3OVKA

Crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P, Xaa-Pro dipeptidase
publication title Crystal structure of an XXA-pro aminopeptidase from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ovkA00
4B28A 3I7MA 1M35A 5CDEA 1CHMA 4FKCA 3RVAA 4S00A 1W2MA 3QOCA 4ZWOA 1WN1A 5CE6A 5E5BA 4ZWPA 4S2RP 2BWUA 4R60A 5CDVA 3PN9A 2BN7A 4ZNGA 3CB5A 5FCHA 1WLRA 2BHBA 5FCFA 2BWSA 1WY2A 4PV4A 2V3YA 3L24A 2OKNA 4ZWUA 1WBQA 2BH3A 2BHCA 4S2TP 1N51A 3L7GA 2BWTA 4RZYA 2BWXA 4QR8A 4RGZ1 2ZSGA 2IW2A 3Q6DA 2HOWA 3BIPA 1PV9A 5CIKA 3PEBA 3OVKA 3IG4A 2BWYA 2V3ZA 1WL6A 5E2CA 4RZZA 2BWWA 3IL0A 1JAWA 5CNXA 3OOOA 2BWVA 3CB6A 3CTZA 1WL9A 4S01A 3BIQA 1KP0A 4EGEA 5CDLA 1W7VA 2BHAA 3BITA 3O5VA 1A16A 2V3XA 2BHDA
chains in the Genus database with same CATH superfamily
4B28A 3I7MA 1M35A 5CDEA 1CHMA 4FKCA 3RVAA 4S00A 1W2MA 3QOCA 4ZWOA 1WN1A 5CE6A 5E5BA 4ZWPA 4S2RP 2BWUA 4R60A 5CDVA 3PN9A 2BN7A 4ZNGA 3CB5A 5FCHA 1WLRA 2BHBA 5FCFA 2BWSA 1WY2A 4PV4A 2V3YA 3L24A 2OKNA 4ZWUA 1WBQA 2BH3A 2BHCA 4S2TP 1N51A 3L7GA 2BWTA 4RZYA 2BWXA 4QR8A 4RGZ1 2ZSGA 2IW2A 3Q6DA 2HOWA 3BIPA 1PV9A 5CIKA 3PEBA 3OVKA 3IG4A 2BWYA 2V3ZA 1WL6A 5E2CA 4RZZA 2BWWA 3IL0A 1JAWA 5CNXA 3OOOA 2BWVA 3CB6A 3CTZA 1WL9A 4S01A 3BIQA 1KP0A 4EGEA 5CDLA 1W7VA 2BHAA 3BITA 3O5VA 1A16A 2V3XA 2BHDA
chains in the Genus database with same CATH topology
4B28A 3I7MA 1M35A 5CDEA 1CHMA 4FKCA 3RVAA 4S00A 1W2MA 3QOCA 4ZWOA 1WN1A 5CE6A 5E5BA 4ZWPA 4S2RP 2BWUA 4R60A 5CDVA 3PN9A 2BN7A 4ZNGA 3CB5A 5FCHA 1WLRA 2BHBA 5FCFA 2BWSA 1WY2A 4PV4A 2V3YA 3L24A 2OKNA 4ZWUA 1WBQA 2BH3A 2BHCA 4S2TP 1N51A 3L7GA 2BWTA 4RZYA 2BWXA 4QR8A 4RGZ1 2ZSGA 2IW2A 3Q6DA 2HOWA 3BIPA 1PV9A 5CIKA 3PEBA 3OVKA 3IG4A 2BWYA 2V3ZA 1WL6A 5E2CA 4RZZA 2BWWA 3IL0A 1JAWA 5CNXA 3OOOA 2BWVA 3CB6A 3CTZA 1WL9A 4S01A 3BIQA 1KP0A 4EGEA 5CDLA 1W7VA 2BHAA 3BITA 3O5VA 1A16A 2V3XA 2BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B28 A;  3I7M A;  1M35 A;  5CDE A;  1CHM A;  4FKC A;  3RVA A;  4S00 A;  1W2M A;  3QOC A;  4ZWO A;  1WN1 A;  5CE6 A;  5E5B A;  4ZWP A;  4S2R P;  2BWU A;  4R60 A;  5CDV A;  3PN9 A;  2BN7 A;  4ZNG A;  3CB5 A;  5FCH A;  1WLR A;  2BHB A;  5FCF A;  2BWS A;  1WY2 A;  4PV4 A;  2V3Y A;  3L24 A;  2OKN A;  4ZWU A;  1WBQ A;  2BH3 A;  2BHC A;  4S2T P;  1N51 A;  3L7G A;  2BWT A;  4RZY A;  2BWX A;  4QR8 A;  4RGZ 1;  2ZSG A;  2IW2 A;  3Q6D A;  2HOW A;  3BIP A;  1PV9 A;  5CIK A;  3PEB A;  3OVK A;  3IG4 A;  2BWY A;  2V3Z A;  1WL6 A;  5E2C A;  4RZZ A;  2BWW A;  3IL0 A;  1JAW A;  5CNX A;  3OOO A;  2BWV A;  3CB6 A;  3CTZ A;  1WL9 A;  4S01 A;  3BIQ A;  1KP0 A;  4EGE A;  5CDL A;  1W7V A;  2BHA A;  3BIT A;  3O5V A;  1A16 A;  2V3X A;  2BHD A; 
#chains in the Genus database with same CATH topology
 4B28 A;  3I7M A;  1M35 A;  5CDE A;  1CHM A;  4FKC A;  3RVA A;  4S00 A;  1W2M A;  3QOC A;  4ZWO A;  1WN1 A;  5CE6 A;  5E5B A;  4ZWP A;  4S2R P;  2BWU A;  4R60 A;  5CDV A;  3PN9 A;  2BN7 A;  4ZNG A;  3CB5 A;  5FCH A;  1WLR A;  2BHB A;  5FCF A;  2BWS A;  1WY2 A;  4PV4 A;  2V3Y A;  3L24 A;  2OKN A;  4ZWU A;  1WBQ A;  2BH3 A;  2BHC A;  4S2T P;  1N51 A;  3L7G A;  2BWT A;  4RZY A;  2BWX A;  4QR8 A;  4RGZ 1;  2ZSG A;  2IW2 A;  3Q6D A;  2HOW A;  3BIP A;  1PV9 A;  5CIK A;  3PEB A;  3OVK A;  3IG4 A;  2BWY A;  2V3Z A;  1WL6 A;  5E2C A;  4RZZ A;  2BWW A;  3IL0 A;  1JAW A;  5CNX A;  3OOO A;  2BWV A;  3CB6 A;  3CTZ A;  1WL9 A;  4S01 A;  3BIQ A;  1KP0 A;  4EGE A;  5CDL A;  1W7V A;  2BHA A;  3BIT A;  3O5V A;  1A16 A;  2V3X A;  2BHD A; 
#chains in the Genus database with same CATH homology
 4B28 A;  3I7M A;  1M35 A;  5CDE A;  1CHM A;  4FKC A;  3RVA A;  4S00 A;  1W2M A;  3QOC A;  4ZWO A;  1WN1 A;  5CE6 A;  5E5B A;  4ZWP A;  4S2R P;  2BWU A;  4R60 A;  5CDV A;  3PN9 A;  2BN7 A;  4ZNG A;  3CB5 A;  5FCH A;  1WLR A;  2BHB A;  5FCF A;  2BWS A;  1WY2 A;  4PV4 A;  2V3Y A;  3L24 A;  2OKN A;  4ZWU A;  1WBQ A;  2BH3 A;  2BHC A;  4S2T P;  1N51 A;  3L7G A;  2BWT A;  4RZY A;  2BWX A;  4QR8 A;  4RGZ 1;  2ZSG A;  2IW2 A;  3Q6D A;  2HOW A;  3BIP A;  1PV9 A;  5CIK A;  3PEB A;  3OVK A;  3IG4 A;  2BWY A;  2V3Z A;  1WL6 A;  5E2C A;  4RZZ A;  2BWW A;  3IL0 A;  1JAW A;  5CNX A;  3OOO A;  2BWV A;  3CB6 A;  3CTZ A;  1WL9 A;  4S01 A;  3BIQ A;  1KP0 A;  4EGE A;  5CDL A;  1W7V A;  2BHA A;  3BIT A;  3O5V A;  1A16 A;  2V3X A;  2BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...