3OVKA

Crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P, Xaa-Pro dipeptidase
publication title Crystal structure of an XXA-pro aminopeptidase from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ovkA00
4QR8A 3BIPA 5CE6A 2BWVA 1W7VA 3I7MA 1PV9A 2BHAA 2V3ZA 1KP0A 1WL6A 1WBQA 3OVKA 2IW2A 1W2MA 5CIKA 1JAWA 4FKCA 2BWXA 3IL0A 1M35A 5CDEA 4ZWPA 4S01A 2BHDA 2V3XA 2ZSGA 3BIQA 2BN7A 4S2TP 3QOCA 1WY2A 2BWSA 1WLRA 4ZWOA 1WN1A 1A16A 3CB6A 4B28A 2BWYA 4PV4A 4ZNGA 3PN9A 2BH3A 5E2CA 3PEBA 3L7GA 3O5VA 5CDLA 3L24A 4RZZA 1N51A 2BWTA 3OOOA 4S00A 3CTZA 5E5BA 5FCFA 5CDVA 2BHCA 4ZWUA 4S2RP 2BWUA 2BHBA 4RZYA 4EGEA 1CHMA 3RVAA 3CB5A 3Q6DA 5CNXA 2BWWA 2HOWA 2V3YA 1WL9A 5FCHA 4RGZ1 3IG4A 2OKNA 3BITA 4R60A
chains in the Genus database with same CATH superfamily
4QR8A 3BIPA 5CE6A 2BWVA 1W7VA 3I7MA 1PV9A 2BHAA 2V3ZA 1KP0A 1WL6A 1WBQA 3OVKA 2IW2A 1W2MA 5CIKA 1JAWA 4FKCA 2BWXA 3IL0A 1M35A 5CDEA 4ZWPA 4S01A 2BHDA 2V3XA 2ZSGA 3BIQA 2BN7A 4S2TP 3QOCA 1WY2A 2BWSA 1WLRA 4ZWOA 1WN1A 1A16A 3CB6A 4B28A 2BWYA 4PV4A 4ZNGA 3PN9A 2BH3A 5E2CA 3PEBA 3L7GA 3O5VA 5CDLA 3L24A 4RZZA 1N51A 2BWTA 3OOOA 4S00A 3CTZA 5E5BA 5FCFA 5CDVA 2BHCA 4ZWUA 4S2RP 2BWUA 2BHBA 4RZYA 4EGEA 1CHMA 3RVAA 3CB5A 3Q6DA 5CNXA 2BWWA 2HOWA 2V3YA 1WL9A 5FCHA 4RGZ1 3IG4A 2OKNA 3BITA 4R60A
chains in the Genus database with same CATH topology
4QR8A 3BIPA 5CE6A 2BWVA 1W7VA 3I7MA 1PV9A 2BHAA 2V3ZA 1KP0A 1WL6A 1WBQA 3OVKA 2IW2A 1W2MA 5CIKA 1JAWA 4FKCA 2BWXA 3IL0A 1M35A 5CDEA 4ZWPA 4S01A 2BHDA 2V3XA 2ZSGA 3BIQA 2BN7A 4S2TP 3QOCA 1WY2A 2BWSA 1WLRA 4ZWOA 1WN1A 1A16A 3CB6A 4B28A 2BWYA 4PV4A 4ZNGA 3PN9A 2BH3A 5E2CA 3PEBA 3L7GA 3O5VA 5CDLA 3L24A 4RZZA 1N51A 2BWTA 3OOOA 4S00A 3CTZA 5E5BA 5FCFA 5CDVA 2BHCA 4ZWUA 4S2RP 2BWUA 2BHBA 4RZYA 4EGEA 1CHMA 3RVAA 3CB5A 3Q6DA 5CNXA 2BWWA 2HOWA 2V3YA 1WL9A 5FCHA 4RGZ1 3IG4A 2OKNA 3BITA 4R60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QR8 A;  3BIP A;  5CE6 A;  2BWV A;  1W7V A;  3I7M A;  1PV9 A;  2BHA A;  2V3Z A;  1KP0 A;  1WL6 A;  1WBQ A;  3OVK A;  2IW2 A;  1W2M A;  5CIK A;  1JAW A;  4FKC A;  2BWX A;  3IL0 A;  1M35 A;  5CDE A;  4ZWP A;  4S01 A;  2BHD A;  2V3X A;  2ZSG A;  3BIQ A;  2BN7 A;  4S2T P;  3QOC A;  1WY2 A;  2BWS A;  1WLR A;  4ZWO A;  1WN1 A;  1A16 A;  3CB6 A;  4B28 A;  2BWY A;  4PV4 A;  4ZNG A;  3PN9 A;  2BH3 A;  5E2C A;  3PEB A;  3L7G A;  3O5V A;  5CDL A;  3L24 A;  4RZZ A;  1N51 A;  2BWT A;  3OOO A;  4S00 A;  3CTZ A;  5E5B A;  5FCF A;  5CDV A;  2BHC A;  4ZWU A;  4S2R P;  2BWU A;  2BHB A;  4RZY A;  4EGE A;  1CHM A;  3RVA A;  3CB5 A;  3Q6D A;  5CNX A;  2BWW A;  2HOW A;  2V3Y A;  1WL9 A;  5FCH A;  4RGZ 1;  3IG4 A;  2OKN A;  3BIT A;  4R60 A; 
#chains in the Genus database with same CATH topology
 4QR8 A;  3BIP A;  5CE6 A;  2BWV A;  1W7V A;  3I7M A;  1PV9 A;  2BHA A;  2V3Z A;  1KP0 A;  1WL6 A;  1WBQ A;  3OVK A;  2IW2 A;  1W2M A;  5CIK A;  1JAW A;  4FKC A;  2BWX A;  3IL0 A;  1M35 A;  5CDE A;  4ZWP A;  4S01 A;  2BHD A;  2V3X A;  2ZSG A;  3BIQ A;  2BN7 A;  4S2T P;  3QOC A;  1WY2 A;  2BWS A;  1WLR A;  4ZWO A;  1WN1 A;  1A16 A;  3CB6 A;  4B28 A;  2BWY A;  4PV4 A;  4ZNG A;  3PN9 A;  2BH3 A;  5E2C A;  3PEB A;  3L7G A;  3O5V A;  5CDL A;  3L24 A;  4RZZ A;  1N51 A;  2BWT A;  3OOO A;  4S00 A;  3CTZ A;  5E5B A;  5FCF A;  5CDV A;  2BHC A;  4ZWU A;  4S2R P;  2BWU A;  2BHB A;  4RZY A;  4EGE A;  1CHM A;  3RVA A;  3CB5 A;  3Q6D A;  5CNX A;  2BWW A;  2HOW A;  2V3Y A;  1WL9 A;  5FCH A;  4RGZ 1;  3IG4 A;  2OKN A;  3BIT A;  4R60 A; 
#chains in the Genus database with same CATH homology
 4QR8 A;  3BIP A;  5CE6 A;  2BWV A;  1W7V A;  3I7M A;  1PV9 A;  2BHA A;  2V3Z A;  1KP0 A;  1WL6 A;  1WBQ A;  3OVK A;  2IW2 A;  1W2M A;  5CIK A;  1JAW A;  4FKC A;  2BWX A;  3IL0 A;  1M35 A;  5CDE A;  4ZWP A;  4S01 A;  2BHD A;  2V3X A;  2ZSG A;  3BIQ A;  2BN7 A;  4S2T P;  3QOC A;  1WY2 A;  2BWS A;  1WLR A;  4ZWO A;  1WN1 A;  1A16 A;  3CB6 A;  4B28 A;  2BWY A;  4PV4 A;  4ZNG A;  3PN9 A;  2BH3 A;  5E2C A;  3PEB A;  3L7G A;  3O5V A;  5CDL A;  3L24 A;  4RZZ A;  1N51 A;  2BWT A;  3OOO A;  4S00 A;  3CTZ A;  5E5B A;  5FCF A;  5CDV A;  2BHC A;  4ZWU A;  4S2R P;  2BWU A;  2BHB A;  4RZY A;  4EGE A;  1CHM A;  3RVA A;  3CB5 A;  3Q6D A;  5CNX A;  2BWW A;  2HOW A;  2V3Y A;  1WL9 A;  5FCH A;  4RGZ 1;  3IG4 A;  2OKN A;  3BIT A;  4R60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...