3OVKA

Crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P, Xaa-Pro dipeptidase
publication title Crystal structure of an XXA-pro aminopeptidase from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ovkA00
3IL0A 3L7GA 1WBQA 4QR8A 5CNXA 3CB6A 2BWYA 4S00A 4EGEA 5E2CA 3CTZA 3QOCA 3PEBA 5FCFA 3L24A 3Q6DA 1A16A 3OOOA 3CB5A 5CDEA 1N51A 1W7VA 3OVKA 2BWVA 2BN7A 3PN9A 3I7MA 2ZSGA 4ZWPA 4S2RP 5FCHA 4S2TP 1PV9A 1W2MA 2BHAA 1WLRA 5CDLA 4RGZ1 3BIQA 4ZNGA 2BWXA 3BITA 4PV4A 3O5VA 1WL6A 2BHBA 4ZWUA 2BHCA 5E5BA 4RZZA 4ZWOA 2BWUA 2V3ZA 1WY2A 4B28A 2V3YA 2IW2A 3BIPA 3RVAA 2BWTA 1WL9A 2BWWA 5CDVA 3IG4A 4RZYA 1WN1A 4R60A 2BWSA 2BH3A 5CE6A 5CIKA 2BHDA 1KP0A 1JAWA 1M35A 2HOWA 4S01A 1CHMA 2V3XA 2OKNA 4FKCA
chains in the Genus database with same CATH superfamily
3IL0A 3L7GA 1WBQA 4QR8A 5CNXA 3CB6A 2BWYA 4S00A 4EGEA 5E2CA 3CTZA 3QOCA 3PEBA 5FCFA 3L24A 3Q6DA 1A16A 3OOOA 3CB5A 5CDEA 1N51A 1W7VA 3OVKA 2BWVA 2BN7A 3PN9A 3I7MA 2ZSGA 4ZWPA 4S2RP 5FCHA 4S2TP 1PV9A 1W2MA 2BHAA 1WLRA 5CDLA 4RGZ1 3BIQA 4ZNGA 2BWXA 3BITA 4PV4A 3O5VA 1WL6A 2BHBA 4ZWUA 2BHCA 5E5BA 4RZZA 4ZWOA 2BWUA 2V3ZA 1WY2A 4B28A 2V3YA 2IW2A 3BIPA 3RVAA 2BWTA 1WL9A 2BWWA 5CDVA 3IG4A 4RZYA 1WN1A 4R60A 2BWSA 2BH3A 5CE6A 5CIKA 2BHDA 1KP0A 1JAWA 1M35A 2HOWA 4S01A 1CHMA 2V3XA 2OKNA 4FKCA
chains in the Genus database with same CATH topology
3IL0A 3L7GA 1WBQA 4QR8A 5CNXA 3CB6A 2BWYA 4S00A 4EGEA 5E2CA 3CTZA 3QOCA 3PEBA 5FCFA 3L24A 3Q6DA 1A16A 3OOOA 3CB5A 5CDEA 1N51A 1W7VA 3OVKA 2BWVA 2BN7A 3PN9A 3I7MA 2ZSGA 4ZWPA 4S2RP 5FCHA 4S2TP 1PV9A 1W2MA 2BHAA 1WLRA 5CDLA 4RGZ1 3BIQA 4ZNGA 2BWXA 3BITA 4PV4A 3O5VA 1WL6A 2BHBA 4ZWUA 2BHCA 5E5BA 4RZZA 4ZWOA 2BWUA 2V3ZA 1WY2A 4B28A 2V3YA 2IW2A 3BIPA 3RVAA 2BWTA 1WL9A 2BWWA 5CDVA 3IG4A 4RZYA 1WN1A 4R60A 2BWSA 2BH3A 5CE6A 5CIKA 2BHDA 1KP0A 1JAWA 1M35A 2HOWA 4S01A 1CHMA 2V3XA 2OKNA 4FKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IL0 A;  3L7G A;  1WBQ A;  4QR8 A;  5CNX A;  3CB6 A;  2BWY A;  4S00 A;  4EGE A;  5E2C A;  3CTZ A;  3QOC A;  3PEB A;  5FCF A;  3L24 A;  3Q6D A;  1A16 A;  3OOO A;  3CB5 A;  5CDE A;  1N51 A;  1W7V A;  3OVK A;  2BWV A;  2BN7 A;  3PN9 A;  3I7M A;  2ZSG A;  4ZWP A;  4S2R P;  5FCH A;  4S2T P;  1PV9 A;  1W2M A;  2BHA A;  1WLR A;  5CDL A;  4RGZ 1;  3BIQ A;  4ZNG A;  2BWX A;  3BIT A;  4PV4 A;  3O5V A;  1WL6 A;  2BHB A;  4ZWU A;  2BHC A;  5E5B A;  4RZZ A;  4ZWO A;  2BWU A;  2V3Z A;  1WY2 A;  4B28 A;  2V3Y A;  2IW2 A;  3BIP A;  3RVA A;  2BWT A;  1WL9 A;  2BWW A;  5CDV A;  3IG4 A;  4RZY A;  1WN1 A;  4R60 A;  2BWS A;  2BH3 A;  5CE6 A;  5CIK A;  2BHD A;  1KP0 A;  1JAW A;  1M35 A;  2HOW A;  4S01 A;  1CHM A;  2V3X A;  2OKN A;  4FKC A; 
#chains in the Genus database with same CATH topology
 3IL0 A;  3L7G A;  1WBQ A;  4QR8 A;  5CNX A;  3CB6 A;  2BWY A;  4S00 A;  4EGE A;  5E2C A;  3CTZ A;  3QOC A;  3PEB A;  5FCF A;  3L24 A;  3Q6D A;  1A16 A;  3OOO A;  3CB5 A;  5CDE A;  1N51 A;  1W7V A;  3OVK A;  2BWV A;  2BN7 A;  3PN9 A;  3I7M A;  2ZSG A;  4ZWP A;  4S2R P;  5FCH A;  4S2T P;  1PV9 A;  1W2M A;  2BHA A;  1WLR A;  5CDL A;  4RGZ 1;  3BIQ A;  4ZNG A;  2BWX A;  3BIT A;  4PV4 A;  3O5V A;  1WL6 A;  2BHB A;  4ZWU A;  2BHC A;  5E5B A;  4RZZ A;  4ZWO A;  2BWU A;  2V3Z A;  1WY2 A;  4B28 A;  2V3Y A;  2IW2 A;  3BIP A;  3RVA A;  2BWT A;  1WL9 A;  2BWW A;  5CDV A;  3IG4 A;  4RZY A;  1WN1 A;  4R60 A;  2BWS A;  2BH3 A;  5CE6 A;  5CIK A;  2BHD A;  1KP0 A;  1JAW A;  1M35 A;  2HOW A;  4S01 A;  1CHM A;  2V3X A;  2OKN A;  4FKC A; 
#chains in the Genus database with same CATH homology
 3IL0 A;  3L7G A;  1WBQ A;  4QR8 A;  5CNX A;  3CB6 A;  2BWY A;  4S00 A;  4EGE A;  5E2C A;  3CTZ A;  3QOC A;  3PEB A;  5FCF A;  3L24 A;  3Q6D A;  1A16 A;  3OOO A;  3CB5 A;  5CDE A;  1N51 A;  1W7V A;  3OVK A;  2BWV A;  2BN7 A;  3PN9 A;  3I7M A;  2ZSG A;  4ZWP A;  4S2R P;  5FCH A;  4S2T P;  1PV9 A;  1W2M A;  2BHA A;  1WLR A;  5CDL A;  4RGZ 1;  3BIQ A;  4ZNG A;  2BWX A;  3BIT A;  4PV4 A;  3O5V A;  1WL6 A;  2BHB A;  4ZWU A;  2BHC A;  5E5B A;  4RZZ A;  4ZWO A;  2BWU A;  2V3Z A;  1WY2 A;  4B28 A;  2V3Y A;  2IW2 A;  3BIP A;  3RVA A;  2BWT A;  1WL9 A;  2BWW A;  5CDV A;  3IG4 A;  4RZY A;  1WN1 A;  4R60 A;  2BWS A;  2BH3 A;  5CE6 A;  5CIK A;  2BHD A;  1KP0 A;  1JAW A;  1M35 A;  2HOW A;  4S01 A;  1CHM A;  2V3X A;  2OKN A;  4FKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...