1WLRA

Apo aminopeptidase p from e. coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wlrA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wlrA02
1O0XA 1JAWA 1YVMA 1C24A 3L24A 4FLJA 2EA4A 1C21A 2G6PA 2BWSA 2GA2A 3CTZA 2BWUA 2NQ6A 4Z7MA 2GU7A 2BHDA 1XGOA 1WLRA 2BWTA 2V6CA 2Q8KA 4FO7A 4EGEA 4FLKA 4FO8A 4IDYA 2BHBA 2B3LA 2Q92A 2GG7A 4IU6A 3TAVA 5JHUA 1YJ3A 2GZ5A 4IKRA 2V3ZA 4IF7A 5CIKA 3D27A 2OAZA 4U6ZA 3FM3A 5CE6A 1KQ9A 3OVKA 4HXXA 2GGBA 1R5GA 1WY2A 2GU6A 2NQ7A 2Q96A 1B6AA 2GG9A 3RVAA 3IG4A 2Q95A 5E2CA 3IU7A 3BIPA 3CB5A 2GG5A 3PKAA 5JFRA 2BHCA 2OKNA 1YW7A 2GU4A 3IU9A 3TB5A 1WL6A 1YW9A 4S01A 4OOKA 4U71A 4RZZA 2Q93A 4KM3A 1R5HA 3BIQA 3BITA 3MX6A 2P99A 1YW8A 4U6WA 4RZYA 2MATA 4U76A 2BWYA 1WN1A 3PKDA 5FCHA 4IKUA 1N51A 2BWXA 1QXWA 2GG0A 1Y1NA 4FUKA 5D6EA 2GTXA 1QXYA 3FMRA 1QXZA 1KP0A 1XNZA 1CHMA 2B3KA 4IKSA 1C22A 4B28A 2EVOA 1WBQA 4FKCA 1WKMA 3PKBA 3Q6DA 3I7MA 3CB6A 1A16A 3O5VA 3MATA 4IPAA 2GG3A 1XGSA 5CNXA 2V3YA 1QZYA 2GGCA 4U6JA 2P9AA 4U75A 2B3HA 3OOOA 4S2TP 2Q94A 4IECA 4U6CA 1B59A 4U73A 2BB7A 4ZNGA 4A6VA 5CLSA 1KQ0A 2GG8A 5CDVA 2GG2A 4ZWOA 1C27A 2BN7A 4R60A 2BWWA 2BHAA 3FMQA 1W7VA 1PV9A 4PNCA 4U69A 3IL0A 3L7GA 2BH3A 4ZWPA 2IW2A 4FLLA 2EA2A 1C23A 2BWVA 4A6WA 5CDLA 3RORA 4QR8A 3IU8A 1XGNA 1BN5A 5JI6A 4S2RP 3S6BA 3PKEA 2V3XA 5D6FA 2EVCA 1MATA 2DFIA 1W2MA 4IKTA 2ZSGA 3PEBA 4U6EA 3QOCA 1R58A 5E5BA 4JUQA 3MR1A 1WL9A 4ZWUA 4PV4A 3PKCA 4MATA 4S00A 1XGMA 5FCFA 4FLIA 1BOAA 4U1BA 2ADUA 3PN9A 2GU5A 5CDEA 2P98A 4U70A 2HOWA 1M35A 4RGZ1 2EVMA
chains in the Genus database with same CATH superfamily
1O0XA 1JAWA 1YVMA 1C24A 3L24A 4FLJA 2EA4A 1C21A 2G6PA 2BWSA 2GA2A 3CTZA 2BWUA 2NQ6A 4Z7MA 2GU7A 2BHDA 1XGOA 1WLRA 2BWTA 2V6CA 2Q8KA 4FO7A 4EGEA 4FLKA 4FO8A 4IDYA 2BHBA 2B3LA 2Q92A 2GG7A 4IU6A 3TAVA 5JHUA 1YJ3A 2GZ5A 4IKRA 2V3ZA 4IF7A 5CIKA 3D27A 2OAZA 4U6ZA 3FM3A 5CE6A 1KQ9A 3OVKA 4HXXA 2GGBA 1R5GA 1WY2A 2GU6A 2NQ7A 2Q96A 1B6AA 2GG9A 3RVAA 3IG4A 2Q95A 5E2CA 3IU7A 3BIPA 3CB5A 2GG5A 3PKAA 5JFRA 2BHCA 2OKNA 1YW7A 2GU4A 3IU9A 3TB5A 1WL6A 1YW9A 4S01A 4OOKA 4U71A 4RZZA 2Q93A 4KM3A 1R5HA 3BIQA 3BITA 3MX6A 2P99A 1YW8A 4U6WA 4RZYA 2MATA 4U76A 2BWYA 1WN1A 3PKDA 5FCHA 4IKUA 1N51A 2BWXA 1QXWA 2GG0A 1Y1NA 4FUKA 5D6EA 2GTXA 1QXYA 3FMRA 1QXZA 1KP0A 1XNZA 1CHMA 2B3KA 4IKSA 1C22A 4B28A 2EVOA 1WBQA 4FKCA 1WKMA 3PKBA 3Q6DA 3I7MA 3CB6A 1A16A 3O5VA 3MATA 4IPAA 2GG3A 1XGSA 5CNXA 2V3YA 1QZYA 2GGCA 4U6JA 2P9AA 4U75A 2B3HA 3OOOA 4S2TP 2Q94A 4IECA 4U6CA 1B59A 4U73A 2BB7A 4ZNGA 4A6VA 5CLSA 1KQ0A 2GG8A 5CDVA 2GG2A 4ZWOA 1C27A 2BN7A 4R60A 2BWWA 2BHAA 3FMQA 1W7VA 1PV9A 4PNCA 4U69A 3IL0A 3L7GA 2BH3A 4ZWPA 2IW2A 4FLLA 2EA2A 1C23A 2BWVA 4A6WA 5CDLA 3RORA 4QR8A 3IU8A 1XGNA 1BN5A 5JI6A 4S2RP 3S6BA 3PKEA 2V3XA 5D6FA 2EVCA 1MATA 2DFIA 1W2MA 4IKTA 2ZSGA 3PEBA 4U6EA 3QOCA 1R58A 5E5BA 4JUQA 3MR1A 1WL9A 4ZWUA 4PV4A 3PKCA 4MATA 4S00A 1XGMA 5FCFA 4FLIA 1BOAA 4U1BA 2ADUA 3PN9A 2GU5A 5CDEA 2P98A 4U70A 2HOWA 1M35A 4RGZ1 2EVMA
chains in the Genus database with same CATH topology
1O0XA 1JAWA 1YVMA 1C24A 3L24A 4FLJA 2EA4A 1C21A 2G6PA 2BWSA 2GA2A 3CTZA 2BWUA 2NQ6A 4Z7MA 2GU7A 2BHDA 1XGOA 1WLRA 2BWTA 2V6CA 2Q8KA 4FO7A 4EGEA 4FLKA 4FO8A 4IDYA 2BHBA 2B3LA 2Q92A 2GG7A 4IU6A 3TAVA 5JHUA 1YJ3A 2GZ5A 4IKRA 2V3ZA 4IF7A 5CIKA 3D27A 2OAZA 4U6ZA 3FM3A 5CE6A 1KQ9A 3OVKA 4HXXA 2GGBA 1R5GA 1WY2A 2GU6A 2NQ7A 2Q96A 1B6AA 2GG9A 3RVAA 3IG4A 2Q95A 5E2CA 3IU7A 3BIPA 3CB5A 2GG5A 3PKAA 5JFRA 2BHCA 2OKNA 1YW7A 2GU4A 3IU9A 3TB5A 1WL6A 1YW9A 4S01A 4OOKA 4U71A 4RZZA 2Q93A 4KM3A 1R5HA 3BIQA 3BITA 3MX6A 2P99A 1YW8A 4U6WA 4RZYA 2MATA 4U76A 2BWYA 1WN1A 3PKDA 5FCHA 4IKUA 1N51A 2BWXA 1QXWA 2GG0A 1Y1NA 4FUKA 5D6EA 2GTXA 1QXYA 3FMRA 1QXZA 1KP0A 1XNZA 1CHMA 2B3KA 4IKSA 1C22A 4B28A 2EVOA 1WBQA 4FKCA 1WKMA 3PKBA 3Q6DA 3I7MA 3CB6A 1A16A 3O5VA 3MATA 4IPAA 2GG3A 1XGSA 5CNXA 2V3YA 1QZYA 2GGCA 4U6JA 2P9AA 4U75A 2B3HA 3OOOA 4S2TP 2Q94A 4IECA 4U6CA 1B59A 4U73A 2BB7A 4ZNGA 4A6VA 5CLSA 1KQ0A 2GG8A 5CDVA 2GG2A 4ZWOA 1C27A 2BN7A 4R60A 2BWWA 2BHAA 3FMQA 1W7VA 1PV9A 4PNCA 4U69A 3IL0A 3L7GA 2BH3A 4ZWPA 2IW2A 4FLLA 2EA2A 1C23A 2BWVA 4A6WA 5CDLA 3RORA 4QR8A 3IU8A 1XGNA 1BN5A 5JI6A 4S2RP 3S6BA 3PKEA 2V3XA 5D6FA 2EVCA 1MATA 2DFIA 1W2MA 4IKTA 2ZSGA 3PEBA 4U6EA 3QOCA 1R58A 5E5BA 4JUQA 3MR1A 1WL9A 4ZWUA 4PV4A 3PKCA 4MATA 4S00A 1XGMA 5FCFA 4FLIA 1BOAA 4U1BA 2ADUA 3PN9A 2GU5A 5CDEA 2P98A 4U70A 2HOWA 1M35A 4RGZ1 2EVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O0X A;  1JAW A;  1YVM A;  1C24 A;  3L24 A;  4FLJ A;  2EA4 A;  1C21 A;  2G6P A;  2BWS A;  2GA2 A;  3CTZ A;  2BWU A;  2NQ6 A;  4Z7M A;  2GU7 A;  2BHD A;  1XGO A;  1WLR A;  2BWT A;  2V6C A;  2Q8K A;  4FO7 A;  4EGE A;  4FLK A;  4FO8 A;  4IDY A;  2BHB A;  2B3L A;  2Q92 A;  2GG7 A;  4IU6 A;  3TAV A;  5JHU A;  1YJ3 A;  2GZ5 A;  4IKR A;  2V3Z A;  4IF7 A;  5CIK A;  3D27 A;  2OAZ A;  4U6Z A;  3FM3 A;  5CE6 A;  1KQ9 A;  3OVK A;  4HXX A;  2GGB A;  1R5G A;  1WY2 A;  2GU6 A;  2NQ7 A;  2Q96 A;  1B6A A;  2GG9 A;  3RVA A;  3IG4 A;  2Q95 A;  5E2C A;  3IU7 A;  3BIP A;  3CB5 A;  2GG5 A;  3PKA A;  5JFR A;  2BHC A;  2OKN A;  1YW7 A;  2GU4 A;  3IU9 A;  3TB5 A;  1WL6 A;  1YW9 A;  4S01 A;  4OOK A;  4U71 A;  4RZZ A;  2Q93 A;  4KM3 A;  1R5H A;  3BIQ A;  3BIT A;  3MX6 A;  2P99 A;  1YW8 A;  4U6W A;  4RZY A;  2MAT A;  4U76 A;  2BWY A;  1WN1 A;  3PKD A;  5FCH A;  4IKU A;  1N51 A;  2BWX A;  1QXW A;  2GG0 A;  1Y1N A;  4FUK A;  5D6E A;  2GTX A;  1QXY A;  3FMR A;  1QXZ A;  1KP0 A;  1XNZ A;  1CHM A;  2B3K A;  4IKS A;  1C22 A;  4B28 A;  2EVO A;  1WBQ A;  4FKC A;  1WKM A;  3PKB A;  3Q6D A;  3I7M A;  3CB6 A;  1A16 A;  3O5V A;  3MAT A;  4IPA A;  2GG3 A;  1XGS A;  5CNX A;  2V3Y A;  1QZY A;  2GGC A;  4U6J A;  2P9A A;  4U75 A;  2B3H A;  3OOO A;  4S2T P;  2Q94 A;  4IEC A;  4U6C A;  1B59 A;  4U73 A;  2BB7 A;  4ZNG A;  4A6V A;  5CLS A;  1KQ0 A;  2GG8 A;  5CDV A;  2GG2 A;  4ZWO A;  1C27 A;  2BN7 A;  4R60 A;  2BWW A;  2BHA A;  3FMQ A;  1W7V A;  1PV9 A;  4PNC A;  4U69 A;  3IL0 A;  3L7G A;  2BH3 A;  4ZWP A;  2IW2 A;  4FLL A;  2EA2 A;  1C23 A;  2BWV A;  4A6W A;  5CDL A;  3ROR A;  4QR8 A;  3IU8 A;  1XGN A;  1BN5 A;  5JI6 A;  4S2R P;  3S6B A;  3PKE A;  2V3X A;  5D6F A;  2EVC A;  1MAT A;  2DFI A;  1W2M A;  4IKT A;  2ZSG A;  3PEB A;  4U6E A;  3QOC A;  1R58 A;  5E5B A;  4JUQ A;  3MR1 A;  1WL9 A;  4ZWU A;  4PV4 A;  3PKC A;  4MAT A;  4S00 A;  1XGM A;  5FCF A;  4FLI A;  1BOA A;  4U1B A;  2ADU A;  3PN9 A;  2GU5 A;  5CDE A;  2P98 A;  4U70 A;  2HOW A;  1M35 A;  4RGZ 1;  2EVM A; 
#chains in the Genus database with same CATH topology
 1O0X A;  1JAW A;  1YVM A;  1C24 A;  3L24 A;  4FLJ A;  2EA4 A;  1C21 A;  2G6P A;  2BWS A;  2GA2 A;  3CTZ A;  2BWU A;  2NQ6 A;  4Z7M A;  2GU7 A;  2BHD A;  1XGO A;  1WLR A;  2BWT A;  2V6C A;  2Q8K A;  4FO7 A;  4EGE A;  4FLK A;  4FO8 A;  4IDY A;  2BHB A;  2B3L A;  2Q92 A;  2GG7 A;  4IU6 A;  3TAV A;  5JHU A;  1YJ3 A;  2GZ5 A;  4IKR A;  2V3Z A;  4IF7 A;  5CIK A;  3D27 A;  2OAZ A;  4U6Z A;  3FM3 A;  5CE6 A;  1KQ9 A;  3OVK A;  4HXX A;  2GGB A;  1R5G A;  1WY2 A;  2GU6 A;  2NQ7 A;  2Q96 A;  1B6A A;  2GG9 A;  3RVA A;  3IG4 A;  2Q95 A;  5E2C A;  3IU7 A;  3BIP A;  3CB5 A;  2GG5 A;  3PKA A;  5JFR A;  2BHC A;  2OKN A;  1YW7 A;  2GU4 A;  3IU9 A;  3TB5 A;  1WL6 A;  1YW9 A;  4S01 A;  4OOK A;  4U71 A;  4RZZ A;  2Q93 A;  4KM3 A;  1R5H A;  3BIQ A;  3BIT A;  3MX6 A;  2P99 A;  1YW8 A;  4U6W A;  4RZY A;  2MAT A;  4U76 A;  2BWY A;  1WN1 A;  3PKD A;  5FCH A;  4IKU A;  1N51 A;  2BWX A;  1QXW A;  2GG0 A;  1Y1N A;  4FUK A;  5D6E A;  2GTX A;  1QXY A;  3FMR A;  1QXZ A;  1KP0 A;  1XNZ A;  1CHM A;  2B3K A;  4IKS A;  1C22 A;  4B28 A;  2EVO A;  1WBQ A;  4FKC A;  1WKM A;  3PKB A;  3Q6D A;  3I7M A;  3CB6 A;  1A16 A;  3O5V A;  3MAT A;  4IPA A;  2GG3 A;  1XGS A;  5CNX A;  2V3Y A;  1QZY A;  2GGC A;  4U6J A;  2P9A A;  4U75 A;  2B3H A;  3OOO A;  4S2T P;  2Q94 A;  4IEC A;  4U6C A;  1B59 A;  4U73 A;  2BB7 A;  4ZNG A;  4A6V A;  5CLS A;  1KQ0 A;  2GG8 A;  5CDV A;  2GG2 A;  4ZWO A;  1C27 A;  2BN7 A;  4R60 A;  2BWW A;  2BHA A;  3FMQ A;  1W7V A;  1PV9 A;  4PNC A;  4U69 A;  3IL0 A;  3L7G A;  2BH3 A;  4ZWP A;  2IW2 A;  4FLL A;  2EA2 A;  1C23 A;  2BWV A;  4A6W A;  5CDL A;  3ROR A;  4QR8 A;  3IU8 A;  1XGN A;  1BN5 A;  5JI6 A;  4S2R P;  3S6B A;  3PKE A;  2V3X A;  5D6F A;  2EVC A;  1MAT A;  2DFI A;  1W2M A;  4IKT A;  2ZSG A;  3PEB A;  4U6E A;  3QOC A;  1R58 A;  5E5B A;  4JUQ A;  3MR1 A;  1WL9 A;  4ZWU A;  4PV4 A;  3PKC A;  4MAT A;  4S00 A;  1XGM A;  5FCF A;  4FLI A;  1BOA A;  4U1B A;  2ADU A;  3PN9 A;  2GU5 A;  5CDE A;  2P98 A;  4U70 A;  2HOW A;  1M35 A;  4RGZ 1;  2EVM A; 
#chains in the Genus database with same CATH homology
 1O0X A;  1JAW A;  1YVM A;  1C24 A;  3L24 A;  4FLJ A;  2EA4 A;  1C21 A;  2G6P A;  2BWS A;  2GA2 A;  3CTZ A;  2BWU A;  2NQ6 A;  4Z7M A;  2GU7 A;  2BHD A;  1XGO A;  1WLR A;  2BWT A;  2V6C A;  2Q8K A;  4FO7 A;  4EGE A;  4FLK A;  4FO8 A;  4IDY A;  2BHB A;  2B3L A;  2Q92 A;  2GG7 A;  4IU6 A;  3TAV A;  5JHU A;  1YJ3 A;  2GZ5 A;  4IKR A;  2V3Z A;  4IF7 A;  5CIK A;  3D27 A;  2OAZ A;  4U6Z A;  3FM3 A;  5CE6 A;  1KQ9 A;  3OVK A;  4HXX A;  2GGB A;  1R5G A;  1WY2 A;  2GU6 A;  2NQ7 A;  2Q96 A;  1B6A A;  2GG9 A;  3RVA A;  3IG4 A;  2Q95 A;  5E2C A;  3IU7 A;  3BIP A;  3CB5 A;  2GG5 A;  3PKA A;  5JFR A;  2BHC A;  2OKN A;  1YW7 A;  2GU4 A;  3IU9 A;  3TB5 A;  1WL6 A;  1YW9 A;  4S01 A;  4OOK A;  4U71 A;  4RZZ A;  2Q93 A;  4KM3 A;  1R5H A;  3BIQ A;  3BIT A;  3MX6 A;  2P99 A;  1YW8 A;  4U6W A;  4RZY A;  2MAT A;  4U76 A;  2BWY A;  1WN1 A;  3PKD A;  5FCH A;  4IKU A;  1N51 A;  2BWX A;  1QXW A;  2GG0 A;  1Y1N A;  4FUK A;  5D6E A;  2GTX A;  1QXY A;  3FMR A;  1QXZ A;  1KP0 A;  1XNZ A;  1CHM A;  2B3K A;  4IKS A;  1C22 A;  4B28 A;  2EVO A;  1WBQ A;  4FKC A;  1WKM A;  3PKB A;  3Q6D A;  3I7M A;  3CB6 A;  1A16 A;  3O5V A;  3MAT A;  4IPA A;  2GG3 A;  1XGS A;  5CNX A;  2V3Y A;  1QZY A;  2GGC A;  4U6J A;  2P9A A;  4U75 A;  2B3H A;  3OOO A;  4S2T P;  2Q94 A;  4IEC A;  4U6C A;  1B59 A;  4U73 A;  2BB7 A;  4ZNG A;  4A6V A;  5CLS A;  1KQ0 A;  2GG8 A;  5CDV A;  2GG2 A;  4ZWO A;  1C27 A;  2BN7 A;  4R60 A;  2BWW A;  2BHA A;  3FMQ A;  1W7V A;  1PV9 A;  4PNC A;  4U69 A;  3IL0 A;  3L7G A;  2BH3 A;  4ZWP A;  2IW2 A;  4FLL A;  2EA2 A;  1C23 A;  2BWV A;  4A6W A;  5CDL A;  3ROR A;  4QR8 A;  3IU8 A;  1XGN A;  1BN5 A;  5JI6 A;  4S2R P;  3S6B A;  3PKE A;  2V3X A;  5D6F A;  2EVC A;  1MAT A;  2DFI A;  1W2M A;  4IKT A;  2ZSG A;  3PEB A;  4U6E A;  3QOC A;  1R58 A;  5E5B A;  4JUQ A;  3MR1 A;  1WL9 A;  4ZWU A;  4PV4 A;  3PKC A;  4MAT A;  4S00 A;  1XGM A;  5FCF A;  4FLI A;  1BOA A;  4U1B A;  2ADU A;  3PN9 A;  2GU5 A;  5CDE A;  2P98 A;  4U70 A;  2HOW A;  1M35 A;  4RGZ 1;  2EVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...