1A16A

Aminopeptidase p from e. coli with the inhibitor pro-leu
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSLEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a proline-specific aminopeptidase from Escherichia coli.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords AMINOPEPTIDASE P
total genus 152
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1a16A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1a16A02
1A16A 5JFRA 2EVCA 5JI6A 4EGEA 1WL9A 2V6CA 2Q95A 3PN9A 4S2RP 4FO8A 4PV4A 2BWUA 5CDVA 2P98A 5D6EA 4U69A 4U71A 3FM3A 3PKBA 3OOOA 3TAVA 2NQ6A 4FLJA 2BWXA 1YW7A 2Q94A 4IECA 2BB7A 3I7MA 5JHUA 3Q6DA 1C21A 1YJ3A 5E5BA 4RZYA 2GG7A 4IPAA 5CE6A 2BH3A 1R5HA 2GU5A 4JUQA 2BWSA 4U6EA 1XNZA 4U1BA 3O5VA 1Y1NA 3PKCA 4FUKA 2GGBA 1M35A 4FLIA 4U6ZA 2GU7A 1B6AA 4HXXA 2GG3A 1XGMA 2Q96A 4IKSA 4KM3A 3L24A 2BHAA 1KQ9A 1WKMA 3D27A 5FCHA 3FMRA 2GU6A 4IKUA 3BIQA 2BWTA 1C22A 1C23A 1R5GA 4U76A 3RORA 4FO7A 2V3ZA 2Q8KA 4FLLA 4IU6A 4QR8A 4PNCA 2V3YA 4RGZ1 3RVAA 1WL6A 1WY2A 1XGSA 2G6PA 1YW8A 3IL0A 3QOCA 2P99A 4U70A 2BWYA 4R60A 2GG2A 2ZSGA 2EA2A 5CNXA 1KQ0A 4A6WA 2GG0A 3BITA 2BHCA 1MATA 1QXWA 4U6WA 2GU4A 3IG4A 2ADUA 1YVMA 1WBQA 2BWWA 2B3HA 2BHBA 2GZ5A 5CDLA 1O0XA 1N51A 3CB6A 4A6VA 1BN5A 2GA2A 4IKTA 3L7GA 2EA4A 5E2CA 3BIPA 1WLRA 2B3KA 4MATA 1C27A 2BWVA 2OKNA 4ZWUA 2EVOA 3IU8A 4S2TP 1R58A 3TB5A 2B3LA 4U6CA 3MX6A 3CTZA 4B28A 1QXYA 1YW9A 4OOKA 2BN7A 2GG5A 3IU9A 5FCFA 1CHMA 5D6FA 2Q92A 4U73A 1W7VA 1C24A 2GG9A 1WN1A 4FLKA 3PKAA 2V3XA 3MATA 4S01A 1QZYA 3OVKA 2MATA 3IU7A 2NQ7A 1B59A 4U75A 3S6BA 2OAZA 3PEBA 3PKDA 2DFIA 1XGNA 2GGCA 1KP0A 2GTXA 2IW2A 5CLSA 4IF7A 3PKEA 1JAWA 1PV9A 5CIKA 4IDYA 4FKCA 1W2MA 2Q93A 2HOWA 3MR1A 4ZNGA 1QXZA 4ZWOA 2P9AA 2GG8A 1BOAA 2BHDA 4Z7MA 4S00A 4ZWPA 4U6JA 1XGOA 3CB5A 4IKRA 3FMQA 2EVMA 4RZZA 5CDEA
chains in the Genus database with same CATH superfamily
1A16A 5JFRA 2EVCA 5JI6A 4EGEA 1WL9A 2V6CA 2Q95A 3PN9A 4S2RP 4FO8A 4PV4A 2BWUA 5CDVA 2P98A 5D6EA 4U69A 4U71A 3FM3A 3PKBA 3OOOA 3TAVA 2NQ6A 4FLJA 2BWXA 1YW7A 2Q94A 4IECA 2BB7A 3I7MA 5JHUA 3Q6DA 1C21A 1YJ3A 5E5BA 4RZYA 2GG7A 4IPAA 5CE6A 2BH3A 1R5HA 2GU5A 4JUQA 2BWSA 4U6EA 1XNZA 4U1BA 3O5VA 1Y1NA 3PKCA 4FUKA 2GGBA 1M35A 4FLIA 4U6ZA 2GU7A 1B6AA 4HXXA 2GG3A 1XGMA 2Q96A 4IKSA 4KM3A 3L24A 2BHAA 1KQ9A 1WKMA 3D27A 5FCHA 3FMRA 2GU6A 4IKUA 3BIQA 2BWTA 1C22A 1C23A 1R5GA 4U76A 3RORA 4FO7A 2V3ZA 2Q8KA 4FLLA 4IU6A 4QR8A 4PNCA 2V3YA 4RGZ1 3RVAA 1WL6A 1WY2A 1XGSA 2G6PA 1YW8A 3IL0A 3QOCA 2P99A 4U70A 2BWYA 4R60A 2GG2A 2ZSGA 2EA2A 5CNXA 1KQ0A 4A6WA 2GG0A 3BITA 2BHCA 1MATA 1QXWA 4U6WA 2GU4A 3IG4A 2ADUA 1YVMA 1WBQA 2BWWA 2B3HA 2BHBA 2GZ5A 5CDLA 1O0XA 1N51A 3CB6A 4A6VA 1BN5A 2GA2A 4IKTA 3L7GA 2EA4A 5E2CA 3BIPA 1WLRA 2B3KA 4MATA 1C27A 2BWVA 2OKNA 4ZWUA 2EVOA 3IU8A 4S2TP 1R58A 3TB5A 2B3LA 4U6CA 3MX6A 3CTZA 4B28A 1QXYA 1YW9A 4OOKA 2BN7A 2GG5A 3IU9A 5FCFA 1CHMA 5D6FA 2Q92A 4U73A 1W7VA 1C24A 2GG9A 1WN1A 4FLKA 3PKAA 2V3XA 3MATA 4S01A 1QZYA 3OVKA 2MATA 3IU7A 2NQ7A 1B59A 4U75A 3S6BA 2OAZA 3PEBA 3PKDA 2DFIA 1XGNA 2GGCA 1KP0A 2GTXA 2IW2A 5CLSA 4IF7A 3PKEA 1JAWA 1PV9A 5CIKA 4IDYA 4FKCA 1W2MA 2Q93A 2HOWA 3MR1A 4ZNGA 1QXZA 4ZWOA 2P9AA 2GG8A 1BOAA 2BHDA 4Z7MA 4S00A 4ZWPA 4U6JA 1XGOA 3CB5A 4IKRA 3FMQA 2EVMA 4RZZA 5CDEA
chains in the Genus database with same CATH topology
1A16A 5JFRA 2EVCA 5JI6A 4EGEA 1WL9A 2V6CA 2Q95A 3PN9A 4S2RP 4FO8A 4PV4A 2BWUA 5CDVA 2P98A 5D6EA 4U69A 4U71A 3FM3A 3PKBA 3OOOA 3TAVA 2NQ6A 4FLJA 2BWXA 1YW7A 2Q94A 4IECA 2BB7A 3I7MA 5JHUA 3Q6DA 1C21A 1YJ3A 5E5BA 4RZYA 2GG7A 4IPAA 5CE6A 2BH3A 1R5HA 2GU5A 4JUQA 2BWSA 4U6EA 1XNZA 4U1BA 3O5VA 1Y1NA 3PKCA 4FUKA 2GGBA 1M35A 4FLIA 4U6ZA 2GU7A 1B6AA 4HXXA 2GG3A 1XGMA 2Q96A 4IKSA 4KM3A 3L24A 2BHAA 1KQ9A 1WKMA 3D27A 5FCHA 3FMRA 2GU6A 4IKUA 3BIQA 2BWTA 1C22A 1C23A 1R5GA 4U76A 3RORA 4FO7A 2V3ZA 2Q8KA 4FLLA 4IU6A 4QR8A 4PNCA 2V3YA 4RGZ1 3RVAA 1WL6A 1WY2A 1XGSA 2G6PA 1YW8A 3IL0A 3QOCA 2P99A 4U70A 2BWYA 4R60A 2GG2A 2ZSGA 2EA2A 5CNXA 1KQ0A 4A6WA 2GG0A 3BITA 2BHCA 1MATA 1QXWA 4U6WA 2GU4A 3IG4A 2ADUA 1YVMA 1WBQA 2BWWA 2B3HA 2BHBA 2GZ5A 5CDLA 1O0XA 1N51A 3CB6A 4A6VA 1BN5A 2GA2A 4IKTA 3L7GA 2EA4A 5E2CA 3BIPA 1WLRA 2B3KA 4MATA 1C27A 2BWVA 2OKNA 4ZWUA 2EVOA 3IU8A 4S2TP 1R58A 3TB5A 2B3LA 4U6CA 3MX6A 3CTZA 4B28A 1QXYA 1YW9A 4OOKA 2BN7A 2GG5A 3IU9A 5FCFA 1CHMA 5D6FA 2Q92A 4U73A 1W7VA 1C24A 2GG9A 1WN1A 4FLKA 3PKAA 2V3XA 3MATA 4S01A 1QZYA 3OVKA 2MATA 3IU7A 2NQ7A 1B59A 4U75A 3S6BA 2OAZA 3PEBA 3PKDA 2DFIA 1XGNA 2GGCA 1KP0A 2GTXA 2IW2A 5CLSA 4IF7A 3PKEA 1JAWA 1PV9A 5CIKA 4IDYA 4FKCA 1W2MA 2Q93A 2HOWA 3MR1A 4ZNGA 1QXZA 4ZWOA 2P9AA 2GG8A 1BOAA 2BHDA 4Z7MA 4S00A 4ZWPA 4U6JA 1XGOA 3CB5A 4IKRA 3FMQA 2EVMA 4RZZA 5CDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A16 A;  5JFR A;  2EVC A;  5JI6 A;  4EGE A;  1WL9 A;  2V6C A;  2Q95 A;  3PN9 A;  4S2R P;  4FO8 A;  4PV4 A;  2BWU A;  5CDV A;  2P98 A;  5D6E A;  4U69 A;  4U71 A;  3FM3 A;  3PKB A;  3OOO A;  3TAV A;  2NQ6 A;  4FLJ A;  2BWX A;  1YW7 A;  2Q94 A;  4IEC A;  2BB7 A;  3I7M A;  5JHU A;  3Q6D A;  1C21 A;  1YJ3 A;  5E5B A;  4RZY A;  2GG7 A;  4IPA A;  5CE6 A;  2BH3 A;  1R5H A;  2GU5 A;  4JUQ A;  2BWS A;  4U6E A;  1XNZ A;  4U1B A;  3O5V A;  1Y1N A;  3PKC A;  4FUK A;  2GGB A;  1M35 A;  4FLI A;  4U6Z A;  2GU7 A;  1B6A A;  4HXX A;  2GG3 A;  1XGM A;  2Q96 A;  4IKS A;  4KM3 A;  3L24 A;  2BHA A;  1KQ9 A;  1WKM A;  3D27 A;  5FCH A;  3FMR A;  2GU6 A;  4IKU A;  3BIQ A;  2BWT A;  1C22 A;  1C23 A;  1R5G A;  4U76 A;  3ROR A;  4FO7 A;  2V3Z A;  2Q8K A;  4FLL A;  4IU6 A;  4QR8 A;  4PNC A;  2V3Y A;  4RGZ 1;  3RVA A;  1WL6 A;  1WY2 A;  1XGS A;  2G6P A;  1YW8 A;  3IL0 A;  3QOC A;  2P99 A;  4U70 A;  2BWY A;  4R60 A;  2GG2 A;  2ZSG A;  2EA2 A;  5CNX A;  1KQ0 A;  4A6W A;  2GG0 A;  3BIT A;  2BHC A;  1MAT A;  1QXW A;  4U6W A;  2GU4 A;  3IG4 A;  2ADU A;  1YVM A;  1WBQ A;  2BWW A;  2B3H A;  2BHB A;  2GZ5 A;  5CDL A;  1O0X A;  1N51 A;  3CB6 A;  4A6V A;  1BN5 A;  2GA2 A;  4IKT A;  3L7G A;  2EA4 A;  5E2C A;  3BIP A;  1WLR A;  2B3K A;  4MAT A;  1C27 A;  2BWV A;  2OKN A;  4ZWU A;  2EVO A;  3IU8 A;  4S2T P;  1R58 A;  3TB5 A;  2B3L A;  4U6C A;  3MX6 A;  3CTZ A;  4B28 A;  1QXY A;  1YW9 A;  4OOK A;  2BN7 A;  2GG5 A;  3IU9 A;  5FCF A;  1CHM A;  5D6F A;  2Q92 A;  4U73 A;  1W7V A;  1C24 A;  2GG9 A;  1WN1 A;  4FLK A;  3PKA A;  2V3X A;  3MAT A;  4S01 A;  1QZY A;  3OVK A;  2MAT A;  3IU7 A;  2NQ7 A;  1B59 A;  4U75 A;  3S6B A;  2OAZ A;  3PEB A;  3PKD A;  2DFI A;  1XGN A;  2GGC A;  1KP0 A;  2GTX A;  2IW2 A;  5CLS A;  4IF7 A;  3PKE A;  1JAW A;  1PV9 A;  5CIK A;  4IDY A;  4FKC A;  1W2M A;  2Q93 A;  2HOW A;  3MR1 A;  4ZNG A;  1QXZ A;  4ZWO A;  2P9A A;  2GG8 A;  1BOA A;  2BHD A;  4Z7M A;  4S00 A;  4ZWP A;  4U6J A;  1XGO A;  3CB5 A;  4IKR A;  3FMQ A;  2EVM A;  4RZZ A;  5CDE A; 
#chains in the Genus database with same CATH topology
 1A16 A;  5JFR A;  2EVC A;  5JI6 A;  4EGE A;  1WL9 A;  2V6C A;  2Q95 A;  3PN9 A;  4S2R P;  4FO8 A;  4PV4 A;  2BWU A;  5CDV A;  2P98 A;  5D6E A;  4U69 A;  4U71 A;  3FM3 A;  3PKB A;  3OOO A;  3TAV A;  2NQ6 A;  4FLJ A;  2BWX A;  1YW7 A;  2Q94 A;  4IEC A;  2BB7 A;  3I7M A;  5JHU A;  3Q6D A;  1C21 A;  1YJ3 A;  5E5B A;  4RZY A;  2GG7 A;  4IPA A;  5CE6 A;  2BH3 A;  1R5H A;  2GU5 A;  4JUQ A;  2BWS A;  4U6E A;  1XNZ A;  4U1B A;  3O5V A;  1Y1N A;  3PKC A;  4FUK A;  2GGB A;  1M35 A;  4FLI A;  4U6Z A;  2GU7 A;  1B6A A;  4HXX A;  2GG3 A;  1XGM A;  2Q96 A;  4IKS A;  4KM3 A;  3L24 A;  2BHA A;  1KQ9 A;  1WKM A;  3D27 A;  5FCH A;  3FMR A;  2GU6 A;  4IKU A;  3BIQ A;  2BWT A;  1C22 A;  1C23 A;  1R5G A;  4U76 A;  3ROR A;  4FO7 A;  2V3Z A;  2Q8K A;  4FLL A;  4IU6 A;  4QR8 A;  4PNC A;  2V3Y A;  4RGZ 1;  3RVA A;  1WL6 A;  1WY2 A;  1XGS A;  2G6P A;  1YW8 A;  3IL0 A;  3QOC A;  2P99 A;  4U70 A;  2BWY A;  4R60 A;  2GG2 A;  2ZSG A;  2EA2 A;  5CNX A;  1KQ0 A;  4A6W A;  2GG0 A;  3BIT A;  2BHC A;  1MAT A;  1QXW A;  4U6W A;  2GU4 A;  3IG4 A;  2ADU A;  1YVM A;  1WBQ A;  2BWW A;  2B3H A;  2BHB A;  2GZ5 A;  5CDL A;  1O0X A;  1N51 A;  3CB6 A;  4A6V A;  1BN5 A;  2GA2 A;  4IKT A;  3L7G A;  2EA4 A;  5E2C A;  3BIP A;  1WLR A;  2B3K A;  4MAT A;  1C27 A;  2BWV A;  2OKN A;  4ZWU A;  2EVO A;  3IU8 A;  4S2T P;  1R58 A;  3TB5 A;  2B3L A;  4U6C A;  3MX6 A;  3CTZ A;  4B28 A;  1QXY A;  1YW9 A;  4OOK A;  2BN7 A;  2GG5 A;  3IU9 A;  5FCF A;  1CHM A;  5D6F A;  2Q92 A;  4U73 A;  1W7V A;  1C24 A;  2GG9 A;  1WN1 A;  4FLK A;  3PKA A;  2V3X A;  3MAT A;  4S01 A;  1QZY A;  3OVK A;  2MAT A;  3IU7 A;  2NQ7 A;  1B59 A;  4U75 A;  3S6B A;  2OAZ A;  3PEB A;  3PKD A;  2DFI A;  1XGN A;  2GGC A;  1KP0 A;  2GTX A;  2IW2 A;  5CLS A;  4IF7 A;  3PKE A;  1JAW A;  1PV9 A;  5CIK A;  4IDY A;  4FKC A;  1W2M A;  2Q93 A;  2HOW A;  3MR1 A;  4ZNG A;  1QXZ A;  4ZWO A;  2P9A A;  2GG8 A;  1BOA A;  2BHD A;  4Z7M A;  4S00 A;  4ZWP A;  4U6J A;  1XGO A;  3CB5 A;  4IKR A;  3FMQ A;  2EVM A;  4RZZ A;  5CDE A; 
#chains in the Genus database with same CATH homology
 1A16 A;  5JFR A;  2EVC A;  5JI6 A;  4EGE A;  1WL9 A;  2V6C A;  2Q95 A;  3PN9 A;  4S2R P;  4FO8 A;  4PV4 A;  2BWU A;  5CDV A;  2P98 A;  5D6E A;  4U69 A;  4U71 A;  3FM3 A;  3PKB A;  3OOO A;  3TAV A;  2NQ6 A;  4FLJ A;  2BWX A;  1YW7 A;  2Q94 A;  4IEC A;  2BB7 A;  3I7M A;  5JHU A;  3Q6D A;  1C21 A;  1YJ3 A;  5E5B A;  4RZY A;  2GG7 A;  4IPA A;  5CE6 A;  2BH3 A;  1R5H A;  2GU5 A;  4JUQ A;  2BWS A;  4U6E A;  1XNZ A;  4U1B A;  3O5V A;  1Y1N A;  3PKC A;  4FUK A;  2GGB A;  1M35 A;  4FLI A;  4U6Z A;  2GU7 A;  1B6A A;  4HXX A;  2GG3 A;  1XGM A;  2Q96 A;  4IKS A;  4KM3 A;  3L24 A;  2BHA A;  1KQ9 A;  1WKM A;  3D27 A;  5FCH A;  3FMR A;  2GU6 A;  4IKU A;  3BIQ A;  2BWT A;  1C22 A;  1C23 A;  1R5G A;  4U76 A;  3ROR A;  4FO7 A;  2V3Z A;  2Q8K A;  4FLL A;  4IU6 A;  4QR8 A;  4PNC A;  2V3Y A;  4RGZ 1;  3RVA A;  1WL6 A;  1WY2 A;  1XGS A;  2G6P A;  1YW8 A;  3IL0 A;  3QOC A;  2P99 A;  4U70 A;  2BWY A;  4R60 A;  2GG2 A;  2ZSG A;  2EA2 A;  5CNX A;  1KQ0 A;  4A6W A;  2GG0 A;  3BIT A;  2BHC A;  1MAT A;  1QXW A;  4U6W A;  2GU4 A;  3IG4 A;  2ADU A;  1YVM A;  1WBQ A;  2BWW A;  2B3H A;  2BHB A;  2GZ5 A;  5CDL A;  1O0X A;  1N51 A;  3CB6 A;  4A6V A;  1BN5 A;  2GA2 A;  4IKT A;  3L7G A;  2EA4 A;  5E2C A;  3BIP A;  1WLR A;  2B3K A;  4MAT A;  1C27 A;  2BWV A;  2OKN A;  4ZWU A;  2EVO A;  3IU8 A;  4S2T P;  1R58 A;  3TB5 A;  2B3L A;  4U6C A;  3MX6 A;  3CTZ A;  4B28 A;  1QXY A;  1YW9 A;  4OOK A;  2BN7 A;  2GG5 A;  3IU9 A;  5FCF A;  1CHM A;  5D6F A;  2Q92 A;  4U73 A;  1W7V A;  1C24 A;  2GG9 A;  1WN1 A;  4FLK A;  3PKA A;  2V3X A;  3MAT A;  4S01 A;  1QZY A;  3OVK A;  2MAT A;  3IU7 A;  2NQ7 A;  1B59 A;  4U75 A;  3S6B A;  2OAZ A;  3PEB A;  3PKD A;  2DFI A;  1XGN A;  2GGC A;  1KP0 A;  2GTX A;  2IW2 A;  5CLS A;  4IF7 A;  3PKE A;  1JAW A;  1PV9 A;  5CIK A;  4IDY A;  4FKC A;  1W2M A;  2Q93 A;  2HOW A;  3MR1 A;  4ZNG A;  1QXZ A;  4ZWO A;  2P9A A;  2GG8 A;  1BOA A;  2BHD A;  4Z7M A;  4S00 A;  4ZWP A;  4U6J A;  1XGO A;  3CB5 A;  4IKR A;  3FMQ A;  2EVM A;  4RZZ A;  5CDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...