1A16A

Aminopeptidase p from e. coli with the inhibitor pro-leu
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSLEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
molecule tags Hydrolase/hydrolase inhibitor
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
total genus 152
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1a16A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1a16A02
4PNCA 3FMQA 1KQ0A 5JHUA 2G6PA 1R5HA 1N51A 2BWWA 2Q95A 4JUQA 1WL6A 2P98A 1C23A 4IPAA 1KP0A 5D6FA 2BHDA 1WLRA 2BWTA 2GG3A 2ZSGA 4ZWUA 2B3KA 3PKAA 4U73A 4Z7MA 1PV9A 1XGSA 1QZYA 3PEBA 3RVAA 1QXWA 2BB7A 2NQ6A 3S6BA 4A6VA 4RZYA 2EVCA 2Q96A 2V3XA 4S00A 4HXXA 2GGCA 2EA4A 2BN7A 3CB5A 1CHMA 5CNXA 3MX6A 5FCHA 1W2MA 2BHAA 4U6ZA 4FKCA 2P9AA 2BWVA 4IKRA 1XNZA 2ADUA 2EVOA 3BIQA 1YW9A 2EA2A 4MATA 3IU9A 2BWSA 4IKTA 2GG2A 5CDVA 4EGEA 3L24A 1YVMA 1WL9A 2B3HA 1MATA 2GA2A 4FLJA 3IG4A 5CLSA 3CTZA 2V6CA 3OVKA 2GG8A 4U6WA 3O5VA 4KM3A 1XGOA 3IU8A 1R5GA 1WKMA 4RGZ1 2BWYA 1M35A 1W7VA 2GGBA 2NQ7A 5CDEA 3L7GA 2GU4A 4U76A 4ZWOA 2GG9A 4FLLA 2GU6A 4FLKA 3FM3A 2IW2A 2Q93A 3QOCA 4ZNGA 4PV4A 4U75A 3TAVA 1WN1A 2DFIA 4U69A 5FCFA 4U6JA 4FLIA 4RZZA 5E5BA 3PKCA 4S2TP 3I7MA 1O0XA 3RORA 1BN5A 4U70A 4OOKA 2GU7A 2BHBA 1YJ3A 3TB5A 1JAWA 2P99A 4ZWPA 5E2CA 4IECA 2EVMA 2V3YA 2BWUA 2GTXA 2GG7A 5JFRA 2BHCA 2GU5A 1YW8A 5CIKA 1R58A 1Y1NA 3IU7A 2Q92A 4FO8A 4IU6A 5D6EA 3OOOA 2B3LA 4A6WA 1WY2A 4FUKA 4R60A 2GG5A 4U6EA 3D27A 4U1BA 1A16A 1QXYA 3MATA 1YW7A 1C27A 1WBQA 3MR1A 2GZ5A 4FO7A 4S2RP 1C24A 3CB6A 4U71A 5JI6A 3PN9A 2Q8KA 3BITA 4IKUA 1KQ9A 4S01A 3IL0A 5CDLA 2BH3A 3PKBA 1B6AA 2Q94A 4B28A 2MATA 2GG0A 1QXZA 3PKDA 5CE6A 2OKNA 2V3ZA 3PKEA 1XGMA 4IKSA 4U6CA 3Q6DA 2HOWA 2OAZA 2BWXA 3BIPA 1C21A 4IF7A 1C22A 4QR8A 1BOAA 4IDYA 3FMRA 1B59A 1XGNA
chains in the Genus database with same CATH superfamily
4PNCA 3FMQA 1KQ0A 5JHUA 2G6PA 1R5HA 1N51A 2BWWA 2Q95A 4JUQA 1WL6A 2P98A 1C23A 4IPAA 1KP0A 5D6FA 2BHDA 1WLRA 2BWTA 2GG3A 2ZSGA 4ZWUA 2B3KA 3PKAA 4U73A 4Z7MA 1PV9A 1XGSA 1QZYA 3PEBA 3RVAA 1QXWA 2BB7A 2NQ6A 3S6BA 4A6VA 4RZYA 2EVCA 2Q96A 2V3XA 4S00A 4HXXA 2GGCA 2EA4A 2BN7A 3CB5A 1CHMA 5CNXA 3MX6A 5FCHA 1W2MA 2BHAA 4U6ZA 4FKCA 2P9AA 2BWVA 4IKRA 1XNZA 2ADUA 2EVOA 3BIQA 1YW9A 2EA2A 4MATA 3IU9A 2BWSA 4IKTA 2GG2A 5CDVA 4EGEA 3L24A 1YVMA 1WL9A 2B3HA 1MATA 2GA2A 4FLJA 3IG4A 5CLSA 3CTZA 2V6CA 3OVKA 2GG8A 4U6WA 3O5VA 4KM3A 1XGOA 3IU8A 1R5GA 1WKMA 4RGZ1 2BWYA 1M35A 1W7VA 2GGBA 2NQ7A 5CDEA 3L7GA 2GU4A 4U76A 4ZWOA 2GG9A 4FLLA 2GU6A 4FLKA 3FM3A 2IW2A 2Q93A 3QOCA 4ZNGA 4PV4A 4U75A 3TAVA 1WN1A 2DFIA 4U69A 5FCFA 4U6JA 4FLIA 4RZZA 5E5BA 3PKCA 4S2TP 3I7MA 1O0XA 3RORA 1BN5A 4U70A 4OOKA 2GU7A 2BHBA 1YJ3A 3TB5A 1JAWA 2P99A 4ZWPA 5E2CA 4IECA 2EVMA 2V3YA 2BWUA 2GTXA 2GG7A 5JFRA 2BHCA 2GU5A 1YW8A 5CIKA 1R58A 1Y1NA 3IU7A 2Q92A 4FO8A 4IU6A 5D6EA 3OOOA 2B3LA 4A6WA 1WY2A 4FUKA 4R60A 2GG5A 4U6EA 3D27A 4U1BA 1A16A 1QXYA 3MATA 1YW7A 1C27A 1WBQA 3MR1A 2GZ5A 4FO7A 4S2RP 1C24A 3CB6A 4U71A 5JI6A 3PN9A 2Q8KA 3BITA 4IKUA 1KQ9A 4S01A 3IL0A 5CDLA 2BH3A 3PKBA 1B6AA 2Q94A 4B28A 2MATA 2GG0A 1QXZA 3PKDA 5CE6A 2OKNA 2V3ZA 3PKEA 1XGMA 4IKSA 4U6CA 3Q6DA 2HOWA 2OAZA 2BWXA 3BIPA 1C21A 4IF7A 1C22A 4QR8A 1BOAA 4IDYA 3FMRA 1B59A 1XGNA
chains in the Genus database with same CATH topology
4PNCA 3FMQA 1KQ0A 5JHUA 2G6PA 1R5HA 1N51A 2BWWA 2Q95A 4JUQA 1WL6A 2P98A 1C23A 4IPAA 1KP0A 5D6FA 2BHDA 1WLRA 2BWTA 2GG3A 2ZSGA 4ZWUA 2B3KA 3PKAA 4U73A 4Z7MA 1PV9A 1XGSA 1QZYA 3PEBA 3RVAA 1QXWA 2BB7A 2NQ6A 3S6BA 4A6VA 4RZYA 2EVCA 2Q96A 2V3XA 4S00A 4HXXA 2GGCA 2EA4A 2BN7A 3CB5A 1CHMA 5CNXA 3MX6A 5FCHA 1W2MA 2BHAA 4U6ZA 4FKCA 2P9AA 2BWVA 4IKRA 1XNZA 2ADUA 2EVOA 3BIQA 1YW9A 2EA2A 4MATA 3IU9A 2BWSA 4IKTA 2GG2A 5CDVA 4EGEA 3L24A 1YVMA 1WL9A 2B3HA 1MATA 2GA2A 4FLJA 3IG4A 5CLSA 3CTZA 2V6CA 3OVKA 2GG8A 4U6WA 3O5VA 4KM3A 1XGOA 3IU8A 1R5GA 1WKMA 4RGZ1 2BWYA 1M35A 1W7VA 2GGBA 2NQ7A 5CDEA 3L7GA 2GU4A 4U76A 4ZWOA 2GG9A 4FLLA 2GU6A 4FLKA 3FM3A 2IW2A 2Q93A 3QOCA 4ZNGA 4PV4A 4U75A 3TAVA 1WN1A 2DFIA 4U69A 5FCFA 4U6JA 4FLIA 4RZZA 5E5BA 3PKCA 4S2TP 3I7MA 1O0XA 3RORA 1BN5A 4U70A 4OOKA 2GU7A 2BHBA 1YJ3A 3TB5A 1JAWA 2P99A 4ZWPA 5E2CA 4IECA 2EVMA 2V3YA 2BWUA 2GTXA 2GG7A 5JFRA 2BHCA 2GU5A 1YW8A 5CIKA 1R58A 1Y1NA 3IU7A 2Q92A 4FO8A 4IU6A 5D6EA 3OOOA 2B3LA 4A6WA 1WY2A 4FUKA 4R60A 2GG5A 4U6EA 3D27A 4U1BA 1A16A 1QXYA 3MATA 1YW7A 1C27A 1WBQA 3MR1A 2GZ5A 4FO7A 4S2RP 1C24A 3CB6A 4U71A 5JI6A 3PN9A 2Q8KA 3BITA 4IKUA 1KQ9A 4S01A 3IL0A 5CDLA 2BH3A 3PKBA 1B6AA 2Q94A 4B28A 2MATA 2GG0A 1QXZA 3PKDA 5CE6A 2OKNA 2V3ZA 3PKEA 1XGMA 4IKSA 4U6CA 3Q6DA 2HOWA 2OAZA 2BWXA 3BIPA 1C21A 4IF7A 1C22A 4QR8A 1BOAA 4IDYA 3FMRA 1B59A 1XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNC A;  3FMQ A;  1KQ0 A;  5JHU A;  2G6P A;  1R5H A;  1N51 A;  2BWW A;  2Q95 A;  4JUQ A;  1WL6 A;  2P98 A;  1C23 A;  4IPA A;  1KP0 A;  5D6F A;  2BHD A;  1WLR A;  2BWT A;  2GG3 A;  2ZSG A;  4ZWU A;  2B3K A;  3PKA A;  4U73 A;  4Z7M A;  1PV9 A;  1XGS A;  1QZY A;  3PEB A;  3RVA A;  1QXW A;  2BB7 A;  2NQ6 A;  3S6B A;  4A6V A;  4RZY A;  2EVC A;  2Q96 A;  2V3X A;  4S00 A;  4HXX A;  2GGC A;  2EA4 A;  2BN7 A;  3CB5 A;  1CHM A;  5CNX A;  3MX6 A;  5FCH A;  1W2M A;  2BHA A;  4U6Z A;  4FKC A;  2P9A A;  2BWV A;  4IKR A;  1XNZ A;  2ADU A;  2EVO A;  3BIQ A;  1YW9 A;  2EA2 A;  4MAT A;  3IU9 A;  2BWS A;  4IKT A;  2GG2 A;  5CDV A;  4EGE A;  3L24 A;  1YVM A;  1WL9 A;  2B3H A;  1MAT A;  2GA2 A;  4FLJ A;  3IG4 A;  5CLS A;  3CTZ A;  2V6C A;  3OVK A;  2GG8 A;  4U6W A;  3O5V A;  4KM3 A;  1XGO A;  3IU8 A;  1R5G A;  1WKM A;  4RGZ 1;  2BWY A;  1M35 A;  1W7V A;  2GGB A;  2NQ7 A;  5CDE A;  3L7G A;  2GU4 A;  4U76 A;  4ZWO A;  2GG9 A;  4FLL A;  2GU6 A;  4FLK A;  3FM3 A;  2IW2 A;  2Q93 A;  3QOC A;  4ZNG A;  4PV4 A;  4U75 A;  3TAV A;  1WN1 A;  2DFI A;  4U69 A;  5FCF A;  4U6J A;  4FLI A;  4RZZ A;  5E5B A;  3PKC A;  4S2T P;  3I7M A;  1O0X A;  3ROR A;  1BN5 A;  4U70 A;  4OOK A;  2GU7 A;  2BHB A;  1YJ3 A;  3TB5 A;  1JAW A;  2P99 A;  4ZWP A;  5E2C A;  4IEC A;  2EVM A;  2V3Y A;  2BWU A;  2GTX A;  2GG7 A;  5JFR A;  2BHC A;  2GU5 A;  1YW8 A;  5CIK A;  1R58 A;  1Y1N A;  3IU7 A;  2Q92 A;  4FO8 A;  4IU6 A;  5D6E A;  3OOO A;  2B3L A;  4A6W A;  1WY2 A;  4FUK A;  4R60 A;  2GG5 A;  4U6E A;  3D27 A;  4U1B A;  1A16 A;  1QXY A;  3MAT A;  1YW7 A;  1C27 A;  1WBQ A;  3MR1 A;  2GZ5 A;  4FO7 A;  4S2R P;  1C24 A;  3CB6 A;  4U71 A;  5JI6 A;  3PN9 A;  2Q8K A;  3BIT A;  4IKU A;  1KQ9 A;  4S01 A;  3IL0 A;  5CDL A;  2BH3 A;  3PKB A;  1B6A A;  2Q94 A;  4B28 A;  2MAT A;  2GG0 A;  1QXZ A;  3PKD A;  5CE6 A;  2OKN A;  2V3Z A;  3PKE A;  1XGM A;  4IKS A;  4U6C A;  3Q6D A;  2HOW A;  2OAZ A;  2BWX A;  3BIP A;  1C21 A;  4IF7 A;  1C22 A;  4QR8 A;  1BOA A;  4IDY A;  3FMR A;  1B59 A;  1XGN A; 
#chains in the Genus database with same CATH topology
 4PNC A;  3FMQ A;  1KQ0 A;  5JHU A;  2G6P A;  1R5H A;  1N51 A;  2BWW A;  2Q95 A;  4JUQ A;  1WL6 A;  2P98 A;  1C23 A;  4IPA A;  1KP0 A;  5D6F A;  2BHD A;  1WLR A;  2BWT A;  2GG3 A;  2ZSG A;  4ZWU A;  2B3K A;  3PKA A;  4U73 A;  4Z7M A;  1PV9 A;  1XGS A;  1QZY A;  3PEB A;  3RVA A;  1QXW A;  2BB7 A;  2NQ6 A;  3S6B A;  4A6V A;  4RZY A;  2EVC A;  2Q96 A;  2V3X A;  4S00 A;  4HXX A;  2GGC A;  2EA4 A;  2BN7 A;  3CB5 A;  1CHM A;  5CNX A;  3MX6 A;  5FCH A;  1W2M A;  2BHA A;  4U6Z A;  4FKC A;  2P9A A;  2BWV A;  4IKR A;  1XNZ A;  2ADU A;  2EVO A;  3BIQ A;  1YW9 A;  2EA2 A;  4MAT A;  3IU9 A;  2BWS A;  4IKT A;  2GG2 A;  5CDV A;  4EGE A;  3L24 A;  1YVM A;  1WL9 A;  2B3H A;  1MAT A;  2GA2 A;  4FLJ A;  3IG4 A;  5CLS A;  3CTZ A;  2V6C A;  3OVK A;  2GG8 A;  4U6W A;  3O5V A;  4KM3 A;  1XGO A;  3IU8 A;  1R5G A;  1WKM A;  4RGZ 1;  2BWY A;  1M35 A;  1W7V A;  2GGB A;  2NQ7 A;  5CDE A;  3L7G A;  2GU4 A;  4U76 A;  4ZWO A;  2GG9 A;  4FLL A;  2GU6 A;  4FLK A;  3FM3 A;  2IW2 A;  2Q93 A;  3QOC A;  4ZNG A;  4PV4 A;  4U75 A;  3TAV A;  1WN1 A;  2DFI A;  4U69 A;  5FCF A;  4U6J A;  4FLI A;  4RZZ A;  5E5B A;  3PKC A;  4S2T P;  3I7M A;  1O0X A;  3ROR A;  1BN5 A;  4U70 A;  4OOK A;  2GU7 A;  2BHB A;  1YJ3 A;  3TB5 A;  1JAW A;  2P99 A;  4ZWP A;  5E2C A;  4IEC A;  2EVM A;  2V3Y A;  2BWU A;  2GTX A;  2GG7 A;  5JFR A;  2BHC A;  2GU5 A;  1YW8 A;  5CIK A;  1R58 A;  1Y1N A;  3IU7 A;  2Q92 A;  4FO8 A;  4IU6 A;  5D6E A;  3OOO A;  2B3L A;  4A6W A;  1WY2 A;  4FUK A;  4R60 A;  2GG5 A;  4U6E A;  3D27 A;  4U1B A;  1A16 A;  1QXY A;  3MAT A;  1YW7 A;  1C27 A;  1WBQ A;  3MR1 A;  2GZ5 A;  4FO7 A;  4S2R P;  1C24 A;  3CB6 A;  4U71 A;  5JI6 A;  3PN9 A;  2Q8K A;  3BIT A;  4IKU A;  1KQ9 A;  4S01 A;  3IL0 A;  5CDL A;  2BH3 A;  3PKB A;  1B6A A;  2Q94 A;  4B28 A;  2MAT A;  2GG0 A;  1QXZ A;  3PKD A;  5CE6 A;  2OKN A;  2V3Z A;  3PKE A;  1XGM A;  4IKS A;  4U6C A;  3Q6D A;  2HOW A;  2OAZ A;  2BWX A;  3BIP A;  1C21 A;  4IF7 A;  1C22 A;  4QR8 A;  1BOA A;  4IDY A;  3FMR A;  1B59 A;  1XGN A; 
#chains in the Genus database with same CATH homology
 4PNC A;  3FMQ A;  1KQ0 A;  5JHU A;  2G6P A;  1R5H A;  1N51 A;  2BWW A;  2Q95 A;  4JUQ A;  1WL6 A;  2P98 A;  1C23 A;  4IPA A;  1KP0 A;  5D6F A;  2BHD A;  1WLR A;  2BWT A;  2GG3 A;  2ZSG A;  4ZWU A;  2B3K A;  3PKA A;  4U73 A;  4Z7M A;  1PV9 A;  1XGS A;  1QZY A;  3PEB A;  3RVA A;  1QXW A;  2BB7 A;  2NQ6 A;  3S6B A;  4A6V A;  4RZY A;  2EVC A;  2Q96 A;  2V3X A;  4S00 A;  4HXX A;  2GGC A;  2EA4 A;  2BN7 A;  3CB5 A;  1CHM A;  5CNX A;  3MX6 A;  5FCH A;  1W2M A;  2BHA A;  4U6Z A;  4FKC A;  2P9A A;  2BWV A;  4IKR A;  1XNZ A;  2ADU A;  2EVO A;  3BIQ A;  1YW9 A;  2EA2 A;  4MAT A;  3IU9 A;  2BWS A;  4IKT A;  2GG2 A;  5CDV A;  4EGE A;  3L24 A;  1YVM A;  1WL9 A;  2B3H A;  1MAT A;  2GA2 A;  4FLJ A;  3IG4 A;  5CLS A;  3CTZ A;  2V6C A;  3OVK A;  2GG8 A;  4U6W A;  3O5V A;  4KM3 A;  1XGO A;  3IU8 A;  1R5G A;  1WKM A;  4RGZ 1;  2BWY A;  1M35 A;  1W7V A;  2GGB A;  2NQ7 A;  5CDE A;  3L7G A;  2GU4 A;  4U76 A;  4ZWO A;  2GG9 A;  4FLL A;  2GU6 A;  4FLK A;  3FM3 A;  2IW2 A;  2Q93 A;  3QOC A;  4ZNG A;  4PV4 A;  4U75 A;  3TAV A;  1WN1 A;  2DFI A;  4U69 A;  5FCF A;  4U6J A;  4FLI A;  4RZZ A;  5E5B A;  3PKC A;  4S2T P;  3I7M A;  1O0X A;  3ROR A;  1BN5 A;  4U70 A;  4OOK A;  2GU7 A;  2BHB A;  1YJ3 A;  3TB5 A;  1JAW A;  2P99 A;  4ZWP A;  5E2C A;  4IEC A;  2EVM A;  2V3Y A;  2BWU A;  2GTX A;  2GG7 A;  5JFR A;  2BHC A;  2GU5 A;  1YW8 A;  5CIK A;  1R58 A;  1Y1N A;  3IU7 A;  2Q92 A;  4FO8 A;  4IU6 A;  5D6E A;  3OOO A;  2B3L A;  4A6W A;  1WY2 A;  4FUK A;  4R60 A;  2GG5 A;  4U6E A;  3D27 A;  4U1B A;  1A16 A;  1QXY A;  3MAT A;  1YW7 A;  1C27 A;  1WBQ A;  3MR1 A;  2GZ5 A;  4FO7 A;  4S2R P;  1C24 A;  3CB6 A;  4U71 A;  5JI6 A;  3PN9 A;  2Q8K A;  3BIT A;  4IKU A;  1KQ9 A;  4S01 A;  3IL0 A;  5CDL A;  2BH3 A;  3PKB A;  1B6A A;  2Q94 A;  4B28 A;  2MAT A;  2GG0 A;  1QXZ A;  3PKD A;  5CE6 A;  2OKN A;  2V3Z A;  3PKE A;  1XGM A;  4IKS A;  4U6C A;  3Q6D A;  2HOW A;  2OAZ A;  2BWX A;  3BIP A;  1C21 A;  4IF7 A;  1C22 A;  4QR8 A;  1BOA A;  4IDY A;  3FMR A;  1B59 A;  1XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...