2BWYA

Glu383ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwyA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwyA02
5E5BA 2GZ5A 2MATA 3PKAA 1O0XA 1XGSA 1YVMA 4IECA 1KQ0A 3PKDA 1B59A 1JAWA 3IL0A 1B6AA 4U71A 2IW2A 4FLKA 1A16A 4U6WA 5CDLA 1WBQA 1M35A 2BN7A 3IU9A 2BWTA 3BIPA 2GG7A 2NQ6A 4IDYA 1PV9A 3QOCA 3PN9A 1WY2A 3PKBA 4IKSA 4RZZA 2GTXA 4IU6A 4ZWOA 3IU8A 4OOKA 4ZWUA 4FUKA 2ADUA 2BHBA 4U6EA 1KP0A 3BITA 2BWSA 4S00A 1C23A 3FMQA 5JFRA 5E2CA 2OAZA 1XGMA 4JUQA 4U69A 4IKTA 4U75A 1WN1A 2Q92A 4U6ZA 4S01A 1YW7A 1R58A 4QR8A 2B3HA 3MX6A 3PEBA 4RGZ1 3PKCA 4IF7A 3PKEA 1QZYA 3FM3A 2BWWA 3BIQA 4B28A 3IG4A 1MATA 2DFIA 2GU4A 5CDVA 2BH3A 3MATA 3O5VA 3RORA 5CE6A 3CB6A 4U6CA 3IU7A 5CLSA 2B3KA 1XGOA 2NQ7A 4Z7MA 4FLLA 3TB5A 2BHAA 5FCFA 4FLJA 3S6BA 4PNCA 2BWUA 4ZWPA 2Q96A 2P9AA 4U1BA 5D6EA 2GGCA 1C22A 4U76A 2OKNA 1W2MA 3FMRA 4PV4A 4ZNGA 3OVKA 2EA2A 4EGEA 2EA4A 2GG9A 2GGBA 4A6WA 4FO8A 2P98A 2GU6A 4RZYA 5CNXA 1QXYA 3CTZA 4FO7A 2BHDA 2BHCA 3Q6DA 1Y1NA 1C21A 5CIKA 2GU7A 2Q93A 4FKCA 2BWYA 3RVAA 5JI6A 1N51A 4S2TP 2Q8KA 2EVCA 4IKUA 4U73A 2HOWA 3OOOA 1BN5A 2GG8A 1W7VA 2GG2A 1XGNA 1YW9A 4U6JA 4MATA 1WL6A 3I7MA 2G6PA 1BOAA 4IKRA 3L24A 1YW8A 4FLIA 4R60A 3D27A 4U70A 2BB7A 2BWXA 2P99A 2BWVA 1KQ9A 2V3ZA 2EVMA 1QXWA 4KM3A 2GG0A 2B3LA 5JHUA 1WLRA 2EVOA 2GG5A 1R5GA 1C24A 2GG3A 5CDEA 1QXZA 1XNZA 2V3XA 1YJ3A 2V3YA 2GA2A 5D6FA 4S2RP 5FCHA 1WL9A 4HXXA 1CHMA 2Q95A 4A6VA 3MR1A 1C27A 2V6CA 3L7GA 3TAVA 4IPAA 1WKMA 2ZSGA 3CB5A 2GU5A 2Q94A 1R5HA
chains in the Genus database with same CATH superfamily
5E5BA 2GZ5A 2MATA 3PKAA 1O0XA 1XGSA 1YVMA 4IECA 1KQ0A 3PKDA 1B59A 1JAWA 3IL0A 1B6AA 4U71A 2IW2A 4FLKA 1A16A 4U6WA 5CDLA 1WBQA 1M35A 2BN7A 3IU9A 2BWTA 3BIPA 2GG7A 2NQ6A 4IDYA 1PV9A 3QOCA 3PN9A 1WY2A 3PKBA 4IKSA 4RZZA 2GTXA 4IU6A 4ZWOA 3IU8A 4OOKA 4ZWUA 4FUKA 2ADUA 2BHBA 4U6EA 1KP0A 3BITA 2BWSA 4S00A 1C23A 3FMQA 5JFRA 5E2CA 2OAZA 1XGMA 4JUQA 4U69A 4IKTA 4U75A 1WN1A 2Q92A 4U6ZA 4S01A 1YW7A 1R58A 4QR8A 2B3HA 3MX6A 3PEBA 4RGZ1 3PKCA 4IF7A 3PKEA 1QZYA 3FM3A 2BWWA 3BIQA 4B28A 3IG4A 1MATA 2DFIA 2GU4A 5CDVA 2BH3A 3MATA 3O5VA 3RORA 5CE6A 3CB6A 4U6CA 3IU7A 5CLSA 2B3KA 1XGOA 2NQ7A 4Z7MA 4FLLA 3TB5A 2BHAA 5FCFA 4FLJA 3S6BA 4PNCA 2BWUA 4ZWPA 2Q96A 2P9AA 4U1BA 5D6EA 2GGCA 1C22A 4U76A 2OKNA 1W2MA 3FMRA 4PV4A 4ZNGA 3OVKA 2EA2A 4EGEA 2EA4A 2GG9A 2GGBA 4A6WA 4FO8A 2P98A 2GU6A 4RZYA 5CNXA 1QXYA 3CTZA 4FO7A 2BHDA 2BHCA 3Q6DA 1Y1NA 1C21A 5CIKA 2GU7A 2Q93A 4FKCA 2BWYA 3RVAA 5JI6A 1N51A 4S2TP 2Q8KA 2EVCA 4IKUA 4U73A 2HOWA 3OOOA 1BN5A 2GG8A 1W7VA 2GG2A 1XGNA 1YW9A 4U6JA 4MATA 1WL6A 3I7MA 2G6PA 1BOAA 4IKRA 3L24A 1YW8A 4FLIA 4R60A 3D27A 4U70A 2BB7A 2BWXA 2P99A 2BWVA 1KQ9A 2V3ZA 2EVMA 1QXWA 4KM3A 2GG0A 2B3LA 5JHUA 1WLRA 2EVOA 2GG5A 1R5GA 1C24A 2GG3A 5CDEA 1QXZA 1XNZA 2V3XA 1YJ3A 2V3YA 2GA2A 5D6FA 4S2RP 5FCHA 1WL9A 4HXXA 1CHMA 2Q95A 4A6VA 3MR1A 1C27A 2V6CA 3L7GA 3TAVA 4IPAA 1WKMA 2ZSGA 3CB5A 2GU5A 2Q94A 1R5HA
chains in the Genus database with same CATH topology
5E5BA 2GZ5A 2MATA 3PKAA 1O0XA 1XGSA 1YVMA 4IECA 1KQ0A 3PKDA 1B59A 1JAWA 3IL0A 1B6AA 4U71A 2IW2A 4FLKA 1A16A 4U6WA 5CDLA 1WBQA 1M35A 2BN7A 3IU9A 2BWTA 3BIPA 2GG7A 2NQ6A 4IDYA 1PV9A 3QOCA 3PN9A 1WY2A 3PKBA 4IKSA 4RZZA 2GTXA 4IU6A 4ZWOA 3IU8A 4OOKA 4ZWUA 4FUKA 2ADUA 2BHBA 4U6EA 1KP0A 3BITA 2BWSA 4S00A 1C23A 3FMQA 5JFRA 5E2CA 2OAZA 1XGMA 4JUQA 4U69A 4IKTA 4U75A 1WN1A 2Q92A 4U6ZA 4S01A 1YW7A 1R58A 4QR8A 2B3HA 3MX6A 3PEBA 4RGZ1 3PKCA 4IF7A 3PKEA 1QZYA 3FM3A 2BWWA 3BIQA 4B28A 3IG4A 1MATA 2DFIA 2GU4A 5CDVA 2BH3A 3MATA 3O5VA 3RORA 5CE6A 3CB6A 4U6CA 3IU7A 5CLSA 2B3KA 1XGOA 2NQ7A 4Z7MA 4FLLA 3TB5A 2BHAA 5FCFA 4FLJA 3S6BA 4PNCA 2BWUA 4ZWPA 2Q96A 2P9AA 4U1BA 5D6EA 2GGCA 1C22A 4U76A 2OKNA 1W2MA 3FMRA 4PV4A 4ZNGA 3OVKA 2EA2A 4EGEA 2EA4A 2GG9A 2GGBA 4A6WA 4FO8A 2P98A 2GU6A 4RZYA 5CNXA 1QXYA 3CTZA 4FO7A 2BHDA 2BHCA 3Q6DA 1Y1NA 1C21A 5CIKA 2GU7A 2Q93A 4FKCA 2BWYA 3RVAA 5JI6A 1N51A 4S2TP 2Q8KA 2EVCA 4IKUA 4U73A 2HOWA 3OOOA 1BN5A 2GG8A 1W7VA 2GG2A 1XGNA 1YW9A 4U6JA 4MATA 1WL6A 3I7MA 2G6PA 1BOAA 4IKRA 3L24A 1YW8A 4FLIA 4R60A 3D27A 4U70A 2BB7A 2BWXA 2P99A 2BWVA 1KQ9A 2V3ZA 2EVMA 1QXWA 4KM3A 2GG0A 2B3LA 5JHUA 1WLRA 2EVOA 2GG5A 1R5GA 1C24A 2GG3A 5CDEA 1QXZA 1XNZA 2V3XA 1YJ3A 2V3YA 2GA2A 5D6FA 4S2RP 5FCHA 1WL9A 4HXXA 1CHMA 2Q95A 4A6VA 3MR1A 1C27A 2V6CA 3L7GA 3TAVA 4IPAA 1WKMA 2ZSGA 3CB5A 2GU5A 2Q94A 1R5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5B A;  2GZ5 A;  2MAT A;  3PKA A;  1O0X A;  1XGS A;  1YVM A;  4IEC A;  1KQ0 A;  3PKD A;  1B59 A;  1JAW A;  3IL0 A;  1B6A A;  4U71 A;  2IW2 A;  4FLK A;  1A16 A;  4U6W A;  5CDL A;  1WBQ A;  1M35 A;  2BN7 A;  3IU9 A;  2BWT A;  3BIP A;  2GG7 A;  2NQ6 A;  4IDY A;  1PV9 A;  3QOC A;  3PN9 A;  1WY2 A;  3PKB A;  4IKS A;  4RZZ A;  2GTX A;  4IU6 A;  4ZWO A;  3IU8 A;  4OOK A;  4ZWU A;  4FUK A;  2ADU A;  2BHB A;  4U6E A;  1KP0 A;  3BIT A;  2BWS A;  4S00 A;  1C23 A;  3FMQ A;  5JFR A;  5E2C A;  2OAZ A;  1XGM A;  4JUQ A;  4U69 A;  4IKT A;  4U75 A;  1WN1 A;  2Q92 A;  4U6Z A;  4S01 A;  1YW7 A;  1R58 A;  4QR8 A;  2B3H A;  3MX6 A;  3PEB A;  4RGZ 1;  3PKC A;  4IF7 A;  3PKE A;  1QZY A;  3FM3 A;  2BWW A;  3BIQ A;  4B28 A;  3IG4 A;  1MAT A;  2DFI A;  2GU4 A;  5CDV A;  2BH3 A;  3MAT A;  3O5V A;  3ROR A;  5CE6 A;  3CB6 A;  4U6C A;  3IU7 A;  5CLS A;  2B3K A;  1XGO A;  2NQ7 A;  4Z7M A;  4FLL A;  3TB5 A;  2BHA A;  5FCF A;  4FLJ A;  3S6B A;  4PNC A;  2BWU A;  4ZWP A;  2Q96 A;  2P9A A;  4U1B A;  5D6E A;  2GGC A;  1C22 A;  4U76 A;  2OKN A;  1W2M A;  3FMR A;  4PV4 A;  4ZNG A;  3OVK A;  2EA2 A;  4EGE A;  2EA4 A;  2GG9 A;  2GGB A;  4A6W A;  4FO8 A;  2P98 A;  2GU6 A;  4RZY A;  5CNX A;  1QXY A;  3CTZ A;  4FO7 A;  2BHD A;  2BHC A;  3Q6D A;  1Y1N A;  1C21 A;  5CIK A;  2GU7 A;  2Q93 A;  4FKC A;  2BWY A;  3RVA A;  5JI6 A;  1N51 A;  4S2T P;  2Q8K A;  2EVC A;  4IKU A;  4U73 A;  2HOW A;  3OOO A;  1BN5 A;  2GG8 A;  1W7V A;  2GG2 A;  1XGN A;  1YW9 A;  4U6J A;  4MAT A;  1WL6 A;  3I7M A;  2G6P A;  1BOA A;  4IKR A;  3L24 A;  1YW8 A;  4FLI A;  4R60 A;  3D27 A;  4U70 A;  2BB7 A;  2BWX A;  2P99 A;  2BWV A;  1KQ9 A;  2V3Z A;  2EVM A;  1QXW A;  4KM3 A;  2GG0 A;  2B3L A;  5JHU A;  1WLR A;  2EVO A;  2GG5 A;  1R5G A;  1C24 A;  2GG3 A;  5CDE A;  1QXZ A;  1XNZ A;  2V3X A;  1YJ3 A;  2V3Y A;  2GA2 A;  5D6F A;  4S2R P;  5FCH A;  1WL9 A;  4HXX A;  1CHM A;  2Q95 A;  4A6V A;  3MR1 A;  1C27 A;  2V6C A;  3L7G A;  3TAV A;  4IPA A;  1WKM A;  2ZSG A;  3CB5 A;  2GU5 A;  2Q94 A;  1R5H A; 
#chains in the Genus database with same CATH topology
 5E5B A;  2GZ5 A;  2MAT A;  3PKA A;  1O0X A;  1XGS A;  1YVM A;  4IEC A;  1KQ0 A;  3PKD A;  1B59 A;  1JAW A;  3IL0 A;  1B6A A;  4U71 A;  2IW2 A;  4FLK A;  1A16 A;  4U6W A;  5CDL A;  1WBQ A;  1M35 A;  2BN7 A;  3IU9 A;  2BWT A;  3BIP A;  2GG7 A;  2NQ6 A;  4IDY A;  1PV9 A;  3QOC A;  3PN9 A;  1WY2 A;  3PKB A;  4IKS A;  4RZZ A;  2GTX A;  4IU6 A;  4ZWO A;  3IU8 A;  4OOK A;  4ZWU A;  4FUK A;  2ADU A;  2BHB A;  4U6E A;  1KP0 A;  3BIT A;  2BWS A;  4S00 A;  1C23 A;  3FMQ A;  5JFR A;  5E2C A;  2OAZ A;  1XGM A;  4JUQ A;  4U69 A;  4IKT A;  4U75 A;  1WN1 A;  2Q92 A;  4U6Z A;  4S01 A;  1YW7 A;  1R58 A;  4QR8 A;  2B3H A;  3MX6 A;  3PEB A;  4RGZ 1;  3PKC A;  4IF7 A;  3PKE A;  1QZY A;  3FM3 A;  2BWW A;  3BIQ A;  4B28 A;  3IG4 A;  1MAT A;  2DFI A;  2GU4 A;  5CDV A;  2BH3 A;  3MAT A;  3O5V A;  3ROR A;  5CE6 A;  3CB6 A;  4U6C A;  3IU7 A;  5CLS A;  2B3K A;  1XGO A;  2NQ7 A;  4Z7M A;  4FLL A;  3TB5 A;  2BHA A;  5FCF A;  4FLJ A;  3S6B A;  4PNC A;  2BWU A;  4ZWP A;  2Q96 A;  2P9A A;  4U1B A;  5D6E A;  2GGC A;  1C22 A;  4U76 A;  2OKN A;  1W2M A;  3FMR A;  4PV4 A;  4ZNG A;  3OVK A;  2EA2 A;  4EGE A;  2EA4 A;  2GG9 A;  2GGB A;  4A6W A;  4FO8 A;  2P98 A;  2GU6 A;  4RZY A;  5CNX A;  1QXY A;  3CTZ A;  4FO7 A;  2BHD A;  2BHC A;  3Q6D A;  1Y1N A;  1C21 A;  5CIK A;  2GU7 A;  2Q93 A;  4FKC A;  2BWY A;  3RVA A;  5JI6 A;  1N51 A;  4S2T P;  2Q8K A;  2EVC A;  4IKU A;  4U73 A;  2HOW A;  3OOO A;  1BN5 A;  2GG8 A;  1W7V A;  2GG2 A;  1XGN A;  1YW9 A;  4U6J A;  4MAT A;  1WL6 A;  3I7M A;  2G6P A;  1BOA A;  4IKR A;  3L24 A;  1YW8 A;  4FLI A;  4R60 A;  3D27 A;  4U70 A;  2BB7 A;  2BWX A;  2P99 A;  2BWV A;  1KQ9 A;  2V3Z A;  2EVM A;  1QXW A;  4KM3 A;  2GG0 A;  2B3L A;  5JHU A;  1WLR A;  2EVO A;  2GG5 A;  1R5G A;  1C24 A;  2GG3 A;  5CDE A;  1QXZ A;  1XNZ A;  2V3X A;  1YJ3 A;  2V3Y A;  2GA2 A;  5D6F A;  4S2R P;  5FCH A;  1WL9 A;  4HXX A;  1CHM A;  2Q95 A;  4A6V A;  3MR1 A;  1C27 A;  2V6C A;  3L7G A;  3TAV A;  4IPA A;  1WKM A;  2ZSG A;  3CB5 A;  2GU5 A;  2Q94 A;  1R5H A; 
#chains in the Genus database with same CATH homology
 5E5B A;  2GZ5 A;  2MAT A;  3PKA A;  1O0X A;  1XGS A;  1YVM A;  4IEC A;  1KQ0 A;  3PKD A;  1B59 A;  1JAW A;  3IL0 A;  1B6A A;  4U71 A;  2IW2 A;  4FLK A;  1A16 A;  4U6W A;  5CDL A;  1WBQ A;  1M35 A;  2BN7 A;  3IU9 A;  2BWT A;  3BIP A;  2GG7 A;  2NQ6 A;  4IDY A;  1PV9 A;  3QOC A;  3PN9 A;  1WY2 A;  3PKB A;  4IKS A;  4RZZ A;  2GTX A;  4IU6 A;  4ZWO A;  3IU8 A;  4OOK A;  4ZWU A;  4FUK A;  2ADU A;  2BHB A;  4U6E A;  1KP0 A;  3BIT A;  2BWS A;  4S00 A;  1C23 A;  3FMQ A;  5JFR A;  5E2C A;  2OAZ A;  1XGM A;  4JUQ A;  4U69 A;  4IKT A;  4U75 A;  1WN1 A;  2Q92 A;  4U6Z A;  4S01 A;  1YW7 A;  1R58 A;  4QR8 A;  2B3H A;  3MX6 A;  3PEB A;  4RGZ 1;  3PKC A;  4IF7 A;  3PKE A;  1QZY A;  3FM3 A;  2BWW A;  3BIQ A;  4B28 A;  3IG4 A;  1MAT A;  2DFI A;  2GU4 A;  5CDV A;  2BH3 A;  3MAT A;  3O5V A;  3ROR A;  5CE6 A;  3CB6 A;  4U6C A;  3IU7 A;  5CLS A;  2B3K A;  1XGO A;  2NQ7 A;  4Z7M A;  4FLL A;  3TB5 A;  2BHA A;  5FCF A;  4FLJ A;  3S6B A;  4PNC A;  2BWU A;  4ZWP A;  2Q96 A;  2P9A A;  4U1B A;  5D6E A;  2GGC A;  1C22 A;  4U76 A;  2OKN A;  1W2M A;  3FMR A;  4PV4 A;  4ZNG A;  3OVK A;  2EA2 A;  4EGE A;  2EA4 A;  2GG9 A;  2GGB A;  4A6W A;  4FO8 A;  2P98 A;  2GU6 A;  4RZY A;  5CNX A;  1QXY A;  3CTZ A;  4FO7 A;  2BHD A;  2BHC A;  3Q6D A;  1Y1N A;  1C21 A;  5CIK A;  2GU7 A;  2Q93 A;  4FKC A;  2BWY A;  3RVA A;  5JI6 A;  1N51 A;  4S2T P;  2Q8K A;  2EVC A;  4IKU A;  4U73 A;  2HOW A;  3OOO A;  1BN5 A;  2GG8 A;  1W7V A;  2GG2 A;  1XGN A;  1YW9 A;  4U6J A;  4MAT A;  1WL6 A;  3I7M A;  2G6P A;  1BOA A;  4IKR A;  3L24 A;  1YW8 A;  4FLI A;  4R60 A;  3D27 A;  4U70 A;  2BB7 A;  2BWX A;  2P99 A;  2BWV A;  1KQ9 A;  2V3Z A;  2EVM A;  1QXW A;  4KM3 A;  2GG0 A;  2B3L A;  5JHU A;  1WLR A;  2EVO A;  2GG5 A;  1R5G A;  1C24 A;  2GG3 A;  5CDE A;  1QXZ A;  1XNZ A;  2V3X A;  1YJ3 A;  2V3Y A;  2GA2 A;  5D6F A;  4S2R P;  5FCH A;  1WL9 A;  4HXX A;  1CHM A;  2Q95 A;  4A6V A;  3MR1 A;  1C27 A;  2V6C A;  3L7G A;  3TAV A;  4IPA A;  1WKM A;  2ZSG A;  3CB5 A;  2GU5 A;  2Q94 A;  1R5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...