3CTZA

Structure of human cytosolic x-prolyl aminopeptidase
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
617
structure length
617
Chain Sequence
b'PKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xaa-Pro aminopeptidase 1
publication title Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 207
structure length 617
sequence length 617
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
A PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
A PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA02
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ctzA03
2BHBA 5JFRA 3FMQA 2V3ZA 2GGBA 5FCHA 1M35A 1BOAA 4JUQA 4S2RP 1JAWA 5FCFA 3BITA 4B28A 3PKEA 1YW9A 2GG9A 2BHCA 3PKAA 3L24A 1W7VA 4RZZA 2BH3A 2DFIA 4U1BA 4ZWPA 4ZWUA 1BN5A 1B6AA 2EA4A 5CLSA 3PEBA 2GTXA 1C21A 3PKBA 4IKTA 4FLKA 1W2MA 4Z7MA 2GU5A 3IU7A 5E2CA 2OAZA 1WL6A 2OKNA 2GZ5A 2GG5A 4FLLA 4R60A 4FUKA 2BWUA 2B3HA 4PNCA 4FKCA 2GG8A 5JHUA 4U69A 5CNXA 2GG0A 2B3LA 1XGOA 2BWYA 3RVAA 4OOKA 5CIKA 4U6ZA 4QR8A 2Q93A 1N51A 4S01A 2G6PA 5JI6A 4U70A 4U6EA 4IF7A 3TAVA 3IU9A 4A6VA 1PV9A 4U6WA 1KQ9A 2NQ7A 2P98A 4ZNGA 1WKMA 2EVOA 4IKUA 4RGZ1 2Q94A 1R5HA 1C24A 1Y1NA 4FO8A 1XNZA 3I7MA 3PKCA 2BHAA 1WL9A 2GA2A 4U73A 2GU7A 2EVMA 2BB7A 3D27A 2IW2A 1WLRA 4MATA 1KQ0A 4IKRA 4U75A 3OOOA 3QOCA 3MATA 4FLJA 3Q6DA 2BWVA 4HXXA 3FMRA 3IU8A 4U76A 1YJ3A 1R5GA 4IKSA 3MR1A 2V3XA 1O0XA 3TB5A 5D6EA 1YW7A 2EA2A 2ZSGA 3PKDA 3PN9A 1WBQA 3O5VA 4ZWOA 2V3YA 2EVCA 4U6JA 2BWSA 2P9AA 2NQ6A 1QXZA 2BHDA 1MATA 1R58A 4IU6A 5CDEA 3IL0A 3RORA 1B59A 1WN1A 1YVMA 3BIQA 2GU6A 2B3KA 4S2TP 4EGEA 2GG3A 4KM3A 2BWWA 4FO7A 5CDLA 3IG4A 2GU4A 5D6FA 1C22A 2P99A 4U6CA 5CDVA 3OVKA 1C23A 3FM3A 3CB5A 2Q8KA 1XGMA 4IDYA 4IECA 4U71A 1XGNA 2ADUA 4IPAA 2MATA 3S6BA 1QXYA 3CTZA 1YW8A 4FLIA 2BWXA 2BN7A 2GGCA 4PV4A 2GG7A 1XGSA 2HOWA 3L7GA 1CHMA 2V6CA 2Q95A 4S00A 1WY2A 1A16A 2BWTA 1C27A 3BIPA 5E5BA 4RZYA 1QXWA 3MX6A 2GG2A 2Q92A 4A6WA 5CE6A 2Q96A 1KP0A 3CB6A 1QZYA
chains in the Genus database with same CATH superfamily
2BHBA 5JFRA 3FMQA 2V3ZA 2GGBA 5FCHA 1M35A 1BOAA 4JUQA 4S2RP 1JAWA 5FCFA 3BITA 4B28A 3PKEA 1YW9A 2GG9A 2BHCA 3PKAA 3L24A 1W7VA 4RZZA 2BH3A 2DFIA 4U1BA 4ZWPA 4ZWUA 1BN5A 1B6AA 2EA4A 5CLSA 3PEBA 2GTXA 1C21A 3PKBA 4IKTA 4FLKA 1W2MA 4Z7MA 2GU5A 3IU7A 5E2CA 2OAZA 1WL6A 2OKNA 2GZ5A 2GG5A 4FLLA 4R60A 4FUKA 2BWUA 2B3HA 4PNCA 4FKCA 2GG8A 5JHUA 4U69A 5CNXA 2GG0A 2B3LA 1XGOA 2BWYA 3RVAA 4OOKA 5CIKA 4U6ZA 4QR8A 2Q93A 1N51A 4S01A 2G6PA 5JI6A 4U70A 4U6EA 4IF7A 3TAVA 3IU9A 4A6VA 1PV9A 4U6WA 1KQ9A 2NQ7A 2P98A 4ZNGA 1WKMA 2EVOA 4IKUA 4RGZ1 2Q94A 1R5HA 1C24A 1Y1NA 4FO8A 1XNZA 3I7MA 3PKCA 2BHAA 1WL9A 2GA2A 4U73A 2GU7A 2EVMA 2BB7A 3D27A 2IW2A 1WLRA 4MATA 1KQ0A 4IKRA 4U75A 3OOOA 3QOCA 3MATA 4FLJA 3Q6DA 2BWVA 4HXXA 3FMRA 3IU8A 4U76A 1YJ3A 1R5GA 4IKSA 3MR1A 2V3XA 1O0XA 3TB5A 5D6EA 1YW7A 2EA2A 2ZSGA 3PKDA 3PN9A 1WBQA 3O5VA 4ZWOA 2V3YA 2EVCA 4U6JA 2BWSA 2P9AA 2NQ6A 1QXZA 2BHDA 1MATA 1R58A 4IU6A 5CDEA 3IL0A 3RORA 1B59A 1WN1A 1YVMA 3BIQA 2GU6A 2B3KA 4S2TP 4EGEA 2GG3A 4KM3A 2BWWA 4FO7A 5CDLA 3IG4A 2GU4A 5D6FA 1C22A 2P99A 4U6CA 5CDVA 3OVKA 1C23A 3FM3A 3CB5A 2Q8KA 1XGMA 4IDYA 4IECA 4U71A 1XGNA 2ADUA 4IPAA 2MATA 3S6BA 1QXYA 3CTZA 1YW8A 4FLIA 2BWXA 2BN7A 2GGCA 4PV4A 2GG7A 1XGSA 2HOWA 3L7GA 1CHMA 2V6CA 2Q95A 4S00A 1WY2A 1A16A 2BWTA 1C27A 3BIPA 5E5BA 4RZYA 1QXWA 3MX6A 2GG2A 2Q92A 4A6WA 5CE6A 2Q96A 1KP0A 3CB6A 1QZYA
chains in the Genus database with same CATH topology
2BHBA 5JFRA 3FMQA 2V3ZA 2GGBA 5FCHA 1M35A 1BOAA 4JUQA 4S2RP 1JAWA 5FCFA 3BITA 4B28A 3PKEA 1YW9A 2GG9A 2BHCA 3PKAA 3L24A 1W7VA 4RZZA 2BH3A 2DFIA 4U1BA 4ZWPA 4ZWUA 1BN5A 1B6AA 2EA4A 5CLSA 3PEBA 2GTXA 1C21A 3PKBA 4IKTA 4FLKA 1W2MA 4Z7MA 2GU5A 3IU7A 5E2CA 2OAZA 1WL6A 2OKNA 2GZ5A 2GG5A 4FLLA 4R60A 4FUKA 2BWUA 2B3HA 4PNCA 4FKCA 2GG8A 5JHUA 4U69A 5CNXA 2GG0A 2B3LA 1XGOA 2BWYA 3RVAA 4OOKA 5CIKA 4U6ZA 4QR8A 2Q93A 1N51A 4S01A 2G6PA 5JI6A 4U70A 4U6EA 4IF7A 3TAVA 3IU9A 4A6VA 1PV9A 4U6WA 1KQ9A 2NQ7A 2P98A 4ZNGA 1WKMA 2EVOA 4IKUA 4RGZ1 2Q94A 1R5HA 1C24A 1Y1NA 4FO8A 1XNZA 3I7MA 3PKCA 2BHAA 1WL9A 2GA2A 4U73A 2GU7A 2EVMA 2BB7A 3D27A 2IW2A 1WLRA 4MATA 1KQ0A 4IKRA 4U75A 3OOOA 3QOCA 3MATA 4FLJA 3Q6DA 2BWVA 4HXXA 3FMRA 3IU8A 4U76A 1YJ3A 1R5GA 4IKSA 3MR1A 2V3XA 1O0XA 3TB5A 5D6EA 1YW7A 2EA2A 2ZSGA 3PKDA 3PN9A 1WBQA 3O5VA 4ZWOA 2V3YA 2EVCA 4U6JA 2BWSA 2P9AA 2NQ6A 1QXZA 2BHDA 1MATA 1R58A 4IU6A 5CDEA 3IL0A 3RORA 1B59A 1WN1A 1YVMA 3BIQA 2GU6A 2B3KA 4S2TP 4EGEA 2GG3A 4KM3A 2BWWA 4FO7A 5CDLA 3IG4A 2GU4A 5D6FA 1C22A 2P99A 4U6CA 5CDVA 3OVKA 1C23A 3FM3A 3CB5A 2Q8KA 1XGMA 4IDYA 4IECA 4U71A 1XGNA 2ADUA 4IPAA 2MATA 3S6BA 1QXYA 3CTZA 1YW8A 4FLIA 2BWXA 2BN7A 2GGCA 4PV4A 2GG7A 1XGSA 2HOWA 3L7GA 1CHMA 2V6CA 2Q95A 4S00A 1WY2A 1A16A 2BWTA 1C27A 3BIPA 5E5BA 4RZYA 1QXWA 3MX6A 2GG2A 2Q92A 4A6WA 5CE6A 2Q96A 1KP0A 3CB6A 1QZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  5JFR A;  3FMQ A;  2V3Z A;  2GGB A;  5FCH A;  1M35 A;  1BOA A;  4JUQ A;  4S2R P;  1JAW A;  5FCF A;  3BIT A;  4B28 A;  3PKE A;  1YW9 A;  2GG9 A;  2BHC A;  3PKA A;  3L24 A;  1W7V A;  4RZZ A;  2BH3 A;  2DFI A;  4U1B A;  4ZWP A;  4ZWU A;  1BN5 A;  1B6A A;  2EA4 A;  5CLS A;  3PEB A;  2GTX A;  1C21 A;  3PKB A;  4IKT A;  4FLK A;  1W2M A;  4Z7M A;  2GU5 A;  3IU7 A;  5E2C A;  2OAZ A;  1WL6 A;  2OKN A;  2GZ5 A;  2GG5 A;  4FLL A;  4R60 A;  4FUK A;  2BWU A;  2B3H A;  4PNC A;  4FKC A;  2GG8 A;  5JHU A;  4U69 A;  5CNX A;  2GG0 A;  2B3L A;  1XGO A;  2BWY A;  3RVA A;  4OOK A;  5CIK A;  4U6Z A;  4QR8 A;  2Q93 A;  1N51 A;  4S01 A;  2G6P A;  5JI6 A;  4U70 A;  4U6E A;  4IF7 A;  3TAV A;  3IU9 A;  4A6V A;  1PV9 A;  4U6W A;  1KQ9 A;  2NQ7 A;  2P98 A;  4ZNG A;  1WKM A;  2EVO A;  4IKU A;  4RGZ 1;  2Q94 A;  1R5H A;  1C24 A;  1Y1N A;  4FO8 A;  1XNZ A;  3I7M A;  3PKC A;  2BHA A;  1WL9 A;  2GA2 A;  4U73 A;  2GU7 A;  2EVM A;  2BB7 A;  3D27 A;  2IW2 A;  1WLR A;  4MAT A;  1KQ0 A;  4IKR A;  4U75 A;  3OOO A;  3QOC A;  3MAT A;  4FLJ A;  3Q6D A;  2BWV A;  4HXX A;  3FMR A;  3IU8 A;  4U76 A;  1YJ3 A;  1R5G A;  4IKS A;  3MR1 A;  2V3X A;  1O0X A;  3TB5 A;  5D6E A;  1YW7 A;  2EA2 A;  2ZSG A;  3PKD A;  3PN9 A;  1WBQ A;  3O5V A;  4ZWO A;  2V3Y A;  2EVC A;  4U6J A;  2BWS A;  2P9A A;  2NQ6 A;  1QXZ A;  2BHD A;  1MAT A;  1R58 A;  4IU6 A;  5CDE A;  3IL0 A;  3ROR A;  1B59 A;  1WN1 A;  1YVM A;  3BIQ A;  2GU6 A;  2B3K A;  4S2T P;  4EGE A;  2GG3 A;  4KM3 A;  2BWW A;  4FO7 A;  5CDL A;  3IG4 A;  2GU4 A;  5D6F A;  1C22 A;  2P99 A;  4U6C A;  5CDV A;  3OVK A;  1C23 A;  3FM3 A;  3CB5 A;  2Q8K A;  1XGM A;  4IDY A;  4IEC A;  4U71 A;  1XGN A;  2ADU A;  4IPA A;  2MAT A;  3S6B A;  1QXY A;  3CTZ A;  1YW8 A;  4FLI A;  2BWX A;  2BN7 A;  2GGC A;  4PV4 A;  2GG7 A;  1XGS A;  2HOW A;  3L7G A;  1CHM A;  2V6C A;  2Q95 A;  4S00 A;  1WY2 A;  1A16 A;  2BWT A;  1C27 A;  3BIP A;  5E5B A;  4RZY A;  1QXW A;  3MX6 A;  2GG2 A;  2Q92 A;  4A6W A;  5CE6 A;  2Q96 A;  1KP0 A;  3CB6 A;  1QZY A; 
#chains in the Genus database with same CATH topology
 2BHB A;  5JFR A;  3FMQ A;  2V3Z A;  2GGB A;  5FCH A;  1M35 A;  1BOA A;  4JUQ A;  4S2R P;  1JAW A;  5FCF A;  3BIT A;  4B28 A;  3PKE A;  1YW9 A;  2GG9 A;  2BHC A;  3PKA A;  3L24 A;  1W7V A;  4RZZ A;  2BH3 A;  2DFI A;  4U1B A;  4ZWP A;  4ZWU A;  1BN5 A;  1B6A A;  2EA4 A;  5CLS A;  3PEB A;  2GTX A;  1C21 A;  3PKB A;  4IKT A;  4FLK A;  1W2M A;  4Z7M A;  2GU5 A;  3IU7 A;  5E2C A;  2OAZ A;  1WL6 A;  2OKN A;  2GZ5 A;  2GG5 A;  4FLL A;  4R60 A;  4FUK A;  2BWU A;  2B3H A;  4PNC A;  4FKC A;  2GG8 A;  5JHU A;  4U69 A;  5CNX A;  2GG0 A;  2B3L A;  1XGO A;  2BWY A;  3RVA A;  4OOK A;  5CIK A;  4U6Z A;  4QR8 A;  2Q93 A;  1N51 A;  4S01 A;  2G6P A;  5JI6 A;  4U70 A;  4U6E A;  4IF7 A;  3TAV A;  3IU9 A;  4A6V A;  1PV9 A;  4U6W A;  1KQ9 A;  2NQ7 A;  2P98 A;  4ZNG A;  1WKM A;  2EVO A;  4IKU A;  4RGZ 1;  2Q94 A;  1R5H A;  1C24 A;  1Y1N A;  4FO8 A;  1XNZ A;  3I7M A;  3PKC A;  2BHA A;  1WL9 A;  2GA2 A;  4U73 A;  2GU7 A;  2EVM A;  2BB7 A;  3D27 A;  2IW2 A;  1WLR A;  4MAT A;  1KQ0 A;  4IKR A;  4U75 A;  3OOO A;  3QOC A;  3MAT A;  4FLJ A;  3Q6D A;  2BWV A;  4HXX A;  3FMR A;  3IU8 A;  4U76 A;  1YJ3 A;  1R5G A;  4IKS A;  3MR1 A;  2V3X A;  1O0X A;  3TB5 A;  5D6E A;  1YW7 A;  2EA2 A;  2ZSG A;  3PKD A;  3PN9 A;  1WBQ A;  3O5V A;  4ZWO A;  2V3Y A;  2EVC A;  4U6J A;  2BWS A;  2P9A A;  2NQ6 A;  1QXZ A;  2BHD A;  1MAT A;  1R58 A;  4IU6 A;  5CDE A;  3IL0 A;  3ROR A;  1B59 A;  1WN1 A;  1YVM A;  3BIQ A;  2GU6 A;  2B3K A;  4S2T P;  4EGE A;  2GG3 A;  4KM3 A;  2BWW A;  4FO7 A;  5CDL A;  3IG4 A;  2GU4 A;  5D6F A;  1C22 A;  2P99 A;  4U6C A;  5CDV A;  3OVK A;  1C23 A;  3FM3 A;  3CB5 A;  2Q8K A;  1XGM A;  4IDY A;  4IEC A;  4U71 A;  1XGN A;  2ADU A;  4IPA A;  2MAT A;  3S6B A;  1QXY A;  3CTZ A;  1YW8 A;  4FLI A;  2BWX A;  2BN7 A;  2GGC A;  4PV4 A;  2GG7 A;  1XGS A;  2HOW A;  3L7G A;  1CHM A;  2V6C A;  2Q95 A;  4S00 A;  1WY2 A;  1A16 A;  2BWT A;  1C27 A;  3BIP A;  5E5B A;  4RZY A;  1QXW A;  3MX6 A;  2GG2 A;  2Q92 A;  4A6W A;  5CE6 A;  2Q96 A;  1KP0 A;  3CB6 A;  1QZY A; 
#chains in the Genus database with same CATH homology
 2BHB A;  5JFR A;  3FMQ A;  2V3Z A;  2GGB A;  5FCH A;  1M35 A;  1BOA A;  4JUQ A;  4S2R P;  1JAW A;  5FCF A;  3BIT A;  4B28 A;  3PKE A;  1YW9 A;  2GG9 A;  2BHC A;  3PKA A;  3L24 A;  1W7V A;  4RZZ A;  2BH3 A;  2DFI A;  4U1B A;  4ZWP A;  4ZWU A;  1BN5 A;  1B6A A;  2EA4 A;  5CLS A;  3PEB A;  2GTX A;  1C21 A;  3PKB A;  4IKT A;  4FLK A;  1W2M A;  4Z7M A;  2GU5 A;  3IU7 A;  5E2C A;  2OAZ A;  1WL6 A;  2OKN A;  2GZ5 A;  2GG5 A;  4FLL A;  4R60 A;  4FUK A;  2BWU A;  2B3H A;  4PNC A;  4FKC A;  2GG8 A;  5JHU A;  4U69 A;  5CNX A;  2GG0 A;  2B3L A;  1XGO A;  2BWY A;  3RVA A;  4OOK A;  5CIK A;  4U6Z A;  4QR8 A;  2Q93 A;  1N51 A;  4S01 A;  2G6P A;  5JI6 A;  4U70 A;  4U6E A;  4IF7 A;  3TAV A;  3IU9 A;  4A6V A;  1PV9 A;  4U6W A;  1KQ9 A;  2NQ7 A;  2P98 A;  4ZNG A;  1WKM A;  2EVO A;  4IKU A;  4RGZ 1;  2Q94 A;  1R5H A;  1C24 A;  1Y1N A;  4FO8 A;  1XNZ A;  3I7M A;  3PKC A;  2BHA A;  1WL9 A;  2GA2 A;  4U73 A;  2GU7 A;  2EVM A;  2BB7 A;  3D27 A;  2IW2 A;  1WLR A;  4MAT A;  1KQ0 A;  4IKR A;  4U75 A;  3OOO A;  3QOC A;  3MAT A;  4FLJ A;  3Q6D A;  2BWV A;  4HXX A;  3FMR A;  3IU8 A;  4U76 A;  1YJ3 A;  1R5G A;  4IKS A;  3MR1 A;  2V3X A;  1O0X A;  3TB5 A;  5D6E A;  1YW7 A;  2EA2 A;  2ZSG A;  3PKD A;  3PN9 A;  1WBQ A;  3O5V A;  4ZWO A;  2V3Y A;  2EVC A;  4U6J A;  2BWS A;  2P9A A;  2NQ6 A;  1QXZ A;  2BHD A;  1MAT A;  1R58 A;  4IU6 A;  5CDE A;  3IL0 A;  3ROR A;  1B59 A;  1WN1 A;  1YVM A;  3BIQ A;  2GU6 A;  2B3K A;  4S2T P;  4EGE A;  2GG3 A;  4KM3 A;  2BWW A;  4FO7 A;  5CDL A;  3IG4 A;  2GU4 A;  5D6F A;  1C22 A;  2P99 A;  4U6C A;  5CDV A;  3OVK A;  1C23 A;  3FM3 A;  3CB5 A;  2Q8K A;  1XGM A;  4IDY A;  4IEC A;  4U71 A;  1XGN A;  2ADU A;  4IPA A;  2MAT A;  3S6B A;  1QXY A;  3CTZ A;  1YW8 A;  4FLI A;  2BWX A;  2BN7 A;  2GGC A;  4PV4 A;  2GG7 A;  1XGS A;  2HOW A;  3L7G A;  1CHM A;  2V6C A;  2Q95 A;  4S00 A;  1WY2 A;  1A16 A;  2BWT A;  1C27 A;  3BIP A;  5E5B A;  4RZY A;  1QXW A;  3MX6 A;  2GG2 A;  2Q92 A;  4A6W A;  5CE6 A;  2Q96 A;  1KP0 A;  3CB6 A;  1QZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...