1A16A

Aminopeptidase p from e. coli with the inhibitor pro-leu
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSLEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 152
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1a16A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1a16A02
2BHAA 4IKRA 3MX6A 4S01A 4B28A 2V3ZA 4FKCA 1R58A 4U6JA 5D6FA 2GU5A 5D6EA 1YW9A 4U70A 3BITA 2GG0A 1C22A 1QXZA 3TB5A 3PKDA 4A6VA 3L7GA 3BIQA 3IU8A 2NQ7A 5CLSA 3IL0A 1Y1NA 1O0XA 3MR1A 1B6AA 2B3HA 3PKEA 3IG4A 2BWUA 2GGBA 4HXXA 2GG5A 4IDYA 3PKCA 4U6ZA 2BWXA 3I7MA 4IKTA 4IU6A 4IECA 2Q94A 4U6WA 4Z7MA 4EGEA 3D27A 3CTZA 2GG7A 2V3YA 2GU7A 4U71A 4PV4A 2EVCA 4IPAA 4ZWOA 1QXYA 2BWSA 1C27A 1W2MA 2NQ6A 1YW7A 3PKBA 3Q6DA 3IU7A 1QXWA 1R5HA 4U6CA 3FMRA 1WL6A 4FLJA 4U73A 5JFRA 3QOCA 1C24A 2BWWA 2BB7A 2GG3A 4R60A 2OAZA 3OOOA 4FLIA 2EVMA 1XGNA 1W7VA 2GU4A 1JAWA 2B3KA 1WL9A 2BH3A 2ZSGA 2Q96A 4U69A 4FUKA 1C23A 3IU9A 3BIPA 1N51A 5CE6A 1WKMA 2GZ5A 2BHDA 3PEBA 2BWVA 2BWTA 2V3XA 4FLLA 4U1BA 2BN7A 5CIKA 1M35A 2Q8KA 5E5BA 2BHCA 2GG9A 4FO8A 2EA2A 2P9AA 1BOAA 3MATA 1A16A 3L24A 4PNCA 2Q95A 1QZYA 1C21A 5JI6A 2P99A 1PV9A 1XNZA 2Q93A 4FO7A 4S00A 4OOKA 4FLKA 1KQ9A 4RGZ1 2DFIA 2V6CA 1YJ3A 2P98A 3S6BA 2GU6A 2GGCA 1YW8A 4ZWUA 4A6WA 3PKAA 3CB5A 1CHMA 5E2CA 1BN5A 1KQ0A 5CDLA 1WLRA 3FMQA 3PN9A 3TAVA 1B59A 5CDVA 2GTXA 2G6PA 2OKNA 4U76A 3O5VA 5FCFA 2EVOA 4ZWPA 2GG2A 2GA2A 2MATA 4U6EA 1MATA 1XGMA 2GG8A 3RORA 3RVAA 1WY2A 2BHBA 4S2RP 4ZNGA 4KM3A 4RZZA 4MATA 1WN1A 1XGOA 2BWYA 2IW2A 1YVMA 4S2TP 2B3LA 4U75A 1KP0A 2HOWA 3FM3A 4IKSA 3OVKA 4RZYA 5CNXA 1XGSA 2ADUA 5FCHA 2Q92A 4QR8A 3CB6A 5CDEA 4IKUA 4JUQA 1WBQA 5JHUA 2EA4A 1R5GA 4IF7A
chains in the Genus database with same CATH superfamily
2BHAA 4IKRA 3MX6A 4S01A 4B28A 2V3ZA 4FKCA 1R58A 4U6JA 5D6FA 2GU5A 5D6EA 1YW9A 4U70A 3BITA 2GG0A 1C22A 1QXZA 3TB5A 3PKDA 4A6VA 3L7GA 3BIQA 3IU8A 2NQ7A 5CLSA 3IL0A 1Y1NA 1O0XA 3MR1A 1B6AA 2B3HA 3PKEA 3IG4A 2BWUA 2GGBA 4HXXA 2GG5A 4IDYA 3PKCA 4U6ZA 2BWXA 3I7MA 4IKTA 4IU6A 4IECA 2Q94A 4U6WA 4Z7MA 4EGEA 3D27A 3CTZA 2GG7A 2V3YA 2GU7A 4U71A 4PV4A 2EVCA 4IPAA 4ZWOA 1QXYA 2BWSA 1C27A 1W2MA 2NQ6A 1YW7A 3PKBA 3Q6DA 3IU7A 1QXWA 1R5HA 4U6CA 3FMRA 1WL6A 4FLJA 4U73A 5JFRA 3QOCA 1C24A 2BWWA 2BB7A 2GG3A 4R60A 2OAZA 3OOOA 4FLIA 2EVMA 1XGNA 1W7VA 2GU4A 1JAWA 2B3KA 1WL9A 2BH3A 2ZSGA 2Q96A 4U69A 4FUKA 1C23A 3IU9A 3BIPA 1N51A 5CE6A 1WKMA 2GZ5A 2BHDA 3PEBA 2BWVA 2BWTA 2V3XA 4FLLA 4U1BA 2BN7A 5CIKA 1M35A 2Q8KA 5E5BA 2BHCA 2GG9A 4FO8A 2EA2A 2P9AA 1BOAA 3MATA 1A16A 3L24A 4PNCA 2Q95A 1QZYA 1C21A 5JI6A 2P99A 1PV9A 1XNZA 2Q93A 4FO7A 4S00A 4OOKA 4FLKA 1KQ9A 4RGZ1 2DFIA 2V6CA 1YJ3A 2P98A 3S6BA 2GU6A 2GGCA 1YW8A 4ZWUA 4A6WA 3PKAA 3CB5A 1CHMA 5E2CA 1BN5A 1KQ0A 5CDLA 1WLRA 3FMQA 3PN9A 3TAVA 1B59A 5CDVA 2GTXA 2G6PA 2OKNA 4U76A 3O5VA 5FCFA 2EVOA 4ZWPA 2GG2A 2GA2A 2MATA 4U6EA 1MATA 1XGMA 2GG8A 3RORA 3RVAA 1WY2A 2BHBA 4S2RP 4ZNGA 4KM3A 4RZZA 4MATA 1WN1A 1XGOA 2BWYA 2IW2A 1YVMA 4S2TP 2B3LA 4U75A 1KP0A 2HOWA 3FM3A 4IKSA 3OVKA 4RZYA 5CNXA 1XGSA 2ADUA 5FCHA 2Q92A 4QR8A 3CB6A 5CDEA 4IKUA 4JUQA 1WBQA 5JHUA 2EA4A 1R5GA 4IF7A
chains in the Genus database with same CATH topology
2BHAA 4IKRA 3MX6A 4S01A 4B28A 2V3ZA 4FKCA 1R58A 4U6JA 5D6FA 2GU5A 5D6EA 1YW9A 4U70A 3BITA 2GG0A 1C22A 1QXZA 3TB5A 3PKDA 4A6VA 3L7GA 3BIQA 3IU8A 2NQ7A 5CLSA 3IL0A 1Y1NA 1O0XA 3MR1A 1B6AA 2B3HA 3PKEA 3IG4A 2BWUA 2GGBA 4HXXA 2GG5A 4IDYA 3PKCA 4U6ZA 2BWXA 3I7MA 4IKTA 4IU6A 4IECA 2Q94A 4U6WA 4Z7MA 4EGEA 3D27A 3CTZA 2GG7A 2V3YA 2GU7A 4U71A 4PV4A 2EVCA 4IPAA 4ZWOA 1QXYA 2BWSA 1C27A 1W2MA 2NQ6A 1YW7A 3PKBA 3Q6DA 3IU7A 1QXWA 1R5HA 4U6CA 3FMRA 1WL6A 4FLJA 4U73A 5JFRA 3QOCA 1C24A 2BWWA 2BB7A 2GG3A 4R60A 2OAZA 3OOOA 4FLIA 2EVMA 1XGNA 1W7VA 2GU4A 1JAWA 2B3KA 1WL9A 2BH3A 2ZSGA 2Q96A 4U69A 4FUKA 1C23A 3IU9A 3BIPA 1N51A 5CE6A 1WKMA 2GZ5A 2BHDA 3PEBA 2BWVA 2BWTA 2V3XA 4FLLA 4U1BA 2BN7A 5CIKA 1M35A 2Q8KA 5E5BA 2BHCA 2GG9A 4FO8A 2EA2A 2P9AA 1BOAA 3MATA 1A16A 3L24A 4PNCA 2Q95A 1QZYA 1C21A 5JI6A 2P99A 1PV9A 1XNZA 2Q93A 4FO7A 4S00A 4OOKA 4FLKA 1KQ9A 4RGZ1 2DFIA 2V6CA 1YJ3A 2P98A 3S6BA 2GU6A 2GGCA 1YW8A 4ZWUA 4A6WA 3PKAA 3CB5A 1CHMA 5E2CA 1BN5A 1KQ0A 5CDLA 1WLRA 3FMQA 3PN9A 3TAVA 1B59A 5CDVA 2GTXA 2G6PA 2OKNA 4U76A 3O5VA 5FCFA 2EVOA 4ZWPA 2GG2A 2GA2A 2MATA 4U6EA 1MATA 1XGMA 2GG8A 3RORA 3RVAA 1WY2A 2BHBA 4S2RP 4ZNGA 4KM3A 4RZZA 4MATA 1WN1A 1XGOA 2BWYA 2IW2A 1YVMA 4S2TP 2B3LA 4U75A 1KP0A 2HOWA 3FM3A 4IKSA 3OVKA 4RZYA 5CNXA 1XGSA 2ADUA 5FCHA 2Q92A 4QR8A 3CB6A 5CDEA 4IKUA 4JUQA 1WBQA 5JHUA 2EA4A 1R5GA 4IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHA A;  4IKR A;  3MX6 A;  4S01 A;  4B28 A;  2V3Z A;  4FKC A;  1R58 A;  4U6J A;  5D6F A;  2GU5 A;  5D6E A;  1YW9 A;  4U70 A;  3BIT A;  2GG0 A;  1C22 A;  1QXZ A;  3TB5 A;  3PKD A;  4A6V A;  3L7G A;  3BIQ A;  3IU8 A;  2NQ7 A;  5CLS A;  3IL0 A;  1Y1N A;  1O0X A;  3MR1 A;  1B6A A;  2B3H A;  3PKE A;  3IG4 A;  2BWU A;  2GGB A;  4HXX A;  2GG5 A;  4IDY A;  3PKC A;  4U6Z A;  2BWX A;  3I7M A;  4IKT A;  4IU6 A;  4IEC A;  2Q94 A;  4U6W A;  4Z7M A;  4EGE A;  3D27 A;  3CTZ A;  2GG7 A;  2V3Y A;  2GU7 A;  4U71 A;  4PV4 A;  2EVC A;  4IPA A;  4ZWO A;  1QXY A;  2BWS A;  1C27 A;  1W2M A;  2NQ6 A;  1YW7 A;  3PKB A;  3Q6D A;  3IU7 A;  1QXW A;  1R5H A;  4U6C A;  3FMR A;  1WL6 A;  4FLJ A;  4U73 A;  5JFR A;  3QOC A;  1C24 A;  2BWW A;  2BB7 A;  2GG3 A;  4R60 A;  2OAZ A;  3OOO A;  4FLI A;  2EVM A;  1XGN A;  1W7V A;  2GU4 A;  1JAW A;  2B3K A;  1WL9 A;  2BH3 A;  2ZSG A;  2Q96 A;  4U69 A;  4FUK A;  1C23 A;  3IU9 A;  3BIP A;  1N51 A;  5CE6 A;  1WKM A;  2GZ5 A;  2BHD A;  3PEB A;  2BWV A;  2BWT A;  2V3X A;  4FLL A;  4U1B A;  2BN7 A;  5CIK A;  1M35 A;  2Q8K A;  5E5B A;  2BHC A;  2GG9 A;  4FO8 A;  2EA2 A;  2P9A A;  1BOA A;  3MAT A;  1A16 A;  3L24 A;  4PNC A;  2Q95 A;  1QZY A;  1C21 A;  5JI6 A;  2P99 A;  1PV9 A;  1XNZ A;  2Q93 A;  4FO7 A;  4S00 A;  4OOK A;  4FLK A;  1KQ9 A;  4RGZ 1;  2DFI A;  2V6C A;  1YJ3 A;  2P98 A;  3S6B A;  2GU6 A;  2GGC A;  1YW8 A;  4ZWU A;  4A6W A;  3PKA A;  3CB5 A;  1CHM A;  5E2C A;  1BN5 A;  1KQ0 A;  5CDL A;  1WLR A;  3FMQ A;  3PN9 A;  3TAV A;  1B59 A;  5CDV A;  2GTX A;  2G6P A;  2OKN A;  4U76 A;  3O5V A;  5FCF A;  2EVO A;  4ZWP A;  2GG2 A;  2GA2 A;  2MAT A;  4U6E A;  1MAT A;  1XGM A;  2GG8 A;  3ROR A;  3RVA A;  1WY2 A;  2BHB A;  4S2R P;  4ZNG A;  4KM3 A;  4RZZ A;  4MAT A;  1WN1 A;  1XGO A;  2BWY A;  2IW2 A;  1YVM A;  4S2T P;  2B3L A;  4U75 A;  1KP0 A;  2HOW A;  3FM3 A;  4IKS A;  3OVK A;  4RZY A;  5CNX A;  1XGS A;  2ADU A;  5FCH A;  2Q92 A;  4QR8 A;  3CB6 A;  5CDE A;  4IKU A;  4JUQ A;  1WBQ A;  5JHU A;  2EA4 A;  1R5G A;  4IF7 A; 
#chains in the Genus database with same CATH topology
 2BHA A;  4IKR A;  3MX6 A;  4S01 A;  4B28 A;  2V3Z A;  4FKC A;  1R58 A;  4U6J A;  5D6F A;  2GU5 A;  5D6E A;  1YW9 A;  4U70 A;  3BIT A;  2GG0 A;  1C22 A;  1QXZ A;  3TB5 A;  3PKD A;  4A6V A;  3L7G A;  3BIQ A;  3IU8 A;  2NQ7 A;  5CLS A;  3IL0 A;  1Y1N A;  1O0X A;  3MR1 A;  1B6A A;  2B3H A;  3PKE A;  3IG4 A;  2BWU A;  2GGB A;  4HXX A;  2GG5 A;  4IDY A;  3PKC A;  4U6Z A;  2BWX A;  3I7M A;  4IKT A;  4IU6 A;  4IEC A;  2Q94 A;  4U6W A;  4Z7M A;  4EGE A;  3D27 A;  3CTZ A;  2GG7 A;  2V3Y A;  2GU7 A;  4U71 A;  4PV4 A;  2EVC A;  4IPA A;  4ZWO A;  1QXY A;  2BWS A;  1C27 A;  1W2M A;  2NQ6 A;  1YW7 A;  3PKB A;  3Q6D A;  3IU7 A;  1QXW A;  1R5H A;  4U6C A;  3FMR A;  1WL6 A;  4FLJ A;  4U73 A;  5JFR A;  3QOC A;  1C24 A;  2BWW A;  2BB7 A;  2GG3 A;  4R60 A;  2OAZ A;  3OOO A;  4FLI A;  2EVM A;  1XGN A;  1W7V A;  2GU4 A;  1JAW A;  2B3K A;  1WL9 A;  2BH3 A;  2ZSG A;  2Q96 A;  4U69 A;  4FUK A;  1C23 A;  3IU9 A;  3BIP A;  1N51 A;  5CE6 A;  1WKM A;  2GZ5 A;  2BHD A;  3PEB A;  2BWV A;  2BWT A;  2V3X A;  4FLL A;  4U1B A;  2BN7 A;  5CIK A;  1M35 A;  2Q8K A;  5E5B A;  2BHC A;  2GG9 A;  4FO8 A;  2EA2 A;  2P9A A;  1BOA A;  3MAT A;  1A16 A;  3L24 A;  4PNC A;  2Q95 A;  1QZY A;  1C21 A;  5JI6 A;  2P99 A;  1PV9 A;  1XNZ A;  2Q93 A;  4FO7 A;  4S00 A;  4OOK A;  4FLK A;  1KQ9 A;  4RGZ 1;  2DFI A;  2V6C A;  1YJ3 A;  2P98 A;  3S6B A;  2GU6 A;  2GGC A;  1YW8 A;  4ZWU A;  4A6W A;  3PKA A;  3CB5 A;  1CHM A;  5E2C A;  1BN5 A;  1KQ0 A;  5CDL A;  1WLR A;  3FMQ A;  3PN9 A;  3TAV A;  1B59 A;  5CDV A;  2GTX A;  2G6P A;  2OKN A;  4U76 A;  3O5V A;  5FCF A;  2EVO A;  4ZWP A;  2GG2 A;  2GA2 A;  2MAT A;  4U6E A;  1MAT A;  1XGM A;  2GG8 A;  3ROR A;  3RVA A;  1WY2 A;  2BHB A;  4S2R P;  4ZNG A;  4KM3 A;  4RZZ A;  4MAT A;  1WN1 A;  1XGO A;  2BWY A;  2IW2 A;  1YVM A;  4S2T P;  2B3L A;  4U75 A;  1KP0 A;  2HOW A;  3FM3 A;  4IKS A;  3OVK A;  4RZY A;  5CNX A;  1XGS A;  2ADU A;  5FCH A;  2Q92 A;  4QR8 A;  3CB6 A;  5CDE A;  4IKU A;  4JUQ A;  1WBQ A;  5JHU A;  2EA4 A;  1R5G A;  4IF7 A; 
#chains in the Genus database with same CATH homology
 2BHA A;  4IKR A;  3MX6 A;  4S01 A;  4B28 A;  2V3Z A;  4FKC A;  1R58 A;  4U6J A;  5D6F A;  2GU5 A;  5D6E A;  1YW9 A;  4U70 A;  3BIT A;  2GG0 A;  1C22 A;  1QXZ A;  3TB5 A;  3PKD A;  4A6V A;  3L7G A;  3BIQ A;  3IU8 A;  2NQ7 A;  5CLS A;  3IL0 A;  1Y1N A;  1O0X A;  3MR1 A;  1B6A A;  2B3H A;  3PKE A;  3IG4 A;  2BWU A;  2GGB A;  4HXX A;  2GG5 A;  4IDY A;  3PKC A;  4U6Z A;  2BWX A;  3I7M A;  4IKT A;  4IU6 A;  4IEC A;  2Q94 A;  4U6W A;  4Z7M A;  4EGE A;  3D27 A;  3CTZ A;  2GG7 A;  2V3Y A;  2GU7 A;  4U71 A;  4PV4 A;  2EVC A;  4IPA A;  4ZWO A;  1QXY A;  2BWS A;  1C27 A;  1W2M A;  2NQ6 A;  1YW7 A;  3PKB A;  3Q6D A;  3IU7 A;  1QXW A;  1R5H A;  4U6C A;  3FMR A;  1WL6 A;  4FLJ A;  4U73 A;  5JFR A;  3QOC A;  1C24 A;  2BWW A;  2BB7 A;  2GG3 A;  4R60 A;  2OAZ A;  3OOO A;  4FLI A;  2EVM A;  1XGN A;  1W7V A;  2GU4 A;  1JAW A;  2B3K A;  1WL9 A;  2BH3 A;  2ZSG A;  2Q96 A;  4U69 A;  4FUK A;  1C23 A;  3IU9 A;  3BIP A;  1N51 A;  5CE6 A;  1WKM A;  2GZ5 A;  2BHD A;  3PEB A;  2BWV A;  2BWT A;  2V3X A;  4FLL A;  4U1B A;  2BN7 A;  5CIK A;  1M35 A;  2Q8K A;  5E5B A;  2BHC A;  2GG9 A;  4FO8 A;  2EA2 A;  2P9A A;  1BOA A;  3MAT A;  1A16 A;  3L24 A;  4PNC A;  2Q95 A;  1QZY A;  1C21 A;  5JI6 A;  2P99 A;  1PV9 A;  1XNZ A;  2Q93 A;  4FO7 A;  4S00 A;  4OOK A;  4FLK A;  1KQ9 A;  4RGZ 1;  2DFI A;  2V6C A;  1YJ3 A;  2P98 A;  3S6B A;  2GU6 A;  2GGC A;  1YW8 A;  4ZWU A;  4A6W A;  3PKA A;  3CB5 A;  1CHM A;  5E2C A;  1BN5 A;  1KQ0 A;  5CDL A;  1WLR A;  3FMQ A;  3PN9 A;  3TAV A;  1B59 A;  5CDV A;  2GTX A;  2G6P A;  2OKN A;  4U76 A;  3O5V A;  5FCF A;  2EVO A;  4ZWP A;  2GG2 A;  2GA2 A;  2MAT A;  4U6E A;  1MAT A;  1XGM A;  2GG8 A;  3ROR A;  3RVA A;  1WY2 A;  2BHB A;  4S2R P;  4ZNG A;  4KM3 A;  4RZZ A;  4MAT A;  1WN1 A;  1XGO A;  2BWY A;  2IW2 A;  1YVM A;  4S2T P;  2B3L A;  4U75 A;  1KP0 A;  2HOW A;  3FM3 A;  4IKS A;  3OVK A;  4RZY A;  5CNX A;  1XGS A;  2ADU A;  5FCH A;  2Q92 A;  4QR8 A;  3CB6 A;  5CDE A;  4IKU A;  4JUQ A;  1WBQ A;  5JHU A;  2EA4 A;  1R5G A;  4IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...