3CTZA

Structure of human cytosolic x-prolyl aminopeptidase
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
617
structure length
617
Chain Sequence
PKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xaa-Pro aminopeptidase 1
publication title Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 207
structure length 617
sequence length 617
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
A PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
A PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA02
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ctzA03
4A6WA 2BH3A 2OAZA 2B3KA 4MATA 4U76A 1R58A 3IL0A 3TB5A 3Q6DA 1MATA 2BWTA 5FCFA 3BIPA 1QXZA 2V3YA 3FM3A 4FLKA 3RORA 1A16A 1WL9A 2DFIA 2GTXA 4IKTA 4IPAA 3BIQA 3FMRA 2GU4A 3PKAA 1KQ0A 2BB7A 1N51A 3I7MA 4FO7A 4R60A 5CDEA 4ZNGA 5CE6A 2GGBA 4U69A 1XNZA 4IDYA 3MR1A 3L7GA 4S00A 1Y1NA 2V6CA 4FKCA 1QXWA 4U6WA 2EVMA 2P99A 3FMQA 2P98A 4U70A 1B6AA 2GU7A 1R5HA 4QR8A 2B3LA 4U6JA 2B3HA 4KM3A 1W7VA 5JI6A 5CNXA 2GA2A 2EVCA 4U73A 4PV4A 4ZWOA 1XGSA 3CTZA 5CDVA 1KQ9A 4S2TP 1C23A 1R5GA 1M35A 2GG2A 2Q95A 3OOOA 3L24A 3RVAA 2BWVA 1YVMA 4IU6A 2GGCA 1WLRA 2IW2A 2BWYA 3CB5A 4FLJA 4S01A 1JAWA 1YW7A 4U6CA 2Q8KA 1C27A 1QXYA 1QZYA 5E2CA 1WKMA 4IKRA 4OOKA 4PNCA 4RZYA 2ZSGA 3QOCA 2GU6A 3IU9A 1PV9A 3IG4A 4A6VA 4FO8A 1O0XA 2BN7A 5CIKA 2GG5A 4U71A 5CLSA 3MX6A 3PKBA 2MATA 1XGNA 4FUKA 3PEBA 2ADUA 1XGOA 2GG0A 2BWWA 3PKCA 2G6PA 4IF7A 4RZZA 2BHBA 4RGZ1 1XGMA 1YJ3A 2GG7A 2OKNA 3IU8A 5FCHA 3S6BA 4B28A 3OVKA 2GG3A 3PKEA 2EA4A 1KP0A 1B59A 1C24A 2Q96A 3O5VA 2BWXA 4EGEA 1BOAA 1W2MA 5D6FA 2Q93A 4IECA 1BN5A 2BHDA 1WY2A 1C21A 2EVOA 1YW9A 2GU5A 2GG8A 4U6EA 2HOWA 3CB6A 3MATA 3IU7A 5JHUA 5E5BA 4FLLA 2BHAA 3BITA 1YW8A 2GZ5A 1WN1A 2BWSA 2V3ZA 4S2RP 2P9AA 3PKDA 4HXXA 5D6EA 4IKSA 3PN9A 2BWUA 4IKUA 4U75A 2GG9A 3TAVA 4U6ZA 2Q92A 4JUQA 4ZWUA 2EA2A 3D27A 1WL6A 2NQ6A 5CDLA 1CHMA 1C22A 1WBQA 2BHCA 2Q94A 2V3XA 5JFRA 4Z7MA 2NQ7A 4ZWPA 4U1BA 4FLIA
chains in the Genus database with same CATH superfamily
4A6WA 2BH3A 2OAZA 2B3KA 4MATA 4U76A 1R58A 3IL0A 3TB5A 3Q6DA 1MATA 2BWTA 5FCFA 3BIPA 1QXZA 2V3YA 3FM3A 4FLKA 3RORA 1A16A 1WL9A 2DFIA 2GTXA 4IKTA 4IPAA 3BIQA 3FMRA 2GU4A 3PKAA 1KQ0A 2BB7A 1N51A 3I7MA 4FO7A 4R60A 5CDEA 4ZNGA 5CE6A 2GGBA 4U69A 1XNZA 4IDYA 3MR1A 3L7GA 4S00A 1Y1NA 2V6CA 4FKCA 1QXWA 4U6WA 2EVMA 2P99A 3FMQA 2P98A 4U70A 1B6AA 2GU7A 1R5HA 4QR8A 2B3LA 4U6JA 2B3HA 4KM3A 1W7VA 5JI6A 5CNXA 2GA2A 2EVCA 4U73A 4PV4A 4ZWOA 1XGSA 3CTZA 5CDVA 1KQ9A 4S2TP 1C23A 1R5GA 1M35A 2GG2A 2Q95A 3OOOA 3L24A 3RVAA 2BWVA 1YVMA 4IU6A 2GGCA 1WLRA 2IW2A 2BWYA 3CB5A 4FLJA 4S01A 1JAWA 1YW7A 4U6CA 2Q8KA 1C27A 1QXYA 1QZYA 5E2CA 1WKMA 4IKRA 4OOKA 4PNCA 4RZYA 2ZSGA 3QOCA 2GU6A 3IU9A 1PV9A 3IG4A 4A6VA 4FO8A 1O0XA 2BN7A 5CIKA 2GG5A 4U71A 5CLSA 3MX6A 3PKBA 2MATA 1XGNA 4FUKA 3PEBA 2ADUA 1XGOA 2GG0A 2BWWA 3PKCA 2G6PA 4IF7A 4RZZA 2BHBA 4RGZ1 1XGMA 1YJ3A 2GG7A 2OKNA 3IU8A 5FCHA 3S6BA 4B28A 3OVKA 2GG3A 3PKEA 2EA4A 1KP0A 1B59A 1C24A 2Q96A 3O5VA 2BWXA 4EGEA 1BOAA 1W2MA 5D6FA 2Q93A 4IECA 1BN5A 2BHDA 1WY2A 1C21A 2EVOA 1YW9A 2GU5A 2GG8A 4U6EA 2HOWA 3CB6A 3MATA 3IU7A 5JHUA 5E5BA 4FLLA 2BHAA 3BITA 1YW8A 2GZ5A 1WN1A 2BWSA 2V3ZA 4S2RP 2P9AA 3PKDA 4HXXA 5D6EA 4IKSA 3PN9A 2BWUA 4IKUA 4U75A 2GG9A 3TAVA 4U6ZA 2Q92A 4JUQA 4ZWUA 2EA2A 3D27A 1WL6A 2NQ6A 5CDLA 1CHMA 1C22A 1WBQA 2BHCA 2Q94A 2V3XA 5JFRA 4Z7MA 2NQ7A 4ZWPA 4U1BA 4FLIA
chains in the Genus database with same CATH topology
4A6WA 2BH3A 2OAZA 2B3KA 4MATA 4U76A 1R58A 3IL0A 3TB5A 3Q6DA 1MATA 2BWTA 5FCFA 3BIPA 1QXZA 2V3YA 3FM3A 4FLKA 3RORA 1A16A 1WL9A 2DFIA 2GTXA 4IKTA 4IPAA 3BIQA 3FMRA 2GU4A 3PKAA 1KQ0A 2BB7A 1N51A 3I7MA 4FO7A 4R60A 5CDEA 4ZNGA 5CE6A 2GGBA 4U69A 1XNZA 4IDYA 3MR1A 3L7GA 4S00A 1Y1NA 2V6CA 4FKCA 1QXWA 4U6WA 2EVMA 2P99A 3FMQA 2P98A 4U70A 1B6AA 2GU7A 1R5HA 4QR8A 2B3LA 4U6JA 2B3HA 4KM3A 1W7VA 5JI6A 5CNXA 2GA2A 2EVCA 4U73A 4PV4A 4ZWOA 1XGSA 3CTZA 5CDVA 1KQ9A 4S2TP 1C23A 1R5GA 1M35A 2GG2A 2Q95A 3OOOA 3L24A 3RVAA 2BWVA 1YVMA 4IU6A 2GGCA 1WLRA 2IW2A 2BWYA 3CB5A 4FLJA 4S01A 1JAWA 1YW7A 4U6CA 2Q8KA 1C27A 1QXYA 1QZYA 5E2CA 1WKMA 4IKRA 4OOKA 4PNCA 4RZYA 2ZSGA 3QOCA 2GU6A 3IU9A 1PV9A 3IG4A 4A6VA 4FO8A 1O0XA 2BN7A 5CIKA 2GG5A 4U71A 5CLSA 3MX6A 3PKBA 2MATA 1XGNA 4FUKA 3PEBA 2ADUA 1XGOA 2GG0A 2BWWA 3PKCA 2G6PA 4IF7A 4RZZA 2BHBA 4RGZ1 1XGMA 1YJ3A 2GG7A 2OKNA 3IU8A 5FCHA 3S6BA 4B28A 3OVKA 2GG3A 3PKEA 2EA4A 1KP0A 1B59A 1C24A 2Q96A 3O5VA 2BWXA 4EGEA 1BOAA 1W2MA 5D6FA 2Q93A 4IECA 1BN5A 2BHDA 1WY2A 1C21A 2EVOA 1YW9A 2GU5A 2GG8A 4U6EA 2HOWA 3CB6A 3MATA 3IU7A 5JHUA 5E5BA 4FLLA 2BHAA 3BITA 1YW8A 2GZ5A 1WN1A 2BWSA 2V3ZA 4S2RP 2P9AA 3PKDA 4HXXA 5D6EA 4IKSA 3PN9A 2BWUA 4IKUA 4U75A 2GG9A 3TAVA 4U6ZA 2Q92A 4JUQA 4ZWUA 2EA2A 3D27A 1WL6A 2NQ6A 5CDLA 1CHMA 1C22A 1WBQA 2BHCA 2Q94A 2V3XA 5JFRA 4Z7MA 2NQ7A 4ZWPA 4U1BA 4FLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6W A;  2BH3 A;  2OAZ A;  2B3K A;  4MAT A;  4U76 A;  1R58 A;  3IL0 A;  3TB5 A;  3Q6D A;  1MAT A;  2BWT A;  5FCF A;  3BIP A;  1QXZ A;  2V3Y A;  3FM3 A;  4FLK A;  3ROR A;  1A16 A;  1WL9 A;  2DFI A;  2GTX A;  4IKT A;  4IPA A;  3BIQ A;  3FMR A;  2GU4 A;  3PKA A;  1KQ0 A;  2BB7 A;  1N51 A;  3I7M A;  4FO7 A;  4R60 A;  5CDE A;  4ZNG A;  5CE6 A;  2GGB A;  4U69 A;  1XNZ A;  4IDY A;  3MR1 A;  3L7G A;  4S00 A;  1Y1N A;  2V6C A;  4FKC A;  1QXW A;  4U6W A;  2EVM A;  2P99 A;  3FMQ A;  2P98 A;  4U70 A;  1B6A A;  2GU7 A;  1R5H A;  4QR8 A;  2B3L A;  4U6J A;  2B3H A;  4KM3 A;  1W7V A;  5JI6 A;  5CNX A;  2GA2 A;  2EVC A;  4U73 A;  4PV4 A;  4ZWO A;  1XGS A;  3CTZ A;  5CDV A;  1KQ9 A;  4S2T P;  1C23 A;  1R5G A;  1M35 A;  2GG2 A;  2Q95 A;  3OOO A;  3L24 A;  3RVA A;  2BWV A;  1YVM A;  4IU6 A;  2GGC A;  1WLR A;  2IW2 A;  2BWY A;  3CB5 A;  4FLJ A;  4S01 A;  1JAW A;  1YW7 A;  4U6C A;  2Q8K A;  1C27 A;  1QXY A;  1QZY A;  5E2C A;  1WKM A;  4IKR A;  4OOK A;  4PNC A;  4RZY A;  2ZSG A;  3QOC A;  2GU6 A;  3IU9 A;  1PV9 A;  3IG4 A;  4A6V A;  4FO8 A;  1O0X A;  2BN7 A;  5CIK A;  2GG5 A;  4U71 A;  5CLS A;  3MX6 A;  3PKB A;  2MAT A;  1XGN A;  4FUK A;  3PEB A;  2ADU A;  1XGO A;  2GG0 A;  2BWW A;  3PKC A;  2G6P A;  4IF7 A;  4RZZ A;  2BHB A;  4RGZ 1;  1XGM A;  1YJ3 A;  2GG7 A;  2OKN A;  3IU8 A;  5FCH A;  3S6B A;  4B28 A;  3OVK A;  2GG3 A;  3PKE A;  2EA4 A;  1KP0 A;  1B59 A;  1C24 A;  2Q96 A;  3O5V A;  2BWX A;  4EGE A;  1BOA A;  1W2M A;  5D6F A;  2Q93 A;  4IEC A;  1BN5 A;  2BHD A;  1WY2 A;  1C21 A;  2EVO A;  1YW9 A;  2GU5 A;  2GG8 A;  4U6E A;  2HOW A;  3CB6 A;  3MAT A;  3IU7 A;  5JHU A;  5E5B A;  4FLL A;  2BHA A;  3BIT A;  1YW8 A;  2GZ5 A;  1WN1 A;  2BWS A;  2V3Z A;  4S2R P;  2P9A A;  3PKD A;  4HXX A;  5D6E A;  4IKS A;  3PN9 A;  2BWU A;  4IKU A;  4U75 A;  2GG9 A;  3TAV A;  4U6Z A;  2Q92 A;  4JUQ A;  4ZWU A;  2EA2 A;  3D27 A;  1WL6 A;  2NQ6 A;  5CDL A;  1CHM A;  1C22 A;  1WBQ A;  2BHC A;  2Q94 A;  2V3X A;  5JFR A;  4Z7M A;  2NQ7 A;  4ZWP A;  4U1B A;  4FLI A; 
#chains in the Genus database with same CATH topology
 4A6W A;  2BH3 A;  2OAZ A;  2B3K A;  4MAT A;  4U76 A;  1R58 A;  3IL0 A;  3TB5 A;  3Q6D A;  1MAT A;  2BWT A;  5FCF A;  3BIP A;  1QXZ A;  2V3Y A;  3FM3 A;  4FLK A;  3ROR A;  1A16 A;  1WL9 A;  2DFI A;  2GTX A;  4IKT A;  4IPA A;  3BIQ A;  3FMR A;  2GU4 A;  3PKA A;  1KQ0 A;  2BB7 A;  1N51 A;  3I7M A;  4FO7 A;  4R60 A;  5CDE A;  4ZNG A;  5CE6 A;  2GGB A;  4U69 A;  1XNZ A;  4IDY A;  3MR1 A;  3L7G A;  4S00 A;  1Y1N A;  2V6C A;  4FKC A;  1QXW A;  4U6W A;  2EVM A;  2P99 A;  3FMQ A;  2P98 A;  4U70 A;  1B6A A;  2GU7 A;  1R5H A;  4QR8 A;  2B3L A;  4U6J A;  2B3H A;  4KM3 A;  1W7V A;  5JI6 A;  5CNX A;  2GA2 A;  2EVC A;  4U73 A;  4PV4 A;  4ZWO A;  1XGS A;  3CTZ A;  5CDV A;  1KQ9 A;  4S2T P;  1C23 A;  1R5G A;  1M35 A;  2GG2 A;  2Q95 A;  3OOO A;  3L24 A;  3RVA A;  2BWV A;  1YVM A;  4IU6 A;  2GGC A;  1WLR A;  2IW2 A;  2BWY A;  3CB5 A;  4FLJ A;  4S01 A;  1JAW A;  1YW7 A;  4U6C A;  2Q8K A;  1C27 A;  1QXY A;  1QZY A;  5E2C A;  1WKM A;  4IKR A;  4OOK A;  4PNC A;  4RZY A;  2ZSG A;  3QOC A;  2GU6 A;  3IU9 A;  1PV9 A;  3IG4 A;  4A6V A;  4FO8 A;  1O0X A;  2BN7 A;  5CIK A;  2GG5 A;  4U71 A;  5CLS A;  3MX6 A;  3PKB A;  2MAT A;  1XGN A;  4FUK A;  3PEB A;  2ADU A;  1XGO A;  2GG0 A;  2BWW A;  3PKC A;  2G6P A;  4IF7 A;  4RZZ A;  2BHB A;  4RGZ 1;  1XGM A;  1YJ3 A;  2GG7 A;  2OKN A;  3IU8 A;  5FCH A;  3S6B A;  4B28 A;  3OVK A;  2GG3 A;  3PKE A;  2EA4 A;  1KP0 A;  1B59 A;  1C24 A;  2Q96 A;  3O5V A;  2BWX A;  4EGE A;  1BOA A;  1W2M A;  5D6F A;  2Q93 A;  4IEC A;  1BN5 A;  2BHD A;  1WY2 A;  1C21 A;  2EVO A;  1YW9 A;  2GU5 A;  2GG8 A;  4U6E A;  2HOW A;  3CB6 A;  3MAT A;  3IU7 A;  5JHU A;  5E5B A;  4FLL A;  2BHA A;  3BIT A;  1YW8 A;  2GZ5 A;  1WN1 A;  2BWS A;  2V3Z A;  4S2R P;  2P9A A;  3PKD A;  4HXX A;  5D6E A;  4IKS A;  3PN9 A;  2BWU A;  4IKU A;  4U75 A;  2GG9 A;  3TAV A;  4U6Z A;  2Q92 A;  4JUQ A;  4ZWU A;  2EA2 A;  3D27 A;  1WL6 A;  2NQ6 A;  5CDL A;  1CHM A;  1C22 A;  1WBQ A;  2BHC A;  2Q94 A;  2V3X A;  5JFR A;  4Z7M A;  2NQ7 A;  4ZWP A;  4U1B A;  4FLI A; 
#chains in the Genus database with same CATH homology
 4A6W A;  2BH3 A;  2OAZ A;  2B3K A;  4MAT A;  4U76 A;  1R58 A;  3IL0 A;  3TB5 A;  3Q6D A;  1MAT A;  2BWT A;  5FCF A;  3BIP A;  1QXZ A;  2V3Y A;  3FM3 A;  4FLK A;  3ROR A;  1A16 A;  1WL9 A;  2DFI A;  2GTX A;  4IKT A;  4IPA A;  3BIQ A;  3FMR A;  2GU4 A;  3PKA A;  1KQ0 A;  2BB7 A;  1N51 A;  3I7M A;  4FO7 A;  4R60 A;  5CDE A;  4ZNG A;  5CE6 A;  2GGB A;  4U69 A;  1XNZ A;  4IDY A;  3MR1 A;  3L7G A;  4S00 A;  1Y1N A;  2V6C A;  4FKC A;  1QXW A;  4U6W A;  2EVM A;  2P99 A;  3FMQ A;  2P98 A;  4U70 A;  1B6A A;  2GU7 A;  1R5H A;  4QR8 A;  2B3L A;  4U6J A;  2B3H A;  4KM3 A;  1W7V A;  5JI6 A;  5CNX A;  2GA2 A;  2EVC A;  4U73 A;  4PV4 A;  4ZWO A;  1XGS A;  3CTZ A;  5CDV A;  1KQ9 A;  4S2T P;  1C23 A;  1R5G A;  1M35 A;  2GG2 A;  2Q95 A;  3OOO A;  3L24 A;  3RVA A;  2BWV A;  1YVM A;  4IU6 A;  2GGC A;  1WLR A;  2IW2 A;  2BWY A;  3CB5 A;  4FLJ A;  4S01 A;  1JAW A;  1YW7 A;  4U6C A;  2Q8K A;  1C27 A;  1QXY A;  1QZY A;  5E2C A;  1WKM A;  4IKR A;  4OOK A;  4PNC A;  4RZY A;  2ZSG A;  3QOC A;  2GU6 A;  3IU9 A;  1PV9 A;  3IG4 A;  4A6V A;  4FO8 A;  1O0X A;  2BN7 A;  5CIK A;  2GG5 A;  4U71 A;  5CLS A;  3MX6 A;  3PKB A;  2MAT A;  1XGN A;  4FUK A;  3PEB A;  2ADU A;  1XGO A;  2GG0 A;  2BWW A;  3PKC A;  2G6P A;  4IF7 A;  4RZZ A;  2BHB A;  4RGZ 1;  1XGM A;  1YJ3 A;  2GG7 A;  2OKN A;  3IU8 A;  5FCH A;  3S6B A;  4B28 A;  3OVK A;  2GG3 A;  3PKE A;  2EA4 A;  1KP0 A;  1B59 A;  1C24 A;  2Q96 A;  3O5V A;  2BWX A;  4EGE A;  1BOA A;  1W2M A;  5D6F A;  2Q93 A;  4IEC A;  1BN5 A;  2BHD A;  1WY2 A;  1C21 A;  2EVO A;  1YW9 A;  2GU5 A;  2GG8 A;  4U6E A;  2HOW A;  3CB6 A;  3MAT A;  3IU7 A;  5JHU A;  5E5B A;  4FLL A;  2BHA A;  3BIT A;  1YW8 A;  2GZ5 A;  1WN1 A;  2BWS A;  2V3Z A;  4S2R P;  2P9A A;  3PKD A;  4HXX A;  5D6E A;  4IKS A;  3PN9 A;  2BWU A;  4IKU A;  4U75 A;  2GG9 A;  3TAV A;  4U6Z A;  2Q92 A;  4JUQ A;  4ZWU A;  2EA2 A;  3D27 A;  1WL6 A;  2NQ6 A;  5CDL A;  1CHM A;  1C22 A;  1WBQ A;  2BHC A;  2Q94 A;  2V3X A;  5JFR A;  4Z7M A;  2NQ7 A;  4ZWP A;  4U1B A;  4FLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...