1WLRA

Apo aminopeptidase p from e. coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wlrA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wlrA02
4RZYA 3RVAA 1Y1NA 1KQ9A 3IG4A 4R60A 5CE6A 2GG8A 2GU6A 2EA2A 2Q94A 5E5BA 2ZSGA 2V3ZA 2G6PA 3PKDA 4IKTA 2GU4A 4IU6A 1O0XA 2V6CA 3CTZA 1C24A 4U73A 4IKSA 1XGNA 4S2RP 1WL9A 3I7MA 4HXXA 4PNCA 4U6JA 2BHBA 1C27A 2GGBA 4FO7A 1R5GA 5FCHA 4ZNGA 2BHDA 2NQ7A 4U70A 5JHUA 3D27A 1PV9A 3MATA 3PKEA 3PKAA 2NQ6A 1QXWA 2GA2A 5JFRA 4FO8A 2GG3A 3IU7A 4RGZ1 2BWUA 1WN1A 3PN9A 2GG9A 2EVCA 2EVOA 3L7GA 2OKNA 1YW9A 4IECA 3TB5A 4Z7MA 1YVMA 3OVKA 3CB5A 3FM3A 1C21A 2GG7A 1XGOA 2ADUA 2P9AA 4PV4A 3PKCA 4OOKA 2Q93A 4U6CA 3RORA 2Q96A 4A6WA 4IDYA 1BOAA 1WKMA 1JAWA 4ZWOA 3CB6A 1R58A 4B28A 3BITA 3BIPA 4FLLA 4FLKA 4U75A 4IKUA 3Q6DA 2Q95A 1R5HA 4JUQA 2BWSA 3IL0A 1XGSA 5D6EA 3IU8A 1MATA 1WLRA 2BWWA 2BH3A 2BWYA 5CDLA 1KQ0A 2B3KA 2BB7A 2GU7A 4IF7A 4RZZA 2GG5A 4S01A 5JI6A 3PKBA 4IKRA 2Q8KA 2BHAA 1B59A 1YW7A 2GG0A 4FUKA 2GTXA 3FMRA 3MX6A 5D6FA 4U1BA 2GZ5A 4IPAA 4U69A 1M35A 2HOWA 1QZYA 2B3HA 2P98A 1A16A 3TAVA 2GU5A 4QR8A 3MR1A 4KM3A 1W7VA 2BWXA 2V3XA 1CHMA 5CLSA 4A6VA 3PEBA 4U76A 1QXYA 2DFIA 4S2TP 1WY2A 2GGCA 1C23A 1WBQA 5CDEA 3FMQA 1QXZA 5CNXA 3L24A 1KP0A 5E2CA 2EA4A 3IU9A 1WL6A 3BIQA 1BN5A 4EGEA 4ZWPA 2BWTA 3S6BA 2MATA 4U6WA 4U6ZA 1N51A 2BN7A 3QOCA 1B6AA 2P99A 4FLJA 2Q92A 2B3LA 1C22A 3O5VA 4FKCA 4MATA 4U6EA 4ZWUA 1YJ3A 4S00A 2V3YA 2OAZA 5CDVA 5CIKA 4FLIA 2EVMA 4U71A 2BWVA 1YW8A 1XNZA 2IW2A 2BHCA 2GG2A 1XGMA 1W2MA 5FCFA 3OOOA
chains in the Genus database with same CATH superfamily
4RZYA 3RVAA 1Y1NA 1KQ9A 3IG4A 4R60A 5CE6A 2GG8A 2GU6A 2EA2A 2Q94A 5E5BA 2ZSGA 2V3ZA 2G6PA 3PKDA 4IKTA 2GU4A 4IU6A 1O0XA 2V6CA 3CTZA 1C24A 4U73A 4IKSA 1XGNA 4S2RP 1WL9A 3I7MA 4HXXA 4PNCA 4U6JA 2BHBA 1C27A 2GGBA 4FO7A 1R5GA 5FCHA 4ZNGA 2BHDA 2NQ7A 4U70A 5JHUA 3D27A 1PV9A 3MATA 3PKEA 3PKAA 2NQ6A 1QXWA 2GA2A 5JFRA 4FO8A 2GG3A 3IU7A 4RGZ1 2BWUA 1WN1A 3PN9A 2GG9A 2EVCA 2EVOA 3L7GA 2OKNA 1YW9A 4IECA 3TB5A 4Z7MA 1YVMA 3OVKA 3CB5A 3FM3A 1C21A 2GG7A 1XGOA 2ADUA 2P9AA 4PV4A 3PKCA 4OOKA 2Q93A 4U6CA 3RORA 2Q96A 4A6WA 4IDYA 1BOAA 1WKMA 1JAWA 4ZWOA 3CB6A 1R58A 4B28A 3BITA 3BIPA 4FLLA 4FLKA 4U75A 4IKUA 3Q6DA 2Q95A 1R5HA 4JUQA 2BWSA 3IL0A 1XGSA 5D6EA 3IU8A 1MATA 1WLRA 2BWWA 2BH3A 2BWYA 5CDLA 1KQ0A 2B3KA 2BB7A 2GU7A 4IF7A 4RZZA 2GG5A 4S01A 5JI6A 3PKBA 4IKRA 2Q8KA 2BHAA 1B59A 1YW7A 2GG0A 4FUKA 2GTXA 3FMRA 3MX6A 5D6FA 4U1BA 2GZ5A 4IPAA 4U69A 1M35A 2HOWA 1QZYA 2B3HA 2P98A 1A16A 3TAVA 2GU5A 4QR8A 3MR1A 4KM3A 1W7VA 2BWXA 2V3XA 1CHMA 5CLSA 4A6VA 3PEBA 4U76A 1QXYA 2DFIA 4S2TP 1WY2A 2GGCA 1C23A 1WBQA 5CDEA 3FMQA 1QXZA 5CNXA 3L24A 1KP0A 5E2CA 2EA4A 3IU9A 1WL6A 3BIQA 1BN5A 4EGEA 4ZWPA 2BWTA 3S6BA 2MATA 4U6WA 4U6ZA 1N51A 2BN7A 3QOCA 1B6AA 2P99A 4FLJA 2Q92A 2B3LA 1C22A 3O5VA 4FKCA 4MATA 4U6EA 4ZWUA 1YJ3A 4S00A 2V3YA 2OAZA 5CDVA 5CIKA 4FLIA 2EVMA 4U71A 2BWVA 1YW8A 1XNZA 2IW2A 2BHCA 2GG2A 1XGMA 1W2MA 5FCFA 3OOOA
chains in the Genus database with same CATH topology
4RZYA 3RVAA 1Y1NA 1KQ9A 3IG4A 4R60A 5CE6A 2GG8A 2GU6A 2EA2A 2Q94A 5E5BA 2ZSGA 2V3ZA 2G6PA 3PKDA 4IKTA 2GU4A 4IU6A 1O0XA 2V6CA 3CTZA 1C24A 4U73A 4IKSA 1XGNA 4S2RP 1WL9A 3I7MA 4HXXA 4PNCA 4U6JA 2BHBA 1C27A 2GGBA 4FO7A 1R5GA 5FCHA 4ZNGA 2BHDA 2NQ7A 4U70A 5JHUA 3D27A 1PV9A 3MATA 3PKEA 3PKAA 2NQ6A 1QXWA 2GA2A 5JFRA 4FO8A 2GG3A 3IU7A 4RGZ1 2BWUA 1WN1A 3PN9A 2GG9A 2EVCA 2EVOA 3L7GA 2OKNA 1YW9A 4IECA 3TB5A 4Z7MA 1YVMA 3OVKA 3CB5A 3FM3A 1C21A 2GG7A 1XGOA 2ADUA 2P9AA 4PV4A 3PKCA 4OOKA 2Q93A 4U6CA 3RORA 2Q96A 4A6WA 4IDYA 1BOAA 1WKMA 1JAWA 4ZWOA 3CB6A 1R58A 4B28A 3BITA 3BIPA 4FLLA 4FLKA 4U75A 4IKUA 3Q6DA 2Q95A 1R5HA 4JUQA 2BWSA 3IL0A 1XGSA 5D6EA 3IU8A 1MATA 1WLRA 2BWWA 2BH3A 2BWYA 5CDLA 1KQ0A 2B3KA 2BB7A 2GU7A 4IF7A 4RZZA 2GG5A 4S01A 5JI6A 3PKBA 4IKRA 2Q8KA 2BHAA 1B59A 1YW7A 2GG0A 4FUKA 2GTXA 3FMRA 3MX6A 5D6FA 4U1BA 2GZ5A 4IPAA 4U69A 1M35A 2HOWA 1QZYA 2B3HA 2P98A 1A16A 3TAVA 2GU5A 4QR8A 3MR1A 4KM3A 1W7VA 2BWXA 2V3XA 1CHMA 5CLSA 4A6VA 3PEBA 4U76A 1QXYA 2DFIA 4S2TP 1WY2A 2GGCA 1C23A 1WBQA 5CDEA 3FMQA 1QXZA 5CNXA 3L24A 1KP0A 5E2CA 2EA4A 3IU9A 1WL6A 3BIQA 1BN5A 4EGEA 4ZWPA 2BWTA 3S6BA 2MATA 4U6WA 4U6ZA 1N51A 2BN7A 3QOCA 1B6AA 2P99A 4FLJA 2Q92A 2B3LA 1C22A 3O5VA 4FKCA 4MATA 4U6EA 4ZWUA 1YJ3A 4S00A 2V3YA 2OAZA 5CDVA 5CIKA 4FLIA 2EVMA 4U71A 2BWVA 1YW8A 1XNZA 2IW2A 2BHCA 2GG2A 1XGMA 1W2MA 5FCFA 3OOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZY A;  3RVA A;  1Y1N A;  1KQ9 A;  3IG4 A;  4R60 A;  5CE6 A;  2GG8 A;  2GU6 A;  2EA2 A;  2Q94 A;  5E5B A;  2ZSG A;  2V3Z A;  2G6P A;  3PKD A;  4IKT A;  2GU4 A;  4IU6 A;  1O0X A;  2V6C A;  3CTZ A;  1C24 A;  4U73 A;  4IKS A;  1XGN A;  4S2R P;  1WL9 A;  3I7M A;  4HXX A;  4PNC A;  4U6J A;  2BHB A;  1C27 A;  2GGB A;  4FO7 A;  1R5G A;  5FCH A;  4ZNG A;  2BHD A;  2NQ7 A;  4U70 A;  5JHU A;  3D27 A;  1PV9 A;  3MAT A;  3PKE A;  3PKA A;  2NQ6 A;  1QXW A;  2GA2 A;  5JFR A;  4FO8 A;  2GG3 A;  3IU7 A;  4RGZ 1;  2BWU A;  1WN1 A;  3PN9 A;  2GG9 A;  2EVC A;  2EVO A;  3L7G A;  2OKN A;  1YW9 A;  4IEC A;  3TB5 A;  4Z7M A;  1YVM A;  3OVK A;  3CB5 A;  3FM3 A;  1C21 A;  2GG7 A;  1XGO A;  2ADU A;  2P9A A;  4PV4 A;  3PKC A;  4OOK A;  2Q93 A;  4U6C A;  3ROR A;  2Q96 A;  4A6W A;  4IDY A;  1BOA A;  1WKM A;  1JAW A;  4ZWO A;  3CB6 A;  1R58 A;  4B28 A;  3BIT A;  3BIP A;  4FLL A;  4FLK A;  4U75 A;  4IKU A;  3Q6D A;  2Q95 A;  1R5H A;  4JUQ A;  2BWS A;  3IL0 A;  1XGS A;  5D6E A;  3IU8 A;  1MAT A;  1WLR A;  2BWW A;  2BH3 A;  2BWY A;  5CDL A;  1KQ0 A;  2B3K A;  2BB7 A;  2GU7 A;  4IF7 A;  4RZZ A;  2GG5 A;  4S01 A;  5JI6 A;  3PKB A;  4IKR A;  2Q8K A;  2BHA A;  1B59 A;  1YW7 A;  2GG0 A;  4FUK A;  2GTX A;  3FMR A;  3MX6 A;  5D6F A;  4U1B A;  2GZ5 A;  4IPA A;  4U69 A;  1M35 A;  2HOW A;  1QZY A;  2B3H A;  2P98 A;  1A16 A;  3TAV A;  2GU5 A;  4QR8 A;  3MR1 A;  4KM3 A;  1W7V A;  2BWX A;  2V3X A;  1CHM A;  5CLS A;  4A6V A;  3PEB A;  4U76 A;  1QXY A;  2DFI A;  4S2T P;  1WY2 A;  2GGC A;  1C23 A;  1WBQ A;  5CDE A;  3FMQ A;  1QXZ A;  5CNX A;  3L24 A;  1KP0 A;  5E2C A;  2EA4 A;  3IU9 A;  1WL6 A;  3BIQ A;  1BN5 A;  4EGE A;  4ZWP A;  2BWT A;  3S6B A;  2MAT A;  4U6W A;  4U6Z A;  1N51 A;  2BN7 A;  3QOC A;  1B6A A;  2P99 A;  4FLJ A;  2Q92 A;  2B3L A;  1C22 A;  3O5V A;  4FKC A;  4MAT A;  4U6E A;  4ZWU A;  1YJ3 A;  4S00 A;  2V3Y A;  2OAZ A;  5CDV A;  5CIK A;  4FLI A;  2EVM A;  4U71 A;  2BWV A;  1YW8 A;  1XNZ A;  2IW2 A;  2BHC A;  2GG2 A;  1XGM A;  1W2M A;  5FCF A;  3OOO A; 
#chains in the Genus database with same CATH topology
 4RZY A;  3RVA A;  1Y1N A;  1KQ9 A;  3IG4 A;  4R60 A;  5CE6 A;  2GG8 A;  2GU6 A;  2EA2 A;  2Q94 A;  5E5B A;  2ZSG A;  2V3Z A;  2G6P A;  3PKD A;  4IKT A;  2GU4 A;  4IU6 A;  1O0X A;  2V6C A;  3CTZ A;  1C24 A;  4U73 A;  4IKS A;  1XGN A;  4S2R P;  1WL9 A;  3I7M A;  4HXX A;  4PNC A;  4U6J A;  2BHB A;  1C27 A;  2GGB A;  4FO7 A;  1R5G A;  5FCH A;  4ZNG A;  2BHD A;  2NQ7 A;  4U70 A;  5JHU A;  3D27 A;  1PV9 A;  3MAT A;  3PKE A;  3PKA A;  2NQ6 A;  1QXW A;  2GA2 A;  5JFR A;  4FO8 A;  2GG3 A;  3IU7 A;  4RGZ 1;  2BWU A;  1WN1 A;  3PN9 A;  2GG9 A;  2EVC A;  2EVO A;  3L7G A;  2OKN A;  1YW9 A;  4IEC A;  3TB5 A;  4Z7M A;  1YVM A;  3OVK A;  3CB5 A;  3FM3 A;  1C21 A;  2GG7 A;  1XGO A;  2ADU A;  2P9A A;  4PV4 A;  3PKC A;  4OOK A;  2Q93 A;  4U6C A;  3ROR A;  2Q96 A;  4A6W A;  4IDY A;  1BOA A;  1WKM A;  1JAW A;  4ZWO A;  3CB6 A;  1R58 A;  4B28 A;  3BIT A;  3BIP A;  4FLL A;  4FLK A;  4U75 A;  4IKU A;  3Q6D A;  2Q95 A;  1R5H A;  4JUQ A;  2BWS A;  3IL0 A;  1XGS A;  5D6E A;  3IU8 A;  1MAT A;  1WLR A;  2BWW A;  2BH3 A;  2BWY A;  5CDL A;  1KQ0 A;  2B3K A;  2BB7 A;  2GU7 A;  4IF7 A;  4RZZ A;  2GG5 A;  4S01 A;  5JI6 A;  3PKB A;  4IKR A;  2Q8K A;  2BHA A;  1B59 A;  1YW7 A;  2GG0 A;  4FUK A;  2GTX A;  3FMR A;  3MX6 A;  5D6F A;  4U1B A;  2GZ5 A;  4IPA A;  4U69 A;  1M35 A;  2HOW A;  1QZY A;  2B3H A;  2P98 A;  1A16 A;  3TAV A;  2GU5 A;  4QR8 A;  3MR1 A;  4KM3 A;  1W7V A;  2BWX A;  2V3X A;  1CHM A;  5CLS A;  4A6V A;  3PEB A;  4U76 A;  1QXY A;  2DFI A;  4S2T P;  1WY2 A;  2GGC A;  1C23 A;  1WBQ A;  5CDE A;  3FMQ A;  1QXZ A;  5CNX A;  3L24 A;  1KP0 A;  5E2C A;  2EA4 A;  3IU9 A;  1WL6 A;  3BIQ A;  1BN5 A;  4EGE A;  4ZWP A;  2BWT A;  3S6B A;  2MAT A;  4U6W A;  4U6Z A;  1N51 A;  2BN7 A;  3QOC A;  1B6A A;  2P99 A;  4FLJ A;  2Q92 A;  2B3L A;  1C22 A;  3O5V A;  4FKC A;  4MAT A;  4U6E A;  4ZWU A;  1YJ3 A;  4S00 A;  2V3Y A;  2OAZ A;  5CDV A;  5CIK A;  4FLI A;  2EVM A;  4U71 A;  2BWV A;  1YW8 A;  1XNZ A;  2IW2 A;  2BHC A;  2GG2 A;  1XGM A;  1W2M A;  5FCF A;  3OOO A; 
#chains in the Genus database with same CATH homology
 4RZY A;  3RVA A;  1Y1N A;  1KQ9 A;  3IG4 A;  4R60 A;  5CE6 A;  2GG8 A;  2GU6 A;  2EA2 A;  2Q94 A;  5E5B A;  2ZSG A;  2V3Z A;  2G6P A;  3PKD A;  4IKT A;  2GU4 A;  4IU6 A;  1O0X A;  2V6C A;  3CTZ A;  1C24 A;  4U73 A;  4IKS A;  1XGN A;  4S2R P;  1WL9 A;  3I7M A;  4HXX A;  4PNC A;  4U6J A;  2BHB A;  1C27 A;  2GGB A;  4FO7 A;  1R5G A;  5FCH A;  4ZNG A;  2BHD A;  2NQ7 A;  4U70 A;  5JHU A;  3D27 A;  1PV9 A;  3MAT A;  3PKE A;  3PKA A;  2NQ6 A;  1QXW A;  2GA2 A;  5JFR A;  4FO8 A;  2GG3 A;  3IU7 A;  4RGZ 1;  2BWU A;  1WN1 A;  3PN9 A;  2GG9 A;  2EVC A;  2EVO A;  3L7G A;  2OKN A;  1YW9 A;  4IEC A;  3TB5 A;  4Z7M A;  1YVM A;  3OVK A;  3CB5 A;  3FM3 A;  1C21 A;  2GG7 A;  1XGO A;  2ADU A;  2P9A A;  4PV4 A;  3PKC A;  4OOK A;  2Q93 A;  4U6C A;  3ROR A;  2Q96 A;  4A6W A;  4IDY A;  1BOA A;  1WKM A;  1JAW A;  4ZWO A;  3CB6 A;  1R58 A;  4B28 A;  3BIT A;  3BIP A;  4FLL A;  4FLK A;  4U75 A;  4IKU A;  3Q6D A;  2Q95 A;  1R5H A;  4JUQ A;  2BWS A;  3IL0 A;  1XGS A;  5D6E A;  3IU8 A;  1MAT A;  1WLR A;  2BWW A;  2BH3 A;  2BWY A;  5CDL A;  1KQ0 A;  2B3K A;  2BB7 A;  2GU7 A;  4IF7 A;  4RZZ A;  2GG5 A;  4S01 A;  5JI6 A;  3PKB A;  4IKR A;  2Q8K A;  2BHA A;  1B59 A;  1YW7 A;  2GG0 A;  4FUK A;  2GTX A;  3FMR A;  3MX6 A;  5D6F A;  4U1B A;  2GZ5 A;  4IPA A;  4U69 A;  1M35 A;  2HOW A;  1QZY A;  2B3H A;  2P98 A;  1A16 A;  3TAV A;  2GU5 A;  4QR8 A;  3MR1 A;  4KM3 A;  1W7V A;  2BWX A;  2V3X A;  1CHM A;  5CLS A;  4A6V A;  3PEB A;  4U76 A;  1QXY A;  2DFI A;  4S2T P;  1WY2 A;  2GGC A;  1C23 A;  1WBQ A;  5CDE A;  3FMQ A;  1QXZ A;  5CNX A;  3L24 A;  1KP0 A;  5E2C A;  2EA4 A;  3IU9 A;  1WL6 A;  3BIQ A;  1BN5 A;  4EGE A;  4ZWP A;  2BWT A;  3S6B A;  2MAT A;  4U6W A;  4U6Z A;  1N51 A;  2BN7 A;  3QOC A;  1B6A A;  2P99 A;  4FLJ A;  2Q92 A;  2B3L A;  1C22 A;  3O5V A;  4FKC A;  4MAT A;  4U6E A;  4ZWU A;  1YJ3 A;  4S00 A;  2V3Y A;  2OAZ A;  5CDV A;  5CIK A;  4FLI A;  2EVM A;  4U71 A;  2BWV A;  1YW8 A;  1XNZ A;  2IW2 A;  2BHC A;  2GG2 A;  1XGM A;  1W2M A;  5FCF A;  3OOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...