1WLRA

Apo aminopeptidase p from e. coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wlrA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wlrA02
4MATA 5CE6A 2BHBA 1Y1NA 1N51A 1QXZA 3PKAA 4S00A 1XGNA 1XNZA 3D27A 1WL6A 3RVAA 2B3HA 1C21A 2GG8A 3PEBA 1WBQA 2GG3A 1A16A 4U1BA 3FM3A 3MX6A 2Q92A 4JUQA 4RZZA 3BIQA 2BWXA 2V3YA 2GG2A 4IF7A 5D6FA 3TB5A 3L24A 2GU4A 2ZSGA 2Q95A 3PKDA 2BH3A 2BWWA 4U75A 2BN7A 4IDYA 5CLSA 2GTXA 5E5BA 3BITA 1XGMA 3CB5A 1W7VA 2BWYA 2BHAA 1BOAA 1WLRA 3O5VA 1O0XA 1YVMA 2OAZA 2Q93A 3RORA 2IW2A 1BN5A 2GU7A 5JI6A 4QR8A 3S6BA 1C23A 2BB7A 3OVKA 4U6JA 4U6CA 4EGEA 1C24A 1CHMA 3IG4A 1MATA 2GG5A 1JAWA 2NQ6A 3IU7A 4U6WA 1XGOA 4FO8A 4U6EA 1R5GA 4A6VA 1QZYA 2P98A 3OOOA 1KP0A 4IKRA 5E2CA 4IKTA 4KM3A 1YW8A 4U6ZA 4PV4A 3CB6A 2GGCA 1KQ9A 2GG7A 3Q6DA 2NQ7A 2V3XA 2EVMA 3IU8A 1WY2A 2HOWA 4FLLA 4HXXA 4ZWPA 2EA2A 4U70A 3FMQA 3TAVA 2ADUA 4Z7MA 2BHDA 2V6CA 2OKNA 1B59A 2GG9A 4B28A 4IPAA 2BWUA 2GU6A 3I7MA 2Q8KA 4IU6A 2V3ZA 2BWTA 1WN1A 3QOCA 4RGZ1 3IU9A 4R60A 5JHUA 5CDLA 3PKEA 2B3KA 4FUKA 1YJ3A 1M35A 2BWVA 2BHCA 2B3LA 2DFIA 5D6EA 4ZWOA 4FLJA 2EVOA 2P9AA 3L7GA 1R5HA 4FLIA 4PNCA 3BIPA 1W2MA 1YW9A 3FMRA 4U73A 1B6AA 5CIKA 5CNXA 4S01A 3IL0A 5FCFA 2Q96A 3MATA 4FO7A 4IKUA 3MR1A 3PKCA 4FLKA 4ZNGA 2GGBA 1PV9A 4S2TP 2MATA 1QXWA 4S2RP 2EVCA 1QXYA 3CTZA 4OOKA 4A6WA 1KQ0A 4ZWUA 5CDEA 4U76A 2GU5A 4U71A 3PKBA 2BWSA 4U69A 4RZYA 2Q94A 4IECA 2GZ5A 5FCHA 4FKCA 2P99A 5CDVA 4IKSA 1R58A 1C27A 2GA2A 5JFRA 2G6PA 2GG0A 1XGSA 1WKMA 2EA4A 1C22A 1WL9A 3PN9A 1YW7A
chains in the Genus database with same CATH superfamily
4MATA 5CE6A 2BHBA 1Y1NA 1N51A 1QXZA 3PKAA 4S00A 1XGNA 1XNZA 3D27A 1WL6A 3RVAA 2B3HA 1C21A 2GG8A 3PEBA 1WBQA 2GG3A 1A16A 4U1BA 3FM3A 3MX6A 2Q92A 4JUQA 4RZZA 3BIQA 2BWXA 2V3YA 2GG2A 4IF7A 5D6FA 3TB5A 3L24A 2GU4A 2ZSGA 2Q95A 3PKDA 2BH3A 2BWWA 4U75A 2BN7A 4IDYA 5CLSA 2GTXA 5E5BA 3BITA 1XGMA 3CB5A 1W7VA 2BWYA 2BHAA 1BOAA 1WLRA 3O5VA 1O0XA 1YVMA 2OAZA 2Q93A 3RORA 2IW2A 1BN5A 2GU7A 5JI6A 4QR8A 3S6BA 1C23A 2BB7A 3OVKA 4U6JA 4U6CA 4EGEA 1C24A 1CHMA 3IG4A 1MATA 2GG5A 1JAWA 2NQ6A 3IU7A 4U6WA 1XGOA 4FO8A 4U6EA 1R5GA 4A6VA 1QZYA 2P98A 3OOOA 1KP0A 4IKRA 5E2CA 4IKTA 4KM3A 1YW8A 4U6ZA 4PV4A 3CB6A 2GGCA 1KQ9A 2GG7A 3Q6DA 2NQ7A 2V3XA 2EVMA 3IU8A 1WY2A 2HOWA 4FLLA 4HXXA 4ZWPA 2EA2A 4U70A 3FMQA 3TAVA 2ADUA 4Z7MA 2BHDA 2V6CA 2OKNA 1B59A 2GG9A 4B28A 4IPAA 2BWUA 2GU6A 3I7MA 2Q8KA 4IU6A 2V3ZA 2BWTA 1WN1A 3QOCA 4RGZ1 3IU9A 4R60A 5JHUA 5CDLA 3PKEA 2B3KA 4FUKA 1YJ3A 1M35A 2BWVA 2BHCA 2B3LA 2DFIA 5D6EA 4ZWOA 4FLJA 2EVOA 2P9AA 3L7GA 1R5HA 4FLIA 4PNCA 3BIPA 1W2MA 1YW9A 3FMRA 4U73A 1B6AA 5CIKA 5CNXA 4S01A 3IL0A 5FCFA 2Q96A 3MATA 4FO7A 4IKUA 3MR1A 3PKCA 4FLKA 4ZNGA 2GGBA 1PV9A 4S2TP 2MATA 1QXWA 4S2RP 2EVCA 1QXYA 3CTZA 4OOKA 4A6WA 1KQ0A 4ZWUA 5CDEA 4U76A 2GU5A 4U71A 3PKBA 2BWSA 4U69A 4RZYA 2Q94A 4IECA 2GZ5A 5FCHA 4FKCA 2P99A 5CDVA 4IKSA 1R58A 1C27A 2GA2A 5JFRA 2G6PA 2GG0A 1XGSA 1WKMA 2EA4A 1C22A 1WL9A 3PN9A 1YW7A
chains in the Genus database with same CATH topology
4MATA 5CE6A 2BHBA 1Y1NA 1N51A 1QXZA 3PKAA 4S00A 1XGNA 1XNZA 3D27A 1WL6A 3RVAA 2B3HA 1C21A 2GG8A 3PEBA 1WBQA 2GG3A 1A16A 4U1BA 3FM3A 3MX6A 2Q92A 4JUQA 4RZZA 3BIQA 2BWXA 2V3YA 2GG2A 4IF7A 5D6FA 3TB5A 3L24A 2GU4A 2ZSGA 2Q95A 3PKDA 2BH3A 2BWWA 4U75A 2BN7A 4IDYA 5CLSA 2GTXA 5E5BA 3BITA 1XGMA 3CB5A 1W7VA 2BWYA 2BHAA 1BOAA 1WLRA 3O5VA 1O0XA 1YVMA 2OAZA 2Q93A 3RORA 2IW2A 1BN5A 2GU7A 5JI6A 4QR8A 3S6BA 1C23A 2BB7A 3OVKA 4U6JA 4U6CA 4EGEA 1C24A 1CHMA 3IG4A 1MATA 2GG5A 1JAWA 2NQ6A 3IU7A 4U6WA 1XGOA 4FO8A 4U6EA 1R5GA 4A6VA 1QZYA 2P98A 3OOOA 1KP0A 4IKRA 5E2CA 4IKTA 4KM3A 1YW8A 4U6ZA 4PV4A 3CB6A 2GGCA 1KQ9A 2GG7A 3Q6DA 2NQ7A 2V3XA 2EVMA 3IU8A 1WY2A 2HOWA 4FLLA 4HXXA 4ZWPA 2EA2A 4U70A 3FMQA 3TAVA 2ADUA 4Z7MA 2BHDA 2V6CA 2OKNA 1B59A 2GG9A 4B28A 4IPAA 2BWUA 2GU6A 3I7MA 2Q8KA 4IU6A 2V3ZA 2BWTA 1WN1A 3QOCA 4RGZ1 3IU9A 4R60A 5JHUA 5CDLA 3PKEA 2B3KA 4FUKA 1YJ3A 1M35A 2BWVA 2BHCA 2B3LA 2DFIA 5D6EA 4ZWOA 4FLJA 2EVOA 2P9AA 3L7GA 1R5HA 4FLIA 4PNCA 3BIPA 1W2MA 1YW9A 3FMRA 4U73A 1B6AA 5CIKA 5CNXA 4S01A 3IL0A 5FCFA 2Q96A 3MATA 4FO7A 4IKUA 3MR1A 3PKCA 4FLKA 4ZNGA 2GGBA 1PV9A 4S2TP 2MATA 1QXWA 4S2RP 2EVCA 1QXYA 3CTZA 4OOKA 4A6WA 1KQ0A 4ZWUA 5CDEA 4U76A 2GU5A 4U71A 3PKBA 2BWSA 4U69A 4RZYA 2Q94A 4IECA 2GZ5A 5FCHA 4FKCA 2P99A 5CDVA 4IKSA 1R58A 1C27A 2GA2A 5JFRA 2G6PA 2GG0A 1XGSA 1WKMA 2EA4A 1C22A 1WL9A 3PN9A 1YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAT A;  5CE6 A;  2BHB A;  1Y1N A;  1N51 A;  1QXZ A;  3PKA A;  4S00 A;  1XGN A;  1XNZ A;  3D27 A;  1WL6 A;  3RVA A;  2B3H A;  1C21 A;  2GG8 A;  3PEB A;  1WBQ A;  2GG3 A;  1A16 A;  4U1B A;  3FM3 A;  3MX6 A;  2Q92 A;  4JUQ A;  4RZZ A;  3BIQ A;  2BWX A;  2V3Y A;  2GG2 A;  4IF7 A;  5D6F A;  3TB5 A;  3L24 A;  2GU4 A;  2ZSG A;  2Q95 A;  3PKD A;  2BH3 A;  2BWW A;  4U75 A;  2BN7 A;  4IDY A;  5CLS A;  2GTX A;  5E5B A;  3BIT A;  1XGM A;  3CB5 A;  1W7V A;  2BWY A;  2BHA A;  1BOA A;  1WLR A;  3O5V A;  1O0X A;  1YVM A;  2OAZ A;  2Q93 A;  3ROR A;  2IW2 A;  1BN5 A;  2GU7 A;  5JI6 A;  4QR8 A;  3S6B A;  1C23 A;  2BB7 A;  3OVK A;  4U6J A;  4U6C A;  4EGE A;  1C24 A;  1CHM A;  3IG4 A;  1MAT A;  2GG5 A;  1JAW A;  2NQ6 A;  3IU7 A;  4U6W A;  1XGO A;  4FO8 A;  4U6E A;  1R5G A;  4A6V A;  1QZY A;  2P98 A;  3OOO A;  1KP0 A;  4IKR A;  5E2C A;  4IKT A;  4KM3 A;  1YW8 A;  4U6Z A;  4PV4 A;  3CB6 A;  2GGC A;  1KQ9 A;  2GG7 A;  3Q6D A;  2NQ7 A;  2V3X A;  2EVM A;  3IU8 A;  1WY2 A;  2HOW A;  4FLL A;  4HXX A;  4ZWP A;  2EA2 A;  4U70 A;  3FMQ A;  3TAV A;  2ADU A;  4Z7M A;  2BHD A;  2V6C A;  2OKN A;  1B59 A;  2GG9 A;  4B28 A;  4IPA A;  2BWU A;  2GU6 A;  3I7M A;  2Q8K A;  4IU6 A;  2V3Z A;  2BWT A;  1WN1 A;  3QOC A;  4RGZ 1;  3IU9 A;  4R60 A;  5JHU A;  5CDL A;  3PKE A;  2B3K A;  4FUK A;  1YJ3 A;  1M35 A;  2BWV A;  2BHC A;  2B3L A;  2DFI A;  5D6E A;  4ZWO A;  4FLJ A;  2EVO A;  2P9A A;  3L7G A;  1R5H A;  4FLI A;  4PNC A;  3BIP A;  1W2M A;  1YW9 A;  3FMR A;  4U73 A;  1B6A A;  5CIK A;  5CNX A;  4S01 A;  3IL0 A;  5FCF A;  2Q96 A;  3MAT A;  4FO7 A;  4IKU A;  3MR1 A;  3PKC A;  4FLK A;  4ZNG A;  2GGB A;  1PV9 A;  4S2T P;  2MAT A;  1QXW A;  4S2R P;  2EVC A;  1QXY A;  3CTZ A;  4OOK A;  4A6W A;  1KQ0 A;  4ZWU A;  5CDE A;  4U76 A;  2GU5 A;  4U71 A;  3PKB A;  2BWS A;  4U69 A;  4RZY A;  2Q94 A;  4IEC A;  2GZ5 A;  5FCH A;  4FKC A;  2P99 A;  5CDV A;  4IKS A;  1R58 A;  1C27 A;  2GA2 A;  5JFR A;  2G6P A;  2GG0 A;  1XGS A;  1WKM A;  2EA4 A;  1C22 A;  1WL9 A;  3PN9 A;  1YW7 A; 
#chains in the Genus database with same CATH topology
 4MAT A;  5CE6 A;  2BHB A;  1Y1N A;  1N51 A;  1QXZ A;  3PKA A;  4S00 A;  1XGN A;  1XNZ A;  3D27 A;  1WL6 A;  3RVA A;  2B3H A;  1C21 A;  2GG8 A;  3PEB A;  1WBQ A;  2GG3 A;  1A16 A;  4U1B A;  3FM3 A;  3MX6 A;  2Q92 A;  4JUQ A;  4RZZ A;  3BIQ A;  2BWX A;  2V3Y A;  2GG2 A;  4IF7 A;  5D6F A;  3TB5 A;  3L24 A;  2GU4 A;  2ZSG A;  2Q95 A;  3PKD A;  2BH3 A;  2BWW A;  4U75 A;  2BN7 A;  4IDY A;  5CLS A;  2GTX A;  5E5B A;  3BIT A;  1XGM A;  3CB5 A;  1W7V A;  2BWY A;  2BHA A;  1BOA A;  1WLR A;  3O5V A;  1O0X A;  1YVM A;  2OAZ A;  2Q93 A;  3ROR A;  2IW2 A;  1BN5 A;  2GU7 A;  5JI6 A;  4QR8 A;  3S6B A;  1C23 A;  2BB7 A;  3OVK A;  4U6J A;  4U6C A;  4EGE A;  1C24 A;  1CHM A;  3IG4 A;  1MAT A;  2GG5 A;  1JAW A;  2NQ6 A;  3IU7 A;  4U6W A;  1XGO A;  4FO8 A;  4U6E A;  1R5G A;  4A6V A;  1QZY A;  2P98 A;  3OOO A;  1KP0 A;  4IKR A;  5E2C A;  4IKT A;  4KM3 A;  1YW8 A;  4U6Z A;  4PV4 A;  3CB6 A;  2GGC A;  1KQ9 A;  2GG7 A;  3Q6D A;  2NQ7 A;  2V3X A;  2EVM A;  3IU8 A;  1WY2 A;  2HOW A;  4FLL A;  4HXX A;  4ZWP A;  2EA2 A;  4U70 A;  3FMQ A;  3TAV A;  2ADU A;  4Z7M A;  2BHD A;  2V6C A;  2OKN A;  1B59 A;  2GG9 A;  4B28 A;  4IPA A;  2BWU A;  2GU6 A;  3I7M A;  2Q8K A;  4IU6 A;  2V3Z A;  2BWT A;  1WN1 A;  3QOC A;  4RGZ 1;  3IU9 A;  4R60 A;  5JHU A;  5CDL A;  3PKE A;  2B3K A;  4FUK A;  1YJ3 A;  1M35 A;  2BWV A;  2BHC A;  2B3L A;  2DFI A;  5D6E A;  4ZWO A;  4FLJ A;  2EVO A;  2P9A A;  3L7G A;  1R5H A;  4FLI A;  4PNC A;  3BIP A;  1W2M A;  1YW9 A;  3FMR A;  4U73 A;  1B6A A;  5CIK A;  5CNX A;  4S01 A;  3IL0 A;  5FCF A;  2Q96 A;  3MAT A;  4FO7 A;  4IKU A;  3MR1 A;  3PKC A;  4FLK A;  4ZNG A;  2GGB A;  1PV9 A;  4S2T P;  2MAT A;  1QXW A;  4S2R P;  2EVC A;  1QXY A;  3CTZ A;  4OOK A;  4A6W A;  1KQ0 A;  4ZWU A;  5CDE A;  4U76 A;  2GU5 A;  4U71 A;  3PKB A;  2BWS A;  4U69 A;  4RZY A;  2Q94 A;  4IEC A;  2GZ5 A;  5FCH A;  4FKC A;  2P99 A;  5CDV A;  4IKS A;  1R58 A;  1C27 A;  2GA2 A;  5JFR A;  2G6P A;  2GG0 A;  1XGS A;  1WKM A;  2EA4 A;  1C22 A;  1WL9 A;  3PN9 A;  1YW7 A; 
#chains in the Genus database with same CATH homology
 4MAT A;  5CE6 A;  2BHB A;  1Y1N A;  1N51 A;  1QXZ A;  3PKA A;  4S00 A;  1XGN A;  1XNZ A;  3D27 A;  1WL6 A;  3RVA A;  2B3H A;  1C21 A;  2GG8 A;  3PEB A;  1WBQ A;  2GG3 A;  1A16 A;  4U1B A;  3FM3 A;  3MX6 A;  2Q92 A;  4JUQ A;  4RZZ A;  3BIQ A;  2BWX A;  2V3Y A;  2GG2 A;  4IF7 A;  5D6F A;  3TB5 A;  3L24 A;  2GU4 A;  2ZSG A;  2Q95 A;  3PKD A;  2BH3 A;  2BWW A;  4U75 A;  2BN7 A;  4IDY A;  5CLS A;  2GTX A;  5E5B A;  3BIT A;  1XGM A;  3CB5 A;  1W7V A;  2BWY A;  2BHA A;  1BOA A;  1WLR A;  3O5V A;  1O0X A;  1YVM A;  2OAZ A;  2Q93 A;  3ROR A;  2IW2 A;  1BN5 A;  2GU7 A;  5JI6 A;  4QR8 A;  3S6B A;  1C23 A;  2BB7 A;  3OVK A;  4U6J A;  4U6C A;  4EGE A;  1C24 A;  1CHM A;  3IG4 A;  1MAT A;  2GG5 A;  1JAW A;  2NQ6 A;  3IU7 A;  4U6W A;  1XGO A;  4FO8 A;  4U6E A;  1R5G A;  4A6V A;  1QZY A;  2P98 A;  3OOO A;  1KP0 A;  4IKR A;  5E2C A;  4IKT A;  4KM3 A;  1YW8 A;  4U6Z A;  4PV4 A;  3CB6 A;  2GGC A;  1KQ9 A;  2GG7 A;  3Q6D A;  2NQ7 A;  2V3X A;  2EVM A;  3IU8 A;  1WY2 A;  2HOW A;  4FLL A;  4HXX A;  4ZWP A;  2EA2 A;  4U70 A;  3FMQ A;  3TAV A;  2ADU A;  4Z7M A;  2BHD A;  2V6C A;  2OKN A;  1B59 A;  2GG9 A;  4B28 A;  4IPA A;  2BWU A;  2GU6 A;  3I7M A;  2Q8K A;  4IU6 A;  2V3Z A;  2BWT A;  1WN1 A;  3QOC A;  4RGZ 1;  3IU9 A;  4R60 A;  5JHU A;  5CDL A;  3PKE A;  2B3K A;  4FUK A;  1YJ3 A;  1M35 A;  2BWV A;  2BHC A;  2B3L A;  2DFI A;  5D6E A;  4ZWO A;  4FLJ A;  2EVO A;  2P9A A;  3L7G A;  1R5H A;  4FLI A;  4PNC A;  3BIP A;  1W2M A;  1YW9 A;  3FMR A;  4U73 A;  1B6A A;  5CIK A;  5CNX A;  4S01 A;  3IL0 A;  5FCF A;  2Q96 A;  3MAT A;  4FO7 A;  4IKU A;  3MR1 A;  3PKC A;  4FLK A;  4ZNG A;  2GGB A;  1PV9 A;  4S2T P;  2MAT A;  1QXW A;  4S2R P;  2EVC A;  1QXY A;  3CTZ A;  4OOK A;  4A6W A;  1KQ0 A;  4ZWU A;  5CDE A;  4U76 A;  2GU5 A;  4U71 A;  3PKB A;  2BWS A;  4U69 A;  4RZY A;  2Q94 A;  4IEC A;  2GZ5 A;  5FCH A;  4FKC A;  2P99 A;  5CDV A;  4IKS A;  1R58 A;  1C27 A;  2GA2 A;  5JFR A;  2G6P A;  2GG0 A;  1XGS A;  1WKM A;  2EA4 A;  1C22 A;  1WL9 A;  3PN9 A;  1YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...