3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-pro aminopeptidase
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
1YJ3A 2BHCA 2ADUA 2P9AA 4FLLA 4U6EA 2BHAA 2IW2A 4FKCA 2GA2A 2V3YA 2GTXA 4U1BA 4U70A 4IKUA 4JUQA 4QR8A 2BH3A 2BWSA 3BITA 4U76A 3MX6A 4U73A 2V3ZA 2BWXA 2BN7A 3RVAA 4FLIA 5FCFA 2V6CA 4FO8A 4Z7MA 2P98A 4FUKA 4IKSA 3QOCA 1C21A 3FM3A 5CIKA 4MATA 3IU8A 1C27A 1C23A 4U6JA 2BHBA 2GU6A 2BWVA 2V3XA 1KQ9A 4FLJA 4FLKA 4IPAA 3TAVA 3D27A 5JFRA 2G6PA 2BWTA 2Q92A 4EGEA 2GGCA 3PKBA 5CNXA 2Q8KA 4S2RP 3IL0A 3BIPA 1WY2A 4PNCA 3IU9A 3PKDA 1C22A 4IKTA 4OOKA 2GG0A 2Q96A 4S01A 5E2CA 1XGSA 2GU5A 5D6EA 1WL6A 3PKAA 1O0XA 1R58A 1WBQA 2EVOA 4ZWPA 2GU7A 4IKRA 5JHUA 2MATA 3PKCA 1WLRA 3Q6DA 4B28A 2GG5A 2BWUA 4IF7A 4U71A 1XGOA 1BOAA 1A16A 4ZWOA 3O5VA 1QXYA 1XGNA 2GZ5A 4IDYA 4U6ZA 3BIQA 4S00A 5CE6A 1WKMA 1XNZA 3PEBA 1XGMA 1C24A 1QZYA 2DFIA 1YVMA 4R60A 2GGBA 4IU6A 1R5HA 3IU7A 5CDLA 2EVMA 1W7VA 2GG8A 3PN9A 2EA2A 1QXWA 1WL9A 1QXZA 2B3LA 5E5BA 1YW7A 2GG2A 3I7MA 3OOOA 4A6WA 3L7GA 2Q94A 3IG4A 4U6CA 1B59A 2BWYA 1YW8A 5D6FA 3FMRA 1YW9A 2ZSGA 3CTZA 1R5GA 2NQ6A 1PV9A 4S2TP 4RGZ1 2EA4A 4KM3A 1M35A 5JI6A 2HOWA 4PV4A 1Y1NA 3CB5A 2GG7A 3S6BA 2B3KA 3OVKA 1B6AA 2OAZA 2GG3A 3L24A 1N51A 2GG9A 5CDVA 4ZWUA 2B3HA 1CHMA 1MATA 4ZNGA 2OKNA 4RZYA 1BN5A 5CLSA 3TB5A 1KP0A 3CB6A 4HXXA 4U69A 2EVCA 2GU4A 3MR1A 4RZZA 2P99A 5FCHA 3MATA 2BHDA 2BB7A 3PKEA 4U75A 3FMQA 2NQ7A 4FO7A 1KQ0A 1WN1A 1W2MA 2Q93A 4IECA 4A6VA 5CDEA 3RORA 1JAWA 2BWWA 4U6WA 2Q95A
chains in the Genus database with same CATH superfamily
1YJ3A 2BHCA 2ADUA 2P9AA 4FLLA 4U6EA 2BHAA 2IW2A 4FKCA 2GA2A 2V3YA 2GTXA 4U1BA 4U70A 4IKUA 4JUQA 4QR8A 2BH3A 2BWSA 3BITA 4U76A 3MX6A 4U73A 2V3ZA 2BWXA 2BN7A 3RVAA 4FLIA 5FCFA 2V6CA 4FO8A 4Z7MA 2P98A 4FUKA 4IKSA 3QOCA 1C21A 3FM3A 5CIKA 4MATA 3IU8A 1C27A 1C23A 4U6JA 2BHBA 2GU6A 2BWVA 2V3XA 1KQ9A 4FLJA 4FLKA 4IPAA 3TAVA 3D27A 5JFRA 2G6PA 2BWTA 2Q92A 4EGEA 2GGCA 3PKBA 5CNXA 2Q8KA 4S2RP 3IL0A 3BIPA 1WY2A 4PNCA 3IU9A 3PKDA 1C22A 4IKTA 4OOKA 2GG0A 2Q96A 4S01A 5E2CA 1XGSA 2GU5A 5D6EA 1WL6A 3PKAA 1O0XA 1R58A 1WBQA 2EVOA 4ZWPA 2GU7A 4IKRA 5JHUA 2MATA 3PKCA 1WLRA 3Q6DA 4B28A 2GG5A 2BWUA 4IF7A 4U71A 1XGOA 1BOAA 1A16A 4ZWOA 3O5VA 1QXYA 1XGNA 2GZ5A 4IDYA 4U6ZA 3BIQA 4S00A 5CE6A 1WKMA 1XNZA 3PEBA 1XGMA 1C24A 1QZYA 2DFIA 1YVMA 4R60A 2GGBA 4IU6A 1R5HA 3IU7A 5CDLA 2EVMA 1W7VA 2GG8A 3PN9A 2EA2A 1QXWA 1WL9A 1QXZA 2B3LA 5E5BA 1YW7A 2GG2A 3I7MA 3OOOA 4A6WA 3L7GA 2Q94A 3IG4A 4U6CA 1B59A 2BWYA 1YW8A 5D6FA 3FMRA 1YW9A 2ZSGA 3CTZA 1R5GA 2NQ6A 1PV9A 4S2TP 4RGZ1 2EA4A 4KM3A 1M35A 5JI6A 2HOWA 4PV4A 1Y1NA 3CB5A 2GG7A 3S6BA 2B3KA 3OVKA 1B6AA 2OAZA 2GG3A 3L24A 1N51A 2GG9A 5CDVA 4ZWUA 2B3HA 1CHMA 1MATA 4ZNGA 2OKNA 4RZYA 1BN5A 5CLSA 3TB5A 1KP0A 3CB6A 4HXXA 4U69A 2EVCA 2GU4A 3MR1A 4RZZA 2P99A 5FCHA 3MATA 2BHDA 2BB7A 3PKEA 4U75A 3FMQA 2NQ7A 4FO7A 1KQ0A 1WN1A 1W2MA 2Q93A 4IECA 4A6VA 5CDEA 3RORA 1JAWA 2BWWA 4U6WA 2Q95A
chains in the Genus database with same CATH topology
1YJ3A 2BHCA 2ADUA 2P9AA 4FLLA 4U6EA 2BHAA 2IW2A 4FKCA 2GA2A 2V3YA 2GTXA 4U1BA 4U70A 4IKUA 4JUQA 4QR8A 2BH3A 2BWSA 3BITA 4U76A 3MX6A 4U73A 2V3ZA 2BWXA 2BN7A 3RVAA 4FLIA 5FCFA 2V6CA 4FO8A 4Z7MA 2P98A 4FUKA 4IKSA 3QOCA 1C21A 3FM3A 5CIKA 4MATA 3IU8A 1C27A 1C23A 4U6JA 2BHBA 2GU6A 2BWVA 2V3XA 1KQ9A 4FLJA 4FLKA 4IPAA 3TAVA 3D27A 5JFRA 2G6PA 2BWTA 2Q92A 4EGEA 2GGCA 3PKBA 5CNXA 2Q8KA 4S2RP 3IL0A 3BIPA 1WY2A 4PNCA 3IU9A 3PKDA 1C22A 4IKTA 4OOKA 2GG0A 2Q96A 4S01A 5E2CA 1XGSA 2GU5A 5D6EA 1WL6A 3PKAA 1O0XA 1R58A 1WBQA 2EVOA 4ZWPA 2GU7A 4IKRA 5JHUA 2MATA 3PKCA 1WLRA 3Q6DA 4B28A 2GG5A 2BWUA 4IF7A 4U71A 1XGOA 1BOAA 1A16A 4ZWOA 3O5VA 1QXYA 1XGNA 2GZ5A 4IDYA 4U6ZA 3BIQA 4S00A 5CE6A 1WKMA 1XNZA 3PEBA 1XGMA 1C24A 1QZYA 2DFIA 1YVMA 4R60A 2GGBA 4IU6A 1R5HA 3IU7A 5CDLA 2EVMA 1W7VA 2GG8A 3PN9A 2EA2A 1QXWA 1WL9A 1QXZA 2B3LA 5E5BA 1YW7A 2GG2A 3I7MA 3OOOA 4A6WA 3L7GA 2Q94A 3IG4A 4U6CA 1B59A 2BWYA 1YW8A 5D6FA 3FMRA 1YW9A 2ZSGA 3CTZA 1R5GA 2NQ6A 1PV9A 4S2TP 4RGZ1 2EA4A 4KM3A 1M35A 5JI6A 2HOWA 4PV4A 1Y1NA 3CB5A 2GG7A 3S6BA 2B3KA 3OVKA 1B6AA 2OAZA 2GG3A 3L24A 1N51A 2GG9A 5CDVA 4ZWUA 2B3HA 1CHMA 1MATA 4ZNGA 2OKNA 4RZYA 1BN5A 5CLSA 3TB5A 1KP0A 3CB6A 4HXXA 4U69A 2EVCA 2GU4A 3MR1A 4RZZA 2P99A 5FCHA 3MATA 2BHDA 2BB7A 3PKEA 4U75A 3FMQA 2NQ7A 4FO7A 1KQ0A 1WN1A 1W2MA 2Q93A 4IECA 4A6VA 5CDEA 3RORA 1JAWA 2BWWA 4U6WA 2Q95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  2BHC A;  2ADU A;  2P9A A;  4FLL A;  4U6E A;  2BHA A;  2IW2 A;  4FKC A;  2GA2 A;  2V3Y A;  2GTX A;  4U1B A;  4U70 A;  4IKU A;  4JUQ A;  4QR8 A;  2BH3 A;  2BWS A;  3BIT A;  4U76 A;  3MX6 A;  4U73 A;  2V3Z A;  2BWX A;  2BN7 A;  3RVA A;  4FLI A;  5FCF A;  2V6C A;  4FO8 A;  4Z7M A;  2P98 A;  4FUK A;  4IKS A;  3QOC A;  1C21 A;  3FM3 A;  5CIK A;  4MAT A;  3IU8 A;  1C27 A;  1C23 A;  4U6J A;  2BHB A;  2GU6 A;  2BWV A;  2V3X A;  1KQ9 A;  4FLJ A;  4FLK A;  4IPA A;  3TAV A;  3D27 A;  5JFR A;  2G6P A;  2BWT A;  2Q92 A;  4EGE A;  2GGC A;  3PKB A;  5CNX A;  2Q8K A;  4S2R P;  3IL0 A;  3BIP A;  1WY2 A;  4PNC A;  3IU9 A;  3PKD A;  1C22 A;  4IKT A;  4OOK A;  2GG0 A;  2Q96 A;  4S01 A;  5E2C A;  1XGS A;  2GU5 A;  5D6E A;  1WL6 A;  3PKA A;  1O0X A;  1R58 A;  1WBQ A;  2EVO A;  4ZWP A;  2GU7 A;  4IKR A;  5JHU A;  2MAT A;  3PKC A;  1WLR A;  3Q6D A;  4B28 A;  2GG5 A;  2BWU A;  4IF7 A;  4U71 A;  1XGO A;  1BOA A;  1A16 A;  4ZWO A;  3O5V A;  1QXY A;  1XGN A;  2GZ5 A;  4IDY A;  4U6Z A;  3BIQ A;  4S00 A;  5CE6 A;  1WKM A;  1XNZ A;  3PEB A;  1XGM A;  1C24 A;  1QZY A;  2DFI A;  1YVM A;  4R60 A;  2GGB A;  4IU6 A;  1R5H A;  3IU7 A;  5CDL A;  2EVM A;  1W7V A;  2GG8 A;  3PN9 A;  2EA2 A;  1QXW A;  1WL9 A;  1QXZ A;  2B3L A;  5E5B A;  1YW7 A;  2GG2 A;  3I7M A;  3OOO A;  4A6W A;  3L7G A;  2Q94 A;  3IG4 A;  4U6C A;  1B59 A;  2BWY A;  1YW8 A;  5D6F A;  3FMR A;  1YW9 A;  2ZSG A;  3CTZ A;  1R5G A;  2NQ6 A;  1PV9 A;  4S2T P;  4RGZ 1;  2EA4 A;  4KM3 A;  1M35 A;  5JI6 A;  2HOW A;  4PV4 A;  1Y1N A;  3CB5 A;  2GG7 A;  3S6B A;  2B3K A;  3OVK A;  1B6A A;  2OAZ A;  2GG3 A;  3L24 A;  1N51 A;  2GG9 A;  5CDV A;  4ZWU A;  2B3H A;  1CHM A;  1MAT A;  4ZNG A;  2OKN A;  4RZY A;  1BN5 A;  5CLS A;  3TB5 A;  1KP0 A;  3CB6 A;  4HXX A;  4U69 A;  2EVC A;  2GU4 A;  3MR1 A;  4RZZ A;  2P99 A;  5FCH A;  3MAT A;  2BHD A;  2BB7 A;  3PKE A;  4U75 A;  3FMQ A;  2NQ7 A;  4FO7 A;  1KQ0 A;  1WN1 A;  1W2M A;  2Q93 A;  4IEC A;  4A6V A;  5CDE A;  3ROR A;  1JAW A;  2BWW A;  4U6W A;  2Q95 A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  2BHC A;  2ADU A;  2P9A A;  4FLL A;  4U6E A;  2BHA A;  2IW2 A;  4FKC A;  2GA2 A;  2V3Y A;  2GTX A;  4U1B A;  4U70 A;  4IKU A;  4JUQ A;  4QR8 A;  2BH3 A;  2BWS A;  3BIT A;  4U76 A;  3MX6 A;  4U73 A;  2V3Z A;  2BWX A;  2BN7 A;  3RVA A;  4FLI A;  5FCF A;  2V6C A;  4FO8 A;  4Z7M A;  2P98 A;  4FUK A;  4IKS A;  3QOC A;  1C21 A;  3FM3 A;  5CIK A;  4MAT A;  3IU8 A;  1C27 A;  1C23 A;  4U6J A;  2BHB A;  2GU6 A;  2BWV A;  2V3X A;  1KQ9 A;  4FLJ A;  4FLK A;  4IPA A;  3TAV A;  3D27 A;  5JFR A;  2G6P A;  2BWT A;  2Q92 A;  4EGE A;  2GGC A;  3PKB A;  5CNX A;  2Q8K A;  4S2R P;  3IL0 A;  3BIP A;  1WY2 A;  4PNC A;  3IU9 A;  3PKD A;  1C22 A;  4IKT A;  4OOK A;  2GG0 A;  2Q96 A;  4S01 A;  5E2C A;  1XGS A;  2GU5 A;  5D6E A;  1WL6 A;  3PKA A;  1O0X A;  1R58 A;  1WBQ A;  2EVO A;  4ZWP A;  2GU7 A;  4IKR A;  5JHU A;  2MAT A;  3PKC A;  1WLR A;  3Q6D A;  4B28 A;  2GG5 A;  2BWU A;  4IF7 A;  4U71 A;  1XGO A;  1BOA A;  1A16 A;  4ZWO A;  3O5V A;  1QXY A;  1XGN A;  2GZ5 A;  4IDY A;  4U6Z A;  3BIQ A;  4S00 A;  5CE6 A;  1WKM A;  1XNZ A;  3PEB A;  1XGM A;  1C24 A;  1QZY A;  2DFI A;  1YVM A;  4R60 A;  2GGB A;  4IU6 A;  1R5H A;  3IU7 A;  5CDL A;  2EVM A;  1W7V A;  2GG8 A;  3PN9 A;  2EA2 A;  1QXW A;  1WL9 A;  1QXZ A;  2B3L A;  5E5B A;  1YW7 A;  2GG2 A;  3I7M A;  3OOO A;  4A6W A;  3L7G A;  2Q94 A;  3IG4 A;  4U6C A;  1B59 A;  2BWY A;  1YW8 A;  5D6F A;  3FMR A;  1YW9 A;  2ZSG A;  3CTZ A;  1R5G A;  2NQ6 A;  1PV9 A;  4S2T P;  4RGZ 1;  2EA4 A;  4KM3 A;  1M35 A;  5JI6 A;  2HOW A;  4PV4 A;  1Y1N A;  3CB5 A;  2GG7 A;  3S6B A;  2B3K A;  3OVK A;  1B6A A;  2OAZ A;  2GG3 A;  3L24 A;  1N51 A;  2GG9 A;  5CDV A;  4ZWU A;  2B3H A;  1CHM A;  1MAT A;  4ZNG A;  2OKN A;  4RZY A;  1BN5 A;  5CLS A;  3TB5 A;  1KP0 A;  3CB6 A;  4HXX A;  4U69 A;  2EVC A;  2GU4 A;  3MR1 A;  4RZZ A;  2P99 A;  5FCH A;  3MAT A;  2BHD A;  2BB7 A;  3PKE A;  4U75 A;  3FMQ A;  2NQ7 A;  4FO7 A;  1KQ0 A;  1WN1 A;  1W2M A;  2Q93 A;  4IEC A;  4A6V A;  5CDE A;  3ROR A;  1JAW A;  2BWW A;  4U6W A;  2Q95 A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  2BHC A;  2ADU A;  2P9A A;  4FLL A;  4U6E A;  2BHA A;  2IW2 A;  4FKC A;  2GA2 A;  2V3Y A;  2GTX A;  4U1B A;  4U70 A;  4IKU A;  4JUQ A;  4QR8 A;  2BH3 A;  2BWS A;  3BIT A;  4U76 A;  3MX6 A;  4U73 A;  2V3Z A;  2BWX A;  2BN7 A;  3RVA A;  4FLI A;  5FCF A;  2V6C A;  4FO8 A;  4Z7M A;  2P98 A;  4FUK A;  4IKS A;  3QOC A;  1C21 A;  3FM3 A;  5CIK A;  4MAT A;  3IU8 A;  1C27 A;  1C23 A;  4U6J A;  2BHB A;  2GU6 A;  2BWV A;  2V3X A;  1KQ9 A;  4FLJ A;  4FLK A;  4IPA A;  3TAV A;  3D27 A;  5JFR A;  2G6P A;  2BWT A;  2Q92 A;  4EGE A;  2GGC A;  3PKB A;  5CNX A;  2Q8K A;  4S2R P;  3IL0 A;  3BIP A;  1WY2 A;  4PNC A;  3IU9 A;  3PKD A;  1C22 A;  4IKT A;  4OOK A;  2GG0 A;  2Q96 A;  4S01 A;  5E2C A;  1XGS A;  2GU5 A;  5D6E A;  1WL6 A;  3PKA A;  1O0X A;  1R58 A;  1WBQ A;  2EVO A;  4ZWP A;  2GU7 A;  4IKR A;  5JHU A;  2MAT A;  3PKC A;  1WLR A;  3Q6D A;  4B28 A;  2GG5 A;  2BWU A;  4IF7 A;  4U71 A;  1XGO A;  1BOA A;  1A16 A;  4ZWO A;  3O5V A;  1QXY A;  1XGN A;  2GZ5 A;  4IDY A;  4U6Z A;  3BIQ A;  4S00 A;  5CE6 A;  1WKM A;  1XNZ A;  3PEB A;  1XGM A;  1C24 A;  1QZY A;  2DFI A;  1YVM A;  4R60 A;  2GGB A;  4IU6 A;  1R5H A;  3IU7 A;  5CDL A;  2EVM A;  1W7V A;  2GG8 A;  3PN9 A;  2EA2 A;  1QXW A;  1WL9 A;  1QXZ A;  2B3L A;  5E5B A;  1YW7 A;  2GG2 A;  3I7M A;  3OOO A;  4A6W A;  3L7G A;  2Q94 A;  3IG4 A;  4U6C A;  1B59 A;  2BWY A;  1YW8 A;  5D6F A;  3FMR A;  1YW9 A;  2ZSG A;  3CTZ A;  1R5G A;  2NQ6 A;  1PV9 A;  4S2T P;  4RGZ 1;  2EA4 A;  4KM3 A;  1M35 A;  5JI6 A;  2HOW A;  4PV4 A;  1Y1N A;  3CB5 A;  2GG7 A;  3S6B A;  2B3K A;  3OVK A;  1B6A A;  2OAZ A;  2GG3 A;  3L24 A;  1N51 A;  2GG9 A;  5CDV A;  4ZWU A;  2B3H A;  1CHM A;  1MAT A;  4ZNG A;  2OKN A;  4RZY A;  1BN5 A;  5CLS A;  3TB5 A;  1KP0 A;  3CB6 A;  4HXX A;  4U69 A;  2EVC A;  2GU4 A;  3MR1 A;  4RZZ A;  2P99 A;  5FCH A;  3MAT A;  2BHD A;  2BB7 A;  3PKE A;  4U75 A;  3FMQ A;  2NQ7 A;  4FO7 A;  1KQ0 A;  1WN1 A;  1W2M A;  2Q93 A;  4IEC A;  4A6V A;  5CDE A;  3ROR A;  1JAW A;  2BWW A;  4U6W A;  2Q95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...