3BITA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
447
structure length
447
Chain Sequence
MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bitA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bitA02
3PN9A 2BWUA 3RVAA 2NQ7A 4IF7A 4U71A 4S01A 4RGZ1 1WN1A 2BWXA 1C24A 3CTZA 2V3ZA 3BIPA 2GG3A 4FO8A 3IG4A 2GU6A 4IDYA 2BHCA 5E2CA 4U1BA 4A6WA 1R58A 2GU4A 2GG2A 2B3HA 2EVCA 3O5VA 5CLSA 3PKCA 4S2RP 4FLIA 2V3XA 4ZWUA 1XGMA 4KM3A 4IECA 2BWWA 1W7VA 4MATA 4FLJA 2GGCA 1B6AA 3S6BA 5JI6A 3OVKA 1C23A 4U6CA 2GU5A 3BIQA 4U6JA 4U6ZA 5CDVA 2P98A 4PNCA 1XGSA 3IL0A 4EGEA 5D6EA 1C21A 4U75A 2BHAA 4IKUA 3PEBA 2EVOA 3QOCA 2V6CA 5JHUA 4ZNGA 1R5GA 1W2MA 4RZZA 3D27A 2HOWA 2BWYA 1YW9A 4IU6A 4U69A 2MATA 2NQ6A 4S00A 4IPAA 3MR1A 3RORA 1QXZA 3TB5A 5D6FA 5CIKA 2DFIA 3MATA 1YW8A 1XGNA 4IKSA 1QXWA 1YW7A 1M35A 1C27A 3BITA 2Q96A 4ZWPA 3IU7A 1XGOA 2EA4A 4FKCA 1KP0A 2OAZA 1Y1NA 4FO7A 4RZYA 2P9AA 3IU9A 1N51A 1WKMA 3L24A 2GG7A 4IKTA 4U6EA 3FMQA 4HXXA 3FMRA 1CHMA 1BN5A 3I7MA 3CB5A 5CNXA 2B3KA 2GG0A 1WY2A 2GG9A 2Q94A 4FUKA 1PV9A 4U70A 4U73A 1WLRA 3Q6DA 2GG5A 1QZYA 5JFRA 4QR8A 5CDLA 1B59A 1BOAA 1O0XA 1WL6A 3IU8A 3MX6A 2BHBA 1MATA 2G6PA 2OKNA 2ADUA 2EVMA 2Q93A 3PKAA 4Z7MA 1WL9A 3OOOA 4U76A 1JAWA 1A16A 2EA2A 2P99A 1XNZA 2BN7A 1C22A 1R5HA 2Q95A 1QXYA 2Q92A 4IKRA 3PKEA 4R60A 5CE6A 1KQ0A 3TAVA 4FLLA 3PKBA 2Q8KA 2BWVA 2BWTA 5FCFA 5CDEA 2GG8A 1WBQA 2GA2A 2GZ5A 2B3LA 4B28A 2GGBA 3CB6A 2BHDA 4FLKA 5FCHA 4OOKA 3PKDA 1YVMA 2GTXA 3L7GA 2BH3A 2BB7A 2IW2A 4ZWOA 2ZSGA 1KQ9A 1YJ3A 3FM3A 5E5BA 4A6VA 2V3YA 2GU7A 2BWSA 4JUQA 4U6WA 4S2TP 4PV4A
chains in the Genus database with same CATH superfamily
3PN9A 2BWUA 3RVAA 2NQ7A 4IF7A 4U71A 4S01A 4RGZ1 1WN1A 2BWXA 1C24A 3CTZA 2V3ZA 3BIPA 2GG3A 4FO8A 3IG4A 2GU6A 4IDYA 2BHCA 5E2CA 4U1BA 4A6WA 1R58A 2GU4A 2GG2A 2B3HA 2EVCA 3O5VA 5CLSA 3PKCA 4S2RP 4FLIA 2V3XA 4ZWUA 1XGMA 4KM3A 4IECA 2BWWA 1W7VA 4MATA 4FLJA 2GGCA 1B6AA 3S6BA 5JI6A 3OVKA 1C23A 4U6CA 2GU5A 3BIQA 4U6JA 4U6ZA 5CDVA 2P98A 4PNCA 1XGSA 3IL0A 4EGEA 5D6EA 1C21A 4U75A 2BHAA 4IKUA 3PEBA 2EVOA 3QOCA 2V6CA 5JHUA 4ZNGA 1R5GA 1W2MA 4RZZA 3D27A 2HOWA 2BWYA 1YW9A 4IU6A 4U69A 2MATA 2NQ6A 4S00A 4IPAA 3MR1A 3RORA 1QXZA 3TB5A 5D6FA 5CIKA 2DFIA 3MATA 1YW8A 1XGNA 4IKSA 1QXWA 1YW7A 1M35A 1C27A 3BITA 2Q96A 4ZWPA 3IU7A 1XGOA 2EA4A 4FKCA 1KP0A 2OAZA 1Y1NA 4FO7A 4RZYA 2P9AA 3IU9A 1N51A 1WKMA 3L24A 2GG7A 4IKTA 4U6EA 3FMQA 4HXXA 3FMRA 1CHMA 1BN5A 3I7MA 3CB5A 5CNXA 2B3KA 2GG0A 1WY2A 2GG9A 2Q94A 4FUKA 1PV9A 4U70A 4U73A 1WLRA 3Q6DA 2GG5A 1QZYA 5JFRA 4QR8A 5CDLA 1B59A 1BOAA 1O0XA 1WL6A 3IU8A 3MX6A 2BHBA 1MATA 2G6PA 2OKNA 2ADUA 2EVMA 2Q93A 3PKAA 4Z7MA 1WL9A 3OOOA 4U76A 1JAWA 1A16A 2EA2A 2P99A 1XNZA 2BN7A 1C22A 1R5HA 2Q95A 1QXYA 2Q92A 4IKRA 3PKEA 4R60A 5CE6A 1KQ0A 3TAVA 4FLLA 3PKBA 2Q8KA 2BWVA 2BWTA 5FCFA 5CDEA 2GG8A 1WBQA 2GA2A 2GZ5A 2B3LA 4B28A 2GGBA 3CB6A 2BHDA 4FLKA 5FCHA 4OOKA 3PKDA 1YVMA 2GTXA 3L7GA 2BH3A 2BB7A 2IW2A 4ZWOA 2ZSGA 1KQ9A 1YJ3A 3FM3A 5E5BA 4A6VA 2V3YA 2GU7A 2BWSA 4JUQA 4U6WA 4S2TP 4PV4A
chains in the Genus database with same CATH topology
3PN9A 2BWUA 3RVAA 2NQ7A 4IF7A 4U71A 4S01A 4RGZ1 1WN1A 2BWXA 1C24A 3CTZA 2V3ZA 3BIPA 2GG3A 4FO8A 3IG4A 2GU6A 4IDYA 2BHCA 5E2CA 4U1BA 4A6WA 1R58A 2GU4A 2GG2A 2B3HA 2EVCA 3O5VA 5CLSA 3PKCA 4S2RP 4FLIA 2V3XA 4ZWUA 1XGMA 4KM3A 4IECA 2BWWA 1W7VA 4MATA 4FLJA 2GGCA 1B6AA 3S6BA 5JI6A 3OVKA 1C23A 4U6CA 2GU5A 3BIQA 4U6JA 4U6ZA 5CDVA 2P98A 4PNCA 1XGSA 3IL0A 4EGEA 5D6EA 1C21A 4U75A 2BHAA 4IKUA 3PEBA 2EVOA 3QOCA 2V6CA 5JHUA 4ZNGA 1R5GA 1W2MA 4RZZA 3D27A 2HOWA 2BWYA 1YW9A 4IU6A 4U69A 2MATA 2NQ6A 4S00A 4IPAA 3MR1A 3RORA 1QXZA 3TB5A 5D6FA 5CIKA 2DFIA 3MATA 1YW8A 1XGNA 4IKSA 1QXWA 1YW7A 1M35A 1C27A 3BITA 2Q96A 4ZWPA 3IU7A 1XGOA 2EA4A 4FKCA 1KP0A 2OAZA 1Y1NA 4FO7A 4RZYA 2P9AA 3IU9A 1N51A 1WKMA 3L24A 2GG7A 4IKTA 4U6EA 3FMQA 4HXXA 3FMRA 1CHMA 1BN5A 3I7MA 3CB5A 5CNXA 2B3KA 2GG0A 1WY2A 2GG9A 2Q94A 4FUKA 1PV9A 4U70A 4U73A 1WLRA 3Q6DA 2GG5A 1QZYA 5JFRA 4QR8A 5CDLA 1B59A 1BOAA 1O0XA 1WL6A 3IU8A 3MX6A 2BHBA 1MATA 2G6PA 2OKNA 2ADUA 2EVMA 2Q93A 3PKAA 4Z7MA 1WL9A 3OOOA 4U76A 1JAWA 1A16A 2EA2A 2P99A 1XNZA 2BN7A 1C22A 1R5HA 2Q95A 1QXYA 2Q92A 4IKRA 3PKEA 4R60A 5CE6A 1KQ0A 3TAVA 4FLLA 3PKBA 2Q8KA 2BWVA 2BWTA 5FCFA 5CDEA 2GG8A 1WBQA 2GA2A 2GZ5A 2B3LA 4B28A 2GGBA 3CB6A 2BHDA 4FLKA 5FCHA 4OOKA 3PKDA 1YVMA 2GTXA 3L7GA 2BH3A 2BB7A 2IW2A 4ZWOA 2ZSGA 1KQ9A 1YJ3A 3FM3A 5E5BA 4A6VA 2V3YA 2GU7A 2BWSA 4JUQA 4U6WA 4S2TP 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PN9 A;  2BWU A;  3RVA A;  2NQ7 A;  4IF7 A;  4U71 A;  4S01 A;  4RGZ 1;  1WN1 A;  2BWX A;  1C24 A;  3CTZ A;  2V3Z A;  3BIP A;  2GG3 A;  4FO8 A;  3IG4 A;  2GU6 A;  4IDY A;  2BHC A;  5E2C A;  4U1B A;  4A6W A;  1R58 A;  2GU4 A;  2GG2 A;  2B3H A;  2EVC A;  3O5V A;  5CLS A;  3PKC A;  4S2R P;  4FLI A;  2V3X A;  4ZWU A;  1XGM A;  4KM3 A;  4IEC A;  2BWW A;  1W7V A;  4MAT A;  4FLJ A;  2GGC A;  1B6A A;  3S6B A;  5JI6 A;  3OVK A;  1C23 A;  4U6C A;  2GU5 A;  3BIQ A;  4U6J A;  4U6Z A;  5CDV A;  2P98 A;  4PNC A;  1XGS A;  3IL0 A;  4EGE A;  5D6E A;  1C21 A;  4U75 A;  2BHA A;  4IKU A;  3PEB A;  2EVO A;  3QOC A;  2V6C A;  5JHU A;  4ZNG A;  1R5G A;  1W2M A;  4RZZ A;  3D27 A;  2HOW A;  2BWY A;  1YW9 A;  4IU6 A;  4U69 A;  2MAT A;  2NQ6 A;  4S00 A;  4IPA A;  3MR1 A;  3ROR A;  1QXZ A;  3TB5 A;  5D6F A;  5CIK A;  2DFI A;  3MAT A;  1YW8 A;  1XGN A;  4IKS A;  1QXW A;  1YW7 A;  1M35 A;  1C27 A;  3BIT A;  2Q96 A;  4ZWP A;  3IU7 A;  1XGO A;  2EA4 A;  4FKC A;  1KP0 A;  2OAZ A;  1Y1N A;  4FO7 A;  4RZY A;  2P9A A;  3IU9 A;  1N51 A;  1WKM A;  3L24 A;  2GG7 A;  4IKT A;  4U6E A;  3FMQ A;  4HXX A;  3FMR A;  1CHM A;  1BN5 A;  3I7M A;  3CB5 A;  5CNX A;  2B3K A;  2GG0 A;  1WY2 A;  2GG9 A;  2Q94 A;  4FUK A;  1PV9 A;  4U70 A;  4U73 A;  1WLR A;  3Q6D A;  2GG5 A;  1QZY A;  5JFR A;  4QR8 A;  5CDL A;  1B59 A;  1BOA A;  1O0X A;  1WL6 A;  3IU8 A;  3MX6 A;  2BHB A;  1MAT A;  2G6P A;  2OKN A;  2ADU A;  2EVM A;  2Q93 A;  3PKA A;  4Z7M A;  1WL9 A;  3OOO A;  4U76 A;  1JAW A;  1A16 A;  2EA2 A;  2P99 A;  1XNZ A;  2BN7 A;  1C22 A;  1R5H A;  2Q95 A;  1QXY A;  2Q92 A;  4IKR A;  3PKE A;  4R60 A;  5CE6 A;  1KQ0 A;  3TAV A;  4FLL A;  3PKB A;  2Q8K A;  2BWV A;  2BWT A;  5FCF A;  5CDE A;  2GG8 A;  1WBQ A;  2GA2 A;  2GZ5 A;  2B3L A;  4B28 A;  2GGB A;  3CB6 A;  2BHD A;  4FLK A;  5FCH A;  4OOK A;  3PKD A;  1YVM A;  2GTX A;  3L7G A;  2BH3 A;  2BB7 A;  2IW2 A;  4ZWO A;  2ZSG A;  1KQ9 A;  1YJ3 A;  3FM3 A;  5E5B A;  4A6V A;  2V3Y A;  2GU7 A;  2BWS A;  4JUQ A;  4U6W A;  4S2T P;  4PV4 A; 
#chains in the Genus database with same CATH topology
 3PN9 A;  2BWU A;  3RVA A;  2NQ7 A;  4IF7 A;  4U71 A;  4S01 A;  4RGZ 1;  1WN1 A;  2BWX A;  1C24 A;  3CTZ A;  2V3Z A;  3BIP A;  2GG3 A;  4FO8 A;  3IG4 A;  2GU6 A;  4IDY A;  2BHC A;  5E2C A;  4U1B A;  4A6W A;  1R58 A;  2GU4 A;  2GG2 A;  2B3H A;  2EVC A;  3O5V A;  5CLS A;  3PKC A;  4S2R P;  4FLI A;  2V3X A;  4ZWU A;  1XGM A;  4KM3 A;  4IEC A;  2BWW A;  1W7V A;  4MAT A;  4FLJ A;  2GGC A;  1B6A A;  3S6B A;  5JI6 A;  3OVK A;  1C23 A;  4U6C A;  2GU5 A;  3BIQ A;  4U6J A;  4U6Z A;  5CDV A;  2P98 A;  4PNC A;  1XGS A;  3IL0 A;  4EGE A;  5D6E A;  1C21 A;  4U75 A;  2BHA A;  4IKU A;  3PEB A;  2EVO A;  3QOC A;  2V6C A;  5JHU A;  4ZNG A;  1R5G A;  1W2M A;  4RZZ A;  3D27 A;  2HOW A;  2BWY A;  1YW9 A;  4IU6 A;  4U69 A;  2MAT A;  2NQ6 A;  4S00 A;  4IPA A;  3MR1 A;  3ROR A;  1QXZ A;  3TB5 A;  5D6F A;  5CIK A;  2DFI A;  3MAT A;  1YW8 A;  1XGN A;  4IKS A;  1QXW A;  1YW7 A;  1M35 A;  1C27 A;  3BIT A;  2Q96 A;  4ZWP A;  3IU7 A;  1XGO A;  2EA4 A;  4FKC A;  1KP0 A;  2OAZ A;  1Y1N A;  4FO7 A;  4RZY A;  2P9A A;  3IU9 A;  1N51 A;  1WKM A;  3L24 A;  2GG7 A;  4IKT A;  4U6E A;  3FMQ A;  4HXX A;  3FMR A;  1CHM A;  1BN5 A;  3I7M A;  3CB5 A;  5CNX A;  2B3K A;  2GG0 A;  1WY2 A;  2GG9 A;  2Q94 A;  4FUK A;  1PV9 A;  4U70 A;  4U73 A;  1WLR A;  3Q6D A;  2GG5 A;  1QZY A;  5JFR A;  4QR8 A;  5CDL A;  1B59 A;  1BOA A;  1O0X A;  1WL6 A;  3IU8 A;  3MX6 A;  2BHB A;  1MAT A;  2G6P A;  2OKN A;  2ADU A;  2EVM A;  2Q93 A;  3PKA A;  4Z7M A;  1WL9 A;  3OOO A;  4U76 A;  1JAW A;  1A16 A;  2EA2 A;  2P99 A;  1XNZ A;  2BN7 A;  1C22 A;  1R5H A;  2Q95 A;  1QXY A;  2Q92 A;  4IKR A;  3PKE A;  4R60 A;  5CE6 A;  1KQ0 A;  3TAV A;  4FLL A;  3PKB A;  2Q8K A;  2BWV A;  2BWT A;  5FCF A;  5CDE A;  2GG8 A;  1WBQ A;  2GA2 A;  2GZ5 A;  2B3L A;  4B28 A;  2GGB A;  3CB6 A;  2BHD A;  4FLK A;  5FCH A;  4OOK A;  3PKD A;  1YVM A;  2GTX A;  3L7G A;  2BH3 A;  2BB7 A;  2IW2 A;  4ZWO A;  2ZSG A;  1KQ9 A;  1YJ3 A;  3FM3 A;  5E5B A;  4A6V A;  2V3Y A;  2GU7 A;  2BWS A;  4JUQ A;  4U6W A;  4S2T P;  4PV4 A; 
#chains in the Genus database with same CATH homology
 3PN9 A;  2BWU A;  3RVA A;  2NQ7 A;  4IF7 A;  4U71 A;  4S01 A;  4RGZ 1;  1WN1 A;  2BWX A;  1C24 A;  3CTZ A;  2V3Z A;  3BIP A;  2GG3 A;  4FO8 A;  3IG4 A;  2GU6 A;  4IDY A;  2BHC A;  5E2C A;  4U1B A;  4A6W A;  1R58 A;  2GU4 A;  2GG2 A;  2B3H A;  2EVC A;  3O5V A;  5CLS A;  3PKC A;  4S2R P;  4FLI A;  2V3X A;  4ZWU A;  1XGM A;  4KM3 A;  4IEC A;  2BWW A;  1W7V A;  4MAT A;  4FLJ A;  2GGC A;  1B6A A;  3S6B A;  5JI6 A;  3OVK A;  1C23 A;  4U6C A;  2GU5 A;  3BIQ A;  4U6J A;  4U6Z A;  5CDV A;  2P98 A;  4PNC A;  1XGS A;  3IL0 A;  4EGE A;  5D6E A;  1C21 A;  4U75 A;  2BHA A;  4IKU A;  3PEB A;  2EVO A;  3QOC A;  2V6C A;  5JHU A;  4ZNG A;  1R5G A;  1W2M A;  4RZZ A;  3D27 A;  2HOW A;  2BWY A;  1YW9 A;  4IU6 A;  4U69 A;  2MAT A;  2NQ6 A;  4S00 A;  4IPA A;  3MR1 A;  3ROR A;  1QXZ A;  3TB5 A;  5D6F A;  5CIK A;  2DFI A;  3MAT A;  1YW8 A;  1XGN A;  4IKS A;  1QXW A;  1YW7 A;  1M35 A;  1C27 A;  3BIT A;  2Q96 A;  4ZWP A;  3IU7 A;  1XGO A;  2EA4 A;  4FKC A;  1KP0 A;  2OAZ A;  1Y1N A;  4FO7 A;  4RZY A;  2P9A A;  3IU9 A;  1N51 A;  1WKM A;  3L24 A;  2GG7 A;  4IKT A;  4U6E A;  3FMQ A;  4HXX A;  3FMR A;  1CHM A;  1BN5 A;  3I7M A;  3CB5 A;  5CNX A;  2B3K A;  2GG0 A;  1WY2 A;  2GG9 A;  2Q94 A;  4FUK A;  1PV9 A;  4U70 A;  4U73 A;  1WLR A;  3Q6D A;  2GG5 A;  1QZY A;  5JFR A;  4QR8 A;  5CDL A;  1B59 A;  1BOA A;  1O0X A;  1WL6 A;  3IU8 A;  3MX6 A;  2BHB A;  1MAT A;  2G6P A;  2OKN A;  2ADU A;  2EVM A;  2Q93 A;  3PKA A;  4Z7M A;  1WL9 A;  3OOO A;  4U76 A;  1JAW A;  1A16 A;  2EA2 A;  2P99 A;  1XNZ A;  2BN7 A;  1C22 A;  1R5H A;  2Q95 A;  1QXY A;  2Q92 A;  4IKR A;  3PKE A;  4R60 A;  5CE6 A;  1KQ0 A;  3TAV A;  4FLL A;  3PKB A;  2Q8K A;  2BWV A;  2BWT A;  5FCF A;  5CDE A;  2GG8 A;  1WBQ A;  2GA2 A;  2GZ5 A;  2B3L A;  4B28 A;  2GGB A;  3CB6 A;  2BHD A;  4FLK A;  5FCH A;  4OOK A;  3PKD A;  1YVM A;  2GTX A;  3L7G A;  2BH3 A;  2BB7 A;  2IW2 A;  4ZWO A;  2ZSG A;  1KQ9 A;  1YJ3 A;  3FM3 A;  5E5B A;  4A6V A;  2V3Y A;  2GU7 A;  2BWS A;  4JUQ A;  4U6W A;  4S2T P;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...