  1KQ0 A;  2BWT A;  2NQ7 A;  2GTX A;  2GU5 A;  4FO7 A;  4IKR A;  1YW7 A;  1QXZ A;  3MAT A;  5CLS A;  2BHC A;  5CDV A;  4ZNG A;  4IPA A;  1BN5 A; 
#chains in the Genus database with same CATH homology
 3FM3 A;  1WKM A;  4IKU A;  1QXY A;  3BIT A;  5E5B A;  1XGS A;  1C27 A;  2BN7 A;  4S2R P;  4U6C A;  3OOO A;  2OKN A;  5CDL A;  3Q6D A;  3PN9 A;  1YW8 A;  5CDE A;  2EVM A;  4IEC A;  2GZ5 A;  2EA2 A;  1XGN A;  4FLJ A;  2BB7 A;  5E2C A;  2Q8K A;  1A16 A;  1R5H A;  2Q94 A;  5D6E A;  1C23 A;  2BH3 A;  5CE6 A;  2Q93 A;  1WL6 A;  4ZWU A;  5D6F A;  2V3X A;  2GG8 A;  1WY2 A;  5JI6 A;  2BHD A;  1Y1N A;  1XGM A;  3IU7 A;  2GU4 A;  3IU9 A;  2MAT A;  5CNX A;  2NQ6 A;  1QXW A;  3FMR A;  5JHU A;  4S00 A;  4QR8 A;  1PV9 A;  2BWY A;  2GG5 A;  2P99 A;  2BWS A;  1JAW A;  1C24 A;  2GG3 A;  2V6C A;  4HXX A;  3MR1 A;  3I7M A;  2Q96 A;  2EA4 A;  2GU6 A;  3L24 A;  4ZWO A;  3MX6 A;  4U6W A;  1C21 A;  4S01 A;  1KQ9 A;  2BWW A;  2HOW A;  2GGC A;  5FCF A;  1B6A A;  1MAT A;  4U6J A;  1B59 A;  1KP0 A;  4RZY A;  1XGO A;  2Q95 A;  3IU8 A;  4FLI A;  4IKS A;  4U1B A;  3ROR A;  4ZWP A;  2EVC A;  2P9A A;  4FUK A;  4U76 A;  4U75 A;  4PV4 A;  4FLK A;  3CTZ A;  4IKT A;  1WL9 A;  3S6B A;  1W2M A;  3PEB A;  1R5G A;  4FKC A;  3TB5 A;  4U70 A;  3PKE A;  2P98 A;  3O5V A;  2Q92 A;  3PKB A;  4U73 A;  2ADU A;  4A6W A;  4OOK A;  4U6E A;  1WBQ A;  1QZY A;  1M35 A;  1BOA A;  3D27 A;  2B3K A;  2GG7 A;  1N51 A;  5JFR A;  4IF7 A;  1WN1 A;  4FO8 A;  4IU6 A;  1YW9 A;  4R60 A;  2GA2 A;  4IDY A;  4PNC A;  4Z7M A;  2OAZ A;  3PKD A;  1O0X A;  4FLL A;  3IG4 A;  2V3Y A;  1XNZ A;  2G6P A;  2GG0 A;  3TAV A;  2GU7 A;  2IW2 A;  4RZZ A;  4JUQ A;  3OVK A;  1R58 A;  3BIQ A;  3RVA A;  4B28 A;  4S2T P;  2B3H A;  3FMQ A;  1C22 A;  3CB6 A;  1WLR A;  1YVM A;  3IL0 A;  1W7V A;  4EGE A;  1CHM A;  2GGB A;  2GG2 A;  3L7G A;  3CB5 A;  2BHA A;  2BHB A;  3BIP A;  4RGZ 1;  3QOC A;  2V3Z A;  2BWV A;  1YJ3 A;  2B3L A;  2EVO A;  3PKA A;  3PKC A;  4MAT A;  4U69 A;  4A6V A;  2BWU A;  4U71 A;  2BWX A;  2GG9 A;  2ZSG A;  2DFI A;  4KM3 A;  4U6Z A;  5CIK A;  5FCH A;  1KQ0 A;  2BWT A;  2NQ7 A;  2GTX A;  2GU5 A;  4FO7 A;  4IKR A;  1YW7 A;  1QXZ A;  3MAT A;  5CLS A;  2BHC A;  5CDV A;  4ZNG A;  4IPA A;  1BN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...