3OVKA

Crystal structure of an xxa-pro aminopeptidase from streptococcus pyogenes
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATVLITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLEADQIDCLGFEDQVSFSFYQAMQAELSGITLLAQSGFVEHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P, Xaa-Pro dipeptidase
publication title Crystal structure of an XXA-pro aminopeptidase from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ovkA00
3Q6DA 1WN1A 4S2RP 2BWSA 1N51A 4S01A 2IW2A 5FCHA 2BHCA 2HOWA 4QR8A 1W2MA 3BIPA 3CTZA 4R60A 4ZWPA 3IG4A 1WLRA 3L7GA 2BH3A 3RVAA 2BWXA 1WL9A 3OOOA 1JAWA 2BHAA 5CDEA 1WY2A 4PV4A 2V3YA 4B28A 3IL0A 2BN7A 5CNXA 2BHDA 1KP0A 4RZYA 1M35A 5CIKA 4ZWUA 3PEBA 4S00A 5E5BA 4RGZ1 3BITA 2ZSGA 4RZZA 5E2CA 4ZNGA 3O5VA 2BWWA 2OKNA 4FKCA 5CDVA 3OVKA 1W7VA 3L24A 2BWVA 1WL6A 4ZWOA 1A16A 2V3XA 2V3ZA 3QOCA 4S2TP 3BIQA 1WBQA 5CDLA 3I7MA 5CE6A 3CB6A 2BWTA 3CB5A 1CHMA 1PV9A 2BWYA 4EGEA 2BWUA 3PN9A 2BHBA 5FCFA
chains in the Genus database with same CATH superfamily
3Q6DA 1WN1A 4S2RP 2BWSA 1N51A 4S01A 2IW2A 5FCHA 2BHCA 2HOWA 4QR8A 1W2MA 3BIPA 3CTZA 4R60A 4ZWPA 3IG4A 1WLRA 3L7GA 2BH3A 3RVAA 2BWXA 1WL9A 3OOOA 1JAWA 2BHAA 5CDEA 1WY2A 4PV4A 2V3YA 4B28A 3IL0A 2BN7A 5CNXA 2BHDA 1KP0A 4RZYA 1M35A 5CIKA 4ZWUA 3PEBA 4S00A 5E5BA 4RGZ1 3BITA 2ZSGA 4RZZA 5E2CA 4ZNGA 3O5VA 2BWWA 2OKNA 4FKCA 5CDVA 3OVKA 1W7VA 3L24A 2BWVA 1WL6A 4ZWOA 1A16A 2V3XA 2V3ZA 3QOCA 4S2TP 3BIQA 1WBQA 5CDLA 3I7MA 5CE6A 3CB6A 2BWTA 3CB5A 1CHMA 1PV9A 2BWYA 4EGEA 2BWUA 3PN9A 2BHBA 5FCFA
chains in the Genus database with same CATH topology
3Q6DA 1WN1A 4S2RP 2BWSA 1N51A 4S01A 2IW2A 5FCHA 2BHCA 2HOWA 4QR8A 1W2MA 3BIPA 3CTZA 4R60A 4ZWPA 3IG4A 1WLRA 3L7GA 2BH3A 3RVAA 2BWXA 1WL9A 3OOOA 1JAWA 2BHAA 5CDEA 1WY2A 4PV4A 2V3YA 4B28A 3IL0A 2BN7A 5CNXA 2BHDA 1KP0A 4RZYA 1M35A 5CIKA 4ZWUA 3PEBA 4S00A 5E5BA 4RGZ1 3BITA 2ZSGA 4RZZA 5E2CA 4ZNGA 3O5VA 2BWWA 2OKNA 4FKCA 5CDVA 3OVKA 1W7VA 3L24A 2BWVA 1WL6A 4ZWOA 1A16A 2V3XA 2V3ZA 3QOCA 4S2TP 3BIQA 1WBQA 5CDLA 3I7MA 5CE6A 3CB6A 2BWTA 3CB5A 1CHMA 1PV9A 2BWYA 4EGEA 2BWUA 3PN9A 2BHBA 5FCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6D A;  1WN1 A;  4S2R P;  2BWS A;  1N51 A;  4S01 A;  2IW2 A;  5FCH A;  2BHC A;  2HOW A;  4QR8 A;  1W2M A;  3BIP A;  3CTZ A;  4R60 A;  4ZWP A;  3IG4 A;  1WLR A;  3L7G A;  2BH3 A;  3RVA A;  2BWX A;  1WL9 A;  3OOO A;  1JAW A;  2BHA A;  5CDE A;  1WY2 A;  4PV4 A;  2V3Y A;  4B28 A;  3IL0 A;  2BN7 A;  5CNX A;  2BHD A;  1KP0 A;  4RZY A;  1M35 A;  5CIK A;  4ZWU A;  3PEB A;  4S00 A;  5E5B A;  4RGZ 1;  3BIT A;  2ZSG A;  4RZZ A;  5E2C A;  4ZNG A;  3O5V A;  2BWW A;  2OKN A;  4FKC A;  5CDV A;  3OVK A;  1W7V A;  3L24 A;  2BWV A;  1WL6 A;  4ZWO A;  1A16 A;  2V3X A;  2V3Z A;  3QOC A;  4S2T P;  3BIQ A;  1WBQ A;  5CDL A;  3I7M A;  5CE6 A;  3CB6 A;  2BWT A;  3CB5 A;  1CHM A;  1PV9 A;  2BWY A;  4EGE A;  2BWU A;  3PN9 A;  2BHB A;  5FCF A; 
#chains in the Genus database with same CATH topology
 3Q6D A;  1WN1 A;  4S2R P;  2BWS A;  1N51 A;  4S01 A;  2IW2 A;  5FCH A;  2BHC A;  2HOW A;  4QR8 A;  1W2M A;  3BIP A;  3CTZ A;  4R60 A;  4ZWP A;  3IG4 A;  1WLR A;  3L7G A;  2BH3 A;  3RVA A;  2BWX A;  1WL9 A;  3OOO A;  1JAW A;  2BHA A;  5CDE A;  1WY2 A;  4PV4 A;  2V3Y A;  4B28 A;  3IL0 A;  2BN7 A;  5CNX A;  2BHD A;  1KP0 A;  4RZY A;  1M35 A;  5CIK A;  4ZWU A;  3PEB A;  4S00 A;  5E5B A;  4RGZ 1;  3BIT A;  2ZSG A;  4RZZ A;  5E2C A;  4ZNG A;  3O5V A;  2BWW A;  2OKN A;  4FKC A;  5CDV A;  3OVK A;  1W7V A;  3L24 A;  2BWV A;  1WL6 A;  4ZWO A;  1A16 A;  2V3X A;  2V3Z A;  3QOC A;  4S2T P;  3BIQ A;  1WBQ A;  5CDL A;  3I7M A;  5CE6 A;  3CB6 A;  2BWT A;  3CB5 A;  1CHM A;  1PV9 A;  2BWY A;  4EGE A;  2BWU A;  3PN9 A;  2BHB A;  5FCF A; 
#chains in the Genus database with same CATH homology
 3Q6D A;  1WN1 A;  4S2R P;  2BWS A;  1N51 A;  4S01 A;  2IW2 A;  5FCH A;  2BHC A;  2HOW A;  4QR8 A;  1W2M A;  3BIP A;  3CTZ A;  4R60 A;  4ZWP A;  3IG4 A;  1WLR A;  3L7G A;  2BH3 A;  3RVA A;  2BWX A;  1WL9 A;  3OOO A;  1JAW A;  2BHA A;  5CDE A;  1WY2 A;  4PV4 A;  2V3Y A;  4B28 A;  3IL0 A;  2BN7 A;  5CNX A;  2BHD A;  1KP0 A;  4RZY A;  1M35 A;  5CIK A;  4ZWU A;  3PEB A;  4S00 A;  5E5B A;  4RGZ 1;  3BIT A;  2ZSG A;  4RZZ A;  5E2C A;  4ZNG A;  3O5V A;  2BWW A;  2OKN A;  4FKC A;  5CDV A;  3OVK A;  1W7V A;  3L24 A;  2BWV A;  1WL6 A;  4ZWO A;  1A16 A;  2V3X A;  2V3Z A;  3QOC A;  4S2T P;  3BIQ A;  1WBQ A;  5CDL A;  3I7M A;  5CE6 A;  3CB6 A;  2BWT A;  3CB5 A;  1CHM A;  1PV9 A;  2BWY A;  4EGE A;  2BWU A;  3PN9 A;  2BHB A;  5FCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...