3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords Xaa-pro aminopeptidase
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
4Z7MA 4IKUA 3PKEA 1XGMA 1YW7A 2GG5A 2Q95A 4FLKA 5CNXA 5CE6A 5JI6A 1R5HA 3L7GA 2P98A 4U76A 3BIPA 2BN7A 4KM3A 4ZWUA 2V3ZA 1YJ3A 2BWXA 3RVAA 1W2MA 4S2RP 1O0XA 1XGSA 2GG9A 1C27A 3FM3A 3IU9A 1W7VA 1XGOA 2GG7A 4U70A 2BWVA 3S6BA 3PKDA 2GG2A 4ZWOA 2B3KA 2P99A 2BB7A 3PKAA 4A6VA 2ADUA 1B59A 1BN5A 1C21A 2V3YA 4IF7A 2Q8KA 3IG4A 2DFIA 2GTXA 4FO7A 2BWWA 4ZWPA 3PEBA 3QOCA 1B6AA 3BITA 2GGCA 2EVOA 3MR1A 5JFRA 1Y1NA 5CIKA 3OVKA 5FCFA 4IKTA 5CDVA 3PN9A 4IDYA 1YVMA 4S01A 4QR8A 4OOKA 3FMRA 4PNCA 1N51A 3CTZA 2GG0A 5E2CA 2V3XA 4ZNGA 4FUKA 4MATA 4FLLA 4U6EA 3OOOA 2BWYA 2EVCA 2ZSGA 3TAVA 1WY2A 4S00A 2MATA 3MX6A 2HOWA 4RZZA 4HXXA 2NQ6A 2B3HA 1C22A 5CDEA 2BHCA 2GG8A 1QZYA 3TB5A 1QXWA 5D6FA 1CHMA 5E5BA 1YW8A 3PKBA 4U71A 2GU6A 2BHAA 2EA4A 5FCHA 3PKCA 5CLSA 2NQ7A 2GZ5A 3D27A 4EGEA 4IKSA 2G6PA 2OKNA 2BWTA 4U69A 2BWSA 4RGZ1 1XNZA 2OAZA 1WN1A 4FLJA 4U6ZA 4U6CA 4FLIA 4JUQA 4B28A 2Q92A 2B3LA 1QXZA 1WKMA 2GU7A 4U73A 4U1BA 2V6CA 3CB6A 3L24A 4R60A 2EVMA 2GG3A 2BHDA 2GA2A 1KP0A 1KQ9A 1C23A 1XGNA 4RZYA 1M35A 4IU6A 2BWUA 1YW9A 2Q94A 3IU7A 1WBQA 2GU5A 4U6JA 3FMQA 1A16A 4S2TP 3RORA 3CB5A 1WL6A 3I7MA 1JAWA 2Q96A 3IL0A 4U6WA 1WL9A 1PV9A 4A6WA 1R5GA 2Q93A 4IECA 1C24A 5JHUA 3O5VA 2BH3A 2GGBA 3Q6DA 4FO8A 2P9AA 5D6EA 2BHBA 2IW2A 4U75A 3IU8A 1BOAA 3MATA 4PV4A 1MATA 2GU4A 4FKCA 2EA2A 1R58A 3BIQA 4IKRA 1QXYA 4IPAA 5CDLA 1WLRA 1KQ0A
chains in the Genus database with same CATH superfamily
4Z7MA 4IKUA 3PKEA 1XGMA 1YW7A 2GG5A 2Q95A 4FLKA 5CNXA 5CE6A 5JI6A 1R5HA 3L7GA 2P98A 4U76A 3BIPA 2BN7A 4KM3A 4ZWUA 2V3ZA 1YJ3A 2BWXA 3RVAA 1W2MA 4S2RP 1O0XA 1XGSA 2GG9A 1C27A 3FM3A 3IU9A 1W7VA 1XGOA 2GG7A 4U70A 2BWVA 3S6BA 3PKDA 2GG2A 4ZWOA 2B3KA 2P99A 2BB7A 3PKAA 4A6VA 2ADUA 1B59A 1BN5A 1C21A 2V3YA 4IF7A 2Q8KA 3IG4A 2DFIA 2GTXA 4FO7A 2BWWA 4ZWPA 3PEBA 3QOCA 1B6AA 3BITA 2GGCA 2EVOA 3MR1A 5JFRA 1Y1NA 5CIKA 3OVKA 5FCFA 4IKTA 5CDVA 3PN9A 4IDYA 1YVMA 4S01A 4QR8A 4OOKA 3FMRA 4PNCA 1N51A 3CTZA 2GG0A 5E2CA 2V3XA 4ZNGA 4FUKA 4MATA 4FLLA 4U6EA 3OOOA 2BWYA 2EVCA 2ZSGA 3TAVA 1WY2A 4S00A 2MATA 3MX6A 2HOWA 4RZZA 4HXXA 2NQ6A 2B3HA 1C22A 5CDEA 2BHCA 2GG8A 1QZYA 3TB5A 1QXWA 5D6FA 1CHMA 5E5BA 1YW8A 3PKBA 4U71A 2GU6A 2BHAA 2EA4A 5FCHA 3PKCA 5CLSA 2NQ7A 2GZ5A 3D27A 4EGEA 4IKSA 2G6PA 2OKNA 2BWTA 4U69A 2BWSA 4RGZ1 1XNZA 2OAZA 1WN1A 4FLJA 4U6ZA 4U6CA 4FLIA 4JUQA 4B28A 2Q92A 2B3LA 1QXZA 1WKMA 2GU7A 4U73A 4U1BA 2V6CA 3CB6A 3L24A 4R60A 2EVMA 2GG3A 2BHDA 2GA2A 1KP0A 1KQ9A 1C23A 1XGNA 4RZYA 1M35A 4IU6A 2BWUA 1YW9A 2Q94A 3IU7A 1WBQA 2GU5A 4U6JA 3FMQA 1A16A 4S2TP 3RORA 3CB5A 1WL6A 3I7MA 1JAWA 2Q96A 3IL0A 4U6WA 1WL9A 1PV9A 4A6WA 1R5GA 2Q93A 4IECA 1C24A 5JHUA 3O5VA 2BH3A 2GGBA 3Q6DA 4FO8A 2P9AA 5D6EA 2BHBA 2IW2A 4U75A 3IU8A 1BOAA 3MATA 4PV4A 1MATA 2GU4A 4FKCA 2EA2A 1R58A 3BIQA 4IKRA 1QXYA 4IPAA 5CDLA 1WLRA 1KQ0A
chains in the Genus database with same CATH topology
4Z7MA 4IKUA 3PKEA 1XGMA 1YW7A 2GG5A 2Q95A 4FLKA 5CNXA 5CE6A 5JI6A 1R5HA 3L7GA 2P98A 4U76A 3BIPA 2BN7A 4KM3A 4ZWUA 2V3ZA 1YJ3A 2BWXA 3RVAA 1W2MA 4S2RP 1O0XA 1XGSA 2GG9A 1C27A 3FM3A 3IU9A 1W7VA 1XGOA 2GG7A 4U70A 2BWVA 3S6BA 3PKDA 2GG2A 4ZWOA 2B3KA 2P99A 2BB7A 3PKAA 4A6VA 2ADUA 1B59A 1BN5A 1C21A 2V3YA 4IF7A 2Q8KA 3IG4A 2DFIA 2GTXA 4FO7A 2BWWA 4ZWPA 3PEBA 3QOCA 1B6AA 3BITA 2GGCA 2EVOA 3MR1A 5JFRA 1Y1NA 5CIKA 3OVKA 5FCFA 4IKTA 5CDVA 3PN9A 4IDYA 1YVMA 4S01A 4QR8A 4OOKA 3FMRA 4PNCA 1N51A 3CTZA 2GG0A 5E2CA 2V3XA 4ZNGA 4FUKA 4MATA 4FLLA 4U6EA 3OOOA 2BWYA 2EVCA 2ZSGA 3TAVA 1WY2A 4S00A 2MATA 3MX6A 2HOWA 4RZZA 4HXXA 2NQ6A 2B3HA 1C22A 5CDEA 2BHCA 2GG8A 1QZYA 3TB5A 1QXWA 5D6FA 1CHMA 5E5BA 1YW8A 3PKBA 4U71A 2GU6A 2BHAA 2EA4A 5FCHA 3PKCA 5CLSA 2NQ7A 2GZ5A 3D27A 4EGEA 4IKSA 2G6PA 2OKNA 2BWTA 4U69A 2BWSA 4RGZ1 1XNZA 2OAZA 1WN1A 4FLJA 4U6ZA 4U6CA 4FLIA 4JUQA 4B28A 2Q92A 2B3LA 1QXZA 1WKMA 2GU7A 4U73A 4U1BA 2V6CA 3CB6A 3L24A 4R60A 2EVMA 2GG3A 2BHDA 2GA2A 1KP0A 1KQ9A 1C23A 1XGNA 4RZYA 1M35A 4IU6A 2BWUA 1YW9A 2Q94A 3IU7A 1WBQA 2GU5A 4U6JA 3FMQA 1A16A 4S2TP 3RORA 3CB5A 1WL6A 3I7MA 1JAWA 2Q96A 3IL0A 4U6WA 1WL9A 1PV9A 4A6WA 1R5GA 2Q93A 4IECA 1C24A 5JHUA 3O5VA 2BH3A 2GGBA 3Q6DA 4FO8A 2P9AA 5D6EA 2BHBA 2IW2A 4U75A 3IU8A 1BOAA 3MATA 4PV4A 1MATA 2GU4A 4FKCA 2EA2A 1R58A 3BIQA 4IKRA 1QXYA 4IPAA 5CDLA 1WLRA 1KQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7M A;  4IKU A;  3PKE A;  1XGM A;  1YW7 A;  2GG5 A;  2Q95 A;  4FLK A;  5CNX A;  5CE6 A;  5JI6 A;  1R5H A;  3L7G A;  2P98 A;  4U76 A;  3BIP A;  2BN7 A;  4KM3 A;  4ZWU A;  2V3Z A;  1YJ3 A;  2BWX A;  3RVA A;  1W2M A;  4S2R P;  1O0X A;  1XGS A;  2GG9 A;  1C27 A;  3FM3 A;  3IU9 A;  1W7V A;  1XGO A;  2GG7 A;  4U70 A;  2BWV A;  3S6B A;  3PKD A;  2GG2 A;  4ZWO A;  2B3K A;  2P99 A;  2BB7 A;  3PKA A;  4A6V A;  2ADU A;  1B59 A;  1BN5 A;  1C21 A;  2V3Y A;  4IF7 A;  2Q8K A;  3IG4 A;  2DFI A;  2GTX A;  4FO7 A;  2BWW A;  4ZWP A;  3PEB A;  3QOC A;  1B6A A;  3BIT A;  2GGC A;  2EVO A;  3MR1 A;  5JFR A;  1Y1N A;  5CIK A;  3OVK A;  5FCF A;  4IKT A;  5CDV A;  3PN9 A;  4IDY A;  1YVM A;  4S01 A;  4QR8 A;  4OOK A;  3FMR A;  4PNC A;  1N51 A;  3CTZ A;  2GG0 A;  5E2C A;  2V3X A;  4ZNG A;  4FUK A;  4MAT A;  4FLL A;  4U6E A;  3OOO A;  2BWY A;  2EVC A;  2ZSG A;  3TAV A;  1WY2 A;  4S00 A;  2MAT A;  3MX6 A;  2HOW A;  4RZZ A;  4HXX A;  2NQ6 A;  2B3H A;  1C22 A;  5CDE A;  2BHC A;  2GG8 A;  1QZY A;  3TB5 A;  1QXW A;  5D6F A;  1CHM A;  5E5B A;  1YW8 A;  3PKB A;  4U71 A;  2GU6 A;  2BHA A;  2EA4 A;  5FCH A;  3PKC A;  5CLS A;  2NQ7 A;  2GZ5 A;  3D27 A;  4EGE A;  4IKS A;  2G6P A;  2OKN A;  2BWT A;  4U69 A;  2BWS A;  4RGZ 1;  1XNZ A;  2OAZ A;  1WN1 A;  4FLJ A;  4U6Z A;  4U6C A;  4FLI A;  4JUQ A;  4B28 A;  2Q92 A;  2B3L A;  1QXZ A;  1WKM A;  2GU7 A;  4U73 A;  4U1B A;  2V6C A;  3CB6 A;  3L24 A;  4R60 A;  2EVM A;  2GG3 A;  2BHD A;  2GA2 A;  1KP0 A;  1KQ9 A;  1C23 A;  1XGN A;  4RZY A;  1M35 A;  4IU6 A;  2BWU A;  1YW9 A;  2Q94 A;  3IU7 A;  1WBQ A;  2GU5 A;  4U6J A;  3FMQ A;  1A16 A;  4S2T P;  3ROR A;  3CB5 A;  1WL6 A;  3I7M A;  1JAW A;  2Q96 A;  3IL0 A;  4U6W A;  1WL9 A;  1PV9 A;  4A6W A;  1R5G A;  2Q93 A;  4IEC A;  1C24 A;  5JHU A;  3O5V A;  2BH3 A;  2GGB A;  3Q6D A;  4FO8 A;  2P9A A;  5D6E A;  2BHB A;  2IW2 A;  4U75 A;  3IU8 A;  1BOA A;  3MAT A;  4PV4 A;  1MAT A;  2GU4 A;  4FKC A;  2EA2 A;  1R58 A;  3BIQ A;  4IKR A;  1QXY A;  4IPA A;  5CDL A;  1WLR A;  1KQ0 A; 
#chains in the Genus database with same CATH topology
 4Z7M A;  4IKU A;  3PKE A;  1XGM A;  1YW7 A;  2GG5 A;  2Q95 A;  4FLK A;  5CNX A;  5CE6 A;  5JI6 A;  1R5H A;  3L7G A;  2P98 A;  4U76 A;  3BIP A;  2BN7 A;  4KM3 A;  4ZWU A;  2V3Z A;  1YJ3 A;  2BWX A;  3RVA A;  1W2M A;  4S2R P;  1O0X A;  1XGS A;  2GG9 A;  1C27 A;  3FM3 A;  3IU9 A;  1W7V A;  1XGO A;  2GG7 A;  4U70 A;  2BWV A;  3S6B A;  3PKD A;  2GG2 A;  4ZWO A;  2B3K A;  2P99 A;  2BB7 A;  3PKA A;  4A6V A;  2ADU A;  1B59 A;  1BN5 A;  1C21 A;  2V3Y A;  4IF7 A;  2Q8K A;  3IG4 A;  2DFI A;  2GTX A;  4FO7 A;  2BWW A;  4ZWP A;  3PEB A;  3QOC A;  1B6A A;  3BIT A;  2GGC A;  2EVO A;  3MR1 A;  5JFR A;  1Y1N A;  5CIK A;  3OVK A;  5FCF A;  4IKT A;  5CDV A;  3PN9 A;  4IDY A;  1YVM A;  4S01 A;  4QR8 A;  4OOK A;  3FMR A;  4PNC A;  1N51 A;  3CTZ A;  2GG0 A;  5E2C A;  2V3X A;  4ZNG A;  4FUK A;  4MAT A;  4FLL A;  4U6E A;  3OOO A;  2BWY A;  2EVC A;  2ZSG A;  3TAV A;  1WY2 A;  4S00 A;  2MAT A;  3MX6 A;  2HOW A;  4RZZ A;  4HXX A;  2NQ6 A;  2B3H A;  1C22 A;  5CDE A;  2BHC A;  2GG8 A;  1QZY A;  3TB5 A;  1QXW A;  5D6F A;  1CHM A;  5E5B A;  1YW8 A;  3PKB A;  4U71 A;  2GU6 A;  2BHA A;  2EA4 A;  5FCH A;  3PKC A;  5CLS A;  2NQ7 A;  2GZ5 A;  3D27 A;  4EGE A;  4IKS A;  2G6P A;  2OKN A;  2BWT A;  4U69 A;  2BWS A;  4RGZ 1;  1XNZ A;  2OAZ A;  1WN1 A;  4FLJ A;  4U6Z A;  4U6C A;  4FLI A;  4JUQ A;  4B28 A;  2Q92 A;  2B3L A;  1QXZ A;  1WKM A;  2GU7 A;  4U73 A;  4U1B A;  2V6C A;  3CB6 A;  3L24 A;  4R60 A;  2EVM A;  2GG3 A;  2BHD A;  2GA2 A;  1KP0 A;  1KQ9 A;  1C23 A;  1XGN A;  4RZY A;  1M35 A;  4IU6 A;  2BWU A;  1YW9 A;  2Q94 A;  3IU7 A;  1WBQ A;  2GU5 A;  4U6J A;  3FMQ A;  1A16 A;  4S2T P;  3ROR A;  3CB5 A;  1WL6 A;  3I7M A;  1JAW A;  2Q96 A;  3IL0 A;  4U6W A;  1WL9 A;  1PV9 A;  4A6W A;  1R5G A;  2Q93 A;  4IEC A;  1C24 A;  5JHU A;  3O5V A;  2BH3 A;  2GGB A;  3Q6D A;  4FO8 A;  2P9A A;  5D6E A;  2BHB A;  2IW2 A;  4U75 A;  3IU8 A;  1BOA A;  3MAT A;  4PV4 A;  1MAT A;  2GU4 A;  4FKC A;  2EA2 A;  1R58 A;  3BIQ A;  4IKR A;  1QXY A;  4IPA A;  5CDL A;  1WLR A;  1KQ0 A; 
#chains in the Genus database with same CATH homology
 4Z7M A;  4IKU A;  3PKE A;  1XGM A;  1YW7 A;  2GG5 A;  2Q95 A;  4FLK A;  5CNX A;  5CE6 A;  5JI6 A;  1R5H A;  3L7G A;  2P98 A;  4U76 A;  3BIP A;  2BN7 A;  4KM3 A;  4ZWU A;  2V3Z A;  1YJ3 A;  2BWX A;  3RVA A;  1W2M A;  4S2R P;  1O0X A;  1XGS A;  2GG9 A;  1C27 A;  3FM3 A;  3IU9 A;  1W7V A;  1XGO A;  2GG7 A;  4U70 A;  2BWV A;  3S6B A;  3PKD A;  2GG2 A;  4ZWO A;  2B3K A;  2P99 A;  2BB7 A;  3PKA A;  4A6V A;  2ADU A;  1B59 A;  1BN5 A;  1C21 A;  2V3Y A;  4IF7 A;  2Q8K A;  3IG4 A;  2DFI A;  2GTX A;  4FO7 A;  2BWW A;  4ZWP A;  3PEB A;  3QOC A;  1B6A A;  3BIT A;  2GGC A;  2EVO A;  3MR1 A;  5JFR A;  1Y1N A;  5CIK A;  3OVK A;  5FCF A;  4IKT A;  5CDV A;  3PN9 A;  4IDY A;  1YVM A;  4S01 A;  4QR8 A;  4OOK A;  3FMR A;  4PNC A;  1N51 A;  3CTZ A;  2GG0 A;  5E2C A;  2V3X A;  4ZNG A;  4FUK A;  4MAT A;  4FLL A;  4U6E A;  3OOO A;  2BWY A;  2EVC A;  2ZSG A;  3TAV A;  1WY2 A;  4S00 A;  2MAT A;  3MX6 A;  2HOW A;  4RZZ A;  4HXX A;  2NQ6 A;  2B3H A;  1C22 A;  5CDE A;  2BHC A;  2GG8 A;  1QZY A;  3TB5 A;  1QXW A;  5D6F A;  1CHM A;  5E5B A;  1YW8 A;  3PKB A;  4U71 A;  2GU6 A;  2BHA A;  2EA4 A;  5FCH A;  3PKC A;  5CLS A;  2NQ7 A;  2GZ5 A;  3D27 A;  4EGE A;  4IKS A;  2G6P A;  2OKN A;  2BWT A;  4U69 A;  2BWS A;  4RGZ 1;  1XNZ A;  2OAZ A;  1WN1 A;  4FLJ A;  4U6Z A;  4U6C A;  4FLI A;  4JUQ A;  4B28 A;  2Q92 A;  2B3L A;  1QXZ A;  1WKM A;  2GU7 A;  4U73 A;  4U1B A;  2V6C A;  3CB6 A;  3L24 A;  4R60 A;  2EVM A;  2GG3 A;  2BHD A;  2GA2 A;  1KP0 A;  1KQ9 A;  1C23 A;  1XGN A;  4RZY A;  1M35 A;  4IU6 A;  2BWU A;  1YW9 A;  2Q94 A;  3IU7 A;  1WBQ A;  2GU5 A;  4U6J A;  3FMQ A;  1A16 A;  4S2T P;  3ROR A;  3CB5 A;  1WL6 A;  3I7M A;  1JAW A;  2Q96 A;  3IL0 A;  4U6W A;  1WL9 A;  1PV9 A;  4A6W A;  1R5G A;  2Q93 A;  4IEC A;  1C24 A;  5JHU A;  3O5V A;  2BH3 A;  2GGB A;  3Q6D A;  4FO8 A;  2P9A A;  5D6E A;  2BHB A;  2IW2 A;  4U75 A;  3IU8 A;  1BOA A;  3MAT A;  4PV4 A;  1MAT A;  2GU4 A;  4FKC A;  2EA2 A;  1R58 A;  3BIQ A;  4IKR A;  1QXY A;  4IPA A;  5CDL A;  1WLR A;  1KQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...