3CTZA

Structure of human cytosolic x-prolyl aminopeptidase
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
617
structure length
617
Chain Sequence
PKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xaa-Pro aminopeptidase 1
publication title Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 207
structure length 617
sequence length 617
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
A PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
A PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA02
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ctzA03
3QOCA 4IDYA 4JUQA 3L24A 3BIPA 2HOWA 3PEBA 2Q95A 4FKCA 2OAZA 2V3ZA 1JAWA 1YW9A 4KM3A 1XGOA 1KP0A 2BWWA 2GGBA 2V6CA 2Q8KA 1C27A 2GG7A 5CE6A 3IU9A 2BHDA 4FLIA 4S01A 1O0XA 3FMQA 4MATA 3BIQA 2BWYA 5D6FA 3Q6DA 3IL0A 1CHMA 1XGNA 2EA4A 4IPAA 1BN5A 2GTXA 4FLJA 4IU6A 3RORA 4PNCA 4A6WA 1B59A 4IKUA 5CDLA 1XGMA 5CNXA 2GZ5A 4U76A 4A6VA 1WY2A 4U6CA 2V3XA 4OOKA 2B3KA 2NQ7A 3CTZA 3L7GA 1WL6A 2GU7A 1YW8A 4U75A 5JHUA 3IG4A 1R5HA 4U1BA 3IU8A 3PKAA 5CDVA 5JFRA 2EVMA 2B3HA 2BHAA 4RZYA 2Q94A 2BH3A 2P99A 1A16A 1WKMA 4FLLA 4ZNGA 1W2MA 5E2CA 2ADUA 5CLSA 3BITA 1Y1NA 3CB6A 1C24A 2BWVA 4U69A 4ZWPA 2GG2A 2P98A 4Z7MA 5FCHA 2GA2A 3MR1A 3S6BA 1YW7A 2GG9A 3TB5A 1WN1A 1W7VA 2B3LA 3OOOA 4IKTA 3O5VA 1KQ9A 3D27A 2MATA 2GG0A 5CIKA 2BHBA 2GG8A 2DFIA 2GU6A 4EGEA 1YVMA 2BWTA 4U6JA 3IU7A 2IW2A 4FO8A 2GG3A 4U6ZA 4FLKA 4FUKA 4IECA 3PN9A 1QXZA 3PKCA 2BN7A 2BWSA 2P9AA 4U73A 2BB7A 1YJ3A 5FCFA 4S00A 1BOAA 1MATA 5D6EA 4R60A 3OVKA 2G6PA 5CDEA 4IF7A 3TAVA 2BHCA 1QXWA 4U6EA 2ZSGA 4U71A 4PV4A 1C21A 4QR8A 1M35A 3CB5A 4S2RP 3I7MA 4S2TP 1R58A 3MX6A 1PV9A 1WL9A 2BWXA 4B28A 1WLRA 2Q96A 4U6WA 3RVAA 1B6AA 2V3YA 4RGZ1 2Q93A 3PKBA 1KQ0A 2EVOA 3FM3A 5JI6A 1C22A 2EA2A 2GG5A 4HXXA 2GGCA 2GU4A 4RZZA 4IKRA 4ZWOA 2BWUA 2Q92A 3FMRA 3PKEA 1N51A 4IKSA 2GU5A 2EVCA 1R5GA 1XGSA 1C23A 3MATA 2NQ6A 2OKNA 3PKDA 4ZWUA 4FO7A 1XNZA 1QZYA 5E5BA 1QXYA 1WBQA 4U70A
chains in the Genus database with same CATH superfamily
3QOCA 4IDYA 4JUQA 3L24A 3BIPA 2HOWA 3PEBA 2Q95A 4FKCA 2OAZA 2V3ZA 1JAWA 1YW9A 4KM3A 1XGOA 1KP0A 2BWWA 2GGBA 2V6CA 2Q8KA 1C27A 2GG7A 5CE6A 3IU9A 2BHDA 4FLIA 4S01A 1O0XA 3FMQA 4MATA 3BIQA 2BWYA 5D6FA 3Q6DA 3IL0A 1CHMA 1XGNA 2EA4A 4IPAA 1BN5A 2GTXA 4FLJA 4IU6A 3RORA 4PNCA 4A6WA 1B59A 4IKUA 5CDLA 1XGMA 5CNXA 2GZ5A 4U76A 4A6VA 1WY2A 4U6CA 2V3XA 4OOKA 2B3KA 2NQ7A 3CTZA 3L7GA 1WL6A 2GU7A 1YW8A 4U75A 5JHUA 3IG4A 1R5HA 4U1BA 3IU8A 3PKAA 5CDVA 5JFRA 2EVMA 2B3HA 2BHAA 4RZYA 2Q94A 2BH3A 2P99A 1A16A 1WKMA 4FLLA 4ZNGA 1W2MA 5E2CA 2ADUA 5CLSA 3BITA 1Y1NA 3CB6A 1C24A 2BWVA 4U69A 4ZWPA 2GG2A 2P98A 4Z7MA 5FCHA 2GA2A 3MR1A 3S6BA 1YW7A 2GG9A 3TB5A 1WN1A 1W7VA 2B3LA 3OOOA 4IKTA 3O5VA 1KQ9A 3D27A 2MATA 2GG0A 5CIKA 2BHBA 2GG8A 2DFIA 2GU6A 4EGEA 1YVMA 2BWTA 4U6JA 3IU7A 2IW2A 4FO8A 2GG3A 4U6ZA 4FLKA 4FUKA 4IECA 3PN9A 1QXZA 3PKCA 2BN7A 2BWSA 2P9AA 4U73A 2BB7A 1YJ3A 5FCFA 4S00A 1BOAA 1MATA 5D6EA 4R60A 3OVKA 2G6PA 5CDEA 4IF7A 3TAVA 2BHCA 1QXWA 4U6EA 2ZSGA 4U71A 4PV4A 1C21A 4QR8A 1M35A 3CB5A 4S2RP 3I7MA 4S2TP 1R58A 3MX6A 1PV9A 1WL9A 2BWXA 4B28A 1WLRA 2Q96A 4U6WA 3RVAA 1B6AA 2V3YA 4RGZ1 2Q93A 3PKBA 1KQ0A 2EVOA 3FM3A 5JI6A 1C22A 2EA2A 2GG5A 4HXXA 2GGCA 2GU4A 4RZZA 4IKRA 4ZWOA 2BWUA 2Q92A 3FMRA 3PKEA 1N51A 4IKSA 2GU5A 2EVCA 1R5GA 1XGSA 1C23A 3MATA 2NQ6A 2OKNA 3PKDA 4ZWUA 4FO7A 1XNZA 1QZYA 5E5BA 1QXYA 1WBQA 4U70A
chains in the Genus database with same CATH topology
3QOCA 4IDYA 4JUQA 3L24A 3BIPA 2HOWA 3PEBA 2Q95A 4FKCA 2OAZA 2V3ZA 1JAWA 1YW9A 4KM3A 1XGOA 1KP0A 2BWWA 2GGBA 2V6CA 2Q8KA 1C27A 2GG7A 5CE6A 3IU9A 2BHDA 4FLIA 4S01A 1O0XA 3FMQA 4MATA 3BIQA 2BWYA 5D6FA 3Q6DA 3IL0A 1CHMA 1XGNA 2EA4A 4IPAA 1BN5A 2GTXA 4FLJA 4IU6A 3RORA 4PNCA 4A6WA 1B59A 4IKUA 5CDLA 1XGMA 5CNXA 2GZ5A 4U76A 4A6VA 1WY2A 4U6CA 2V3XA 4OOKA 2B3KA 2NQ7A 3CTZA 3L7GA 1WL6A 2GU7A 1YW8A 4U75A 5JHUA 3IG4A 1R5HA 4U1BA 3IU8A 3PKAA 5CDVA 5JFRA 2EVMA 2B3HA 2BHAA 4RZYA 2Q94A 2BH3A 2P99A 1A16A 1WKMA 4FLLA 4ZNGA 1W2MA 5E2CA 2ADUA 5CLSA 3BITA 1Y1NA 3CB6A 1C24A 2BWVA 4U69A 4ZWPA 2GG2A 2P98A 4Z7MA 5FCHA 2GA2A 3MR1A 3S6BA 1YW7A 2GG9A 3TB5A 1WN1A 1W7VA 2B3LA 3OOOA 4IKTA 3O5VA 1KQ9A 3D27A 2MATA 2GG0A 5CIKA 2BHBA 2GG8A 2DFIA 2GU6A 4EGEA 1YVMA 2BWTA 4U6JA 3IU7A 2IW2A 4FO8A 2GG3A 4U6ZA 4FLKA 4FUKA 4IECA 3PN9A 1QXZA 3PKCA 2BN7A 2BWSA 2P9AA 4U73A 2BB7A 1YJ3A 5FCFA 4S00A 1BOAA 1MATA 5D6EA 4R60A 3OVKA 2G6PA 5CDEA 4IF7A 3TAVA 2BHCA 1QXWA 4U6EA 2ZSGA 4U71A 4PV4A 1C21A 4QR8A 1M35A 3CB5A 4S2RP 3I7MA 4S2TP 1R58A 3MX6A 1PV9A 1WL9A 2BWXA 4B28A 1WLRA 2Q96A 4U6WA 3RVAA 1B6AA 2V3YA 4RGZ1 2Q93A 3PKBA 1KQ0A 2EVOA 3FM3A 5JI6A 1C22A 2EA2A 2GG5A 4HXXA 2GGCA 2GU4A 4RZZA 4IKRA 4ZWOA 2BWUA 2Q92A 3FMRA 3PKEA 1N51A 4IKSA 2GU5A 2EVCA 1R5GA 1XGSA 1C23A 3MATA 2NQ6A 2OKNA 3PKDA 4ZWUA 4FO7A 1XNZA 1QZYA 5E5BA 1QXYA 1WBQA 4U70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOC A;  4IDY A;  4JUQ A;  3L24 A;  3BIP A;  2HOW A;  3PEB A;  2Q95 A;  4FKC A;  2OAZ A;  2V3Z A;  1JAW A;  1YW9 A;  4KM3 A;  1XGO A;  1KP0 A;  2BWW A;  2GGB A;  2V6C A;  2Q8K A;  1C27 A;  2GG7 A;  5CE6 A;  3IU9 A;  2BHD A;  4FLI A;  4S01 A;  1O0X A;  3FMQ A;  4MAT A;  3BIQ A;  2BWY A;  5D6F A;  3Q6D A;  3IL0 A;  1CHM A;  1XGN A;  2EA4 A;  4IPA A;  1BN5 A;  2GTX A;  4FLJ A;  4IU6 A;  3ROR A;  4PNC A;  4A6W A;  1B59 A;  4IKU A;  5CDL A;  1XGM A;  5CNX A;  2GZ5 A;  4U76 A;  4A6V A;  1WY2 A;  4U6C A;  2V3X A;  4OOK A;  2B3K A;  2NQ7 A;  3CTZ A;  3L7G A;  1WL6 A;  2GU7 A;  1YW8 A;  4U75 A;  5JHU A;  3IG4 A;  1R5H A;  4U1B A;  3IU8 A;  3PKA A;  5CDV A;  5JFR A;  2EVM A;  2B3H A;  2BHA A;  4RZY A;  2Q94 A;  2BH3 A;  2P99 A;  1A16 A;  1WKM A;  4FLL A;  4ZNG A;  1W2M A;  5E2C A;  2ADU A;  5CLS A;  3BIT A;  1Y1N A;  3CB6 A;  1C24 A;  2BWV A;  4U69 A;  4ZWP A;  2GG2 A;  2P98 A;  4Z7M A;  5FCH A;  2GA2 A;  3MR1 A;  3S6B A;  1YW7 A;  2GG9 A;  3TB5 A;  1WN1 A;  1W7V A;  2B3L A;  3OOO A;  4IKT A;  3O5V A;  1KQ9 A;  3D27 A;  2MAT A;  2GG0 A;  5CIK A;  2BHB A;  2GG8 A;  2DFI A;  2GU6 A;  4EGE A;  1YVM A;  2BWT A;  4U6J A;  3IU7 A;  2IW2 A;  4FO8 A;  2GG3 A;  4U6Z A;  4FLK A;  4FUK A;  4IEC A;  3PN9 A;  1QXZ A;  3PKC A;  2BN7 A;  2BWS A;  2P9A A;  4U73 A;  2BB7 A;  1YJ3 A;  5FCF A;  4S00 A;  1BOA A;  1MAT A;  5D6E A;  4R60 A;  3OVK A;  2G6P A;  5CDE A;  4IF7 A;  3TAV A;  2BHC A;  1QXW A;  4U6E A;  2ZSG A;  4U71 A;  4PV4 A;  1C21 A;  4QR8 A;  1M35 A;  3CB5 A;  4S2R P;  3I7M A;  4S2T P;  1R58 A;  3MX6 A;  1PV9 A;  1WL9 A;  2BWX A;  4B28 A;  1WLR A;  2Q96 A;  4U6W A;  3RVA A;  1B6A A;  2V3Y A;  4RGZ 1;  2Q93 A;  3PKB A;  1KQ0 A;  2EVO A;  3FM3 A;  5JI6 A;  1C22 A;  2EA2 A;  2GG5 A;  4HXX A;  2GGC A;  2GU4 A;  4RZZ A;  4IKR A;  4ZWO A;  2BWU A;  2Q92 A;  3FMR A;  3PKE A;  1N51 A;  4IKS A;  2GU5 A;  2EVC A;  1R5G A;  1XGS A;  1C23 A;  3MAT A;  2NQ6 A;  2OKN A;  3PKD A;  4ZWU A;  4FO7 A;  1XNZ A;  1QZY A;  5E5B A;  1QXY A;  1WBQ A;  4U70 A; 
#chains in the Genus database with same CATH topology
 3QOC A;  4IDY A;  4JUQ A;  3L24 A;  3BIP A;  2HOW A;  3PEB A;  2Q95 A;  4FKC A;  2OAZ A;  2V3Z A;  1JAW A;  1YW9 A;  4KM3 A;  1XGO A;  1KP0 A;  2BWW A;  2GGB A;  2V6C A;  2Q8K A;  1C27 A;  2GG7 A;  5CE6 A;  3IU9 A;  2BHD A;  4FLI A;  4S01 A;  1O0X A;  3FMQ A;  4MAT A;  3BIQ A;  2BWY A;  5D6F A;  3Q6D A;  3IL0 A;  1CHM A;  1XGN A;  2EA4 A;  4IPA A;  1BN5 A;  2GTX A;  4FLJ A;  4IU6 A;  3ROR A;  4PNC A;  4A6W A;  1B59 A;  4IKU A;  5CDL A;  1XGM A;  5CNX A;  2GZ5 A;  4U76 A;  4A6V A;  1WY2 A;  4U6C A;  2V3X A;  4OOK A;  2B3K A;  2NQ7 A;  3CTZ A;  3L7G A;  1WL6 A;  2GU7 A;  1YW8 A;  4U75 A;  5JHU A;  3IG4 A;  1R5H A;  4U1B A;  3IU8 A;  3PKA A;  5CDV A;  5JFR A;  2EVM A;  2B3H A;  2BHA A;  4RZY A;  2Q94 A;  2BH3 A;  2P99 A;  1A16 A;  1WKM A;  4FLL A;  4ZNG A;  1W2M A;  5E2C A;  2ADU A;  5CLS A;  3BIT A;  1Y1N A;  3CB6 A;  1C24 A;  2BWV A;  4U69 A;  4ZWP A;  2GG2 A;  2P98 A;  4Z7M A;  5FCH A;  2GA2 A;  3MR1 A;  3S6B A;  1YW7 A;  2GG9 A;  3TB5 A;  1WN1 A;  1W7V A;  2B3L A;  3OOO A;  4IKT A;  3O5V A;  1KQ9 A;  3D27 A;  2MAT A;  2GG0 A;  5CIK A;  2BHB A;  2GG8 A;  2DFI A;  2GU6 A;  4EGE A;  1YVM A;  2BWT A;  4U6J A;  3IU7 A;  2IW2 A;  4FO8 A;  2GG3 A;  4U6Z A;  4FLK A;  4FUK A;  4IEC A;  3PN9 A;  1QXZ A;  3PKC A;  2BN7 A;  2BWS A;  2P9A A;  4U73 A;  2BB7 A;  1YJ3 A;  5FCF A;  4S00 A;  1BOA A;  1MAT A;  5D6E A;  4R60 A;  3OVK A;  2G6P A;  5CDE A;  4IF7 A;  3TAV A;  2BHC A;  1QXW A;  4U6E A;  2ZSG A;  4U71 A;  4PV4 A;  1C21 A;  4QR8 A;  1M35 A;  3CB5 A;  4S2R P;  3I7M A;  4S2T P;  1R58 A;  3MX6 A;  1PV9 A;  1WL9 A;  2BWX A;  4B28 A;  1WLR A;  2Q96 A;  4U6W A;  3RVA A;  1B6A A;  2V3Y A;  4RGZ 1;  2Q93 A;  3PKB A;  1KQ0 A;  2EVO A;  3FM3 A;  5JI6 A;  1C22 A;  2EA2 A;  2GG5 A;  4HXX A;  2GGC A;  2GU4 A;  4RZZ A;  4IKR A;  4ZWO A;  2BWU A;  2Q92 A;  3FMR A;  3PKE A;  1N51 A;  4IKS A;  2GU5 A;  2EVC A;  1R5G A;  1XGS A;  1C23 A;  3MAT A;  2NQ6 A;  2OKN A;  3PKD A;  4ZWU A;  4FO7 A;  1XNZ A;  1QZY A;  5E5B A;  1QXY A;  1WBQ A;  4U70 A; 
#chains in the Genus database with same CATH homology
 3QOC A;  4IDY A;  4JUQ A;  3L24 A;  3BIP A;  2HOW A;  3PEB A;  2Q95 A;  4FKC A;  2OAZ A;  2V3Z A;  1JAW A;  1YW9 A;  4KM3 A;  1XGO A;  1KP0 A;  2BWW A;  2GGB A;  2V6C A;  2Q8K A;  1C27 A;  2GG7 A;  5CE6 A;  3IU9 A;  2BHD A;  4FLI A;  4S01 A;  1O0X A;  3FMQ A;  4MAT A;  3BIQ A;  2BWY A;  5D6F A;  3Q6D A;  3IL0 A;  1CHM A;  1XGN A;  2EA4 A;  4IPA A;  1BN5 A;  2GTX A;  4FLJ A;  4IU6 A;  3ROR A;  4PNC A;  4A6W A;  1B59 A;  4IKU A;  5CDL A;  1XGM A;  5CNX A;  2GZ5 A;  4U76 A;  4A6V A;  1WY2 A;  4U6C A;  2V3X A;  4OOK A;  2B3K A;  2NQ7 A;  3CTZ A;  3L7G A;  1WL6 A;  2GU7 A;  1YW8 A;  4U75 A;  5JHU A;  3IG4 A;  1R5H A;  4U1B A;  3IU8 A;  3PKA A;  5CDV A;  5JFR A;  2EVM A;  2B3H A;  2BHA A;  4RZY A;  2Q94 A;  2BH3 A;  2P99 A;  1A16 A;  1WKM A;  4FLL A;  4ZNG A;  1W2M A;  5E2C A;  2ADU A;  5CLS A;  3BIT A;  1Y1N A;  3CB6 A;  1C24 A;  2BWV A;  4U69 A;  4ZWP A;  2GG2 A;  2P98 A;  4Z7M A;  5FCH A;  2GA2 A;  3MR1 A;  3S6B A;  1YW7 A;  2GG9 A;  3TB5 A;  1WN1 A;  1W7V A;  2B3L A;  3OOO A;  4IKT A;  3O5V A;  1KQ9 A;  3D27 A;  2MAT A;  2GG0 A;  5CIK A;  2BHB A;  2GG8 A;  2DFI A;  2GU6 A;  4EGE A;  1YVM A;  2BWT A;  4U6J A;  3IU7 A;  2IW2 A;  4FO8 A;  2GG3 A;  4U6Z A;  4FLK A;  4FUK A;  4IEC A;  3PN9 A;  1QXZ A;  3PKC A;  2BN7 A;  2BWS A;  2P9A A;  4U73 A;  2BB7 A;  1YJ3 A;  5FCF A;  4S00 A;  1BOA A;  1MAT A;  5D6E A;  4R60 A;  3OVK A;  2G6P A;  5CDE A;  4IF7 A;  3TAV A;  2BHC A;  1QXW A;  4U6E A;  2ZSG A;  4U71 A;  4PV4 A;  1C21 A;  4QR8 A;  1M35 A;  3CB5 A;  4S2R P;  3I7M A;  4S2T P;  1R58 A;  3MX6 A;  1PV9 A;  1WL9 A;  2BWX A;  4B28 A;  1WLR A;  2Q96 A;  4U6W A;  3RVA A;  1B6A A;  2V3Y A;  4RGZ 1;  2Q93 A;  3PKB A;  1KQ0 A;  2EVO A;  3FM3 A;  5JI6 A;  1C22 A;  2EA2 A;  2GG5 A;  4HXX A;  2GGC A;  2GU4 A;  4RZZ A;  4IKR A;  4ZWO A;  2BWU A;  2Q92 A;  3FMR A;  3PKE A;  1N51 A;  4IKS A;  2GU5 A;  2EVC A;  1R5G A;  1XGS A;  1C23 A;  3MAT A;  2NQ6 A;  2OKN A;  3PKD A;  4ZWU A;  4FO7 A;  1XNZ A;  1QZY A;  5E5B A;  1QXY A;  1WBQ A;  4U70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...