3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-pro aminopeptidase
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
4FLLA 2BHDA 2BWXA 2Q94A 1BN5A 1XGMA 4U6CA 2GG3A 1YJ3A 2BHBA 2GU6A 2OAZA 2GU5A 4FLJA 1WN1A 1WL6A 5CDLA 2EVCA 3IU9A 4Z7MA 3FM3A 1QXWA 1R5HA 4IKUA 4R60A 2B3HA 4FO8A 1QXZA 4IKTA 5FCFA 4MATA 4U6WA 5CLSA 4A6VA 3PKBA 2BWWA 1WBQA 5E5BA 2GG2A 2BWYA 1W2MA 3O5VA 2GG9A 3IU7A 4U1BA 1R58A 2BWVA 3IU8A 5D6EA 2BB7A 2Q8KA 2GA2A 1XGNA 3PKAA 4FO7A 2NQ6A 1M35A 1QXYA 1YW7A 5CNXA 2G6PA 1YVMA 3CTZA 3FMQA 2EA4A 3I7MA 2Q95A 2GTXA 3MX6A 2BN7A 3BIPA 1WY2A 2NQ7A 5CDEA 4HXXA 1JAWA 1YW9A 4JUQA 2BH3A 4U75A 4U71A 2GZ5A 2GU4A 1C21A 2B3LA 4ZNGA 2ADUA 2B3KA 4RZYA 4ZWOA 4FKCA 3MR1A 3MATA 4IU6A 3IL0A 1BOAA 1WL9A 2P99A 3TAVA 1R5GA 3L24A 3BIQA 3QOCA 3TB5A 2P9AA 4U69A 3PKCA 1B59A 4S00A 5CE6A 1KQ9A 2MATA 2EVOA 3PN9A 3Q6DA 4B28A 1MATA 1WKMA 2P98A 5FCHA 4IF7A 2V3ZA 2GG0A 4FLKA 4U6JA 5D6FA 5JFRA 4RZZA 2OKNA 1KP0A 3PKEA 4OOKA 4A6WA 4U70A 2Q93A 2GU7A 3BITA 4IECA 4KM3A 1A16A 4IPAA 4U6EA 2DFIA 2GGBA 2GG5A 2BWTA 2EVMA 2GG7A 5CDVA 4FLIA 2HOWA 4EGEA 4RGZ1 3L7GA 1N51A 3PEBA 1QZYA 2BHCA 2V6CA 5JHUA 2GG8A 1WLRA 1W7VA 4IDYA 1O0XA 1CHMA 1Y1NA 2Q96A 3CB6A 3D27A 5JI6A 1PV9A 2BHAA 4S2TP 3S6BA 4ZWUA 3RVAA 1C24A 3PKDA 4U73A 2EA2A 2Q92A 3CB5A 1XGSA 4IKRA 4U6ZA 1C27A 4FUKA 3IG4A 2V3YA 4U76A 4IKSA 4ZWPA 2ZSGA 4QR8A 3OOOA 2GGCA 1YW8A 4S2RP 1C22A 3OVKA 2BWSA 1C23A 4PV4A 4S01A 2BWUA 1XNZA 1B6AA 4PNCA 5E2CA 2V3XA 1KQ0A 3FMRA 2IW2A 3RORA 5CIKA 1XGOA
chains in the Genus database with same CATH superfamily
4FLLA 2BHDA 2BWXA 2Q94A 1BN5A 1XGMA 4U6CA 2GG3A 1YJ3A 2BHBA 2GU6A 2OAZA 2GU5A 4FLJA 1WN1A 1WL6A 5CDLA 2EVCA 3IU9A 4Z7MA 3FM3A 1QXWA 1R5HA 4IKUA 4R60A 2B3HA 4FO8A 1QXZA 4IKTA 5FCFA 4MATA 4U6WA 5CLSA 4A6VA 3PKBA 2BWWA 1WBQA 5E5BA 2GG2A 2BWYA 1W2MA 3O5VA 2GG9A 3IU7A 4U1BA 1R58A 2BWVA 3IU8A 5D6EA 2BB7A 2Q8KA 2GA2A 1XGNA 3PKAA 4FO7A 2NQ6A 1M35A 1QXYA 1YW7A 5CNXA 2G6PA 1YVMA 3CTZA 3FMQA 2EA4A 3I7MA 2Q95A 2GTXA 3MX6A 2BN7A 3BIPA 1WY2A 2NQ7A 5CDEA 4HXXA 1JAWA 1YW9A 4JUQA 2BH3A 4U75A 4U71A 2GZ5A 2GU4A 1C21A 2B3LA 4ZNGA 2ADUA 2B3KA 4RZYA 4ZWOA 4FKCA 3MR1A 3MATA 4IU6A 3IL0A 1BOAA 1WL9A 2P99A 3TAVA 1R5GA 3L24A 3BIQA 3QOCA 3TB5A 2P9AA 4U69A 3PKCA 1B59A 4S00A 5CE6A 1KQ9A 2MATA 2EVOA 3PN9A 3Q6DA 4B28A 1MATA 1WKMA 2P98A 5FCHA 4IF7A 2V3ZA 2GG0A 4FLKA 4U6JA 5D6FA 5JFRA 4RZZA 2OKNA 1KP0A 3PKEA 4OOKA 4A6WA 4U70A 2Q93A 2GU7A 3BITA 4IECA 4KM3A 1A16A 4IPAA 4U6EA 2DFIA 2GGBA 2GG5A 2BWTA 2EVMA 2GG7A 5CDVA 4FLIA 2HOWA 4EGEA 4RGZ1 3L7GA 1N51A 3PEBA 1QZYA 2BHCA 2V6CA 5JHUA 2GG8A 1WLRA 1W7VA 4IDYA 1O0XA 1CHMA 1Y1NA 2Q96A 3CB6A 3D27A 5JI6A 1PV9A 2BHAA 4S2TP 3S6BA 4ZWUA 3RVAA 1C24A 3PKDA 4U73A 2EA2A 2Q92A 3CB5A 1XGSA 4IKRA 4U6ZA 1C27A 4FUKA 3IG4A 2V3YA 4U76A 4IKSA 4ZWPA 2ZSGA 4QR8A 3OOOA 2GGCA 1YW8A 4S2RP 1C22A 3OVKA 2BWSA 1C23A 4PV4A 4S01A 2BWUA 1XNZA 1B6AA 4PNCA 5E2CA 2V3XA 1KQ0A 3FMRA 2IW2A 3RORA 5CIKA 1XGOA
chains in the Genus database with same CATH topology
4FLLA 2BHDA 2BWXA 2Q94A 1BN5A 1XGMA 4U6CA 2GG3A 1YJ3A 2BHBA 2GU6A 2OAZA 2GU5A 4FLJA 1WN1A 1WL6A 5CDLA 2EVCA 3IU9A 4Z7MA 3FM3A 1QXWA 1R5HA 4IKUA 4R60A 2B3HA 4FO8A 1QXZA 4IKTA 5FCFA 4MATA 4U6WA 5CLSA 4A6VA 3PKBA 2BWWA 1WBQA 5E5BA 2GG2A 2BWYA 1W2MA 3O5VA 2GG9A 3IU7A 4U1BA 1R58A 2BWVA 3IU8A 5D6EA 2BB7A 2Q8KA 2GA2A 1XGNA 3PKAA 4FO7A 2NQ6A 1M35A 1QXYA 1YW7A 5CNXA 2G6PA 1YVMA 3CTZA 3FMQA 2EA4A 3I7MA 2Q95A 2GTXA 3MX6A 2BN7A 3BIPA 1WY2A 2NQ7A 5CDEA 4HXXA 1JAWA 1YW9A 4JUQA 2BH3A 4U75A 4U71A 2GZ5A 2GU4A 1C21A 2B3LA 4ZNGA 2ADUA 2B3KA 4RZYA 4ZWOA 4FKCA 3MR1A 3MATA 4IU6A 3IL0A 1BOAA 1WL9A 2P99A 3TAVA 1R5GA 3L24A 3BIQA 3QOCA 3TB5A 2P9AA 4U69A 3PKCA 1B59A 4S00A 5CE6A 1KQ9A 2MATA 2EVOA 3PN9A 3Q6DA 4B28A 1MATA 1WKMA 2P98A 5FCHA 4IF7A 2V3ZA 2GG0A 4FLKA 4U6JA 5D6FA 5JFRA 4RZZA 2OKNA 1KP0A 3PKEA 4OOKA 4A6WA 4U70A 2Q93A 2GU7A 3BITA 4IECA 4KM3A 1A16A 4IPAA 4U6EA 2DFIA 2GGBA 2GG5A 2BWTA 2EVMA 2GG7A 5CDVA 4FLIA 2HOWA 4EGEA 4RGZ1 3L7GA 1N51A 3PEBA 1QZYA 2BHCA 2V6CA 5JHUA 2GG8A 1WLRA 1W7VA 4IDYA 1O0XA 1CHMA 1Y1NA 2Q96A 3CB6A 3D27A 5JI6A 1PV9A 2BHAA 4S2TP 3S6BA 4ZWUA 3RVAA 1C24A 3PKDA 4U73A 2EA2A 2Q92A 3CB5A 1XGSA 4IKRA 4U6ZA 1C27A 4FUKA 3IG4A 2V3YA 4U76A 4IKSA 4ZWPA 2ZSGA 4QR8A 3OOOA 2GGCA 1YW8A 4S2RP 1C22A 3OVKA 2BWSA 1C23A 4PV4A 4S01A 2BWUA 1XNZA 1B6AA 4PNCA 5E2CA 2V3XA 1KQ0A 3FMRA 2IW2A 3RORA 5CIKA 1XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLL A;  2BHD A;  2BWX A;  2Q94 A;  1BN5 A;  1XGM A;  4U6C A;  2GG3 A;  1YJ3 A;  2BHB A;  2GU6 A;  2OAZ A;  2GU5 A;  4FLJ A;  1WN1 A;  1WL6 A;  5CDL A;  2EVC A;  3IU9 A;  4Z7M A;  3FM3 A;  1QXW A;  1R5H A;  4IKU A;  4R60 A;  2B3H A;  4FO8 A;  1QXZ A;  4IKT A;  5FCF A;  4MAT A;  4U6W A;  5CLS A;  4A6V A;  3PKB A;  2BWW A;  1WBQ A;  5E5B A;  2GG2 A;  2BWY A;  1W2M A;  3O5V A;  2GG9 A;  3IU7 A;  4U1B A;  1R58 A;  2BWV A;  3IU8 A;  5D6E A;  2BB7 A;  2Q8K A;  2GA2 A;  1XGN A;  3PKA A;  4FO7 A;  2NQ6 A;  1M35 A;  1QXY A;  1YW7 A;  5CNX A;  2G6P A;  1YVM A;  3CTZ A;  3FMQ A;  2EA4 A;  3I7M A;  2Q95 A;  2GTX A;  3MX6 A;  2BN7 A;  3BIP A;  1WY2 A;  2NQ7 A;  5CDE A;  4HXX A;  1JAW A;  1YW9 A;  4JUQ A;  2BH3 A;  4U75 A;  4U71 A;  2GZ5 A;  2GU4 A;  1C21 A;  2B3L A;  4ZNG A;  2ADU A;  2B3K A;  4RZY A;  4ZWO A;  4FKC A;  3MR1 A;  3MAT A;  4IU6 A;  3IL0 A;  1BOA A;  1WL9 A;  2P99 A;  3TAV A;  1R5G A;  3L24 A;  3BIQ A;  3QOC A;  3TB5 A;  2P9A A;  4U69 A;  3PKC A;  1B59 A;  4S00 A;  5CE6 A;  1KQ9 A;  2MAT A;  2EVO A;  3PN9 A;  3Q6D A;  4B28 A;  1MAT A;  1WKM A;  2P98 A;  5FCH A;  4IF7 A;  2V3Z A;  2GG0 A;  4FLK A;  4U6J A;  5D6F A;  5JFR A;  4RZZ A;  2OKN A;  1KP0 A;  3PKE A;  4OOK A;  4A6W A;  4U70 A;  2Q93 A;  2GU7 A;  3BIT A;  4IEC A;  4KM3 A;  1A16 A;  4IPA A;  4U6E A;  2DFI A;  2GGB A;  2GG5 A;  2BWT A;  2EVM A;  2GG7 A;  5CDV A;  4FLI A;  2HOW A;  4EGE A;  4RGZ 1;  3L7G A;  1N51 A;  3PEB A;  1QZY A;  2BHC A;  2V6C A;  5JHU A;  2GG8 A;  1WLR A;  1W7V A;  4IDY A;  1O0X A;  1CHM A;  1Y1N A;  2Q96 A;  3CB6 A;  3D27 A;  5JI6 A;  1PV9 A;  2BHA A;  4S2T P;  3S6B A;  4ZWU A;  3RVA A;  1C24 A;  3PKD A;  4U73 A;  2EA2 A;  2Q92 A;  3CB5 A;  1XGS A;  4IKR A;  4U6Z A;  1C27 A;  4FUK A;  3IG4 A;  2V3Y A;  4U76 A;  4IKS A;  4ZWP A;  2ZSG A;  4QR8 A;  3OOO A;  2GGC A;  1YW8 A;  4S2R P;  1C22 A;  3OVK A;  2BWS A;  1C23 A;  4PV4 A;  4S01 A;  2BWU A;  1XNZ A;  1B6A A;  4PNC A;  5E2C A;  2V3X A;  1KQ0 A;  3FMR A;  2IW2 A;  3ROR A;  5CIK A;  1XGO A; 
#chains in the Genus database with same CATH topology
 4FLL A;  2BHD A;  2BWX A;  2Q94 A;  1BN5 A;  1XGM A;  4U6C A;  2GG3 A;  1YJ3 A;  2BHB A;  2GU6 A;  2OAZ A;  2GU5 A;  4FLJ A;  1WN1 A;  1WL6 A;  5CDL A;  2EVC A;  3IU9 A;  4Z7M A;  3FM3 A;  1QXW A;  1R5H A;  4IKU A;  4R60 A;  2B3H A;  4FO8 A;  1QXZ A;  4IKT A;  5FCF A;  4MAT A;  4U6W A;  5CLS A;  4A6V A;  3PKB A;  2BWW A;  1WBQ A;  5E5B A;  2GG2 A;  2BWY A;  1W2M A;  3O5V A;  2GG9 A;  3IU7 A;  4U1B A;  1R58 A;  2BWV A;  3IU8 A;  5D6E A;  2BB7 A;  2Q8K A;  2GA2 A;  1XGN A;  3PKA A;  4FO7 A;  2NQ6 A;  1M35 A;  1QXY A;  1YW7 A;  5CNX A;  2G6P A;  1YVM A;  3CTZ A;  3FMQ A;  2EA4 A;  3I7M A;  2Q95 A;  2GTX A;  3MX6 A;  2BN7 A;  3BIP A;  1WY2 A;  2NQ7 A;  5CDE A;  4HXX A;  1JAW A;  1YW9 A;  4JUQ A;  2BH3 A;  4U75 A;  4U71 A;  2GZ5 A;  2GU4 A;  1C21 A;  2B3L A;  4ZNG A;  2ADU A;  2B3K A;  4RZY A;  4ZWO A;  4FKC A;  3MR1 A;  3MAT A;  4IU6 A;  3IL0 A;  1BOA A;  1WL9 A;  2P99 A;  3TAV A;  1R5G A;  3L24 A;  3BIQ A;  3QOC A;  3TB5 A;  2P9A A;  4U69 A;  3PKC A;  1B59 A;  4S00 A;  5CE6 A;  1KQ9 A;  2MAT A;  2EVO A;  3PN9 A;  3Q6D A;  4B28 A;  1MAT A;  1WKM A;  2P98 A;  5FCH A;  4IF7 A;  2V3Z A;  2GG0 A;  4FLK A;  4U6J A;  5D6F A;  5JFR A;  4RZZ A;  2OKN A;  1KP0 A;  3PKE A;  4OOK A;  4A6W A;  4U70 A;  2Q93 A;  2GU7 A;  3BIT A;  4IEC A;  4KM3 A;  1A16 A;  4IPA A;  4U6E A;  2DFI A;  2GGB A;  2GG5 A;  2BWT A;  2EVM A;  2GG7 A;  5CDV A;  4FLI A;  2HOW A;  4EGE A;  4RGZ 1;  3L7G A;  1N51 A;  3PEB A;  1QZY A;  2BHC A;  2V6C A;  5JHU A;  2GG8 A;  1WLR A;  1W7V A;  4IDY A;  1O0X A;  1CHM A;  1Y1N A;  2Q96 A;  3CB6 A;  3D27 A;  5JI6 A;  1PV9 A;  2BHA A;  4S2T P;  3S6B A;  4ZWU A;  3RVA A;  1C24 A;  3PKD A;  4U73 A;  2EA2 A;  2Q92 A;  3CB5 A;  1XGS A;  4IKR A;  4U6Z A;  1C27 A;  4FUK A;  3IG4 A;  2V3Y A;  4U76 A;  4IKS A;  4ZWP A;  2ZSG A;  4QR8 A;  3OOO A;  2GGC A;  1YW8 A;  4S2R P;  1C22 A;  3OVK A;  2BWS A;  1C23 A;  4PV4 A;  4S01 A;  2BWU A;  1XNZ A;  1B6A A;  4PNC A;  5E2C A;  2V3X A;  1KQ0 A;  3FMR A;  2IW2 A;  3ROR A;  5CIK A;  1XGO A; 
#chains in the Genus database with same CATH homology
 4FLL A;  2BHD A;  2BWX A;  2Q94 A;  1BN5 A;  1XGM A;  4U6C A;  2GG3 A;  1YJ3 A;  2BHB A;  2GU6 A;  2OAZ A;  2GU5 A;  4FLJ A;  1WN1 A;  1WL6 A;  5CDL A;  2EVC A;  3IU9 A;  4Z7M A;  3FM3 A;  1QXW A;  1R5H A;  4IKU A;  4R60 A;  2B3H A;  4FO8 A;  1QXZ A;  4IKT A;  5FCF A;  4MAT A;  4U6W A;  5CLS A;  4A6V A;  3PKB A;  2BWW A;  1WBQ A;  5E5B A;  2GG2 A;  2BWY A;  1W2M A;  3O5V A;  2GG9 A;  3IU7 A;  4U1B A;  1R58 A;  2BWV A;  3IU8 A;  5D6E A;  2BB7 A;  2Q8K A;  2GA2 A;  1XGN A;  3PKA A;  4FO7 A;  2NQ6 A;  1M35 A;  1QXY A;  1YW7 A;  5CNX A;  2G6P A;  1YVM A;  3CTZ A;  3FMQ A;  2EA4 A;  3I7M A;  2Q95 A;  2GTX A;  3MX6 A;  2BN7 A;  3BIP A;  1WY2 A;  2NQ7 A;  5CDE A;  4HXX A;  1JAW A;  1YW9 A;  4JUQ A;  2BH3 A;  4U75 A;  4U71 A;  2GZ5 A;  2GU4 A;  1C21 A;  2B3L A;  4ZNG A;  2ADU A;  2B3K A;  4RZY A;  4ZWO A;  4FKC A;  3MR1 A;  3MAT A;  4IU6 A;  3IL0 A;  1BOA A;  1WL9 A;  2P99 A;  3TAV A;  1R5G A;  3L24 A;  3BIQ A;  3QOC A;  3TB5 A;  2P9A A;  4U69 A;  3PKC A;  1B59 A;  4S00 A;  5CE6 A;  1KQ9 A;  2MAT A;  2EVO A;  3PN9 A;  3Q6D A;  4B28 A;  1MAT A;  1WKM A;  2P98 A;  5FCH A;  4IF7 A;  2V3Z A;  2GG0 A;  4FLK A;  4U6J A;  5D6F A;  5JFR A;  4RZZ A;  2OKN A;  1KP0 A;  3PKE A;  4OOK A;  4A6W A;  4U70 A;  2Q93 A;  2GU7 A;  3BIT A;  4IEC A;  4KM3 A;  1A16 A;  4IPA A;  4U6E A;  2DFI A;  2GGB A;  2GG5 A;  2BWT A;  2EVM A;  2GG7 A;  5CDV A;  4FLI A;  2HOW A;  4EGE A;  4RGZ 1;  3L7G A;  1N51 A;  3PEB A;  1QZY A;  2BHC A;  2V6C A;  5JHU A;  2GG8 A;  1WLR A;  1W7V A;  4IDY A;  1O0X A;  1CHM A;  1Y1N A;  2Q96 A;  3CB6 A;  3D27 A;  5JI6 A;  1PV9 A;  2BHA A;  4S2T P;  3S6B A;  4ZWU A;  3RVA A;  1C24 A;  3PKD A;  4U73 A;  2EA2 A;  2Q92 A;  3CB5 A;  1XGS A;  4IKR A;  4U6Z A;  1C27 A;  4FUK A;  3IG4 A;  2V3Y A;  4U76 A;  4IKS A;  4ZWP A;  2ZSG A;  4QR8 A;  3OOO A;  2GGC A;  1YW8 A;  4S2R P;  1C22 A;  3OVK A;  2BWS A;  1C23 A;  4PV4 A;  4S01 A;  2BWU A;  1XNZ A;  1B6A A;  4PNC A;  5E2C A;  2V3X A;  1KQ0 A;  3FMR A;  2IW2 A;  3ROR A;  5CIK A;  1XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...