3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-pro aminopeptidase
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
4S2RP 1C27A 1C23A 4ZWOA 3O5VA 1KP0A 2BN7A 1KQ0A 1MATA 2GGBA 4IKRA 2GA2A 2BWTA 2P9AA 1XGSA 4U76A 4B28A 3FMQA 2V3ZA 3CB6A 2B3KA 3PKDA 4U6WA 1B6AA 2V6CA 3MX6A 5JI6A 1W2MA 4IU6A 4A6VA 2HOWA 1R58A 1Y1NA 2GGCA 3RORA 1WLRA 2GG9A 2GG8A 2Q95A 2GG0A 1XGNA 1KQ9A 2GU4A 4RGZ1 4U1BA 2NQ6A 2BHAA 1YVMA 5D6FA 3FMRA 4FLKA 4U6CA 4U73A 3PKAA 4JUQA 2BWUA 4IKTA 2BWXA 4A6WA 4U6JA 3OVKA 1YW8A 4FLJA 4FUKA 4OOKA 3OOOA 3IL0A 5CNXA 1YW9A 2Q92A 2EVOA 4PNCA 3CTZA 3PEBA 4U70A 2IW2A 4IECA 2BHDA 1WBQA 2Q96A 2BHBA 3BIQA 1WKMA 4QR8A 4PV4A 2GU7A 5CDLA 2ADUA 4IPAA 1QXYA 1BN5A 1A16A 3S6BA 1C24A 1YJ3A 1JAWA 2DFIA 4HXXA 2V3YA 2ZSGA 2GG5A 2EVMA 2OKNA 2P98A 2EA4A 4RZZA 5E5BA 5CE6A 1WN1A 3PKBA 2GU6A 1QZYA 1WY2A 1YW7A 3TB5A 4KM3A 3IU7A 2BWVA 2B3LA 1O0XA 1WL9A 2Q8KA 1PV9A 3Q6DA 4ZWUA 4U6ZA 1XGOA 2BWSA 2GZ5A 5FCFA 1R5HA 1XGMA 4R60A 4S01A 3FM3A 3IU8A 4U75A 3L24A 4ZWPA 3MR1A 4EGEA 1W7VA 2P99A 5FCHA 3PKEA 2B3HA 2MATA 4MATA 4FO8A 1BOAA 3IU9A 4Z7MA 4U69A 2G6PA 4FLLA 3D27A 5JHUA 2Q93A 4U6EA 3QOCA 4S2TP 3BIPA 5CIKA 2BWWA 2BWYA 4FKCA 4FO7A 4ZNGA 3MATA 1N51A 2EVCA 2BB7A 2BH3A 2GTXA 3PN9A 4IKUA 2GG7A 1M35A 3I7MA 4RZYA 1XNZA 5JFRA 3PKCA 3RVAA 2V3XA 1R5GA 4FLIA 4U71A 5D6EA 2NQ7A 3CB5A 5E2CA 5CDEA 3L7GA 1C21A 1QXWA 2Q94A 2OAZA 1CHMA 4IDYA 2BHCA 1C22A 4IF7A 4IKSA 2EA2A 1QXZA 3TAVA 3IG4A 5CDVA 3BITA 4S00A 2GG2A 2GU5A 2GG3A 1WL6A 5CLSA 1B59A
chains in the Genus database with same CATH superfamily
4S2RP 1C27A 1C23A 4ZWOA 3O5VA 1KP0A 2BN7A 1KQ0A 1MATA 2GGBA 4IKRA 2GA2A 2BWTA 2P9AA 1XGSA 4U76A 4B28A 3FMQA 2V3ZA 3CB6A 2B3KA 3PKDA 4U6WA 1B6AA 2V6CA 3MX6A 5JI6A 1W2MA 4IU6A 4A6VA 2HOWA 1R58A 1Y1NA 2GGCA 3RORA 1WLRA 2GG9A 2GG8A 2Q95A 2GG0A 1XGNA 1KQ9A 2GU4A 4RGZ1 4U1BA 2NQ6A 2BHAA 1YVMA 5D6FA 3FMRA 4FLKA 4U6CA 4U73A 3PKAA 4JUQA 2BWUA 4IKTA 2BWXA 4A6WA 4U6JA 3OVKA 1YW8A 4FLJA 4FUKA 4OOKA 3OOOA 3IL0A 5CNXA 1YW9A 2Q92A 2EVOA 4PNCA 3CTZA 3PEBA 4U70A 2IW2A 4IECA 2BHDA 1WBQA 2Q96A 2BHBA 3BIQA 1WKMA 4QR8A 4PV4A 2GU7A 5CDLA 2ADUA 4IPAA 1QXYA 1BN5A 1A16A 3S6BA 1C24A 1YJ3A 1JAWA 2DFIA 4HXXA 2V3YA 2ZSGA 2GG5A 2EVMA 2OKNA 2P98A 2EA4A 4RZZA 5E5BA 5CE6A 1WN1A 3PKBA 2GU6A 1QZYA 1WY2A 1YW7A 3TB5A 4KM3A 3IU7A 2BWVA 2B3LA 1O0XA 1WL9A 2Q8KA 1PV9A 3Q6DA 4ZWUA 4U6ZA 1XGOA 2BWSA 2GZ5A 5FCFA 1R5HA 1XGMA 4R60A 4S01A 3FM3A 3IU8A 4U75A 3L24A 4ZWPA 3MR1A 4EGEA 1W7VA 2P99A 5FCHA 3PKEA 2B3HA 2MATA 4MATA 4FO8A 1BOAA 3IU9A 4Z7MA 4U69A 2G6PA 4FLLA 3D27A 5JHUA 2Q93A 4U6EA 3QOCA 4S2TP 3BIPA 5CIKA 2BWWA 2BWYA 4FKCA 4FO7A 4ZNGA 3MATA 1N51A 2EVCA 2BB7A 2BH3A 2GTXA 3PN9A 4IKUA 2GG7A 1M35A 3I7MA 4RZYA 1XNZA 5JFRA 3PKCA 3RVAA 2V3XA 1R5GA 4FLIA 4U71A 5D6EA 2NQ7A 3CB5A 5E2CA 5CDEA 3L7GA 1C21A 1QXWA 2Q94A 2OAZA 1CHMA 4IDYA 2BHCA 1C22A 4IF7A 4IKSA 2EA2A 1QXZA 3TAVA 3IG4A 5CDVA 3BITA 4S00A 2GG2A 2GU5A 2GG3A 1WL6A 5CLSA 1B59A
chains in the Genus database with same CATH topology
4S2RP 1C27A 1C23A 4ZWOA 3O5VA 1KP0A 2BN7A 1KQ0A 1MATA 2GGBA 4IKRA 2GA2A 2BWTA 2P9AA 1XGSA 4U76A 4B28A 3FMQA 2V3ZA 3CB6A 2B3KA 3PKDA 4U6WA 1B6AA 2V6CA 3MX6A 5JI6A 1W2MA 4IU6A 4A6VA 2HOWA 1R58A 1Y1NA 2GGCA 3RORA 1WLRA 2GG9A 2GG8A 2Q95A 2GG0A 1XGNA 1KQ9A 2GU4A 4RGZ1 4U1BA 2NQ6A 2BHAA 1YVMA 5D6FA 3FMRA 4FLKA 4U6CA 4U73A 3PKAA 4JUQA 2BWUA 4IKTA 2BWXA 4A6WA 4U6JA 3OVKA 1YW8A 4FLJA 4FUKA 4OOKA 3OOOA 3IL0A 5CNXA 1YW9A 2Q92A 2EVOA 4PNCA 3CTZA 3PEBA 4U70A 2IW2A 4IECA 2BHDA 1WBQA 2Q96A 2BHBA 3BIQA 1WKMA 4QR8A 4PV4A 2GU7A 5CDLA 2ADUA 4IPAA 1QXYA 1BN5A 1A16A 3S6BA 1C24A 1YJ3A 1JAWA 2DFIA 4HXXA 2V3YA 2ZSGA 2GG5A 2EVMA 2OKNA 2P98A 2EA4A 4RZZA 5E5BA 5CE6A 1WN1A 3PKBA 2GU6A 1QZYA 1WY2A 1YW7A 3TB5A 4KM3A 3IU7A 2BWVA 2B3LA 1O0XA 1WL9A 2Q8KA 1PV9A 3Q6DA 4ZWUA 4U6ZA 1XGOA 2BWSA 2GZ5A 5FCFA 1R5HA 1XGMA 4R60A 4S01A 3FM3A 3IU8A 4U75A 3L24A 4ZWPA 3MR1A 4EGEA 1W7VA 2P99A 5FCHA 3PKEA 2B3HA 2MATA 4MATA 4FO8A 1BOAA 3IU9A 4Z7MA 4U69A 2G6PA 4FLLA 3D27A 5JHUA 2Q93A 4U6EA 3QOCA 4S2TP 3BIPA 5CIKA 2BWWA 2BWYA 4FKCA 4FO7A 4ZNGA 3MATA 1N51A 2EVCA 2BB7A 2BH3A 2GTXA 3PN9A 4IKUA 2GG7A 1M35A 3I7MA 4RZYA 1XNZA 5JFRA 3PKCA 3RVAA 2V3XA 1R5GA 4FLIA 4U71A 5D6EA 2NQ7A 3CB5A 5E2CA 5CDEA 3L7GA 1C21A 1QXWA 2Q94A 2OAZA 1CHMA 4IDYA 2BHCA 1C22A 4IF7A 4IKSA 2EA2A 1QXZA 3TAVA 3IG4A 5CDVA 3BITA 4S00A 2GG2A 2GU5A 2GG3A 1WL6A 5CLSA 1B59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2R P;  1C27 A;  1C23 A;  4ZWO A;  3O5V A;  1KP0 A;  2BN7 A;  1KQ0 A;  1MAT A;  2GGB A;  4IKR A;  2GA2 A;  2BWT A;  2P9A A;  1XGS A;  4U76 A;  4B28 A;  3FMQ A;  2V3Z A;  3CB6 A;  2B3K A;  3PKD A;  4U6W A;  1B6A A;  2V6C A;  3MX6 A;  5JI6 A;  1W2M A;  4IU6 A;  4A6V A;  2HOW A;  1R58 A;  1Y1N A;  2GGC A;  3ROR A;  1WLR A;  2GG9 A;  2GG8 A;  2Q95 A;  2GG0 A;  1XGN A;  1KQ9 A;  2GU4 A;  4RGZ 1;  4U1B A;  2NQ6 A;  2BHA A;  1YVM A;  5D6F A;  3FMR A;  4FLK A;  4U6C A;  4U73 A;  3PKA A;  4JUQ A;  2BWU A;  4IKT A;  2BWX A;  4A6W A;  4U6J A;  3OVK A;  1YW8 A;  4FLJ A;  4FUK A;  4OOK A;  3OOO A;  3IL0 A;  5CNX A;  1YW9 A;  2Q92 A;  2EVO A;  4PNC A;  3CTZ A;  3PEB A;  4U70 A;  2IW2 A;  4IEC A;  2BHD A;  1WBQ A;  2Q96 A;  2BHB A;  3BIQ A;  1WKM A;  4QR8 A;  4PV4 A;  2GU7 A;  5CDL A;  2ADU A;  4IPA A;  1QXY A;  1BN5 A;  1A16 A;  3S6B A;  1C24 A;  1YJ3 A;  1JAW A;  2DFI A;  4HXX A;  2V3Y A;  2ZSG A;  2GG5 A;  2EVM A;  2OKN A;  2P98 A;  2EA4 A;  4RZZ A;  5E5B A;  5CE6 A;  1WN1 A;  3PKB A;  2GU6 A;  1QZY A;  1WY2 A;  1YW7 A;  3TB5 A;  4KM3 A;  3IU7 A;  2BWV A;  2B3L A;  1O0X A;  1WL9 A;  2Q8K A;  1PV9 A;  3Q6D A;  4ZWU A;  4U6Z A;  1XGO A;  2BWS A;  2GZ5 A;  5FCF A;  1R5H A;  1XGM A;  4R60 A;  4S01 A;  3FM3 A;  3IU8 A;  4U75 A;  3L24 A;  4ZWP A;  3MR1 A;  4EGE A;  1W7V A;  2P99 A;  5FCH A;  3PKE A;  2B3H A;  2MAT A;  4MAT A;  4FO8 A;  1BOA A;  3IU9 A;  4Z7M A;  4U69 A;  2G6P A;  4FLL A;  3D27 A;  5JHU A;  2Q93 A;  4U6E A;  3QOC A;  4S2T P;  3BIP A;  5CIK A;  2BWW A;  2BWY A;  4FKC A;  4FO7 A;  4ZNG A;  3MAT A;  1N51 A;  2EVC A;  2BB7 A;  2BH3 A;  2GTX A;  3PN9 A;  4IKU A;  2GG7 A;  1M35 A;  3I7M A;  4RZY A;  1XNZ A;  5JFR A;  3PKC A;  3RVA A;  2V3X A;  1R5G A;  4FLI A;  4U71 A;  5D6E A;  2NQ7 A;  3CB5 A;  5E2C A;  5CDE A;  3L7G A;  1C21 A;  1QXW A;  2Q94 A;  2OAZ A;  1CHM A;  4IDY A;  2BHC A;  1C22 A;  4IF7 A;  4IKS A;  2EA2 A;  1QXZ A;  3TAV A;  3IG4 A;  5CDV A;  3BIT A;  4S00 A;  2GG2 A;  2GU5 A;  2GG3 A;  1WL6 A;  5CLS A;  1B59 A; 
#chains in the Genus database with same CATH topology
 4S2R P;  1C27 A;  1C23 A;  4ZWO A;  3O5V A;  1KP0 A;  2BN7 A;  1KQ0 A;  1MAT A;  2GGB A;  4IKR A;  2GA2 A;  2BWT A;  2P9A A;  1XGS A;  4U76 A;  4B28 A;  3FMQ A;  2V3Z A;  3CB6 A;  2B3K A;  3PKD A;  4U6W A;  1B6A A;  2V6C A;  3MX6 A;  5JI6 A;  1W2M A;  4IU6 A;  4A6V A;  2HOW A;  1R58 A;  1Y1N A;  2GGC A;  3ROR A;  1WLR A;  2GG9 A;  2GG8 A;  2Q95 A;  2GG0 A;  1XGN A;  1KQ9 A;  2GU4 A;  4RGZ 1;  4U1B A;  2NQ6 A;  2BHA A;  1YVM A;  5D6F A;  3FMR A;  4FLK A;  4U6C A;  4U73 A;  3PKA A;  4JUQ A;  2BWU A;  4IKT A;  2BWX A;  4A6W A;  4U6J A;  3OVK A;  1YW8 A;  4FLJ A;  4FUK A;  4OOK A;  3OOO A;  3IL0 A;  5CNX A;  1YW9 A;  2Q92 A;  2EVO A;  4PNC A;  3CTZ A;  3PEB A;  4U70 A;  2IW2 A;  4IEC A;  2BHD A;  1WBQ A;  2Q96 A;  2BHB A;  3BIQ A;  1WKM A;  4QR8 A;  4PV4 A;  2GU7 A;  5CDL A;  2ADU A;  4IPA A;  1QXY A;  1BN5 A;  1A16 A;  3S6B A;  1C24 A;  1YJ3 A;  1JAW A;  2DFI A;  4HXX A;  2V3Y A;  2ZSG A;  2GG5 A;  2EVM A;  2OKN A;  2P98 A;  2EA4 A;  4RZZ A;  5E5B A;  5CE6 A;  1WN1 A;  3PKB A;  2GU6 A;  1QZY A;  1WY2 A;  1YW7 A;  3TB5 A;  4KM3 A;  3IU7 A;  2BWV A;  2B3L A;  1O0X A;  1WL9 A;  2Q8K A;  1PV9 A;  3Q6D A;  4ZWU A;  4U6Z A;  1XGO A;  2BWS A;  2GZ5 A;  5FCF A;  1R5H A;  1XGM A;  4R60 A;  4S01 A;  3FM3 A;  3IU8 A;  4U75 A;  3L24 A;  4ZWP A;  3MR1 A;  4EGE A;  1W7V A;  2P99 A;  5FCH A;  3PKE A;  2B3H A;  2MAT A;  4MAT A;  4FO8 A;  1BOA A;  3IU9 A;  4Z7M A;  4U69 A;  2G6P A;  4FLL A;  3D27 A;  5JHU A;  2Q93 A;  4U6E A;  3QOC A;  4S2T P;  3BIP A;  5CIK A;  2BWW A;  2BWY A;  4FKC A;  4FO7 A;  4ZNG A;  3MAT A;  1N51 A;  2EVC A;  2BB7 A;  2BH3 A;  2GTX A;  3PN9 A;  4IKU A;  2GG7 A;  1M35 A;  3I7M A;  4RZY A;  1XNZ A;  5JFR A;  3PKC A;  3RVA A;  2V3X A;  1R5G A;  4FLI A;  4U71 A;  5D6E A;  2NQ7 A;  3CB5 A;  5E2C A;  5CDE A;  3L7G A;  1C21 A;  1QXW A;  2Q94 A;  2OAZ A;  1CHM A;  4IDY A;  2BHC A;  1C22 A;  4IF7 A;  4IKS A;  2EA2 A;  1QXZ A;  3TAV A;  3IG4 A;  5CDV A;  3BIT A;  4S00 A;  2GG2 A;  2GU5 A;  2GG3 A;  1WL6 A;  5CLS A;  1B59 A; 
#chains in the Genus database with same CATH homology
 4S2R P;  1C27 A;  1C23 A;  4ZWO A;  3O5V A;  1KP0 A;  2BN7 A;  1KQ0 A;  1MAT A;  2GGB A;  4IKR A;  2GA2 A;  2BWT A;  2P9A A;  1XGS A;  4U76 A;  4B28 A;  3FMQ A;  2V3Z A;  3CB6 A;  2B3K A;  3PKD A;  4U6W A;  1B6A A;  2V6C A;  3MX6 A;  5JI6 A;  1W2M A;  4IU6 A;  4A6V A;  2HOW A;  1R58 A;  1Y1N A;  2GGC A;  3ROR A;  1WLR A;  2GG9 A;  2GG8 A;  2Q95 A;  2GG0 A;  1XGN A;  1KQ9 A;  2GU4 A;  4RGZ 1;  4U1B A;  2NQ6 A;  2BHA A;  1YVM A;  5D6F A;  3FMR A;  4FLK A;  4U6C A;  4U73 A;  3PKA A;  4JUQ A;  2BWU A;  4IKT A;  2BWX A;  4A6W A;  4U6J A;  3OVK A;  1YW8 A;  4FLJ A;  4FUK A;  4OOK A;  3OOO A;  3IL0 A;  5CNX A;  1YW9 A;  2Q92 A;  2EVO A;  4PNC A;  3CTZ A;  3PEB A;  4U70 A;  2IW2 A;  4IEC A;  2BHD A;  1WBQ A;  2Q96 A;  2BHB A;  3BIQ A;  1WKM A;  4QR8 A;  4PV4 A;  2GU7 A;  5CDL A;  2ADU A;  4IPA A;  1QXY A;  1BN5 A;  1A16 A;  3S6B A;  1C24 A;  1YJ3 A;  1JAW A;  2DFI A;  4HXX A;  2V3Y A;  2ZSG A;  2GG5 A;  2EVM A;  2OKN A;  2P98 A;  2EA4 A;  4RZZ A;  5E5B A;  5CE6 A;  1WN1 A;  3PKB A;  2GU6 A;  1QZY A;  1WY2 A;  1YW7 A;  3TB5 A;  4KM3 A;  3IU7 A;  2BWV A;  2B3L A;  1O0X A;  1WL9 A;  2Q8K A;  1PV9 A;  3Q6D A;  4ZWU A;  4U6Z A;  1XGO A;  2BWS A;  2GZ5 A;  5FCF A;  1R5H A;  1XGM A;  4R60 A;  4S01 A;  3FM3 A;  3IU8 A;  4U75 A;  3L24 A;  4ZWP A;  3MR1 A;  4EGE A;  1W7V A;  2P99 A;  5FCH A;  3PKE A;  2B3H A;  2MAT A;  4MAT A;  4FO8 A;  1BOA A;  3IU9 A;  4Z7M A;  4U69 A;  2G6P A;  4FLL A;  3D27 A;  5JHU A;  2Q93 A;  4U6E A;  3QOC A;  4S2T P;  3BIP A;  5CIK A;  2BWW A;  2BWY A;  4FKC A;  4FO7 A;  4ZNG A;  3MAT A;  1N51 A;  2EVC A;  2BB7 A;  2BH3 A;  2GTX A;  3PN9 A;  4IKU A;  2GG7 A;  1M35 A;  3I7M A;  4RZY A;  1XNZ A;  5JFR A;  3PKC A;  3RVA A;  2V3X A;  1R5G A;  4FLI A;  4U71 A;  5D6E A;  2NQ7 A;  3CB5 A;  5E2C A;  5CDE A;  3L7G A;  1C21 A;  1QXW A;  2Q94 A;  2OAZ A;  1CHM A;  4IDY A;  2BHC A;  1C22 A;  4IF7 A;  4IKS A;  2EA2 A;  1QXZ A;  3TAV A;  3IG4 A;  5CDV A;  3BIT A;  4S00 A;  2GG2 A;  2GU5 A;  2GG3 A;  1WL6 A;  5CLS A;  1B59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...