1A16A

Aminopeptidase p from e. coli with the inhibitor pro-leu
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSLEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 152
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1a16A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1a16A02
1XNZA 2GG2A 2P99A 1XGMA 4A6WA 3RVAA 3BITA 2BHAA 1MATA 4IU6A 2GU7A 4FLJA 3OVKA 4U6WA 1QXWA 4ZNGA 4Z7MA 1B59A 3MX6A 2BWYA 1R5GA 5CLSA 3IL0A 2EVMA 5CNXA 2GTXA 2BB7A 4RGZ1 1JAWA 1WN1A 4U75A 1XGNA 3PKDA 5CDEA 2BHDA 3MR1A 2MATA 3TB5A 2V6CA 2EVOA 2EA4A 1KP0A 1YW8A 5JFRA 1C27A 2BN7A 2HOWA 5CDVA 2Q96A 3IU9A 2B3KA 4FLLA 5D6EA 3IG4A 4R60A 4B28A 1WKMA 2DFIA 2GG8A 2Q95A 4PNCA 3PKEA 1R5HA 2GU6A 4IKTA 2GGBA 3QOCA 2EA2A 5CDLA 3IU7A 2GG5A 2GU4A 1BOAA 4ZWUA 3PN9A 3BIPA 1C21A 5FCHA 1WLRA 4FO7A 4OOKA 2BWSA 2ZSGA 3FMQA 1WY2A 1WBQA 2OKNA 1KQ9A 2P98A 2P9AA 2GA2A 2IW2A 3MATA 2BWTA 3PKAA 4FKCA 4QR8A 4FLIA 1W2MA 3CB5A 4U71A 2BWXA 2G6PA 1QXYA 4U70A 2NQ7A 2NQ6A 2Q94A 4U69A 1C22A 4FLKA 4HXXA 3FM3A 2Q92A 1QXZA 1O0XA 4ZWPA 3L7GA 1N51A 1QZYA 2BWVA 3L24A 4JUQA 4RZYA 5JI6A 4KM3A 1YJ3A 2ADUA 4FO8A 4S2RP 4IDYA 3OOOA 4IECA 2Q8KA 4ZWOA 1A16A 1W7VA 1C24A 2OAZA 4S2TP 2GZ5A 3PKBA 4FUKA 1YW7A 4U6CA 1M35A 2BWWA 2V3ZA 2GG9A 1XGOA 1KQ0A 3CTZA 2B3HA 4IF7A 3D27A 3CB6A 5CE6A 4U6EA 2V3XA 1XGSA 5E2CA 4RZZA 4S01A 3PEBA 1R58A 2GG7A 2BHCA 1C23A 1PV9A 2BH3A 2GU5A 3BIQA 3I7MA 1YW9A 4U73A 4IKRA 3O5VA 1Y1NA 3FMRA 3RORA 4EGEA 3Q6DA 2BHBA 5FCFA 4IKSA 1BN5A 4MATA 4S00A 5CIKA 4IKUA 5E5BA 2V3YA 2GGCA 5D6FA 3TAVA 4U76A 2Q93A 2BWUA 2GG0A 4U1BA 4U6ZA 1WL9A 3PKCA 4U6JA 1B6AA 2B3LA 4PV4A 3IU8A 3S6BA 2GG3A 4IPAA 1WL6A 1CHMA 4A6VA 2EVCA 1YVMA 5JHUA
chains in the Genus database with same CATH superfamily
1XNZA 2GG2A 2P99A 1XGMA 4A6WA 3RVAA 3BITA 2BHAA 1MATA 4IU6A 2GU7A 4FLJA 3OVKA 4U6WA 1QXWA 4ZNGA 4Z7MA 1B59A 3MX6A 2BWYA 1R5GA 5CLSA 3IL0A 2EVMA 5CNXA 2GTXA 2BB7A 4RGZ1 1JAWA 1WN1A 4U75A 1XGNA 3PKDA 5CDEA 2BHDA 3MR1A 2MATA 3TB5A 2V6CA 2EVOA 2EA4A 1KP0A 1YW8A 5JFRA 1C27A 2BN7A 2HOWA 5CDVA 2Q96A 3IU9A 2B3KA 4FLLA 5D6EA 3IG4A 4R60A 4B28A 1WKMA 2DFIA 2GG8A 2Q95A 4PNCA 3PKEA 1R5HA 2GU6A 4IKTA 2GGBA 3QOCA 2EA2A 5CDLA 3IU7A 2GG5A 2GU4A 1BOAA 4ZWUA 3PN9A 3BIPA 1C21A 5FCHA 1WLRA 4FO7A 4OOKA 2BWSA 2ZSGA 3FMQA 1WY2A 1WBQA 2OKNA 1KQ9A 2P98A 2P9AA 2GA2A 2IW2A 3MATA 2BWTA 3PKAA 4FKCA 4QR8A 4FLIA 1W2MA 3CB5A 4U71A 2BWXA 2G6PA 1QXYA 4U70A 2NQ7A 2NQ6A 2Q94A 4U69A 1C22A 4FLKA 4HXXA 3FM3A 2Q92A 1QXZA 1O0XA 4ZWPA 3L7GA 1N51A 1QZYA 2BWVA 3L24A 4JUQA 4RZYA 5JI6A 4KM3A 1YJ3A 2ADUA 4FO8A 4S2RP 4IDYA 3OOOA 4IECA 2Q8KA 4ZWOA 1A16A 1W7VA 1C24A 2OAZA 4S2TP 2GZ5A 3PKBA 4FUKA 1YW7A 4U6CA 1M35A 2BWWA 2V3ZA 2GG9A 1XGOA 1KQ0A 3CTZA 2B3HA 4IF7A 3D27A 3CB6A 5CE6A 4U6EA 2V3XA 1XGSA 5E2CA 4RZZA 4S01A 3PEBA 1R58A 2GG7A 2BHCA 1C23A 1PV9A 2BH3A 2GU5A 3BIQA 3I7MA 1YW9A 4U73A 4IKRA 3O5VA 1Y1NA 3FMRA 3RORA 4EGEA 3Q6DA 2BHBA 5FCFA 4IKSA 1BN5A 4MATA 4S00A 5CIKA 4IKUA 5E5BA 2V3YA 2GGCA 5D6FA 3TAVA 4U76A 2Q93A 2BWUA 2GG0A 4U1BA 4U6ZA 1WL9A 3PKCA 4U6JA 1B6AA 2B3LA 4PV4A 3IU8A 3S6BA 2GG3A 4IPAA 1WL6A 1CHMA 4A6VA 2EVCA 1YVMA 5JHUA
chains in the Genus database with same CATH topology
1XNZA 2GG2A 2P99A 1XGMA 4A6WA 3RVAA 3BITA 2BHAA 1MATA 4IU6A 2GU7A 4FLJA 3OVKA 4U6WA 1QXWA 4ZNGA 4Z7MA 1B59A 3MX6A 2BWYA 1R5GA 5CLSA 3IL0A 2EVMA 5CNXA 2GTXA 2BB7A 4RGZ1 1JAWA 1WN1A 4U75A 1XGNA 3PKDA 5CDEA 2BHDA 3MR1A 2MATA 3TB5A 2V6CA 2EVOA 2EA4A 1KP0A 1YW8A 5JFRA 1C27A 2BN7A 2HOWA 5CDVA 2Q96A 3IU9A 2B3KA 4FLLA 5D6EA 3IG4A 4R60A 4B28A 1WKMA 2DFIA 2GG8A 2Q95A 4PNCA 3PKEA 1R5HA 2GU6A 4IKTA 2GGBA 3QOCA 2EA2A 5CDLA 3IU7A 2GG5A 2GU4A 1BOAA 4ZWUA 3PN9A 3BIPA 1C21A 5FCHA 1WLRA 4FO7A 4OOKA 2BWSA 2ZSGA 3FMQA 1WY2A 1WBQA 2OKNA 1KQ9A 2P98A 2P9AA 2GA2A 2IW2A 3MATA 2BWTA 3PKAA 4FKCA 4QR8A 4FLIA 1W2MA 3CB5A 4U71A 2BWXA 2G6PA 1QXYA 4U70A 2NQ7A 2NQ6A 2Q94A 4U69A 1C22A 4FLKA 4HXXA 3FM3A 2Q92A 1QXZA 1O0XA 4ZWPA 3L7GA 1N51A 1QZYA 2BWVA 3L24A 4JUQA 4RZYA 5JI6A 4KM3A 1YJ3A 2ADUA 4FO8A 4S2RP 4IDYA 3OOOA 4IECA 2Q8KA 4ZWOA 1A16A 1W7VA 1C24A 2OAZA 4S2TP 2GZ5A 3PKBA 4FUKA 1YW7A 4U6CA 1M35A 2BWWA 2V3ZA 2GG9A 1XGOA 1KQ0A 3CTZA 2B3HA 4IF7A 3D27A 3CB6A 5CE6A 4U6EA 2V3XA 1XGSA 5E2CA 4RZZA 4S01A 3PEBA 1R58A 2GG7A 2BHCA 1C23A 1PV9A 2BH3A 2GU5A 3BIQA 3I7MA 1YW9A 4U73A 4IKRA 3O5VA 1Y1NA 3FMRA 3RORA 4EGEA 3Q6DA 2BHBA 5FCFA 4IKSA 1BN5A 4MATA 4S00A 5CIKA 4IKUA 5E5BA 2V3YA 2GGCA 5D6FA 3TAVA 4U76A 2Q93A 2BWUA 2GG0A 4U1BA 4U6ZA 1WL9A 3PKCA 4U6JA 1B6AA 2B3LA 4PV4A 3IU8A 3S6BA 2GG3A 4IPAA 1WL6A 1CHMA 4A6VA 2EVCA 1YVMA 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNZ A;  2GG2 A;  2P99 A;  1XGM A;  4A6W A;  3RVA A;  3BIT A;  2BHA A;  1MAT A;  4IU6 A;  2GU7 A;  4FLJ A;  3OVK A;  4U6W A;  1QXW A;  4ZNG A;  4Z7M A;  1B59 A;  3MX6 A;  2BWY A;  1R5G A;  5CLS A;  3IL0 A;  2EVM A;  5CNX A;  2GTX A;  2BB7 A;  4RGZ 1;  1JAW A;  1WN1 A;  4U75 A;  1XGN A;  3PKD A;  5CDE A;  2BHD A;  3MR1 A;  2MAT A;  3TB5 A;  2V6C A;  2EVO A;  2EA4 A;  1KP0 A;  1YW8 A;  5JFR A;  1C27 A;  2BN7 A;  2HOW A;  5CDV A;  2Q96 A;  3IU9 A;  2B3K A;  4FLL A;  5D6E A;  3IG4 A;  4R60 A;  4B28 A;  1WKM A;  2DFI A;  2GG8 A;  2Q95 A;  4PNC A;  3PKE A;  1R5H A;  2GU6 A;  4IKT A;  2GGB A;  3QOC A;  2EA2 A;  5CDL A;  3IU7 A;  2GG5 A;  2GU4 A;  1BOA A;  4ZWU A;  3PN9 A;  3BIP A;  1C21 A;  5FCH A;  1WLR A;  4FO7 A;  4OOK A;  2BWS A;  2ZSG A;  3FMQ A;  1WY2 A;  1WBQ A;  2OKN A;  1KQ9 A;  2P98 A;  2P9A A;  2GA2 A;  2IW2 A;  3MAT A;  2BWT A;  3PKA A;  4FKC A;  4QR8 A;  4FLI A;  1W2M A;  3CB5 A;  4U71 A;  2BWX A;  2G6P A;  1QXY A;  4U70 A;  2NQ7 A;  2NQ6 A;  2Q94 A;  4U69 A;  1C22 A;  4FLK A;  4HXX A;  3FM3 A;  2Q92 A;  1QXZ A;  1O0X A;  4ZWP A;  3L7G A;  1N51 A;  1QZY A;  2BWV A;  3L24 A;  4JUQ A;  4RZY A;  5JI6 A;  4KM3 A;  1YJ3 A;  2ADU A;  4FO8 A;  4S2R P;  4IDY A;  3OOO A;  4IEC A;  2Q8K A;  4ZWO A;  1A16 A;  1W7V A;  1C24 A;  2OAZ A;  4S2T P;  2GZ5 A;  3PKB A;  4FUK A;  1YW7 A;  4U6C A;  1M35 A;  2BWW A;  2V3Z A;  2GG9 A;  1XGO A;  1KQ0 A;  3CTZ A;  2B3H A;  4IF7 A;  3D27 A;  3CB6 A;  5CE6 A;  4U6E A;  2V3X A;  1XGS A;  5E2C A;  4RZZ A;  4S01 A;  3PEB A;  1R58 A;  2GG7 A;  2BHC A;  1C23 A;  1PV9 A;  2BH3 A;  2GU5 A;  3BIQ A;  3I7M A;  1YW9 A;  4U73 A;  4IKR A;  3O5V A;  1Y1N A;  3FMR A;  3ROR A;  4EGE A;  3Q6D A;  2BHB A;  5FCF A;  4IKS A;  1BN5 A;  4MAT A;  4S00 A;  5CIK A;  4IKU A;  5E5B A;  2V3Y A;  2GGC A;  5D6F A;  3TAV A;  4U76 A;  2Q93 A;  2BWU A;  2GG0 A;  4U1B A;  4U6Z A;  1WL9 A;  3PKC A;  4U6J A;  1B6A A;  2B3L A;  4PV4 A;  3IU8 A;  3S6B A;  2GG3 A;  4IPA A;  1WL6 A;  1CHM A;  4A6V A;  2EVC A;  1YVM A;  5JHU A; 
#chains in the Genus database with same CATH topology
 1XNZ A;  2GG2 A;  2P99 A;  1XGM A;  4A6W A;  3RVA A;  3BIT A;  2BHA A;  1MAT A;  4IU6 A;  2GU7 A;  4FLJ A;  3OVK A;  4U6W A;  1QXW A;  4ZNG A;  4Z7M A;  1B59 A;  3MX6 A;  2BWY A;  1R5G A;  5CLS A;  3IL0 A;  2EVM A;  5CNX A;  2GTX A;  2BB7 A;  4RGZ 1;  1JAW A;  1WN1 A;  4U75 A;  1XGN A;  3PKD A;  5CDE A;  2BHD A;  3MR1 A;  2MAT A;  3TB5 A;  2V6C A;  2EVO A;  2EA4 A;  1KP0 A;  1YW8 A;  5JFR A;  1C27 A;  2BN7 A;  2HOW A;  5CDV A;  2Q96 A;  3IU9 A;  2B3K A;  4FLL A;  5D6E A;  3IG4 A;  4R60 A;  4B28 A;  1WKM A;  2DFI A;  2GG8 A;  2Q95 A;  4PNC A;  3PKE A;  1R5H A;  2GU6 A;  4IKT A;  2GGB A;  3QOC A;  2EA2 A;  5CDL A;  3IU7 A;  2GG5 A;  2GU4 A;  1BOA A;  4ZWU A;  3PN9 A;  3BIP A;  1C21 A;  5FCH A;  1WLR A;  4FO7 A;  4OOK A;  2BWS A;  2ZSG A;  3FMQ A;  1WY2 A;  1WBQ A;  2OKN A;  1KQ9 A;  2P98 A;  2P9A A;  2GA2 A;  2IW2 A;  3MAT A;  2BWT A;  3PKA A;  4FKC A;  4QR8 A;  4FLI A;  1W2M A;  3CB5 A;  4U71 A;  2BWX A;  2G6P A;  1QXY A;  4U70 A;  2NQ7 A;  2NQ6 A;  2Q94 A;  4U69 A;  1C22 A;  4FLK A;  4HXX A;  3FM3 A;  2Q92 A;  1QXZ A;  1O0X A;  4ZWP A;  3L7G A;  1N51 A;  1QZY A;  2BWV A;  3L24 A;  4JUQ A;  4RZY A;  5JI6 A;  4KM3 A;  1YJ3 A;  2ADU A;  4FO8 A;  4S2R P;  4IDY A;  3OOO A;  4IEC A;  2Q8K A;  4ZWO A;  1A16 A;  1W7V A;  1C24 A;  2OAZ A;  4S2T P;  2GZ5 A;  3PKB A;  4FUK A;  1YW7 A;  4U6C A;  1M35 A;  2BWW A;  2V3Z A;  2GG9 A;  1XGO A;  1KQ0 A;  3CTZ A;  2B3H A;  4IF7 A;  3D27 A;  3CB6 A;  5CE6 A;  4U6E A;  2V3X A;  1XGS A;  5E2C A;  4RZZ A;  4S01 A;  3PEB A;  1R58 A;  2GG7 A;  2BHC A;  1C23 A;  1PV9 A;  2BH3 A;  2GU5 A;  3BIQ A;  3I7M A;  1YW9 A;  4U73 A;  4IKR A;  3O5V A;  1Y1N A;  3FMR A;  3ROR A;  4EGE A;  3Q6D A;  2BHB A;  5FCF A;  4IKS A;  1BN5 A;  4MAT A;  4S00 A;  5CIK A;  4IKU A;  5E5B A;  2V3Y A;  2GGC A;  5D6F A;  3TAV A;  4U76 A;  2Q93 A;  2BWU A;  2GG0 A;  4U1B A;  4U6Z A;  1WL9 A;  3PKC A;  4U6J A;  1B6A A;  2B3L A;  4PV4 A;  3IU8 A;  3S6B A;  2GG3 A;  4IPA A;  1WL6 A;  1CHM A;  4A6V A;  2EVC A;  1YVM A;  5JHU A; 
#chains in the Genus database with same CATH homology
 1XNZ A;  2GG2 A;  2P99 A;  1XGM A;  4A6W A;  3RVA A;  3BIT A;  2BHA A;  1MAT A;  4IU6 A;  2GU7 A;  4FLJ A;  3OVK A;  4U6W A;  1QXW A;  4ZNG A;  4Z7M A;  1B59 A;  3MX6 A;  2BWY A;  1R5G A;  5CLS A;  3IL0 A;  2EVM A;  5CNX A;  2GTX A;  2BB7 A;  4RGZ 1;  1JAW A;  1WN1 A;  4U75 A;  1XGN A;  3PKD A;  5CDE A;  2BHD A;  3MR1 A;  2MAT A;  3TB5 A;  2V6C A;  2EVO A;  2EA4 A;  1KP0 A;  1YW8 A;  5JFR A;  1C27 A;  2BN7 A;  2HOW A;  5CDV A;  2Q96 A;  3IU9 A;  2B3K A;  4FLL A;  5D6E A;  3IG4 A;  4R60 A;  4B28 A;  1WKM A;  2DFI A;  2GG8 A;  2Q95 A;  4PNC A;  3PKE A;  1R5H A;  2GU6 A;  4IKT A;  2GGB A;  3QOC A;  2EA2 A;  5CDL A;  3IU7 A;  2GG5 A;  2GU4 A;  1BOA A;  4ZWU A;  3PN9 A;  3BIP A;  1C21 A;  5FCH A;  1WLR A;  4FO7 A;  4OOK A;  2BWS A;  2ZSG A;  3FMQ A;  1WY2 A;  1WBQ A;  2OKN A;  1KQ9 A;  2P98 A;  2P9A A;  2GA2 A;  2IW2 A;  3MAT A;  2BWT A;  3PKA A;  4FKC A;  4QR8 A;  4FLI A;  1W2M A;  3CB5 A;  4U71 A;  2BWX A;  2G6P A;  1QXY A;  4U70 A;  2NQ7 A;  2NQ6 A;  2Q94 A;  4U69 A;  1C22 A;  4FLK A;  4HXX A;  3FM3 A;  2Q92 A;  1QXZ A;  1O0X A;  4ZWP A;  3L7G A;  1N51 A;  1QZY A;  2BWV A;  3L24 A;  4JUQ A;  4RZY A;  5JI6 A;  4KM3 A;  1YJ3 A;  2ADU A;  4FO8 A;  4S2R P;  4IDY A;  3OOO A;  4IEC A;  2Q8K A;  4ZWO A;  1A16 A;  1W7V A;  1C24 A;  2OAZ A;  4S2T P;  2GZ5 A;  3PKB A;  4FUK A;  1YW7 A;  4U6C A;  1M35 A;  2BWW A;  2V3Z A;  2GG9 A;  1XGO A;  1KQ0 A;  3CTZ A;  2B3H A;  4IF7 A;  3D27 A;  3CB6 A;  5CE6 A;  4U6E A;  2V3X A;  1XGS A;  5E2C A;  4RZZ A;  4S01 A;  3PEB A;  1R58 A;  2GG7 A;  2BHC A;  1C23 A;  1PV9 A;  2BH3 A;  2GU5 A;  3BIQ A;  3I7M A;  1YW9 A;  4U73 A;  4IKR A;  3O5V A;  1Y1N A;  3FMR A;  3ROR A;  4EGE A;  3Q6D A;  2BHB A;  5FCF A;  4IKS A;  1BN5 A;  4MAT A;  4S00 A;  5CIK A;  4IKU A;  5E5B A;  2V3Y A;  2GGC A;  5D6F A;  3TAV A;  4U76 A;  2Q93 A;  2BWU A;  2GG0 A;  4U1B A;  4U6Z A;  1WL9 A;  3PKC A;  4U6J A;  1B6A A;  2B3L A;  4PV4 A;  3IU8 A;  3S6B A;  2GG3 A;  4IPA A;  1WL6 A;  1CHM A;  4A6V A;  2EVC A;  1YVM A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...