3OVKA

Crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an XXA-pro aminopeptidase from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P, Xaa-Pro dipeptidase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ovkA00
2V3XA 2BN7A 2BHDA 3CB6A 2BHAA 1WY2A 4RZYA 1WL9A 2HOWA 3CB5A 5CDEA 1JAWA 3L24A 3IL0A 4PV4A 3OOOA 5CDVA 3PN9A 1CHMA 1WN1A 2V3YA 4RGZ1 4R60A 4ZWPA 3OVKA 1M35A 4S2TP 3PEBA 2ZSGA 2BWUA 3BIPA 5CIKA 3RVAA 1PV9A 1W7VA 2IW2A 2V3ZA 3BIQA 3CTZA 4QR8A 2BH3A 4ZWOA 1A16A 2BWWA 4S01A 2BWTA 4RZZA 4EGEA 3IG4A 5FCHA 1W2MA 5E2CA 5FCFA 2BWYA 3L7GA 4S00A 5CNXA 2BWSA 1WBQA 2BWVA 2OKNA 2BHCA 3BITA 1N51A 3Q6DA 2BWXA 5CE6A 3QOCA 1WL6A 5CDLA 4ZWUA 3O5VA 4S2RP 4ZNGA 4FKCA 2BHBA 5E5BA 4B28A 1KP0A 1WLRA 3I7MA
chains in the Genus database with same CATH superfamily
2V3XA 2BN7A 2BHDA 3CB6A 2BHAA 1WY2A 4RZYA 1WL9A 2HOWA 3CB5A 5CDEA 1JAWA 3L24A 3IL0A 4PV4A 3OOOA 5CDVA 3PN9A 1CHMA 1WN1A 2V3YA 4RGZ1 4R60A 4ZWPA 3OVKA 1M35A 4S2TP 3PEBA 2ZSGA 2BWUA 3BIPA 5CIKA 3RVAA 1PV9A 1W7VA 2IW2A 2V3ZA 3BIQA 3CTZA 4QR8A 2BH3A 4ZWOA 1A16A 2BWWA 4S01A 2BWTA 4RZZA 4EGEA 3IG4A 5FCHA 1W2MA 5E2CA 5FCFA 2BWYA 3L7GA 4S00A 5CNXA 2BWSA 1WBQA 2BWVA 2OKNA 2BHCA 3BITA 1N51A 3Q6DA 2BWXA 5CE6A 3QOCA 1WL6A 5CDLA 4ZWUA 3O5VA 4S2RP 4ZNGA 4FKCA 2BHBA 5E5BA 4B28A 1KP0A 1WLRA 3I7MA
chains in the Genus database with same CATH topology
2V3XA 2BN7A 2BHDA 3CB6A 2BHAA 1WY2A 4RZYA 1WL9A 2HOWA 3CB5A 5CDEA 1JAWA 3L24A 3IL0A 4PV4A 3OOOA 5CDVA 3PN9A 1CHMA 1WN1A 2V3YA 4RGZ1 4R60A 4ZWPA 3OVKA 1M35A 4S2TP 3PEBA 2ZSGA 2BWUA 3BIPA 5CIKA 3RVAA 1PV9A 1W7VA 2IW2A 2V3ZA 3BIQA 3CTZA 4QR8A 2BH3A 4ZWOA 1A16A 2BWWA 4S01A 2BWTA 4RZZA 4EGEA 3IG4A 5FCHA 1W2MA 5E2CA 5FCFA 2BWYA 3L7GA 4S00A 5CNXA 2BWSA 1WBQA 2BWVA 2OKNA 2BHCA 3BITA 1N51A 3Q6DA 2BWXA 5CE6A 3QOCA 1WL6A 5CDLA 4ZWUA 3O5VA 4S2RP 4ZNGA 4FKCA 2BHBA 5E5BA 4B28A 1KP0A 1WLRA 3I7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3X A;  2BN7 A;  2BHD A;  3CB6 A;  2BHA A;  1WY2 A;  4RZY A;  1WL9 A;  2HOW A;  3CB5 A;  5CDE A;  1JAW A;  3L24 A;  3IL0 A;  4PV4 A;  3OOO A;  5CDV A;  3PN9 A;  1CHM A;  1WN1 A;  2V3Y A;  4RGZ 1;  4R60 A;  4ZWP A;  3OVK A;  1M35 A;  4S2T P;  3PEB A;  2ZSG A;  2BWU A;  3BIP A;  5CIK A;  3RVA A;  1PV9 A;  1W7V A;  2IW2 A;  2V3Z A;  3BIQ A;  3CTZ A;  4QR8 A;  2BH3 A;  4ZWO A;  1A16 A;  2BWW A;  4S01 A;  2BWT A;  4RZZ A;  4EGE A;  3IG4 A;  5FCH A;  1W2M A;  5E2C A;  5FCF A;  2BWY A;  3L7G A;  4S00 A;  5CNX A;  2BWS A;  1WBQ A;  2BWV A;  2OKN A;  2BHC A;  3BIT A;  1N51 A;  3Q6D A;  2BWX A;  5CE6 A;  3QOC A;  1WL6 A;  5CDL A;  4ZWU A;  3O5V A;  4S2R P;  4ZNG A;  4FKC A;  2BHB A;  5E5B A;  4B28 A;  1KP0 A;  1WLR A;  3I7M A; 
#chains in the Genus database with same CATH topology
 2V3X A;  2BN7 A;  2BHD A;  3CB6 A;  2BHA A;  1WY2 A;  4RZY A;  1WL9 A;  2HOW A;  3CB5 A;  5CDE A;  1JAW A;  3L24 A;  3IL0 A;  4PV4 A;  3OOO A;  5CDV A;  3PN9 A;  1CHM A;  1WN1 A;  2V3Y A;  4RGZ 1;  4R60 A;  4ZWP A;  3OVK A;  1M35 A;  4S2T P;  3PEB A;  2ZSG A;  2BWU A;  3BIP A;  5CIK A;  3RVA A;  1PV9 A;  1W7V A;  2IW2 A;  2V3Z A;  3BIQ A;  3CTZ A;  4QR8 A;  2BH3 A;  4ZWO A;  1A16 A;  2BWW A;  4S01 A;  2BWT A;  4RZZ A;  4EGE A;  3IG4 A;  5FCH A;  1W2M A;  5E2C A;  5FCF A;  2BWY A;  3L7G A;  4S00 A;  5CNX A;  2BWS A;  1WBQ A;  2BWV A;  2OKN A;  2BHC A;  3BIT A;  1N51 A;  3Q6D A;  2BWX A;  5CE6 A;  3QOC A;  1WL6 A;  5CDL A;  4ZWU A;  3O5V A;  4S2R P;  4ZNG A;  4FKC A;  2BHB A;  5E5B A;  4B28 A;  1KP0 A;  1WLR A;  3I7M A; 
#chains in the Genus database with same CATH homology
 2V3X A;  2BN7 A;  2BHD A;  3CB6 A;  2BHA A;  1WY2 A;  4RZY A;  1WL9 A;  2HOW A;  3CB5 A;  5CDE A;  1JAW A;  3L24 A;  3IL0 A;  4PV4 A;  3OOO A;  5CDV A;  3PN9 A;  1CHM A;  1WN1 A;  2V3Y A;  4RGZ 1;  4R60 A;  4ZWP A;  3OVK A;  1M35 A;  4S2T P;  3PEB A;  2ZSG A;  2BWU A;  3BIP A;  5CIK A;  3RVA A;  1PV9 A;  1W7V A;  2IW2 A;  2V3Z A;  3BIQ A;  3CTZ A;  4QR8 A;  2BH3 A;  4ZWO A;  1A16 A;  2BWW A;  4S01 A;  2BWT A;  4RZZ A;  4EGE A;  3IG4 A;  5FCH A;  1W2M A;  5E2C A;  5FCF A;  2BWY A;  3L7G A;  4S00 A;  5CNX A;  2BWS A;  1WBQ A;  2BWV A;  2OKN A;  2BHC A;  3BIT A;  1N51 A;  3Q6D A;  2BWX A;  5CE6 A;  3QOC A;  1WL6 A;  5CDL A;  4ZWU A;  3O5V A;  4S2R P;  4ZNG A;  4FKC A;  2BHB A;  5E5B A;  4B28 A;  1KP0 A;  1WLR A;  3I7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...