3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
b'MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-pro aminopeptidase
molecule tags Hydrolase
source organism Bacillus anthracis
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
1JAWA 1WBQA 3PN9A 4RGZ1 1YW7A 4IPAA 1WL6A 2GU4A 5CDEA 5E2CA 4U6WA 2GU5A 2BH3A 2GG8A 2V3YA 3FM3A 1KP0A 3D27A 3RVAA 5CDVA 4JUQA 2HOWA 1BN5A 4OOKA 5JHUA 2BWUA 1XGNA 1Y1NA 4IKSA 4IKUA 2BHBA 2GG7A 4U1BA 4U69A 5FCHA 5CNXA 2EVMA 1C24A 1M35A 3Q6DA 1QXWA 1YW9A 2MATA 2GU6A 2NQ7A 4U71A 4R60A 2V3XA 5FCFA 5D6EA 4A6VA 4U70A 3L24A 2ZSGA 1QZYA 4S2RP 3IU8A 3CB6A 3PKBA 1XGMA 3QOCA 4IU6A 2BN7A 4FKCA 3BIPA 2GZ5A 2GG3A 2Q93A 2G6PA 4U6EA 1QXZA 3OVKA 4IDYA 3TAVA 1YVMA 2EA4A 3S6BA 3MX6A 2Q96A 4IECA 2V3ZA 4U73A 5JI6A 1N51A 1A16A 1C21A 2NQ6A 4PNCA 3FMRA 2BWVA 5CDLA 2BB7A 2GGBA 3BIQA 4IF7A 4IKTA 2BWTA 3BITA 4FLLA 3TB5A 5JFRA 4U76A 2GG9A 3FMQA 4U6ZA 4U6CA 2EVCA 2Q95A 2Q8KA 4ZWUA 2GG5A 1MATA 2BWWA 2GU7A 2V6CA 1R58A 4IKRA 2P9AA 4ZWOA 3OOOA 4FO7A 2GG0A 1R5HA 4QR8A 5CE6A 1KQ9A 1B59A 4HXXA 4ZWPA 1BOAA 2EVOA 1W2MA 2B3KA 1PV9A 1B6AA 2BWSA 3IG4A 2EA2A 2Q92A 3PKEA 3CTZA 5CIKA 4FUKA 2B3HA 3O5VA 4S2TP 1XGSA 3IU9A 2OAZA 3L7GA 1CHMA 1W7VA 3MATA 2BWXA 4FLIA 4U75A 3PKCA 2GGCA 4KM3A 5D6FA 2BHAA 2ADUA 3MR1A 1WKMA 2BHDA 5E5BA 3PEBA 4RZZA 4EGEA 3I7MA 1WLRA 2OKNA 1C22A 1R5GA 3RORA 4FO8A 4S00A 1QXYA 2BWYA 4U6JA 1WY2A 1KQ0A 4RZYA 1WN1A 3IU7A 3IL0A 1YW8A 1C23A 1O0XA 2BHCA 2GG2A 4B28A 1C27A 4MATA 4Z7MA 1XGOA 1XNZA 4ZNGA 5CLSA 2Q94A 4FLJA 1WL9A 2IW2A 2DFIA 1YJ3A 3PKDA 3CB5A 2P99A 2P98A 2GA2A 4S01A 3PKAA 4A6WA 2B3LA 2GTXA 4PV4A 4FLKA
chains in the Genus database with same CATH superfamily
1JAWA 1WBQA 3PN9A 4RGZ1 1YW7A 4IPAA 1WL6A 2GU4A 5CDEA 5E2CA 4U6WA 2GU5A 2BH3A 2GG8A 2V3YA 3FM3A 1KP0A 3D27A 3RVAA 5CDVA 4JUQA 2HOWA 1BN5A 4OOKA 5JHUA 2BWUA 1XGNA 1Y1NA 4IKSA 4IKUA 2BHBA 2GG7A 4U1BA 4U69A 5FCHA 5CNXA 2EVMA 1C24A 1M35A 3Q6DA 1QXWA 1YW9A 2MATA 2GU6A 2NQ7A 4U71A 4R60A 2V3XA 5FCFA 5D6EA 4A6VA 4U70A 3L24A 2ZSGA 1QZYA 4S2RP 3IU8A 3CB6A 3PKBA 1XGMA 3QOCA 4IU6A 2BN7A 4FKCA 3BIPA 2GZ5A 2GG3A 2Q93A 2G6PA 4U6EA 1QXZA 3OVKA 4IDYA 3TAVA 1YVMA 2EA4A 3S6BA 3MX6A 2Q96A 4IECA 2V3ZA 4U73A 5JI6A 1N51A 1A16A 1C21A 2NQ6A 4PNCA 3FMRA 2BWVA 5CDLA 2BB7A 2GGBA 3BIQA 4IF7A 4IKTA 2BWTA 3BITA 4FLLA 3TB5A 5JFRA 4U76A 2GG9A 3FMQA 4U6ZA 4U6CA 2EVCA 2Q95A 2Q8KA 4ZWUA 2GG5A 1MATA 2BWWA 2GU7A 2V6CA 1R58A 4IKRA 2P9AA 4ZWOA 3OOOA 4FO7A 2GG0A 1R5HA 4QR8A 5CE6A 1KQ9A 1B59A 4HXXA 4ZWPA 1BOAA 2EVOA 1W2MA 2B3KA 1PV9A 1B6AA 2BWSA 3IG4A 2EA2A 2Q92A 3PKEA 3CTZA 5CIKA 4FUKA 2B3HA 3O5VA 4S2TP 1XGSA 3IU9A 2OAZA 3L7GA 1CHMA 1W7VA 3MATA 2BWXA 4FLIA 4U75A 3PKCA 2GGCA 4KM3A 5D6FA 2BHAA 2ADUA 3MR1A 1WKMA 2BHDA 5E5BA 3PEBA 4RZZA 4EGEA 3I7MA 1WLRA 2OKNA 1C22A 1R5GA 3RORA 4FO8A 4S00A 1QXYA 2BWYA 4U6JA 1WY2A 1KQ0A 4RZYA 1WN1A 3IU7A 3IL0A 1YW8A 1C23A 1O0XA 2BHCA 2GG2A 4B28A 1C27A 4MATA 4Z7MA 1XGOA 1XNZA 4ZNGA 5CLSA 2Q94A 4FLJA 1WL9A 2IW2A 2DFIA 1YJ3A 3PKDA 3CB5A 2P99A 2P98A 2GA2A 4S01A 3PKAA 4A6WA 2B3LA 2GTXA 4PV4A 4FLKA
chains in the Genus database with same CATH topology
1JAWA 1WBQA 3PN9A 4RGZ1 1YW7A 4IPAA 1WL6A 2GU4A 5CDEA 5E2CA 4U6WA 2GU5A 2BH3A 2GG8A 2V3YA 3FM3A 1KP0A 3D27A 3RVAA 5CDVA 4JUQA 2HOWA 1BN5A 4OOKA 5JHUA 2BWUA 1XGNA 1Y1NA 4IKSA 4IKUA 2BHBA 2GG7A 4U1BA 4U69A 5FCHA 5CNXA 2EVMA 1C24A 1M35A 3Q6DA 1QXWA 1YW9A 2MATA 2GU6A 2NQ7A 4U71A 4R60A 2V3XA 5FCFA 5D6EA 4A6VA 4U70A 3L24A 2ZSGA 1QZYA 4S2RP 3IU8A 3CB6A 3PKBA 1XGMA 3QOCA 4IU6A 2BN7A 4FKCA 3BIPA 2GZ5A 2GG3A 2Q93A 2G6PA 4U6EA 1QXZA 3OVKA 4IDYA 3TAVA 1YVMA 2EA4A 3S6BA 3MX6A 2Q96A 4IECA 2V3ZA 4U73A 5JI6A 1N51A 1A16A 1C21A 2NQ6A 4PNCA 3FMRA 2BWVA 5CDLA 2BB7A 2GGBA 3BIQA 4IF7A 4IKTA 2BWTA 3BITA 4FLLA 3TB5A 5JFRA 4U76A 2GG9A 3FMQA 4U6ZA 4U6CA 2EVCA 2Q95A 2Q8KA 4ZWUA 2GG5A 1MATA 2BWWA 2GU7A 2V6CA 1R58A 4IKRA 2P9AA 4ZWOA 3OOOA 4FO7A 2GG0A 1R5HA 4QR8A 5CE6A 1KQ9A 1B59A 4HXXA 4ZWPA 1BOAA 2EVOA 1W2MA 2B3KA 1PV9A 1B6AA 2BWSA 3IG4A 2EA2A 2Q92A 3PKEA 3CTZA 5CIKA 4FUKA 2B3HA 3O5VA 4S2TP 1XGSA 3IU9A 2OAZA 3L7GA 1CHMA 1W7VA 3MATA 2BWXA 4FLIA 4U75A 3PKCA 2GGCA 4KM3A 5D6FA 2BHAA 2ADUA 3MR1A 1WKMA 2BHDA 5E5BA 3PEBA 4RZZA 4EGEA 3I7MA 1WLRA 2OKNA 1C22A 1R5GA 3RORA 4FO8A 4S00A 1QXYA 2BWYA 4U6JA 1WY2A 1KQ0A 4RZYA 1WN1A 3IU7A 3IL0A 1YW8A 1C23A 1O0XA 2BHCA 2GG2A 4B28A 1C27A 4MATA 4Z7MA 1XGOA 1XNZA 4ZNGA 5CLSA 2Q94A 4FLJA 1WL9A 2IW2A 2DFIA 1YJ3A 3PKDA 3CB5A 2P99A 2P98A 2GA2A 4S01A 3PKAA 4A6WA 2B3LA 2GTXA 4PV4A 4FLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAW A;  1WBQ A;  3PN9 A;  4RGZ 1;  1YW7 A;  4IPA A;  1WL6 A;  2GU4 A;  5CDE A;  5E2C A;  4U6W A;  2GU5 A;  2BH3 A;  2GG8 A;  2V3Y A;  3FM3 A;  1KP0 A;  3D27 A;  3RVA A;  5CDV A;  4JUQ A;  2HOW A;  1BN5 A;  4OOK A;  5JHU A;  2BWU A;  1XGN A;  1Y1N A;  4IKS A;  4IKU A;  2BHB A;  2GG7 A;  4U1B A;  4U69 A;  5FCH A;  5CNX A;  2EVM A;  1C24 A;  1M35 A;  3Q6D A;  1QXW A;  1YW9 A;  2MAT A;  2GU6 A;  2NQ7 A;  4U71 A;  4R60 A;  2V3X A;  5FCF A;  5D6E A;  4A6V A;  4U70 A;  3L24 A;  2ZSG A;  1QZY A;  4S2R P;  3IU8 A;  3CB6 A;  3PKB A;  1XGM A;  3QOC A;  4IU6 A;  2BN7 A;  4FKC A;  3BIP A;  2GZ5 A;  2GG3 A;  2Q93 A;  2G6P A;  4U6E A;  1QXZ A;  3OVK A;  4IDY A;  3TAV A;  1YVM A;  2EA4 A;  3S6B A;  3MX6 A;  2Q96 A;  4IEC A;  2V3Z A;  4U73 A;  5JI6 A;  1N51 A;  1A16 A;  1C21 A;  2NQ6 A;  4PNC A;  3FMR A;  2BWV A;  5CDL A;  2BB7 A;  2GGB A;  3BIQ A;  4IF7 A;  4IKT A;  2BWT A;  3BIT A;  4FLL A;  3TB5 A;  5JFR A;  4U76 A;  2GG9 A;  3FMQ A;  4U6Z A;  4U6C A;  2EVC A;  2Q95 A;  2Q8K A;  4ZWU A;  2GG5 A;  1MAT A;  2BWW A;  2GU7 A;  2V6C A;  1R58 A;  4IKR A;  2P9A A;  4ZWO A;  3OOO A;  4FO7 A;  2GG0 A;  1R5H A;  4QR8 A;  5CE6 A;  1KQ9 A;  1B59 A;  4HXX A;  4ZWP A;  1BOA A;  2EVO A;  1W2M A;  2B3K A;  1PV9 A;  1B6A A;  2BWS A;  3IG4 A;  2EA2 A;  2Q92 A;  3PKE A;  3CTZ A;  5CIK A;  4FUK A;  2B3H A;  3O5V A;  4S2T P;  1XGS A;  3IU9 A;  2OAZ A;  3L7G A;  1CHM A;  1W7V A;  3MAT A;  2BWX A;  4FLI A;  4U75 A;  3PKC A;  2GGC A;  4KM3 A;  5D6F A;  2BHA A;  2ADU A;  3MR1 A;  1WKM A;  2BHD A;  5E5B A;  3PEB A;  4RZZ A;  4EGE A;  3I7M A;  1WLR A;  2OKN A;  1C22 A;  1R5G A;  3ROR A;  4FO8 A;  4S00 A;  1QXY A;  2BWY A;  4U6J A;  1WY2 A;  1KQ0 A;  4RZY A;  1WN1 A;  3IU7 A;  3IL0 A;  1YW8 A;  1C23 A;  1O0X A;  2BHC A;  2GG2 A;  4B28 A;  1C27 A;  4MAT A;  4Z7M A;  1XGO A;  1XNZ A;  4ZNG A;  5CLS A;  2Q94 A;  4FLJ A;  1WL9 A;  2IW2 A;  2DFI A;  1YJ3 A;  3PKD A;  3CB5 A;  2P99 A;  2P98 A;  2GA2 A;  4S01 A;  3PKA A;  4A6W A;  2B3L A;  2GTX A;  4PV4 A;  4FLK A; 
#chains in the Genus database with same CATH topology
 1JAW A;  1WBQ A;  3PN9 A;  4RGZ 1;  1YW7 A;  4IPA A;  1WL6 A;  2GU4 A;  5CDE A;  5E2C A;  4U6W A;  2GU5 A;  2BH3 A;  2GG8 A;  2V3Y A;  3FM3 A;  1KP0 A;  3D27 A;  3RVA A;  5CDV A;  4JUQ A;  2HOW A;  1BN5 A;  4OOK A;  5JHU A;  2BWU A;  1XGN A;  1Y1N A;  4IKS A;  4IKU A;  2BHB A;  2GG7 A;  4U1B A;  4U69 A;  5FCH A;  5CNX A;  2EVM A;  1C24 A;  1M35 A;  3Q6D A;  1QXW A;  1YW9 A;  2MAT A;  2GU6 A;  2NQ7 A;  4U71 A;  4R60 A;  2V3X A;  5FCF A;  5D6E A;  4A6V A;  4U70 A;  3L24 A;  2ZSG A;  1QZY A;  4S2R P;  3IU8 A;  3CB6 A;  3PKB A;  1XGM A;  3QOC A;  4IU6 A;  2BN7 A;  4FKC A;  3BIP A;  2GZ5 A;  2GG3 A;  2Q93 A;  2G6P A;  4U6E A;  1QXZ A;  3OVK A;  4IDY A;  3TAV A;  1YVM A;  2EA4 A;  3S6B A;  3MX6 A;  2Q96 A;  4IEC A;  2V3Z A;  4U73 A;  5JI6 A;  1N51 A;  1A16 A;  1C21 A;  2NQ6 A;  4PNC A;  3FMR A;  2BWV A;  5CDL A;  2BB7 A;  2GGB A;  3BIQ A;  4IF7 A;  4IKT A;  2BWT A;  3BIT A;  4FLL A;  3TB5 A;  5JFR A;  4U76 A;  2GG9 A;  3FMQ A;  4U6Z A;  4U6C A;  2EVC A;  2Q95 A;  2Q8K A;  4ZWU A;  2GG5 A;  1MAT A;  2BWW A;  2GU7 A;  2V6C A;  1R58 A;  4IKR A;  2P9A A;  4ZWO A;  3OOO A;  4FO7 A;  2GG0 A;  1R5H A;  4QR8 A;  5CE6 A;  1KQ9 A;  1B59 A;  4HXX A;  4ZWP A;  1BOA A;  2EVO A;  1W2M A;  2B3K A;  1PV9 A;  1B6A A;  2BWS A;  3IG4 A;  2EA2 A;  2Q92 A;  3PKE A;  3CTZ A;  5CIK A;  4FUK A;  2B3H A;  3O5V A;  4S2T P;  1XGS A;  3IU9 A;  2OAZ A;  3L7G A;  1CHM A;  1W7V A;  3MAT A;  2BWX A;  4FLI A;  4U75 A;  3PKC A;  2GGC A;  4KM3 A;  5D6F A;  2BHA A;  2ADU A;  3MR1 A;  1WKM A;  2BHD A;  5E5B A;  3PEB A;  4RZZ A;  4EGE A;  3I7M A;  1WLR A;  2OKN A;  1C22 A;  1R5G A;  3ROR A;  4FO8 A;  4S00 A;  1QXY A;  2BWY A;  4U6J A;  1WY2 A;  1KQ0 A;  4RZY A;  1WN1 A;  3IU7 A;  3IL0 A;  1YW8 A;  1C23 A;  1O0X A;  2BHC A;  2GG2 A;  4B28 A;  1C27 A;  4MAT A;  4Z7M A;  1XGO A;  1XNZ A;  4ZNG A;  5CLS A;  2Q94 A;  4FLJ A;  1WL9 A;  2IW2 A;  2DFI A;  1YJ3 A;  3PKD A;  3CB5 A;  2P99 A;  2P98 A;  2GA2 A;  4S01 A;  3PKA A;  4A6W A;  2B3L A;  2GTX A;  4PV4 A;  4FLK A; 
#chains in the Genus database with same CATH homology
 1JAW A;  1WBQ A;  3PN9 A;  4RGZ 1;  1YW7 A;  4IPA A;  1WL6 A;  2GU4 A;  5CDE A;  5E2C A;  4U6W A;  2GU5 A;  2BH3 A;  2GG8 A;  2V3Y A;  3FM3 A;  1KP0 A;  3D27 A;  3RVA A;  5CDV A;  4JUQ A;  2HOW A;  1BN5 A;  4OOK A;  5JHU A;  2BWU A;  1XGN A;  1Y1N A;  4IKS A;  4IKU A;  2BHB A;  2GG7 A;  4U1B A;  4U69 A;  5FCH A;  5CNX A;  2EVM A;  1C24 A;  1M35 A;  3Q6D A;  1QXW A;  1YW9 A;  2MAT A;  2GU6 A;  2NQ7 A;  4U71 A;  4R60 A;  2V3X A;  5FCF A;  5D6E A;  4A6V A;  4U70 A;  3L24 A;  2ZSG A;  1QZY A;  4S2R P;  3IU8 A;  3CB6 A;  3PKB A;  1XGM A;  3QOC A;  4IU6 A;  2BN7 A;  4FKC A;  3BIP A;  2GZ5 A;  2GG3 A;  2Q93 A;  2G6P A;  4U6E A;  1QXZ A;  3OVK A;  4IDY A;  3TAV A;  1YVM A;  2EA4 A;  3S6B A;  3MX6 A;  2Q96 A;  4IEC A;  2V3Z A;  4U73 A;  5JI6 A;  1N51 A;  1A16 A;  1C21 A;  2NQ6 A;  4PNC A;  3FMR A;  2BWV A;  5CDL A;  2BB7 A;  2GGB A;  3BIQ A;  4IF7 A;  4IKT A;  2BWT A;  3BIT A;  4FLL A;  3TB5 A;  5JFR A;  4U76 A;  2GG9 A;  3FMQ A;  4U6Z A;  4U6C A;  2EVC A;  2Q95 A;  2Q8K A;  4ZWU A;  2GG5 A;  1MAT A;  2BWW A;  2GU7 A;  2V6C A;  1R58 A;  4IKR A;  2P9A A;  4ZWO A;  3OOO A;  4FO7 A;  2GG0 A;  1R5H A;  4QR8 A;  5CE6 A;  1KQ9 A;  1B59 A;  4HXX A;  4ZWP A;  1BOA A;  2EVO A;  1W2M A;  2B3K A;  1PV9 A;  1B6A A;  2BWS A;  3IG4 A;  2EA2 A;  2Q92 A;  3PKE A;  3CTZ A;  5CIK A;  4FUK A;  2B3H A;  3O5V A;  4S2T P;  1XGS A;  3IU9 A;  2OAZ A;  3L7G A;  1CHM A;  1W7V A;  3MAT A;  2BWX A;  4FLI A;  4U75 A;  3PKC A;  2GGC A;  4KM3 A;  5D6F A;  2BHA A;  2ADU A;  3MR1 A;  1WKM A;  2BHD A;  5E5B A;  3PEB A;  4RZZ A;  4EGE A;  3I7M A;  1WLR A;  2OKN A;  1C22 A;  1R5G A;  3ROR A;  4FO8 A;  4S00 A;  1QXY A;  2BWY A;  4U6J A;  1WY2 A;  1KQ0 A;  4RZY A;  1WN1 A;  3IU7 A;  3IL0 A;  1YW8 A;  1C23 A;  1O0X A;  2BHC A;  2GG2 A;  4B28 A;  1C27 A;  4MAT A;  4Z7M A;  1XGO A;  1XNZ A;  4ZNG A;  5CLS A;  2Q94 A;  4FLJ A;  1WL9 A;  2IW2 A;  2DFI A;  1YJ3 A;  3PKD A;  3CB5 A;  2P99 A;  2P98 A;  2GA2 A;  4S01 A;  3PKA A;  4A6W A;  2B3L A;  2GTX A;  4PV4 A;  4FLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...