1WLRA

Apo aminopeptidase p from e. coli
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wlrA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wlrA02
2NQ7A 2GG8A 5D6FA 5FCHA 3MX6A 4PV4A 1C23A 5CIKA 4Z7MA 3BIQA 1XGNA 4U71A 2BHDA 2GG5A 4ZWPA 3MATA 1R5HA 1W7VA 2B3LA 3OOOA 4U6CA 5JI6A 3RVAA 2BWUA 1QZYA 4IKSA 1WL9A 2P99A 1WBQA 4KM3A 1YJ3A 2GGCA 1R5GA 2B3HA 1O0XA 4FLJA 2BWSA 3QOCA 4IF7A 4FUKA 4RGZ1 1A16A 1WKMA 3PKEA 4IPAA 3OVKA 2GGBA 3L24A 1KQ9A 1QXZA 3PKBA 2Q8KA 2BWTA 4OOKA 5CLSA 4U1BA 4S2RP 2P9AA 1JAWA 3PEBA 1C21A 2BWXA 2V3YA 3D27A 3CB6A 2GG7A 3TB5A 4ZWOA 1WL6A 2Q92A 4MATA 1B6AA 4EGEA 1C24A 2BN7A 3O5VA 1QXWA 2EA2A 3FM3A 4ZNGA 4U75A 5JHUA 1BOAA 2ZSGA 3IG4A 2EVOA 4RZYA 2GA2A 4HXXA 1M35A 4IDYA 4IU6A 1KP0A 2GU5A 3PN9A 2HOWA 2GU6A 4IKTA 2ADUA 2B3KA 2V6CA 1B59A 2NQ6A 5JFRA 2V3XA 2P98A 3MR1A 3S6BA 3L7GA 3Q6DA 4IECA 5E2CA 5CE6A 1R58A 4FO8A 4U70A 2GG9A 5CDLA 4FLIA 4A6VA 3CTZA 2MATA 1QXYA 4U6EA 1YVMA 3PKCA 1WN1A 1KQ0A 2Q94A 2BHAA 2GU4A 3PKAA 4U73A 4FLLA 2V3ZA 3I7MA 4U76A 4A6WA 4IKUA 4B28A 3TAVA 2GTXA 4ZWUA 4PNCA 2BWYA 5FCFA 2Q95A 3IL0A 2EVMA 3FMRA 5E5BA 3BIPA 1W2MA 2EA4A 5CDEA 1BN5A 2Q93A 1XGSA 2GZ5A 1XGOA 5CNXA 1YW8A 4S00A 3CB5A 4U6WA 2EVCA 3BITA 4JUQA 1C22A 2GG2A 3IU8A 4U6JA 1C27A 2DFIA 2IW2A 4R60A 1XNZA 2OAZA 4S2TP 4U69A 1WY2A 2BHCA 2BWVA 2BWWA 4S01A 5CDVA 3IU9A 4U6ZA 1MATA 2BH3A 4FKCA 2G6PA 1YW9A 4RZZA 1YW7A 2GG0A 3FMQA 4FO7A 2OKNA 3RORA 3PKDA 1XGMA 2BB7A 1WLRA 1PV9A 4IKRA 2GU7A 3IU7A 2GG3A 5D6EA 1CHMA 2Q96A 4FLKA 1Y1NA 4QR8A 1N51A 2BHBA
chains in the Genus database with same CATH superfamily
2NQ7A 2GG8A 5D6FA 5FCHA 3MX6A 4PV4A 1C23A 5CIKA 4Z7MA 3BIQA 1XGNA 4U71A 2BHDA 2GG5A 4ZWPA 3MATA 1R5HA 1W7VA 2B3LA 3OOOA 4U6CA 5JI6A 3RVAA 2BWUA 1QZYA 4IKSA 1WL9A 2P99A 1WBQA 4KM3A 1YJ3A 2GGCA 1R5GA 2B3HA 1O0XA 4FLJA 2BWSA 3QOCA 4IF7A 4FUKA 4RGZ1 1A16A 1WKMA 3PKEA 4IPAA 3OVKA 2GGBA 3L24A 1KQ9A 1QXZA 3PKBA 2Q8KA 2BWTA 4OOKA 5CLSA 4U1BA 4S2RP 2P9AA 1JAWA 3PEBA 1C21A 2BWXA 2V3YA 3D27A 3CB6A 2GG7A 3TB5A 4ZWOA 1WL6A 2Q92A 4MATA 1B6AA 4EGEA 1C24A 2BN7A 3O5VA 1QXWA 2EA2A 3FM3A 4ZNGA 4U75A 5JHUA 1BOAA 2ZSGA 3IG4A 2EVOA 4RZYA 2GA2A 4HXXA 1M35A 4IDYA 4IU6A 1KP0A 2GU5A 3PN9A 2HOWA 2GU6A 4IKTA 2ADUA 2B3KA 2V6CA 1B59A 2NQ6A 5JFRA 2V3XA 2P98A 3MR1A 3S6BA 3L7GA 3Q6DA 4IECA 5E2CA 5CE6A 1R58A 4FO8A 4U70A 2GG9A 5CDLA 4FLIA 4A6VA 3CTZA 2MATA 1QXYA 4U6EA 1YVMA 3PKCA 1WN1A 1KQ0A 2Q94A 2BHAA 2GU4A 3PKAA 4U73A 4FLLA 2V3ZA 3I7MA 4U76A 4A6WA 4IKUA 4B28A 3TAVA 2GTXA 4ZWUA 4PNCA 2BWYA 5FCFA 2Q95A 3IL0A 2EVMA 3FMRA 5E5BA 3BIPA 1W2MA 2EA4A 5CDEA 1BN5A 2Q93A 1XGSA 2GZ5A 1XGOA 5CNXA 1YW8A 4S00A 3CB5A 4U6WA 2EVCA 3BITA 4JUQA 1C22A 2GG2A 3IU8A 4U6JA 1C27A 2DFIA 2IW2A 4R60A 1XNZA 2OAZA 4S2TP 4U69A 1WY2A 2BHCA 2BWVA 2BWWA 4S01A 5CDVA 3IU9A 4U6ZA 1MATA 2BH3A 4FKCA 2G6PA 1YW9A 4RZZA 1YW7A 2GG0A 3FMQA 4FO7A 2OKNA 3RORA 3PKDA 1XGMA 2BB7A 1WLRA 1PV9A 4IKRA 2GU7A 3IU7A 2GG3A 5D6EA 1CHMA 2Q96A 4FLKA 1Y1NA 4QR8A 1N51A 2BHBA
chains in the Genus database with same CATH topology
2NQ7A 2GG8A 5D6FA 5FCHA 3MX6A 4PV4A 1C23A 5CIKA 4Z7MA 3BIQA 1XGNA 4U71A 2BHDA 2GG5A 4ZWPA 3MATA 1R5HA 1W7VA 2B3LA 3OOOA 4U6CA 5JI6A 3RVAA 2BWUA 1QZYA 4IKSA 1WL9A 2P99A 1WBQA 4KM3A 1YJ3A 2GGCA 1R5GA 2B3HA 1O0XA 4FLJA 2BWSA 3QOCA 4IF7A 4FUKA 4RGZ1 1A16A 1WKMA 3PKEA 4IPAA 3OVKA 2GGBA 3L24A 1KQ9A 1QXZA 3PKBA 2Q8KA 2BWTA 4OOKA 5CLSA 4U1BA 4S2RP 2P9AA 1JAWA 3PEBA 1C21A 2BWXA 2V3YA 3D27A 3CB6A 2GG7A 3TB5A 4ZWOA 1WL6A 2Q92A 4MATA 1B6AA 4EGEA 1C24A 2BN7A 3O5VA 1QXWA 2EA2A 3FM3A 4ZNGA 4U75A 5JHUA 1BOAA 2ZSGA 3IG4A 2EVOA 4RZYA 2GA2A 4HXXA 1M35A 4IDYA 4IU6A 1KP0A 2GU5A 3PN9A 2HOWA 2GU6A 4IKTA 2ADUA 2B3KA 2V6CA 1B59A 2NQ6A 5JFRA 2V3XA 2P98A 3MR1A 3S6BA 3L7GA 3Q6DA 4IECA 5E2CA 5CE6A 1R58A 4FO8A 4U70A 2GG9A 5CDLA 4FLIA 4A6VA 3CTZA 2MATA 1QXYA 4U6EA 1YVMA 3PKCA 1WN1A 1KQ0A 2Q94A 2BHAA 2GU4A 3PKAA 4U73A 4FLLA 2V3ZA 3I7MA 4U76A 4A6WA 4IKUA 4B28A 3TAVA 2GTXA 4ZWUA 4PNCA 2BWYA 5FCFA 2Q95A 3IL0A 2EVMA 3FMRA 5E5BA 3BIPA 1W2MA 2EA4A 5CDEA 1BN5A 2Q93A 1XGSA 2GZ5A 1XGOA 5CNXA 1YW8A 4S00A 3CB5A 4U6WA 2EVCA 3BITA 4JUQA 1C22A 2GG2A 3IU8A 4U6JA 1C27A 2DFIA 2IW2A 4R60A 1XNZA 2OAZA 4S2TP 4U69A 1WY2A 2BHCA 2BWVA 2BWWA 4S01A 5CDVA 3IU9A 4U6ZA 1MATA 2BH3A 4FKCA 2G6PA 1YW9A 4RZZA 1YW7A 2GG0A 3FMQA 4FO7A 2OKNA 3RORA 3PKDA 1XGMA 2BB7A 1WLRA 1PV9A 4IKRA 2GU7A 3IU7A 2GG3A 5D6EA 1CHMA 2Q96A 4FLKA 1Y1NA 4QR8A 1N51A 2BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ7 A;  2GG8 A;  5D6F A;  5FCH A;  3MX6 A;  4PV4 A;  1C23 A;  5CIK A;  4Z7M A;  3BIQ A;  1XGN A;  4U71 A;  2BHD A;  2GG5 A;  4ZWP A;  3MAT A;  1R5H A;  1W7V A;  2B3L A;  3OOO A;  4U6C A;  5JI6 A;  3RVA A;  2BWU A;  1QZY A;  4IKS A;  1WL9 A;  2P99 A;  1WBQ A;  4KM3 A;  1YJ3 A;  2GGC A;  1R5G A;  2B3H A;  1O0X A;  4FLJ A;  2BWS A;  3QOC A;  4IF7 A;  4FUK A;  4RGZ 1;  1A16 A;  1WKM A;  3PKE A;  4IPA A;  3OVK A;  2GGB A;  3L24 A;  1KQ9 A;  1QXZ A;  3PKB A;  2Q8K A;  2BWT A;  4OOK A;  5CLS A;  4U1B A;  4S2R P;  2P9A A;  1JAW A;  3PEB A;  1C21 A;  2BWX A;  2V3Y A;  3D27 A;  3CB6 A;  2GG7 A;  3TB5 A;  4ZWO A;  1WL6 A;  2Q92 A;  4MAT A;  1B6A A;  4EGE A;  1C24 A;  2BN7 A;  3O5V A;  1QXW A;  2EA2 A;  3FM3 A;  4ZNG A;  4U75 A;  5JHU A;  1BOA A;  2ZSG A;  3IG4 A;  2EVO A;  4RZY A;  2GA2 A;  4HXX A;  1M35 A;  4IDY A;  4IU6 A;  1KP0 A;  2GU5 A;  3PN9 A;  2HOW A;  2GU6 A;  4IKT A;  2ADU A;  2B3K A;  2V6C A;  1B59 A;  2NQ6 A;  5JFR A;  2V3X A;  2P98 A;  3MR1 A;  3S6B A;  3L7G A;  3Q6D A;  4IEC A;  5E2C A;  5CE6 A;  1R58 A;  4FO8 A;  4U70 A;  2GG9 A;  5CDL A;  4FLI A;  4A6V A;  3CTZ A;  2MAT A;  1QXY A;  4U6E A;  1YVM A;  3PKC A;  1WN1 A;  1KQ0 A;  2Q94 A;  2BHA A;  2GU4 A;  3PKA A;  4U73 A;  4FLL A;  2V3Z A;  3I7M A;  4U76 A;  4A6W A;  4IKU A;  4B28 A;  3TAV A;  2GTX A;  4ZWU A;  4PNC A;  2BWY A;  5FCF A;  2Q95 A;  3IL0 A;  2EVM A;  3FMR A;  5E5B A;  3BIP A;  1W2M A;  2EA4 A;  5CDE A;  1BN5 A;  2Q93 A;  1XGS A;  2GZ5 A;  1XGO A;  5CNX A;  1YW8 A;  4S00 A;  3CB5 A;  4U6W A;  2EVC A;  3BIT A;  4JUQ A;  1C22 A;  2GG2 A;  3IU8 A;  4U6J A;  1C27 A;  2DFI A;  2IW2 A;  4R60 A;  1XNZ A;  2OAZ A;  4S2T P;  4U69 A;  1WY2 A;  2BHC A;  2BWV A;  2BWW A;  4S01 A;  5CDV A;  3IU9 A;  4U6Z A;  1MAT A;  2BH3 A;  4FKC A;  2G6P A;  1YW9 A;  4RZZ A;  1YW7 A;  2GG0 A;  3FMQ A;  4FO7 A;  2OKN A;  3ROR A;  3PKD A;  1XGM A;  2BB7 A;  1WLR A;  1PV9 A;  4IKR A;  2GU7 A;  3IU7 A;  2GG3 A;  5D6E A;  1CHM A;  2Q96 A;  4FLK A;  1Y1N A;  4QR8 A;  1N51 A;  2BHB A; 
#chains in the Genus database with same CATH topology
 2NQ7 A;  2GG8 A;  5D6F A;  5FCH A;  3MX6 A;  4PV4 A;  1C23 A;  5CIK A;  4Z7M A;  3BIQ A;  1XGN A;  4U71 A;  2BHD A;  2GG5 A;  4ZWP A;  3MAT A;  1R5H A;  1W7V A;  2B3L A;  3OOO A;  4U6C A;  5JI6 A;  3RVA A;  2BWU A;  1QZY A;  4IKS A;  1WL9 A;  2P99 A;  1WBQ A;  4KM3 A;  1YJ3 A;  2GGC A;  1R5G A;  2B3H A;  1O0X A;  4FLJ A;  2BWS A;  3QOC A;  4IF7 A;  4FUK A;  4RGZ 1;  1A16 A;  1WKM A;  3PKE A;  4IPA A;  3OVK A;  2GGB A;  3L24 A;  1KQ9 A;  1QXZ A;  3PKB A;  2Q8K A;  2BWT A;  4OOK A;  5CLS A;  4U1B A;  4S2R P;  2P9A A;  1JAW A;  3PEB A;  1C21 A;  2BWX A;  2V3Y A;  3D27 A;  3CB6 A;  2GG7 A;  3TB5 A;  4ZWO A;  1WL6 A;  2Q92 A;  4MAT A;  1B6A A;  4EGE A;  1C24 A;  2BN7 A;  3O5V A;  1QXW A;  2EA2 A;  3FM3 A;  4ZNG A;  4U75 A;  5JHU A;  1BOA A;  2ZSG A;  3IG4 A;  2EVO A;  4RZY A;  2GA2 A;  4HXX A;  1M35 A;  4IDY A;  4IU6 A;  1KP0 A;  2GU5 A;  3PN9 A;  2HOW A;  2GU6 A;  4IKT A;  2ADU A;  2B3K A;  2V6C A;  1B59 A;  2NQ6 A;  5JFR A;  2V3X A;  2P98 A;  3MR1 A;  3S6B A;  3L7G A;  3Q6D A;  4IEC A;  5E2C A;  5CE6 A;  1R58 A;  4FO8 A;  4U70 A;  2GG9 A;  5CDL A;  4FLI A;  4A6V A;  3CTZ A;  2MAT A;  1QXY A;  4U6E A;  1YVM A;  3PKC A;  1WN1 A;  1KQ0 A;  2Q94 A;  2BHA A;  2GU4 A;  3PKA A;  4U73 A;  4FLL A;  2V3Z A;  3I7M A;  4U76 A;  4A6W A;  4IKU A;  4B28 A;  3TAV A;  2GTX A;  4ZWU A;  4PNC A;  2BWY A;  5FCF A;  2Q95 A;  3IL0 A;  2EVM A;  3FMR A;  5E5B A;  3BIP A;  1W2M A;  2EA4 A;  5CDE A;  1BN5 A;  2Q93 A;  1XGS A;  2GZ5 A;  1XGO A;  5CNX A;  1YW8 A;  4S00 A;  3CB5 A;  4U6W A;  2EVC A;  3BIT A;  4JUQ A;  1C22 A;  2GG2 A;  3IU8 A;  4U6J A;  1C27 A;  2DFI A;  2IW2 A;  4R60 A;  1XNZ A;  2OAZ A;  4S2T P;  4U69 A;  1WY2 A;  2BHC A;  2BWV A;  2BWW A;  4S01 A;  5CDV A;  3IU9 A;  4U6Z A;  1MAT A;  2BH3 A;  4FKC A;  2G6P A;  1YW9 A;  4RZZ A;  1YW7 A;  2GG0 A;  3FMQ A;  4FO7 A;  2OKN A;  3ROR A;  3PKD A;  1XGM A;  2BB7 A;  1WLR A;  1PV9 A;  4IKR A;  2GU7 A;  3IU7 A;  2GG3 A;  5D6E A;  1CHM A;  2Q96 A;  4FLK A;  1Y1N A;  4QR8 A;  1N51 A;  2BHB A; 
#chains in the Genus database with same CATH homology
 2NQ7 A;  2GG8 A;  5D6F A;  5FCH A;  3MX6 A;  4PV4 A;  1C23 A;  5CIK A;  4Z7M A;  3BIQ A;  1XGN A;  4U71 A;  2BHD A;  2GG5 A;  4ZWP A;  3MAT A;  1R5H A;  1W7V A;  2B3L A;  3OOO A;  4U6C A;  5JI6 A;  3RVA A;  2BWU A;  1QZY A;  4IKS A;  1WL9 A;  2P99 A;  1WBQ A;  4KM3 A;  1YJ3 A;  2GGC A;  1R5G A;  2B3H A;  1O0X A;  4FLJ A;  2BWS A;  3QOC A;  4IF7 A;  4FUK A;  4RGZ 1;  1A16 A;  1WKM A;  3PKE A;  4IPA A;  3OVK A;  2GGB A;  3L24 A;  1KQ9 A;  1QXZ A;  3PKB A;  2Q8K A;  2BWT A;  4OOK A;  5CLS A;  4U1B A;  4S2R P;  2P9A A;  1JAW A;  3PEB A;  1C21 A;  2BWX A;  2V3Y A;  3D27 A;  3CB6 A;  2GG7 A;  3TB5 A;  4ZWO A;  1WL6 A;  2Q92 A;  4MAT A;  1B6A A;  4EGE A;  1C24 A;  2BN7 A;  3O5V A;  1QXW A;  2EA2 A;  3FM3 A;  4ZNG A;  4U75 A;  5JHU A;  1BOA A;  2ZSG A;  3IG4 A;  2EVO A;  4RZY A;  2GA2 A;  4HXX A;  1M35 A;  4IDY A;  4IU6 A;  1KP0 A;  2GU5 A;  3PN9 A;  2HOW A;  2GU6 A;  4IKT A;  2ADU A;  2B3K A;  2V6C A;  1B59 A;  2NQ6 A;  5JFR A;  2V3X A;  2P98 A;  3MR1 A;  3S6B A;  3L7G A;  3Q6D A;  4IEC A;  5E2C A;  5CE6 A;  1R58 A;  4FO8 A;  4U70 A;  2GG9 A;  5CDL A;  4FLI A;  4A6V A;  3CTZ A;  2MAT A;  1QXY A;  4U6E A;  1YVM A;  3PKC A;  1WN1 A;  1KQ0 A;  2Q94 A;  2BHA A;  2GU4 A;  3PKA A;  4U73 A;  4FLL A;  2V3Z A;  3I7M A;  4U76 A;  4A6W A;  4IKU A;  4B28 A;  3TAV A;  2GTX A;  4ZWU A;  4PNC A;  2BWY A;  5FCF A;  2Q95 A;  3IL0 A;  2EVM A;  3FMR A;  5E5B A;  3BIP A;  1W2M A;  2EA4 A;  5CDE A;  1BN5 A;  2Q93 A;  1XGS A;  2GZ5 A;  1XGO A;  5CNX A;  1YW8 A;  4S00 A;  3CB5 A;  4U6W A;  2EVC A;  3BIT A;  4JUQ A;  1C22 A;  2GG2 A;  3IU8 A;  4U6J A;  1C27 A;  2DFI A;  2IW2 A;  4R60 A;  1XNZ A;  2OAZ A;  4S2T P;  4U69 A;  1WY2 A;  2BHC A;  2BWV A;  2BWW A;  4S01 A;  5CDV A;  3IU9 A;  4U6Z A;  1MAT A;  2BH3 A;  4FKC A;  2G6P A;  1YW9 A;  4RZZ A;  1YW7 A;  2GG0 A;  3FMQ A;  4FO7 A;  2OKN A;  3ROR A;  3PKD A;  1XGM A;  2BB7 A;  1WLR A;  1PV9 A;  4IKR A;  2GU7 A;  3IU7 A;  2GG3 A;  5D6E A;  1CHM A;  2Q96 A;  4FLK A;  1Y1N A;  4QR8 A;  1N51 A;  2BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...