2BWYA

Glu383ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwyA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwyA02
4IPAA 4IKUA 1A16A 1C22A 1KQ9A 2GG7A 2BB7A 4U6ZA 3RORA 4U75A 2ZSGA 2GGBA 1N51A 3BITA 5JI6A 2NQ7A 1W7VA 1C24A 1YW8A 3L7GA 1KQ0A 4FLLA 2EVMA 1YJ3A 1XGMA 4ZWUA 3RVAA 3PKEA 1QXYA 3FM3A 2BWVA 5CNXA 1R5HA 2DFIA 2P98A 2Q94A 2GG9A 4ZWPA 2IW2A 4ZNGA 4MATA 4FLJA 1B59A 1WN1A 2GZ5A 4JUQA 4U70A 2Q8KA 3MATA 3TAVA 1XGOA 2BHDA 1Y1NA 4IECA 4Z7MA 1WL9A 4ZWOA 2OAZA 1BOAA 1C21A 4OOKA 1JAWA 3OVKA 2BHAA 3Q6DA 3FMQA 3IU7A 2Q92A 4FLKA 1YW7A 2BN7A 3IL0A 3IU8A 2GG5A 1KP0A 5CDEA 2GG8A 2BH3A 4S2RP 1QXZA 1XNZA 4S2TP 2BWXA 2GA2A 3PKCA 1BN5A 2Q96A 5D6FA 1WLRA 1XGSA 2BWUA 2P9AA 5CLSA 5D6EA 2B3KA 3BIPA 4EGEA 1R58A 4U73A 1WL6A 4U1BA 4IKTA 3PKDA 2GG0A 4IF7A 1WBQA 5CDLA 2P99A 4IKSA 4U6CA 4B28A 3CB6A 1WY2A 5FCFA 2ADUA 4FKCA 4S00A 2G6PA 4FO7A 4U76A 2MATA 2V3XA 2GU7A 2Q93A 2V3ZA 4U6EA 5E2CA 4S01A 2B3LA 2GU6A 2HOWA 4U71A 5JFRA 2BWWA 3QOCA 4U6JA 2BHCA 1MATA 4KM3A 4IKRA 2BWYA 3PN9A 4IDYA 2EVCA 5CDVA 1CHMA 2GU4A 3CB5A 4A6VA 3FMRA 3CTZA 3PKBA 5CE6A 2GG2A 2EA4A 4FLIA 4PV4A 4FO8A 4U69A 2BHBA 2BWTA 3L24A 3MX6A 4HXXA 4RZZA 3BIQA 2B3HA 4RGZ1 1M35A 3I7MA 3D27A 1YW9A 4QR8A 2BWSA 3MR1A 2GTXA 2EVOA 5E5BA 2GG3A 1W2MA 5FCHA 1B6AA 3O5VA 3S6BA 2GGCA 1QZYA 1C23A 4RZYA 2Q95A 4IU6A 1R5GA 2V6CA 3IG4A 4FUKA 2EA2A 2NQ6A 4A6WA 1WKMA 4R60A 4U6WA 1O0XA 1YVMA 4PNCA 3TB5A 1XGNA 2OKNA 3IU9A 5CIKA 2V3YA 3PEBA 3OOOA 1QXWA 2GU5A 3PKAA 5JHUA 1C27A 1PV9A
chains in the Genus database with same CATH superfamily
4IPAA 4IKUA 1A16A 1C22A 1KQ9A 2GG7A 2BB7A 4U6ZA 3RORA 4U75A 2ZSGA 2GGBA 1N51A 3BITA 5JI6A 2NQ7A 1W7VA 1C24A 1YW8A 3L7GA 1KQ0A 4FLLA 2EVMA 1YJ3A 1XGMA 4ZWUA 3RVAA 3PKEA 1QXYA 3FM3A 2BWVA 5CNXA 1R5HA 2DFIA 2P98A 2Q94A 2GG9A 4ZWPA 2IW2A 4ZNGA 4MATA 4FLJA 1B59A 1WN1A 2GZ5A 4JUQA 4U70A 2Q8KA 3MATA 3TAVA 1XGOA 2BHDA 1Y1NA 4IECA 4Z7MA 1WL9A 4ZWOA 2OAZA 1BOAA 1C21A 4OOKA 1JAWA 3OVKA 2BHAA 3Q6DA 3FMQA 3IU7A 2Q92A 4FLKA 1YW7A 2BN7A 3IL0A 3IU8A 2GG5A 1KP0A 5CDEA 2GG8A 2BH3A 4S2RP 1QXZA 1XNZA 4S2TP 2BWXA 2GA2A 3PKCA 1BN5A 2Q96A 5D6FA 1WLRA 1XGSA 2BWUA 2P9AA 5CLSA 5D6EA 2B3KA 3BIPA 4EGEA 1R58A 4U73A 1WL6A 4U1BA 4IKTA 3PKDA 2GG0A 4IF7A 1WBQA 5CDLA 2P99A 4IKSA 4U6CA 4B28A 3CB6A 1WY2A 5FCFA 2ADUA 4FKCA 4S00A 2G6PA 4FO7A 4U76A 2MATA 2V3XA 2GU7A 2Q93A 2V3ZA 4U6EA 5E2CA 4S01A 2B3LA 2GU6A 2HOWA 4U71A 5JFRA 2BWWA 3QOCA 4U6JA 2BHCA 1MATA 4KM3A 4IKRA 2BWYA 3PN9A 4IDYA 2EVCA 5CDVA 1CHMA 2GU4A 3CB5A 4A6VA 3FMRA 3CTZA 3PKBA 5CE6A 2GG2A 2EA4A 4FLIA 4PV4A 4FO8A 4U69A 2BHBA 2BWTA 3L24A 3MX6A 4HXXA 4RZZA 3BIQA 2B3HA 4RGZ1 1M35A 3I7MA 3D27A 1YW9A 4QR8A 2BWSA 3MR1A 2GTXA 2EVOA 5E5BA 2GG3A 1W2MA 5FCHA 1B6AA 3O5VA 3S6BA 2GGCA 1QZYA 1C23A 4RZYA 2Q95A 4IU6A 1R5GA 2V6CA 3IG4A 4FUKA 2EA2A 2NQ6A 4A6WA 1WKMA 4R60A 4U6WA 1O0XA 1YVMA 4PNCA 3TB5A 1XGNA 2OKNA 3IU9A 5CIKA 2V3YA 3PEBA 3OOOA 1QXWA 2GU5A 3PKAA 5JHUA 1C27A 1PV9A
chains in the Genus database with same CATH topology
4IPAA 4IKUA 1A16A 1C22A 1KQ9A 2GG7A 2BB7A 4U6ZA 3RORA 4U75A 2ZSGA 2GGBA 1N51A 3BITA 5JI6A 2NQ7A 1W7VA 1C24A 1YW8A 3L7GA 1KQ0A 4FLLA 2EVMA 1YJ3A 1XGMA 4ZWUA 3RVAA 3PKEA 1QXYA 3FM3A 2BWVA 5CNXA 1R5HA 2DFIA 2P98A 2Q94A 2GG9A 4ZWPA 2IW2A 4ZNGA 4MATA 4FLJA 1B59A 1WN1A 2GZ5A 4JUQA 4U70A 2Q8KA 3MATA 3TAVA 1XGOA 2BHDA 1Y1NA 4IECA 4Z7MA 1WL9A 4ZWOA 2OAZA 1BOAA 1C21A 4OOKA 1JAWA 3OVKA 2BHAA 3Q6DA 3FMQA 3IU7A 2Q92A 4FLKA 1YW7A 2BN7A 3IL0A 3IU8A 2GG5A 1KP0A 5CDEA 2GG8A 2BH3A 4S2RP 1QXZA 1XNZA 4S2TP 2BWXA 2GA2A 3PKCA 1BN5A 2Q96A 5D6FA 1WLRA 1XGSA 2BWUA 2P9AA 5CLSA 5D6EA 2B3KA 3BIPA 4EGEA 1R58A 4U73A 1WL6A 4U1BA 4IKTA 3PKDA 2GG0A 4IF7A 1WBQA 5CDLA 2P99A 4IKSA 4U6CA 4B28A 3CB6A 1WY2A 5FCFA 2ADUA 4FKCA 4S00A 2G6PA 4FO7A 4U76A 2MATA 2V3XA 2GU7A 2Q93A 2V3ZA 4U6EA 5E2CA 4S01A 2B3LA 2GU6A 2HOWA 4U71A 5JFRA 2BWWA 3QOCA 4U6JA 2BHCA 1MATA 4KM3A 4IKRA 2BWYA 3PN9A 4IDYA 2EVCA 5CDVA 1CHMA 2GU4A 3CB5A 4A6VA 3FMRA 3CTZA 3PKBA 5CE6A 2GG2A 2EA4A 4FLIA 4PV4A 4FO8A 4U69A 2BHBA 2BWTA 3L24A 3MX6A 4HXXA 4RZZA 3BIQA 2B3HA 4RGZ1 1M35A 3I7MA 3D27A 1YW9A 4QR8A 2BWSA 3MR1A 2GTXA 2EVOA 5E5BA 2GG3A 1W2MA 5FCHA 1B6AA 3O5VA 3S6BA 2GGCA 1QZYA 1C23A 4RZYA 2Q95A 4IU6A 1R5GA 2V6CA 3IG4A 4FUKA 2EA2A 2NQ6A 4A6WA 1WKMA 4R60A 4U6WA 1O0XA 1YVMA 4PNCA 3TB5A 1XGNA 2OKNA 3IU9A 5CIKA 2V3YA 3PEBA 3OOOA 1QXWA 2GU5A 3PKAA 5JHUA 1C27A 1PV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  4IKU A;  1A16 A;  1C22 A;  1KQ9 A;  2GG7 A;  2BB7 A;  4U6Z A;  3ROR A;  4U75 A;  2ZSG A;  2GGB A;  1N51 A;  3BIT A;  5JI6 A;  2NQ7 A;  1W7V A;  1C24 A;  1YW8 A;  3L7G A;  1KQ0 A;  4FLL A;  2EVM A;  1YJ3 A;  1XGM A;  4ZWU A;  3RVA A;  3PKE A;  1QXY A;  3FM3 A;  2BWV A;  5CNX A;  1R5H A;  2DFI A;  2P98 A;  2Q94 A;  2GG9 A;  4ZWP A;  2IW2 A;  4ZNG A;  4MAT A;  4FLJ A;  1B59 A;  1WN1 A;  2GZ5 A;  4JUQ A;  4U70 A;  2Q8K A;  3MAT A;  3TAV A;  1XGO A;  2BHD A;  1Y1N A;  4IEC A;  4Z7M A;  1WL9 A;  4ZWO A;  2OAZ A;  1BOA A;  1C21 A;  4OOK A;  1JAW A;  3OVK A;  2BHA A;  3Q6D A;  3FMQ A;  3IU7 A;  2Q92 A;  4FLK A;  1YW7 A;  2BN7 A;  3IL0 A;  3IU8 A;  2GG5 A;  1KP0 A;  5CDE A;  2GG8 A;  2BH3 A;  4S2R P;  1QXZ A;  1XNZ A;  4S2T P;  2BWX A;  2GA2 A;  3PKC A;  1BN5 A;  2Q96 A;  5D6F A;  1WLR A;  1XGS A;  2BWU A;  2P9A A;  5CLS A;  5D6E A;  2B3K A;  3BIP A;  4EGE A;  1R58 A;  4U73 A;  1WL6 A;  4U1B A;  4IKT A;  3PKD A;  2GG0 A;  4IF7 A;  1WBQ A;  5CDL A;  2P99 A;  4IKS A;  4U6C A;  4B28 A;  3CB6 A;  1WY2 A;  5FCF A;  2ADU A;  4FKC A;  4S00 A;  2G6P A;  4FO7 A;  4U76 A;  2MAT A;  2V3X A;  2GU7 A;  2Q93 A;  2V3Z A;  4U6E A;  5E2C A;  4S01 A;  2B3L A;  2GU6 A;  2HOW A;  4U71 A;  5JFR A;  2BWW A;  3QOC A;  4U6J A;  2BHC A;  1MAT A;  4KM3 A;  4IKR A;  2BWY A;  3PN9 A;  4IDY A;  2EVC A;  5CDV A;  1CHM A;  2GU4 A;  3CB5 A;  4A6V A;  3FMR A;  3CTZ A;  3PKB A;  5CE6 A;  2GG2 A;  2EA4 A;  4FLI A;  4PV4 A;  4FO8 A;  4U69 A;  2BHB A;  2BWT A;  3L24 A;  3MX6 A;  4HXX A;  4RZZ A;  3BIQ A;  2B3H A;  4RGZ 1;  1M35 A;  3I7M A;  3D27 A;  1YW9 A;  4QR8 A;  2BWS A;  3MR1 A;  2GTX A;  2EVO A;  5E5B A;  2GG3 A;  1W2M A;  5FCH A;  1B6A A;  3O5V A;  3S6B A;  2GGC A;  1QZY A;  1C23 A;  4RZY A;  2Q95 A;  4IU6 A;  1R5G A;  2V6C A;  3IG4 A;  4FUK A;  2EA2 A;  2NQ6 A;  4A6W A;  1WKM A;  4R60 A;  4U6W A;  1O0X A;  1YVM A;  4PNC A;  3TB5 A;  1XGN A;  2OKN A;  3IU9 A;  5CIK A;  2V3Y A;  3PEB A;  3OOO A;  1QXW A;  2GU5 A;  3PKA A;  5JHU A;  1C27 A;  1PV9 A; 
#chains in the Genus database with same CATH topology
 4IPA A;  4IKU A;  1A16 A;  1C22 A;  1KQ9 A;  2GG7 A;  2BB7 A;  4U6Z A;  3ROR A;  4U75 A;  2ZSG A;  2GGB A;  1N51 A;  3BIT A;  5JI6 A;  2NQ7 A;  1W7V A;  1C24 A;  1YW8 A;  3L7G A;  1KQ0 A;  4FLL A;  2EVM A;  1YJ3 A;  1XGM A;  4ZWU A;  3RVA A;  3PKE A;  1QXY A;  3FM3 A;  2BWV A;  5CNX A;  1R5H A;  2DFI A;  2P98 A;  2Q94 A;  2GG9 A;  4ZWP A;  2IW2 A;  4ZNG A;  4MAT A;  4FLJ A;  1B59 A;  1WN1 A;  2GZ5 A;  4JUQ A;  4U70 A;  2Q8K A;  3MAT A;  3TAV A;  1XGO A;  2BHD A;  1Y1N A;  4IEC A;  4Z7M A;  1WL9 A;  4ZWO A;  2OAZ A;  1BOA A;  1C21 A;  4OOK A;  1JAW A;  3OVK A;  2BHA A;  3Q6D A;  3FMQ A;  3IU7 A;  2Q92 A;  4FLK A;  1YW7 A;  2BN7 A;  3IL0 A;  3IU8 A;  2GG5 A;  1KP0 A;  5CDE A;  2GG8 A;  2BH3 A;  4S2R P;  1QXZ A;  1XNZ A;  4S2T P;  2BWX A;  2GA2 A;  3PKC A;  1BN5 A;  2Q96 A;  5D6F A;  1WLR A;  1XGS A;  2BWU A;  2P9A A;  5CLS A;  5D6E A;  2B3K A;  3BIP A;  4EGE A;  1R58 A;  4U73 A;  1WL6 A;  4U1B A;  4IKT A;  3PKD A;  2GG0 A;  4IF7 A;  1WBQ A;  5CDL A;  2P99 A;  4IKS A;  4U6C A;  4B28 A;  3CB6 A;  1WY2 A;  5FCF A;  2ADU A;  4FKC A;  4S00 A;  2G6P A;  4FO7 A;  4U76 A;  2MAT A;  2V3X A;  2GU7 A;  2Q93 A;  2V3Z A;  4U6E A;  5E2C A;  4S01 A;  2B3L A;  2GU6 A;  2HOW A;  4U71 A;  5JFR A;  2BWW A;  3QOC A;  4U6J A;  2BHC A;  1MAT A;  4KM3 A;  4IKR A;  2BWY A;  3PN9 A;  4IDY A;  2EVC A;  5CDV A;  1CHM A;  2GU4 A;  3CB5 A;  4A6V A;  3FMR A;  3CTZ A;  3PKB A;  5CE6 A;  2GG2 A;  2EA4 A;  4FLI A;  4PV4 A;  4FO8 A;  4U69 A;  2BHB A;  2BWT A;  3L24 A;  3MX6 A;  4HXX A;  4RZZ A;  3BIQ A;  2B3H A;  4RGZ 1;  1M35 A;  3I7M A;  3D27 A;  1YW9 A;  4QR8 A;  2BWS A;  3MR1 A;  2GTX A;  2EVO A;  5E5B A;  2GG3 A;  1W2M A;  5FCH A;  1B6A A;  3O5V A;  3S6B A;  2GGC A;  1QZY A;  1C23 A;  4RZY A;  2Q95 A;  4IU6 A;  1R5G A;  2V6C A;  3IG4 A;  4FUK A;  2EA2 A;  2NQ6 A;  4A6W A;  1WKM A;  4R60 A;  4U6W A;  1O0X A;  1YVM A;  4PNC A;  3TB5 A;  1XGN A;  2OKN A;  3IU9 A;  5CIK A;  2V3Y A;  3PEB A;  3OOO A;  1QXW A;  2GU5 A;  3PKA A;  5JHU A;  1C27 A;  1PV9 A; 
#chains in the Genus database with same CATH homology
 4IPA A;  4IKU A;  1A16 A;  1C22 A;  1KQ9 A;  2GG7 A;  2BB7 A;  4U6Z A;  3ROR A;  4U75 A;  2ZSG A;  2GGB A;  1N51 A;  3BIT A;  5JI6 A;  2NQ7 A;  1W7V A;  1C24 A;  1YW8 A;  3L7G A;  1KQ0 A;  4FLL A;  2EVM A;  1YJ3 A;  1XGM A;  4ZWU A;  3RVA A;  3PKE A;  1QXY A;  3FM3 A;  2BWV A;  5CNX A;  1R5H A;  2DFI A;  2P98 A;  2Q94 A;  2GG9 A;  4ZWP A;  2IW2 A;  4ZNG A;  4MAT A;  4FLJ A;  1B59 A;  1WN1 A;  2GZ5 A;  4JUQ A;  4U70 A;  2Q8K A;  3MAT A;  3TAV A;  1XGO A;  2BHD A;  1Y1N A;  4IEC A;  4Z7M A;  1WL9 A;  4ZWO A;  2OAZ A;  1BOA A;  1C21 A;  4OOK A;  1JAW A;  3OVK A;  2BHA A;  3Q6D A;  3FMQ A;  3IU7 A;  2Q92 A;  4FLK A;  1YW7 A;  2BN7 A;  3IL0 A;  3IU8 A;  2GG5 A;  1KP0 A;  5CDE A;  2GG8 A;  2BH3 A;  4S2R P;  1QXZ A;  1XNZ A;  4S2T P;  2BWX A;  2GA2 A;  3PKC A;  1BN5 A;  2Q96 A;  5D6F A;  1WLR A;  1XGS A;  2BWU A;  2P9A A;  5CLS A;  5D6E A;  2B3K A;  3BIP A;  4EGE A;  1R58 A;  4U73 A;  1WL6 A;  4U1B A;  4IKT A;  3PKD A;  2GG0 A;  4IF7 A;  1WBQ A;  5CDL A;  2P99 A;  4IKS A;  4U6C A;  4B28 A;  3CB6 A;  1WY2 A;  5FCF A;  2ADU A;  4FKC A;  4S00 A;  2G6P A;  4FO7 A;  4U76 A;  2MAT A;  2V3X A;  2GU7 A;  2Q93 A;  2V3Z A;  4U6E A;  5E2C A;  4S01 A;  2B3L A;  2GU6 A;  2HOW A;  4U71 A;  5JFR A;  2BWW A;  3QOC A;  4U6J A;  2BHC A;  1MAT A;  4KM3 A;  4IKR A;  2BWY A;  3PN9 A;  4IDY A;  2EVC A;  5CDV A;  1CHM A;  2GU4 A;  3CB5 A;  4A6V A;  3FMR A;  3CTZ A;  3PKB A;  5CE6 A;  2GG2 A;  2EA4 A;  4FLI A;  4PV4 A;  4FO8 A;  4U69 A;  2BHB A;  2BWT A;  3L24 A;  3MX6 A;  4HXX A;  4RZZ A;  3BIQ A;  2B3H A;  4RGZ 1;  1M35 A;  3I7M A;  3D27 A;  1YW9 A;  4QR8 A;  2BWS A;  3MR1 A;  2GTX A;  2EVO A;  5E5B A;  2GG3 A;  1W2M A;  5FCH A;  1B6A A;  3O5V A;  3S6B A;  2GGC A;  1QZY A;  1C23 A;  4RZY A;  2Q95 A;  4IU6 A;  1R5G A;  2V6C A;  3IG4 A;  4FUK A;  2EA2 A;  2NQ6 A;  4A6W A;  1WKM A;  4R60 A;  4U6W A;  1O0X A;  1YVM A;  4PNC A;  3TB5 A;  1XGN A;  2OKN A;  3IU9 A;  5CIK A;  2V3Y A;  3PEB A;  3OOO A;  1QXW A;  2GU5 A;  3PKA A;  5JHU A;  1C27 A;  1PV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...