1A16A

Aminopeptidase p from e. coli with the inhibitor pro-leu
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSLEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule keywords AMINOPEPTIDASE P
molecule tags Hydrolase/hydrolase inhibitor
total genus 152
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1a16A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1a16A02
3OVKA 4FLKA 1WN1A 4U6EA 4RZYA 1QXYA 4U76A 1YW9A 2BWTA 4S00A 4ZWOA 4IPAA 4U71A 2B3LA 1WBQA 2BH3A 3TB5A 3S6BA 4U6ZA 4IKSA 1R5GA 1YW8A 4FLIA 3O5VA 2MATA 2BHAA 3QOCA 4S2TP 1KQ0A 2ADUA 4U75A 4B28A 3OOOA 1B59A 1W7VA 1PV9A 4IU6A 2BWUA 2G6PA 3FMQA 4IDYA 3TAVA 2DFIA 4FLJA 4U69A 3IL0A 5D6FA 4ZWPA 3PEBA 4OOKA 4FO8A 1W2MA 1C27A 1QXWA 5CE6A 2EA4A 2GG9A 3CB5A 2BWXA 3PN9A 5CDLA 1MATA 2GG8A 2P9AA 3BIQA 1KQ9A 5JFRA 2GA2A 1C21A 5CDEA 3PKCA 1N51A 4MATA 1QZYA 5FCFA 3FM3A 3IU7A 1YVMA 4S2RP 3PKAA 5FCHA 1WL6A 2BB7A 3FMRA 4RZZA 1XGOA 3CTZA 3RORA 5CNXA 2EA2A 2Q92A 1O0XA 2EVOA 2BWVA 2GU7A 1Y1NA 2GG0A 4JUQA 2B3KA 1YJ3A 3MX6A 2HOWA 3BITA 3RVAA 2V3ZA 5JHUA 1R58A 4S01A 3D27A 2BWSA 2BHCA 3CB6A 2GTXA 2BHBA 4Z7MA 3IU8A 2EVMA 2NQ6A 2V3XA 2BWYA 4ZNGA 1QXZA 4QR8A 2OAZA 5CDVA 2P98A 4FUKA 2GZ5A 3IU9A 4IKTA 1BN5A 4A6VA 5JI6A 2GGCA 2Q94A 4FLLA 1XGNA 4IECA 2GGBA 4FKCA 2BN7A 1WY2A 2GG7A 1WLRA 5D6EA 1A16A 2ZSGA 4ZWUA 1BOAA 1R5HA 2Q96A 4U1BA 4PV4A 2Q93A 2BWWA 1B6AA 2IW2A 4EGEA 3MATA 1WL9A 5E5BA 3BIPA 4IKUA 4RGZ1 3PKBA 2V3YA 1XGMA 3PKDA 4A6WA 1JAWA 1C24A 4IF7A 3L7GA 2EVCA 1M35A 2Q95A 4R60A 1KP0A 2P99A 2BHDA 2GU4A 3IG4A 1CHMA 3PKEA 1WKMA 3Q6DA 4HXXA 5CIKA 2NQ7A 4FO7A 4U6CA 2OKNA 2GU6A 4U73A 4U6WA 2GG3A 4PNCA 4U6JA 1C23A 4U70A 2Q8KA 3L24A 1XGSA 5E2CA 1XNZA 2B3HA 2GG2A 4IKRA 4KM3A 2GU5A 2GG5A 5CLSA 1C22A 3I7MA 1YW7A 2V6CA 3MR1A
chains in the Genus database with same CATH superfamily
3OVKA 4FLKA 1WN1A 4U6EA 4RZYA 1QXYA 4U76A 1YW9A 2BWTA 4S00A 4ZWOA 4IPAA 4U71A 2B3LA 1WBQA 2BH3A 3TB5A 3S6BA 4U6ZA 4IKSA 1R5GA 1YW8A 4FLIA 3O5VA 2MATA 2BHAA 3QOCA 4S2TP 1KQ0A 2ADUA 4U75A 4B28A 3OOOA 1B59A 1W7VA 1PV9A 4IU6A 2BWUA 2G6PA 3FMQA 4IDYA 3TAVA 2DFIA 4FLJA 4U69A 3IL0A 5D6FA 4ZWPA 3PEBA 4OOKA 4FO8A 1W2MA 1C27A 1QXWA 5CE6A 2EA4A 2GG9A 3CB5A 2BWXA 3PN9A 5CDLA 1MATA 2GG8A 2P9AA 3BIQA 1KQ9A 5JFRA 2GA2A 1C21A 5CDEA 3PKCA 1N51A 4MATA 1QZYA 5FCFA 3FM3A 3IU7A 1YVMA 4S2RP 3PKAA 5FCHA 1WL6A 2BB7A 3FMRA 4RZZA 1XGOA 3CTZA 3RORA 5CNXA 2EA2A 2Q92A 1O0XA 2EVOA 2BWVA 2GU7A 1Y1NA 2GG0A 4JUQA 2B3KA 1YJ3A 3MX6A 2HOWA 3BITA 3RVAA 2V3ZA 5JHUA 1R58A 4S01A 3D27A 2BWSA 2BHCA 3CB6A 2GTXA 2BHBA 4Z7MA 3IU8A 2EVMA 2NQ6A 2V3XA 2BWYA 4ZNGA 1QXZA 4QR8A 2OAZA 5CDVA 2P98A 4FUKA 2GZ5A 3IU9A 4IKTA 1BN5A 4A6VA 5JI6A 2GGCA 2Q94A 4FLLA 1XGNA 4IECA 2GGBA 4FKCA 2BN7A 1WY2A 2GG7A 1WLRA 5D6EA 1A16A 2ZSGA 4ZWUA 1BOAA 1R5HA 2Q96A 4U1BA 4PV4A 2Q93A 2BWWA 1B6AA 2IW2A 4EGEA 3MATA 1WL9A 5E5BA 3BIPA 4IKUA 4RGZ1 3PKBA 2V3YA 1XGMA 3PKDA 4A6WA 1JAWA 1C24A 4IF7A 3L7GA 2EVCA 1M35A 2Q95A 4R60A 1KP0A 2P99A 2BHDA 2GU4A 3IG4A 1CHMA 3PKEA 1WKMA 3Q6DA 4HXXA 5CIKA 2NQ7A 4FO7A 4U6CA 2OKNA 2GU6A 4U73A 4U6WA 2GG3A 4PNCA 4U6JA 1C23A 4U70A 2Q8KA 3L24A 1XGSA 5E2CA 1XNZA 2B3HA 2GG2A 4IKRA 4KM3A 2GU5A 2GG5A 5CLSA 1C22A 3I7MA 1YW7A 2V6CA 3MR1A
chains in the Genus database with same CATH topology
3OVKA 4FLKA 1WN1A 4U6EA 4RZYA 1QXYA 4U76A 1YW9A 2BWTA 4S00A 4ZWOA 4IPAA 4U71A 2B3LA 1WBQA 2BH3A 3TB5A 3S6BA 4U6ZA 4IKSA 1R5GA 1YW8A 4FLIA 3O5VA 2MATA 2BHAA 3QOCA 4S2TP 1KQ0A 2ADUA 4U75A 4B28A 3OOOA 1B59A 1W7VA 1PV9A 4IU6A 2BWUA 2G6PA 3FMQA 4IDYA 3TAVA 2DFIA 4FLJA 4U69A 3IL0A 5D6FA 4ZWPA 3PEBA 4OOKA 4FO8A 1W2MA 1C27A 1QXWA 5CE6A 2EA4A 2GG9A 3CB5A 2BWXA 3PN9A 5CDLA 1MATA 2GG8A 2P9AA 3BIQA 1KQ9A 5JFRA 2GA2A 1C21A 5CDEA 3PKCA 1N51A 4MATA 1QZYA 5FCFA 3FM3A 3IU7A 1YVMA 4S2RP 3PKAA 5FCHA 1WL6A 2BB7A 3FMRA 4RZZA 1XGOA 3CTZA 3RORA 5CNXA 2EA2A 2Q92A 1O0XA 2EVOA 2BWVA 2GU7A 1Y1NA 2GG0A 4JUQA 2B3KA 1YJ3A 3MX6A 2HOWA 3BITA 3RVAA 2V3ZA 5JHUA 1R58A 4S01A 3D27A 2BWSA 2BHCA 3CB6A 2GTXA 2BHBA 4Z7MA 3IU8A 2EVMA 2NQ6A 2V3XA 2BWYA 4ZNGA 1QXZA 4QR8A 2OAZA 5CDVA 2P98A 4FUKA 2GZ5A 3IU9A 4IKTA 1BN5A 4A6VA 5JI6A 2GGCA 2Q94A 4FLLA 1XGNA 4IECA 2GGBA 4FKCA 2BN7A 1WY2A 2GG7A 1WLRA 5D6EA 1A16A 2ZSGA 4ZWUA 1BOAA 1R5HA 2Q96A 4U1BA 4PV4A 2Q93A 2BWWA 1B6AA 2IW2A 4EGEA 3MATA 1WL9A 5E5BA 3BIPA 4IKUA 4RGZ1 3PKBA 2V3YA 1XGMA 3PKDA 4A6WA 1JAWA 1C24A 4IF7A 3L7GA 2EVCA 1M35A 2Q95A 4R60A 1KP0A 2P99A 2BHDA 2GU4A 3IG4A 1CHMA 3PKEA 1WKMA 3Q6DA 4HXXA 5CIKA 2NQ7A 4FO7A 4U6CA 2OKNA 2GU6A 4U73A 4U6WA 2GG3A 4PNCA 4U6JA 1C23A 4U70A 2Q8KA 3L24A 1XGSA 5E2CA 1XNZA 2B3HA 2GG2A 4IKRA 4KM3A 2GU5A 2GG5A 5CLSA 1C22A 3I7MA 1YW7A 2V6CA 3MR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVK A;  4FLK A;  1WN1 A;  4U6E A;  4RZY A;  1QXY A;  4U76 A;  1YW9 A;  2BWT A;  4S00 A;  4ZWO A;  4IPA A;  4U71 A;  2B3L A;  1WBQ A;  2BH3 A;  3TB5 A;  3S6B A;  4U6Z A;  4IKS A;  1R5G A;  1YW8 A;  4FLI A;  3O5V A;  2MAT A;  2BHA A;  3QOC A;  4S2T P;  1KQ0 A;  2ADU A;  4U75 A;  4B28 A;  3OOO A;  1B59 A;  1W7V A;  1PV9 A;  4IU6 A;  2BWU A;  2G6P A;  3FMQ A;  4IDY A;  3TAV A;  2DFI A;  4FLJ A;  4U69 A;  3IL0 A;  5D6F A;  4ZWP A;  3PEB A;  4OOK A;  4FO8 A;  1W2M A;  1C27 A;  1QXW A;  5CE6 A;  2EA4 A;  2GG9 A;  3CB5 A;  2BWX A;  3PN9 A;  5CDL A;  1MAT A;  2GG8 A;  2P9A A;  3BIQ A;  1KQ9 A;  5JFR A;  2GA2 A;  1C21 A;  5CDE A;  3PKC A;  1N51 A;  4MAT A;  1QZY A;  5FCF A;  3FM3 A;  3IU7 A;  1YVM A;  4S2R P;  3PKA A;  5FCH A;  1WL6 A;  2BB7 A;  3FMR A;  4RZZ A;  1XGO A;  3CTZ A;  3ROR A;  5CNX A;  2EA2 A;  2Q92 A;  1O0X A;  2EVO A;  2BWV A;  2GU7 A;  1Y1N A;  2GG0 A;  4JUQ A;  2B3K A;  1YJ3 A;  3MX6 A;  2HOW A;  3BIT A;  3RVA A;  2V3Z A;  5JHU A;  1R58 A;  4S01 A;  3D27 A;  2BWS A;  2BHC A;  3CB6 A;  2GTX A;  2BHB A;  4Z7M A;  3IU8 A;  2EVM A;  2NQ6 A;  2V3X A;  2BWY A;  4ZNG A;  1QXZ A;  4QR8 A;  2OAZ A;  5CDV A;  2P98 A;  4FUK A;  2GZ5 A;  3IU9 A;  4IKT A;  1BN5 A;  4A6V A;  5JI6 A;  2GGC A;  2Q94 A;  4FLL A;  1XGN A;  4IEC A;  2GGB A;  4FKC A;  2BN7 A;  1WY2 A;  2GG7 A;  1WLR A;  5D6E A;  1A16 A;  2ZSG A;  4ZWU A;  1BOA A;  1R5H A;  2Q96 A;  4U1B A;  4PV4 A;  2Q93 A;  2BWW A;  1B6A A;  2IW2 A;  4EGE A;  3MAT A;  1WL9 A;  5E5B A;  3BIP A;  4IKU A;  4RGZ 1;  3PKB A;  2V3Y A;  1XGM A;  3PKD A;  4A6W A;  1JAW A;  1C24 A;  4IF7 A;  3L7G A;  2EVC A;  1M35 A;  2Q95 A;  4R60 A;  1KP0 A;  2P99 A;  2BHD A;  2GU4 A;  3IG4 A;  1CHM A;  3PKE A;  1WKM A;  3Q6D A;  4HXX A;  5CIK A;  2NQ7 A;  4FO7 A;  4U6C A;  2OKN A;  2GU6 A;  4U73 A;  4U6W A;  2GG3 A;  4PNC A;  4U6J A;  1C23 A;  4U70 A;  2Q8K A;  3L24 A;  1XGS A;  5E2C A;  1XNZ A;  2B3H A;  2GG2 A;  4IKR A;  4KM3 A;  2GU5 A;  2GG5 A;  5CLS A;  1C22 A;  3I7M A;  1YW7 A;  2V6C A;  3MR1 A; 
#chains in the Genus database with same CATH topology
 3OVK A;  4FLK A;  1WN1 A;  4U6E A;  4RZY A;  1QXY A;  4U76 A;  1YW9 A;  2BWT A;  4S00 A;  4ZWO A;  4IPA A;  4U71 A;  2B3L A;  1WBQ A;  2BH3 A;  3TB5 A;  3S6B A;  4U6Z A;  4IKS A;  1R5G A;  1YW8 A;  4FLI A;  3O5V A;  2MAT A;  2BHA A;  3QOC A;  4S2T P;  1KQ0 A;  2ADU A;  4U75 A;  4B28 A;  3OOO A;  1B59 A;  1W7V A;  1PV9 A;  4IU6 A;  2BWU A;  2G6P A;  3FMQ A;  4IDY A;  3TAV A;  2DFI A;  4FLJ A;  4U69 A;  3IL0 A;  5D6F A;  4ZWP A;  3PEB A;  4OOK A;  4FO8 A;  1W2M A;  1C27 A;  1QXW A;  5CE6 A;  2EA4 A;  2GG9 A;  3CB5 A;  2BWX A;  3PN9 A;  5CDL A;  1MAT A;  2GG8 A;  2P9A A;  3BIQ A;  1KQ9 A;  5JFR A;  2GA2 A;  1C21 A;  5CDE A;  3PKC A;  1N51 A;  4MAT A;  1QZY A;  5FCF A;  3FM3 A;  3IU7 A;  1YVM A;  4S2R P;  3PKA A;  5FCH A;  1WL6 A;  2BB7 A;  3FMR A;  4RZZ A;  1XGO A;  3CTZ A;  3ROR A;  5CNX A;  2EA2 A;  2Q92 A;  1O0X A;  2EVO A;  2BWV A;  2GU7 A;  1Y1N A;  2GG0 A;  4JUQ A;  2B3K A;  1YJ3 A;  3MX6 A;  2HOW A;  3BIT A;  3RVA A;  2V3Z A;  5JHU A;  1R58 A;  4S01 A;  3D27 A;  2BWS A;  2BHC A;  3CB6 A;  2GTX A;  2BHB A;  4Z7M A;  3IU8 A;  2EVM A;  2NQ6 A;  2V3X A;  2BWY A;  4ZNG A;  1QXZ A;  4QR8 A;  2OAZ A;  5CDV A;  2P98 A;  4FUK A;  2GZ5 A;  3IU9 A;  4IKT A;  1BN5 A;  4A6V A;  5JI6 A;  2GGC A;  2Q94 A;  4FLL A;  1XGN A;  4IEC A;  2GGB A;  4FKC A;  2BN7 A;  1WY2 A;  2GG7 A;  1WLR A;  5D6E A;  1A16 A;  2ZSG A;  4ZWU A;  1BOA A;  1R5H A;  2Q96 A;  4U1B A;  4PV4 A;  2Q93 A;  2BWW A;  1B6A A;  2IW2 A;  4EGE A;  3MAT A;  1WL9 A;  5E5B A;  3BIP A;  4IKU A;  4RGZ 1;  3PKB A;  2V3Y A;  1XGM A;  3PKD A;  4A6W A;  1JAW A;  1C24 A;  4IF7 A;  3L7G A;  2EVC A;  1M35 A;  2Q95 A;  4R60 A;  1KP0 A;  2P99 A;  2BHD A;  2GU4 A;  3IG4 A;  1CHM A;  3PKE A;  1WKM A;  3Q6D A;  4HXX A;  5CIK A;  2NQ7 A;  4FO7 A;  4U6C A;  2OKN A;  2GU6 A;  4U73 A;  4U6W A;  2GG3 A;  4PNC A;  4U6J A;  1C23 A;  4U70 A;  2Q8K A;  3L24 A;  1XGS A;  5E2C A;  1XNZ A;  2B3H A;  2GG2 A;  4IKR A;  4KM3 A;  2GU5 A;  2GG5 A;  5CLS A;  1C22 A;  3I7M A;  1YW7 A;  2V6C A;  3MR1 A; 
#chains in the Genus database with same CATH homology
 3OVK A;  4FLK A;  1WN1 A;  4U6E A;  4RZY A;  1QXY A;  4U76 A;  1YW9 A;  2BWT A;  4S00 A;  4ZWO A;  4IPA A;  4U71 A;  2B3L A;  1WBQ A;  2BH3 A;  3TB5 A;  3S6B A;  4U6Z A;  4IKS A;  1R5G A;  1YW8 A;  4FLI A;  3O5V A;  2MAT A;  2BHA A;  3QOC A;  4S2T P;  1KQ0 A;  2ADU A;  4U75 A;  4B28 A;  3OOO A;  1B59 A;  1W7V A;  1PV9 A;  4IU6 A;  2BWU A;  2G6P A;  3FMQ A;  4IDY A;  3TAV A;  2DFI A;  4FLJ A;  4U69 A;  3IL0 A;  5D6F A;  4ZWP A;  3PEB A;  4OOK A;  4FO8 A;  1W2M A;  1C27 A;  1QXW A;  5CE6 A;  2EA4 A;  2GG9 A;  3CB5 A;  2BWX A;  3PN9 A;  5CDL A;  1MAT A;  2GG8 A;  2P9A A;  3BIQ A;  1KQ9 A;  5JFR A;  2GA2 A;  1C21 A;  5CDE A;  3PKC A;  1N51 A;  4MAT A;  1QZY A;  5FCF A;  3FM3 A;  3IU7 A;  1YVM A;  4S2R P;  3PKA A;  5FCH A;  1WL6 A;  2BB7 A;  3FMR A;  4RZZ A;  1XGO A;  3CTZ A;  3ROR A;  5CNX A;  2EA2 A;  2Q92 A;  1O0X A;  2EVO A;  2BWV A;  2GU7 A;  1Y1N A;  2GG0 A;  4JUQ A;  2B3K A;  1YJ3 A;  3MX6 A;  2HOW A;  3BIT A;  3RVA A;  2V3Z A;  5JHU A;  1R58 A;  4S01 A;  3D27 A;  2BWS A;  2BHC A;  3CB6 A;  2GTX A;  2BHB A;  4Z7M A;  3IU8 A;  2EVM A;  2NQ6 A;  2V3X A;  2BWY A;  4ZNG A;  1QXZ A;  4QR8 A;  2OAZ A;  5CDV A;  2P98 A;  4FUK A;  2GZ5 A;  3IU9 A;  4IKT A;  1BN5 A;  4A6V A;  5JI6 A;  2GGC A;  2Q94 A;  4FLL A;  1XGN A;  4IEC A;  2GGB A;  4FKC A;  2BN7 A;  1WY2 A;  2GG7 A;  1WLR A;  5D6E A;  1A16 A;  2ZSG A;  4ZWU A;  1BOA A;  1R5H A;  2Q96 A;  4U1B A;  4PV4 A;  2Q93 A;  2BWW A;  1B6A A;  2IW2 A;  4EGE A;  3MAT A;  1WL9 A;  5E5B A;  3BIP A;  4IKU A;  4RGZ 1;  3PKB A;  2V3Y A;  1XGM A;  3PKD A;  4A6W A;  1JAW A;  1C24 A;  4IF7 A;  3L7G A;  2EVC A;  1M35 A;  2Q95 A;  4R60 A;  1KP0 A;  2P99 A;  2BHD A;  2GU4 A;  3IG4 A;  1CHM A;  3PKE A;  1WKM A;  3Q6D A;  4HXX A;  5CIK A;  2NQ7 A;  4FO7 A;  4U6C A;  2OKN A;  2GU6 A;  4U73 A;  4U6W A;  2GG3 A;  4PNC A;  4U6J A;  1C23 A;  4U70 A;  2Q8K A;  3L24 A;  1XGS A;  5E2C A;  1XNZ A;  2B3H A;  2GG2 A;  4IKR A;  4KM3 A;  2GU5 A;  2GG5 A;  5CLS A;  1C22 A;  3I7M A;  1YW7 A;  2V6C A;  3MR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...