2BWYA

Glu383ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwyA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwyA02
2HOWA 4QR8A 2BB7A 3IL0A 1YW7A 4U71A 4IECA 4U1BA 1B6AA 2GA2A 4PV4A 1XGOA 2BHDA 1PV9A 2ZSGA 2GG9A 3OOOA 4OOKA 4JUQA 1CHMA 3RORA 2V3YA 1BN5A 1XGMA 5E2CA 3D27A 2GG3A 2GU5A 5D6EA 3CTZA 5JI6A 4FO7A 2IW2A 1XGSA 1KP0A 4A6WA 4R60A 4FO8A 1WN1A 1QXWA 3IG4A 2GU6A 4FKCA 4U6JA 2G6PA 2Q93A 4U6ZA 2BHAA 4ZWOA 2B3KA 2V6CA 3QOCA 3MR1A 1QZYA 4IPAA 2BHCA 5FCFA 3CB5A 3OVKA 2EVMA 2GU4A 4IF7A 4U73A 4KM3A 2B3LA 2EA2A 4A6VA 4B28A 3S6BA 2DFIA 2GG5A 3BIQA 4U69A 2Q92A 4RGZ1 2P98A 2GTXA 1MATA 4Z7MA 4FLKA 2GG8A 2GG7A 2NQ7A 1WL9A 5CDLA 1A16A 1W2MA 1WKMA 2V3ZA 2GG0A 2NQ6A 1C27A 1M35A 4U6WA 2EVCA 1BOAA 4FUKA 4PNCA 3PKBA 4IKUA 4MATA 4U76A 4ZNGA 5JHUA 4U75A 1WLRA 4ZWPA 1XNZA 2BWYA 1XGNA 3TAVA 4FLIA 2B3HA 4S2RP 2P99A 2P9AA 3RVAA 3O5VA 2OAZA 2Q94A 1WY2A 1C22A 5E5BA 2GGCA 3TB5A 1WBQA 3PKDA 2GZ5A 1O0XA 1QXZA 4U70A 3CB6A 4IKSA 5CDVA 1W7VA 3FM3A 1R58A 1QXYA 3FMRA 4EGEA 5CDEA 3IU7A 1C24A 1YVMA 4U6EA 1C21A 2OKNA 2V3XA 2EVOA 3IU8A 3MX6A 5CNXA 1R5GA 3Q6DA 2BH3A 4IKTA 4S00A 1C23A 2BWXA 2BHBA 4ZWUA 5D6FA 2BWUA 4S01A 1R5HA 2Q95A 1YJ3A 4RZZA 3L24A 2GGBA 3MATA 1JAWA 2MATA 3I7MA 4IU6A 2ADUA 4HXXA 1YW9A 4IDYA 5FCHA 3PEBA 2GG2A 3BIPA 3L7GA 3FMQA 4IKRA 5CE6A 2GU7A 2EA4A 2BN7A 4S2TP 1Y1NA 1YW8A 4FLJA 1WL6A 2Q96A 3PKAA 4RZYA 2BWTA 3PKEA 3PN9A 4FLLA 3IU9A 4U6CA 5CLSA 5JFRA 1N51A 2BWVA 2BWWA 1KQ9A 2Q8KA 3PKCA 2BWSA 3BITA 1KQ0A 5CIKA 1B59A
chains in the Genus database with same CATH superfamily
2HOWA 4QR8A 2BB7A 3IL0A 1YW7A 4U71A 4IECA 4U1BA 1B6AA 2GA2A 4PV4A 1XGOA 2BHDA 1PV9A 2ZSGA 2GG9A 3OOOA 4OOKA 4JUQA 1CHMA 3RORA 2V3YA 1BN5A 1XGMA 5E2CA 3D27A 2GG3A 2GU5A 5D6EA 3CTZA 5JI6A 4FO7A 2IW2A 1XGSA 1KP0A 4A6WA 4R60A 4FO8A 1WN1A 1QXWA 3IG4A 2GU6A 4FKCA 4U6JA 2G6PA 2Q93A 4U6ZA 2BHAA 4ZWOA 2B3KA 2V6CA 3QOCA 3MR1A 1QZYA 4IPAA 2BHCA 5FCFA 3CB5A 3OVKA 2EVMA 2GU4A 4IF7A 4U73A 4KM3A 2B3LA 2EA2A 4A6VA 4B28A 3S6BA 2DFIA 2GG5A 3BIQA 4U69A 2Q92A 4RGZ1 2P98A 2GTXA 1MATA 4Z7MA 4FLKA 2GG8A 2GG7A 2NQ7A 1WL9A 5CDLA 1A16A 1W2MA 1WKMA 2V3ZA 2GG0A 2NQ6A 1C27A 1M35A 4U6WA 2EVCA 1BOAA 4FUKA 4PNCA 3PKBA 4IKUA 4MATA 4U76A 4ZNGA 5JHUA 4U75A 1WLRA 4ZWPA 1XNZA 2BWYA 1XGNA 3TAVA 4FLIA 2B3HA 4S2RP 2P99A 2P9AA 3RVAA 3O5VA 2OAZA 2Q94A 1WY2A 1C22A 5E5BA 2GGCA 3TB5A 1WBQA 3PKDA 2GZ5A 1O0XA 1QXZA 4U70A 3CB6A 4IKSA 5CDVA 1W7VA 3FM3A 1R58A 1QXYA 3FMRA 4EGEA 5CDEA 3IU7A 1C24A 1YVMA 4U6EA 1C21A 2OKNA 2V3XA 2EVOA 3IU8A 3MX6A 5CNXA 1R5GA 3Q6DA 2BH3A 4IKTA 4S00A 1C23A 2BWXA 2BHBA 4ZWUA 5D6FA 2BWUA 4S01A 1R5HA 2Q95A 1YJ3A 4RZZA 3L24A 2GGBA 3MATA 1JAWA 2MATA 3I7MA 4IU6A 2ADUA 4HXXA 1YW9A 4IDYA 5FCHA 3PEBA 2GG2A 3BIPA 3L7GA 3FMQA 4IKRA 5CE6A 2GU7A 2EA4A 2BN7A 4S2TP 1Y1NA 1YW8A 4FLJA 1WL6A 2Q96A 3PKAA 4RZYA 2BWTA 3PKEA 3PN9A 4FLLA 3IU9A 4U6CA 5CLSA 5JFRA 1N51A 2BWVA 2BWWA 1KQ9A 2Q8KA 3PKCA 2BWSA 3BITA 1KQ0A 5CIKA 1B59A
chains in the Genus database with same CATH topology
2HOWA 4QR8A 2BB7A 3IL0A 1YW7A 4U71A 4IECA 4U1BA 1B6AA 2GA2A 4PV4A 1XGOA 2BHDA 1PV9A 2ZSGA 2GG9A 3OOOA 4OOKA 4JUQA 1CHMA 3RORA 2V3YA 1BN5A 1XGMA 5E2CA 3D27A 2GG3A 2GU5A 5D6EA 3CTZA 5JI6A 4FO7A 2IW2A 1XGSA 1KP0A 4A6WA 4R60A 4FO8A 1WN1A 1QXWA 3IG4A 2GU6A 4FKCA 4U6JA 2G6PA 2Q93A 4U6ZA 2BHAA 4ZWOA 2B3KA 2V6CA 3QOCA 3MR1A 1QZYA 4IPAA 2BHCA 5FCFA 3CB5A 3OVKA 2EVMA 2GU4A 4IF7A 4U73A 4KM3A 2B3LA 2EA2A 4A6VA 4B28A 3S6BA 2DFIA 2GG5A 3BIQA 4U69A 2Q92A 4RGZ1 2P98A 2GTXA 1MATA 4Z7MA 4FLKA 2GG8A 2GG7A 2NQ7A 1WL9A 5CDLA 1A16A 1W2MA 1WKMA 2V3ZA 2GG0A 2NQ6A 1C27A 1M35A 4U6WA 2EVCA 1BOAA 4FUKA 4PNCA 3PKBA 4IKUA 4MATA 4U76A 4ZNGA 5JHUA 4U75A 1WLRA 4ZWPA 1XNZA 2BWYA 1XGNA 3TAVA 4FLIA 2B3HA 4S2RP 2P99A 2P9AA 3RVAA 3O5VA 2OAZA 2Q94A 1WY2A 1C22A 5E5BA 2GGCA 3TB5A 1WBQA 3PKDA 2GZ5A 1O0XA 1QXZA 4U70A 3CB6A 4IKSA 5CDVA 1W7VA 3FM3A 1R58A 1QXYA 3FMRA 4EGEA 5CDEA 3IU7A 1C24A 1YVMA 4U6EA 1C21A 2OKNA 2V3XA 2EVOA 3IU8A 3MX6A 5CNXA 1R5GA 3Q6DA 2BH3A 4IKTA 4S00A 1C23A 2BWXA 2BHBA 4ZWUA 5D6FA 2BWUA 4S01A 1R5HA 2Q95A 1YJ3A 4RZZA 3L24A 2GGBA 3MATA 1JAWA 2MATA 3I7MA 4IU6A 2ADUA 4HXXA 1YW9A 4IDYA 5FCHA 3PEBA 2GG2A 3BIPA 3L7GA 3FMQA 4IKRA 5CE6A 2GU7A 2EA4A 2BN7A 4S2TP 1Y1NA 1YW8A 4FLJA 1WL6A 2Q96A 3PKAA 4RZYA 2BWTA 3PKEA 3PN9A 4FLLA 3IU9A 4U6CA 5CLSA 5JFRA 1N51A 2BWVA 2BWWA 1KQ9A 2Q8KA 3PKCA 2BWSA 3BITA 1KQ0A 5CIKA 1B59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOW A;  4QR8 A;  2BB7 A;  3IL0 A;  1YW7 A;  4U71 A;  4IEC A;  4U1B A;  1B6A A;  2GA2 A;  4PV4 A;  1XGO A;  2BHD A;  1PV9 A;  2ZSG A;  2GG9 A;  3OOO A;  4OOK A;  4JUQ A;  1CHM A;  3ROR A;  2V3Y A;  1BN5 A;  1XGM A;  5E2C A;  3D27 A;  2GG3 A;  2GU5 A;  5D6E A;  3CTZ A;  5JI6 A;  4FO7 A;  2IW2 A;  1XGS A;  1KP0 A;  4A6W A;  4R60 A;  4FO8 A;  1WN1 A;  1QXW A;  3IG4 A;  2GU6 A;  4FKC A;  4U6J A;  2G6P A;  2Q93 A;  4U6Z A;  2BHA A;  4ZWO A;  2B3K A;  2V6C A;  3QOC A;  3MR1 A;  1QZY A;  4IPA A;  2BHC A;  5FCF A;  3CB5 A;  3OVK A;  2EVM A;  2GU4 A;  4IF7 A;  4U73 A;  4KM3 A;  2B3L A;  2EA2 A;  4A6V A;  4B28 A;  3S6B A;  2DFI A;  2GG5 A;  3BIQ A;  4U69 A;  2Q92 A;  4RGZ 1;  2P98 A;  2GTX A;  1MAT A;  4Z7M A;  4FLK A;  2GG8 A;  2GG7 A;  2NQ7 A;  1WL9 A;  5CDL A;  1A16 A;  1W2M A;  1WKM A;  2V3Z A;  2GG0 A;  2NQ6 A;  1C27 A;  1M35 A;  4U6W A;  2EVC A;  1BOA A;  4FUK A;  4PNC A;  3PKB A;  4IKU A;  4MAT A;  4U76 A;  4ZNG A;  5JHU A;  4U75 A;  1WLR A;  4ZWP A;  1XNZ A;  2BWY A;  1XGN A;  3TAV A;  4FLI A;  2B3H A;  4S2R P;  2P99 A;  2P9A A;  3RVA A;  3O5V A;  2OAZ A;  2Q94 A;  1WY2 A;  1C22 A;  5E5B A;  2GGC A;  3TB5 A;  1WBQ A;  3PKD A;  2GZ5 A;  1O0X A;  1QXZ A;  4U70 A;  3CB6 A;  4IKS A;  5CDV A;  1W7V A;  3FM3 A;  1R58 A;  1QXY A;  3FMR A;  4EGE A;  5CDE A;  3IU7 A;  1C24 A;  1YVM A;  4U6E A;  1C21 A;  2OKN A;  2V3X A;  2EVO A;  3IU8 A;  3MX6 A;  5CNX A;  1R5G A;  3Q6D A;  2BH3 A;  4IKT A;  4S00 A;  1C23 A;  2BWX A;  2BHB A;  4ZWU A;  5D6F A;  2BWU A;  4S01 A;  1R5H A;  2Q95 A;  1YJ3 A;  4RZZ A;  3L24 A;  2GGB A;  3MAT A;  1JAW A;  2MAT A;  3I7M A;  4IU6 A;  2ADU A;  4HXX A;  1YW9 A;  4IDY A;  5FCH A;  3PEB A;  2GG2 A;  3BIP A;  3L7G A;  3FMQ A;  4IKR A;  5CE6 A;  2GU7 A;  2EA4 A;  2BN7 A;  4S2T P;  1Y1N A;  1YW8 A;  4FLJ A;  1WL6 A;  2Q96 A;  3PKA A;  4RZY A;  2BWT A;  3PKE A;  3PN9 A;  4FLL A;  3IU9 A;  4U6C A;  5CLS A;  5JFR A;  1N51 A;  2BWV A;  2BWW A;  1KQ9 A;  2Q8K A;  3PKC A;  2BWS A;  3BIT A;  1KQ0 A;  5CIK A;  1B59 A; 
#chains in the Genus database with same CATH topology
 2HOW A;  4QR8 A;  2BB7 A;  3IL0 A;  1YW7 A;  4U71 A;  4IEC A;  4U1B A;  1B6A A;  2GA2 A;  4PV4 A;  1XGO A;  2BHD A;  1PV9 A;  2ZSG A;  2GG9 A;  3OOO A;  4OOK A;  4JUQ A;  1CHM A;  3ROR A;  2V3Y A;  1BN5 A;  1XGM A;  5E2C A;  3D27 A;  2GG3 A;  2GU5 A;  5D6E A;  3CTZ A;  5JI6 A;  4FO7 A;  2IW2 A;  1XGS A;  1KP0 A;  4A6W A;  4R60 A;  4FO8 A;  1WN1 A;  1QXW A;  3IG4 A;  2GU6 A;  4FKC A;  4U6J A;  2G6P A;  2Q93 A;  4U6Z A;  2BHA A;  4ZWO A;  2B3K A;  2V6C A;  3QOC A;  3MR1 A;  1QZY A;  4IPA A;  2BHC A;  5FCF A;  3CB5 A;  3OVK A;  2EVM A;  2GU4 A;  4IF7 A;  4U73 A;  4KM3 A;  2B3L A;  2EA2 A;  4A6V A;  4B28 A;  3S6B A;  2DFI A;  2GG5 A;  3BIQ A;  4U69 A;  2Q92 A;  4RGZ 1;  2P98 A;  2GTX A;  1MAT A;  4Z7M A;  4FLK A;  2GG8 A;  2GG7 A;  2NQ7 A;  1WL9 A;  5CDL A;  1A16 A;  1W2M A;  1WKM A;  2V3Z A;  2GG0 A;  2NQ6 A;  1C27 A;  1M35 A;  4U6W A;  2EVC A;  1BOA A;  4FUK A;  4PNC A;  3PKB A;  4IKU A;  4MAT A;  4U76 A;  4ZNG A;  5JHU A;  4U75 A;  1WLR A;  4ZWP A;  1XNZ A;  2BWY A;  1XGN A;  3TAV A;  4FLI A;  2B3H A;  4S2R P;  2P99 A;  2P9A A;  3RVA A;  3O5V A;  2OAZ A;  2Q94 A;  1WY2 A;  1C22 A;  5E5B A;  2GGC A;  3TB5 A;  1WBQ A;  3PKD A;  2GZ5 A;  1O0X A;  1QXZ A;  4U70 A;  3CB6 A;  4IKS A;  5CDV A;  1W7V A;  3FM3 A;  1R58 A;  1QXY A;  3FMR A;  4EGE A;  5CDE A;  3IU7 A;  1C24 A;  1YVM A;  4U6E A;  1C21 A;  2OKN A;  2V3X A;  2EVO A;  3IU8 A;  3MX6 A;  5CNX A;  1R5G A;  3Q6D A;  2BH3 A;  4IKT A;  4S00 A;  1C23 A;  2BWX A;  2BHB A;  4ZWU A;  5D6F A;  2BWU A;  4S01 A;  1R5H A;  2Q95 A;  1YJ3 A;  4RZZ A;  3L24 A;  2GGB A;  3MAT A;  1JAW A;  2MAT A;  3I7M A;  4IU6 A;  2ADU A;  4HXX A;  1YW9 A;  4IDY A;  5FCH A;  3PEB A;  2GG2 A;  3BIP A;  3L7G A;  3FMQ A;  4IKR A;  5CE6 A;  2GU7 A;  2EA4 A;  2BN7 A;  4S2T P;  1Y1N A;  1YW8 A;  4FLJ A;  1WL6 A;  2Q96 A;  3PKA A;  4RZY A;  2BWT A;  3PKE A;  3PN9 A;  4FLL A;  3IU9 A;  4U6C A;  5CLS A;  5JFR A;  1N51 A;  2BWV A;  2BWW A;  1KQ9 A;  2Q8K A;  3PKC A;  2BWS A;  3BIT A;  1KQ0 A;  5CIK A;  1B59 A; 
#chains in the Genus database with same CATH homology
 2HOW A;  4QR8 A;  2BB7 A;  3IL0 A;  1YW7 A;  4U71 A;  4IEC A;  4U1B A;  1B6A A;  2GA2 A;  4PV4 A;  1XGO A;  2BHD A;  1PV9 A;  2ZSG A;  2GG9 A;  3OOO A;  4OOK A;  4JUQ A;  1CHM A;  3ROR A;  2V3Y A;  1BN5 A;  1XGM A;  5E2C A;  3D27 A;  2GG3 A;  2GU5 A;  5D6E A;  3CTZ A;  5JI6 A;  4FO7 A;  2IW2 A;  1XGS A;  1KP0 A;  4A6W A;  4R60 A;  4FO8 A;  1WN1 A;  1QXW A;  3IG4 A;  2GU6 A;  4FKC A;  4U6J A;  2G6P A;  2Q93 A;  4U6Z A;  2BHA A;  4ZWO A;  2B3K A;  2V6C A;  3QOC A;  3MR1 A;  1QZY A;  4IPA A;  2BHC A;  5FCF A;  3CB5 A;  3OVK A;  2EVM A;  2GU4 A;  4IF7 A;  4U73 A;  4KM3 A;  2B3L A;  2EA2 A;  4A6V A;  4B28 A;  3S6B A;  2DFI A;  2GG5 A;  3BIQ A;  4U69 A;  2Q92 A;  4RGZ 1;  2P98 A;  2GTX A;  1MAT A;  4Z7M A;  4FLK A;  2GG8 A;  2GG7 A;  2NQ7 A;  1WL9 A;  5CDL A;  1A16 A;  1W2M A;  1WKM A;  2V3Z A;  2GG0 A;  2NQ6 A;  1C27 A;  1M35 A;  4U6W A;  2EVC A;  1BOA A;  4FUK A;  4PNC A;  3PKB A;  4IKU A;  4MAT A;  4U76 A;  4ZNG A;  5JHU A;  4U75 A;  1WLR A;  4ZWP A;  1XNZ A;  2BWY A;  1XGN A;  3TAV A;  4FLI A;  2B3H A;  4S2R P;  2P99 A;  2P9A A;  3RVA A;  3O5V A;  2OAZ A;  2Q94 A;  1WY2 A;  1C22 A;  5E5B A;  2GGC A;  3TB5 A;  1WBQ A;  3PKD A;  2GZ5 A;  1O0X A;  1QXZ A;  4U70 A;  3CB6 A;  4IKS A;  5CDV A;  1W7V A;  3FM3 A;  1R58 A;  1QXY A;  3FMR A;  4EGE A;  5CDE A;  3IU7 A;  1C24 A;  1YVM A;  4U6E A;  1C21 A;  2OKN A;  2V3X A;  2EVO A;  3IU8 A;  3MX6 A;  5CNX A;  1R5G A;  3Q6D A;  2BH3 A;  4IKT A;  4S00 A;  1C23 A;  2BWX A;  2BHB A;  4ZWU A;  5D6F A;  2BWU A;  4S01 A;  1R5H A;  2Q95 A;  1YJ3 A;  4RZZ A;  3L24 A;  2GGB A;  3MAT A;  1JAW A;  2MAT A;  3I7M A;  4IU6 A;  2ADU A;  4HXX A;  1YW9 A;  4IDY A;  5FCH A;  3PEB A;  2GG2 A;  3BIP A;  3L7G A;  3FMQ A;  4IKR A;  5CE6 A;  2GU7 A;  2EA4 A;  2BN7 A;  4S2T P;  1Y1N A;  1YW8 A;  4FLJ A;  1WL6 A;  2Q96 A;  3PKA A;  4RZY A;  2BWT A;  3PKE A;  3PN9 A;  4FLL A;  3IU9 A;  4U6C A;  5CLS A;  5JFR A;  1N51 A;  2BWV A;  2BWW A;  1KQ9 A;  2Q8K A;  3PKC A;  2BWS A;  3BIT A;  1KQ0 A;  5CIK A;  1B59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...