1WLRA

Apo aminopeptidase p from e. coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wlrA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wlrA02
5CNXA 4U1BA 2P98A 1B6AA 3OOOA 4IKRA 1B59A 1XGOA 2EVCA 2P9AA 2GU7A 2GZ5A 2GGCA 1C24A 2G6PA 2GG7A 3PKAA 2BWSA 3BITA 3CTZA 2MATA 4U6ZA 3TB5A 1YW8A 3FMQA 2ADUA 4EGEA 1C23A 3PKBA 2EA4A 5JI6A 2BWYA 1O0XA 2DFIA 2GTXA 1C21A 5JHUA 1QZYA 3CB5A 1XNZA 1WL9A 4IKSA 4U75A 1XGSA 2V3YA 1XGNA 5E2CA 2GG3A 3PKEA 2Q8KA 2Q95A 4Z7MA 2GGBA 1KQ0A 2Q92A 4ZNGA 4B28A 1KQ9A 3D27A 1BN5A 1WKMA 3FM3A 4IKUA 4U69A 2Q96A 2IW2A 4U6WA 4S01A 3PKCA 2BWXA 3IU8A 4A6WA 5E5BA 3PKDA 4OOKA 1XGMA 4U6CA 4IPAA 1WY2A 4U71A 4IF7A 3L7GA 2BHCA 1WL6A 1W7VA 1A16A 4FLJA 4U76A 4U70A 4FKCA 1JAWA 2B3HA 2B3KA 4IECA 2EVMA 3OVKA 4RGZ1 4U6JA 2HOWA 3RVAA 4ZWOA 2NQ6A 3MR1A 2ZSGA 1WBQA 4FLKA 4A6VA 2BHDA 5CDVA 1W2MA 2BHAA 1YVMA 4FLIA 1YW9A 5CDEA 4IU6A 1N51A 2EVOA 3Q6DA 3CB6A 3PEBA 4S2RP 4FLLA 4U6EA 3L24A 4FUKA 2OAZA 2GG9A 4KM3A 5JFRA 2NQ7A 1WN1A 2V3XA 3IG4A 1R5GA 4S00A 4IKTA 2EA2A 5CIKA 2BWVA 3QOCA 5D6EA 3S6BA 4U73A 2V6CA 2BWWA 4S2TP 3IU9A 2BN7A 3PN9A 2V3ZA 3MATA 4HXXA 1PV9A 2P99A 1R5HA 4FO8A 3IL0A 1C27A 2GG0A 5CE6A 1QXWA 2BH3A 1MATA 2GA2A 4JUQA 5FCFA 1QXYA 3I7MA 1WLRA 2GG8A 1QXZA 1BOAA 2OKNA 1C22A 4ZWPA 5CDLA 5FCHA 3O5VA 4R60A 1Y1NA 4MATA 3RORA 3MX6A 2GG5A 4RZZA 4PV4A 1KP0A 2GG2A 3FMRA 4FO7A 1M35A 2Q93A 4QR8A 2GU5A 3BIPA 5CLSA 5D6FA 1R58A 3BIQA 1YJ3A 2BWTA 4IDYA 4PNCA 3TAVA 3IU7A 2BHBA 4ZWUA 1CHMA 4RZYA 1YW7A 2Q94A 2BWUA 2GU4A 2GU6A 2B3LA 2BB7A
chains in the Genus database with same CATH superfamily
5CNXA 4U1BA 2P98A 1B6AA 3OOOA 4IKRA 1B59A 1XGOA 2EVCA 2P9AA 2GU7A 2GZ5A 2GGCA 1C24A 2G6PA 2GG7A 3PKAA 2BWSA 3BITA 3CTZA 2MATA 4U6ZA 3TB5A 1YW8A 3FMQA 2ADUA 4EGEA 1C23A 3PKBA 2EA4A 5JI6A 2BWYA 1O0XA 2DFIA 2GTXA 1C21A 5JHUA 1QZYA 3CB5A 1XNZA 1WL9A 4IKSA 4U75A 1XGSA 2V3YA 1XGNA 5E2CA 2GG3A 3PKEA 2Q8KA 2Q95A 4Z7MA 2GGBA 1KQ0A 2Q92A 4ZNGA 4B28A 1KQ9A 3D27A 1BN5A 1WKMA 3FM3A 4IKUA 4U69A 2Q96A 2IW2A 4U6WA 4S01A 3PKCA 2BWXA 3IU8A 4A6WA 5E5BA 3PKDA 4OOKA 1XGMA 4U6CA 4IPAA 1WY2A 4U71A 4IF7A 3L7GA 2BHCA 1WL6A 1W7VA 1A16A 4FLJA 4U76A 4U70A 4FKCA 1JAWA 2B3HA 2B3KA 4IECA 2EVMA 3OVKA 4RGZ1 4U6JA 2HOWA 3RVAA 4ZWOA 2NQ6A 3MR1A 2ZSGA 1WBQA 4FLKA 4A6VA 2BHDA 5CDVA 1W2MA 2BHAA 1YVMA 4FLIA 1YW9A 5CDEA 4IU6A 1N51A 2EVOA 3Q6DA 3CB6A 3PEBA 4S2RP 4FLLA 4U6EA 3L24A 4FUKA 2OAZA 2GG9A 4KM3A 5JFRA 2NQ7A 1WN1A 2V3XA 3IG4A 1R5GA 4S00A 4IKTA 2EA2A 5CIKA 2BWVA 3QOCA 5D6EA 3S6BA 4U73A 2V6CA 2BWWA 4S2TP 3IU9A 2BN7A 3PN9A 2V3ZA 3MATA 4HXXA 1PV9A 2P99A 1R5HA 4FO8A 3IL0A 1C27A 2GG0A 5CE6A 1QXWA 2BH3A 1MATA 2GA2A 4JUQA 5FCFA 1QXYA 3I7MA 1WLRA 2GG8A 1QXZA 1BOAA 2OKNA 1C22A 4ZWPA 5CDLA 5FCHA 3O5VA 4R60A 1Y1NA 4MATA 3RORA 3MX6A 2GG5A 4RZZA 4PV4A 1KP0A 2GG2A 3FMRA 4FO7A 1M35A 2Q93A 4QR8A 2GU5A 3BIPA 5CLSA 5D6FA 1R58A 3BIQA 1YJ3A 2BWTA 4IDYA 4PNCA 3TAVA 3IU7A 2BHBA 4ZWUA 1CHMA 4RZYA 1YW7A 2Q94A 2BWUA 2GU4A 2GU6A 2B3LA 2BB7A
chains in the Genus database with same CATH topology
5CNXA 4U1BA 2P98A 1B6AA 3OOOA 4IKRA 1B59A 1XGOA 2EVCA 2P9AA 2GU7A 2GZ5A 2GGCA 1C24A 2G6PA 2GG7A 3PKAA 2BWSA 3BITA 3CTZA 2MATA 4U6ZA 3TB5A 1YW8A 3FMQA 2ADUA 4EGEA 1C23A 3PKBA 2EA4A 5JI6A 2BWYA 1O0XA 2DFIA 2GTXA 1C21A 5JHUA 1QZYA 3CB5A 1XNZA 1WL9A 4IKSA 4U75A 1XGSA 2V3YA 1XGNA 5E2CA 2GG3A 3PKEA 2Q8KA 2Q95A 4Z7MA 2GGBA 1KQ0A 2Q92A 4ZNGA 4B28A 1KQ9A 3D27A 1BN5A 1WKMA 3FM3A 4IKUA 4U69A 2Q96A 2IW2A 4U6WA 4S01A 3PKCA 2BWXA 3IU8A 4A6WA 5E5BA 3PKDA 4OOKA 1XGMA 4U6CA 4IPAA 1WY2A 4U71A 4IF7A 3L7GA 2BHCA 1WL6A 1W7VA 1A16A 4FLJA 4U76A 4U70A 4FKCA 1JAWA 2B3HA 2B3KA 4IECA 2EVMA 3OVKA 4RGZ1 4U6JA 2HOWA 3RVAA 4ZWOA 2NQ6A 3MR1A 2ZSGA 1WBQA 4FLKA 4A6VA 2BHDA 5CDVA 1W2MA 2BHAA 1YVMA 4FLIA 1YW9A 5CDEA 4IU6A 1N51A 2EVOA 3Q6DA 3CB6A 3PEBA 4S2RP 4FLLA 4U6EA 3L24A 4FUKA 2OAZA 2GG9A 4KM3A 5JFRA 2NQ7A 1WN1A 2V3XA 3IG4A 1R5GA 4S00A 4IKTA 2EA2A 5CIKA 2BWVA 3QOCA 5D6EA 3S6BA 4U73A 2V6CA 2BWWA 4S2TP 3IU9A 2BN7A 3PN9A 2V3ZA 3MATA 4HXXA 1PV9A 2P99A 1R5HA 4FO8A 3IL0A 1C27A 2GG0A 5CE6A 1QXWA 2BH3A 1MATA 2GA2A 4JUQA 5FCFA 1QXYA 3I7MA 1WLRA 2GG8A 1QXZA 1BOAA 2OKNA 1C22A 4ZWPA 5CDLA 5FCHA 3O5VA 4R60A 1Y1NA 4MATA 3RORA 3MX6A 2GG5A 4RZZA 4PV4A 1KP0A 2GG2A 3FMRA 4FO7A 1M35A 2Q93A 4QR8A 2GU5A 3BIPA 5CLSA 5D6FA 1R58A 3BIQA 1YJ3A 2BWTA 4IDYA 4PNCA 3TAVA 3IU7A 2BHBA 4ZWUA 1CHMA 4RZYA 1YW7A 2Q94A 2BWUA 2GU4A 2GU6A 2B3LA 2BB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNX A;  4U1B A;  2P98 A;  1B6A A;  3OOO A;  4IKR A;  1B59 A;  1XGO A;  2EVC A;  2P9A A;  2GU7 A;  2GZ5 A;  2GGC A;  1C24 A;  2G6P A;  2GG7 A;  3PKA A;  2BWS A;  3BIT A;  3CTZ A;  2MAT A;  4U6Z A;  3TB5 A;  1YW8 A;  3FMQ A;  2ADU A;  4EGE A;  1C23 A;  3PKB A;  2EA4 A;  5JI6 A;  2BWY A;  1O0X A;  2DFI A;  2GTX A;  1C21 A;  5JHU A;  1QZY A;  3CB5 A;  1XNZ A;  1WL9 A;  4IKS A;  4U75 A;  1XGS A;  2V3Y A;  1XGN A;  5E2C A;  2GG3 A;  3PKE A;  2Q8K A;  2Q95 A;  4Z7M A;  2GGB A;  1KQ0 A;  2Q92 A;  4ZNG A;  4B28 A;  1KQ9 A;  3D27 A;  1BN5 A;  1WKM A;  3FM3 A;  4IKU A;  4U69 A;  2Q96 A;  2IW2 A;  4U6W A;  4S01 A;  3PKC A;  2BWX A;  3IU8 A;  4A6W A;  5E5B A;  3PKD A;  4OOK A;  1XGM A;  4U6C A;  4IPA A;  1WY2 A;  4U71 A;  4IF7 A;  3L7G A;  2BHC A;  1WL6 A;  1W7V A;  1A16 A;  4FLJ A;  4U76 A;  4U70 A;  4FKC A;  1JAW A;  2B3H A;  2B3K A;  4IEC A;  2EVM A;  3OVK A;  4RGZ 1;  4U6J A;  2HOW A;  3RVA A;  4ZWO A;  2NQ6 A;  3MR1 A;  2ZSG A;  1WBQ A;  4FLK A;  4A6V A;  2BHD A;  5CDV A;  1W2M A;  2BHA A;  1YVM A;  4FLI A;  1YW9 A;  5CDE A;  4IU6 A;  1N51 A;  2EVO A;  3Q6D A;  3CB6 A;  3PEB A;  4S2R P;  4FLL A;  4U6E A;  3L24 A;  4FUK A;  2OAZ A;  2GG9 A;  4KM3 A;  5JFR A;  2NQ7 A;  1WN1 A;  2V3X A;  3IG4 A;  1R5G A;  4S00 A;  4IKT A;  2EA2 A;  5CIK A;  2BWV A;  3QOC A;  5D6E A;  3S6B A;  4U73 A;  2V6C A;  2BWW A;  4S2T P;  3IU9 A;  2BN7 A;  3PN9 A;  2V3Z A;  3MAT A;  4HXX A;  1PV9 A;  2P99 A;  1R5H A;  4FO8 A;  3IL0 A;  1C27 A;  2GG0 A;  5CE6 A;  1QXW A;  2BH3 A;  1MAT A;  2GA2 A;  4JUQ A;  5FCF A;  1QXY A;  3I7M A;  1WLR A;  2GG8 A;  1QXZ A;  1BOA A;  2OKN A;  1C22 A;  4ZWP A;  5CDL A;  5FCH A;  3O5V A;  4R60 A;  1Y1N A;  4MAT A;  3ROR A;  3MX6 A;  2GG5 A;  4RZZ A;  4PV4 A;  1KP0 A;  2GG2 A;  3FMR A;  4FO7 A;  1M35 A;  2Q93 A;  4QR8 A;  2GU5 A;  3BIP A;  5CLS A;  5D6F A;  1R58 A;  3BIQ A;  1YJ3 A;  2BWT A;  4IDY A;  4PNC A;  3TAV A;  3IU7 A;  2BHB A;  4ZWU A;  1CHM A;  4RZY A;  1YW7 A;  2Q94 A;  2BWU A;  2GU4 A;  2GU6 A;  2B3L A;  2BB7 A; 
#chains in the Genus database with same CATH topology
 5CNX A;  4U1B A;  2P98 A;  1B6A A;  3OOO A;  4IKR A;  1B59 A;  1XGO A;  2EVC A;  2P9A A;  2GU7 A;  2GZ5 A;  2GGC A;  1C24 A;  2G6P A;  2GG7 A;  3PKA A;  2BWS A;  3BIT A;  3CTZ A;  2MAT A;  4U6Z A;  3TB5 A;  1YW8 A;  3FMQ A;  2ADU A;  4EGE A;  1C23 A;  3PKB A;  2EA4 A;  5JI6 A;  2BWY A;  1O0X A;  2DFI A;  2GTX A;  1C21 A;  5JHU A;  1QZY A;  3CB5 A;  1XNZ A;  1WL9 A;  4IKS A;  4U75 A;  1XGS A;  2V3Y A;  1XGN A;  5E2C A;  2GG3 A;  3PKE A;  2Q8K A;  2Q95 A;  4Z7M A;  2GGB A;  1KQ0 A;  2Q92 A;  4ZNG A;  4B28 A;  1KQ9 A;  3D27 A;  1BN5 A;  1WKM A;  3FM3 A;  4IKU A;  4U69 A;  2Q96 A;  2IW2 A;  4U6W A;  4S01 A;  3PKC A;  2BWX A;  3IU8 A;  4A6W A;  5E5B A;  3PKD A;  4OOK A;  1XGM A;  4U6C A;  4IPA A;  1WY2 A;  4U71 A;  4IF7 A;  3L7G A;  2BHC A;  1WL6 A;  1W7V A;  1A16 A;  4FLJ A;  4U76 A;  4U70 A;  4FKC A;  1JAW A;  2B3H A;  2B3K A;  4IEC A;  2EVM A;  3OVK A;  4RGZ 1;  4U6J A;  2HOW A;  3RVA A;  4ZWO A;  2NQ6 A;  3MR1 A;  2ZSG A;  1WBQ A;  4FLK A;  4A6V A;  2BHD A;  5CDV A;  1W2M A;  2BHA A;  1YVM A;  4FLI A;  1YW9 A;  5CDE A;  4IU6 A;  1N51 A;  2EVO A;  3Q6D A;  3CB6 A;  3PEB A;  4S2R P;  4FLL A;  4U6E A;  3L24 A;  4FUK A;  2OAZ A;  2GG9 A;  4KM3 A;  5JFR A;  2NQ7 A;  1WN1 A;  2V3X A;  3IG4 A;  1R5G A;  4S00 A;  4IKT A;  2EA2 A;  5CIK A;  2BWV A;  3QOC A;  5D6E A;  3S6B A;  4U73 A;  2V6C A;  2BWW A;  4S2T P;  3IU9 A;  2BN7 A;  3PN9 A;  2V3Z A;  3MAT A;  4HXX A;  1PV9 A;  2P99 A;  1R5H A;  4FO8 A;  3IL0 A;  1C27 A;  2GG0 A;  5CE6 A;  1QXW A;  2BH3 A;  1MAT A;  2GA2 A;  4JUQ A;  5FCF A;  1QXY A;  3I7M A;  1WLR A;  2GG8 A;  1QXZ A;  1BOA A;  2OKN A;  1C22 A;  4ZWP A;  5CDL A;  5FCH A;  3O5V A;  4R60 A;  1Y1N A;  4MAT A;  3ROR A;  3MX6 A;  2GG5 A;  4RZZ A;  4PV4 A;  1KP0 A;  2GG2 A;  3FMR A;  4FO7 A;  1M35 A;  2Q93 A;  4QR8 A;  2GU5 A;  3BIP A;  5CLS A;  5D6F A;  1R58 A;  3BIQ A;  1YJ3 A;  2BWT A;  4IDY A;  4PNC A;  3TAV A;  3IU7 A;  2BHB A;  4ZWU A;  1CHM A;  4RZY A;  1YW7 A;  2Q94 A;  2BWU A;  2GU4 A;  2GU6 A;  2B3L A;  2BB7 A; 
#chains in the Genus database with same CATH homology
 5CNX A;  4U1B A;  2P98 A;  1B6A A;  3OOO A;  4IKR A;  1B59 A;  1XGO A;  2EVC A;  2P9A A;  2GU7 A;  2GZ5 A;  2GGC A;  1C24 A;  2G6P A;  2GG7 A;  3PKA A;  2BWS A;  3BIT A;  3CTZ A;  2MAT A;  4U6Z A;  3TB5 A;  1YW8 A;  3FMQ A;  2ADU A;  4EGE A;  1C23 A;  3PKB A;  2EA4 A;  5JI6 A;  2BWY A;  1O0X A;  2DFI A;  2GTX A;  1C21 A;  5JHU A;  1QZY A;  3CB5 A;  1XNZ A;  1WL9 A;  4IKS A;  4U75 A;  1XGS A;  2V3Y A;  1XGN A;  5E2C A;  2GG3 A;  3PKE A;  2Q8K A;  2Q95 A;  4Z7M A;  2GGB A;  1KQ0 A;  2Q92 A;  4ZNG A;  4B28 A;  1KQ9 A;  3D27 A;  1BN5 A;  1WKM A;  3FM3 A;  4IKU A;  4U69 A;  2Q96 A;  2IW2 A;  4U6W A;  4S01 A;  3PKC A;  2BWX A;  3IU8 A;  4A6W A;  5E5B A;  3PKD A;  4OOK A;  1XGM A;  4U6C A;  4IPA A;  1WY2 A;  4U71 A;  4IF7 A;  3L7G A;  2BHC A;  1WL6 A;  1W7V A;  1A16 A;  4FLJ A;  4U76 A;  4U70 A;  4FKC A;  1JAW A;  2B3H A;  2B3K A;  4IEC A;  2EVM A;  3OVK A;  4RGZ 1;  4U6J A;  2HOW A;  3RVA A;  4ZWO A;  2NQ6 A;  3MR1 A;  2ZSG A;  1WBQ A;  4FLK A;  4A6V A;  2BHD A;  5CDV A;  1W2M A;  2BHA A;  1YVM A;  4FLI A;  1YW9 A;  5CDE A;  4IU6 A;  1N51 A;  2EVO A;  3Q6D A;  3CB6 A;  3PEB A;  4S2R P;  4FLL A;  4U6E A;  3L24 A;  4FUK A;  2OAZ A;  2GG9 A;  4KM3 A;  5JFR A;  2NQ7 A;  1WN1 A;  2V3X A;  3IG4 A;  1R5G A;  4S00 A;  4IKT A;  2EA2 A;  5CIK A;  2BWV A;  3QOC A;  5D6E A;  3S6B A;  4U73 A;  2V6C A;  2BWW A;  4S2T P;  3IU9 A;  2BN7 A;  3PN9 A;  2V3Z A;  3MAT A;  4HXX A;  1PV9 A;  2P99 A;  1R5H A;  4FO8 A;  3IL0 A;  1C27 A;  2GG0 A;  5CE6 A;  1QXW A;  2BH3 A;  1MAT A;  2GA2 A;  4JUQ A;  5FCF A;  1QXY A;  3I7M A;  1WLR A;  2GG8 A;  1QXZ A;  1BOA A;  2OKN A;  1C22 A;  4ZWP A;  5CDL A;  5FCH A;  3O5V A;  4R60 A;  1Y1N A;  4MAT A;  3ROR A;  3MX6 A;  2GG5 A;  4RZZ A;  4PV4 A;  1KP0 A;  2GG2 A;  3FMR A;  4FO7 A;  1M35 A;  2Q93 A;  4QR8 A;  2GU5 A;  3BIP A;  5CLS A;  5D6F A;  1R58 A;  3BIQ A;  1YJ3 A;  2BWT A;  4IDY A;  4PNC A;  3TAV A;  3IU7 A;  2BHB A;  4ZWU A;  1CHM A;  4RZY A;  1YW7 A;  2Q94 A;  2BWU A;  2GU4 A;  2GU6 A;  2B3L A;  2BB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...