3BITA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
447
structure length
447
Chain Sequence
b'MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bitA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bitA02
1C27A 4IDYA 4IKSA 3MR1A 4MATA 4A6VA 2BWVA 2BHCA 4RZZA 4U70A 4S00A 1B59A 1W2MA 2EA4A 4S2RP 4U1BA 3Q6DA 4U73A 4FUKA 2EVCA 1KQ0A 2OAZA 3PKEA 3OOOA 4ZWPA 3CB6A 2BWWA 5CE6A 2GG7A 4U76A 2V3XA 3PKBA 2ZSGA 3FMQA 4A6WA 2BHDA 2Q96A 4RZYA 2GU5A 4QR8A 1M35A 3IU7A 2GU7A 4R60A 2BWXA 4S01A 2Q94A 1WKMA 3PKAA 3L7GA 3PKCA 5JI6A 2GU6A 2GG0A 2NQ6A 2Q92A 1WY2A 2NQ7A 4U6CA 3BITA 1O0XA 4IPAA 5CNXA 1B6AA 4OOKA 1C24A 1A16A 1BOAA 5FCFA 5E5BA 2BH3A 3CB5A 2GG9A 4U6ZA 5JHUA 4EGEA 1XGMA 4U6WA 2BN7A 2G6PA 2Q95A 3FM3A 5JFRA 5CDEA 2Q93A 3MATA 4FLJA 5D6EA 2BB7A 2GGCA 4FKCA 3BIPA 2EA2A 3PN9A 1C22A 4FLKA 2Q8KA 3IU8A 3S6BA 3IU9A 1KP0A 4IKTA 1YJ3A 1CHMA 3RVAA 1Y1NA 4ZNGA 2BWUA 2BHAA 4FLIA 4HXXA 4U75A 2ADUA 3PEBA 3TAVA 1WN1A 2IW2A 4S2TP 3L24A 2V3ZA 2BWTA 2EVMA 1WBQA 5CIKA 4U71A 2GU4A 1R5GA 2V3YA 1N51A 2P9AA 4IF7A 3I7MA 5FCHA 1R58A 2GGBA 4FO7A 1XGSA 1YW8A 4FLLA 4IECA 4IKRA 3QOCA 4ZWUA 1XNZA 4U69A 2GG3A 3PKDA 4IKUA 2BWSA 2BHBA 5CDVA 1QZYA 3RORA 2B3HA 3CTZA 2EVOA 1QXZA 3IG4A 3O5VA 1W7VA 5CLSA 3TB5A 2P99A 2OKNA 4PV4A 4JUQA 4Z7MA 3OVKA 1BN5A 2BWYA 1YVMA 1YW9A 1JAWA 2B3KA 2DFIA 1PV9A 2GG8A 3MX6A 3IL0A 3FMRA 4KM3A 1XGNA 4RGZ1 1YW7A 4B28A 1QXWA 1XGOA 2B3LA 2HOWA 5CDLA 1R5HA 2GZ5A 3BIQA 1C21A 2P98A 1WLRA 4U6JA 4FO8A 4U6EA 1WL6A 2GG2A 5D6FA 2GG5A 2GTXA 4PNCA 4IU6A 3D27A 1KQ9A 5E2CA 1C23A 1WL9A 2GA2A 4ZWOA 2MATA 2V6CA 1QXYA 1MATA
chains in the Genus database with same CATH superfamily
1C27A 4IDYA 4IKSA 3MR1A 4MATA 4A6VA 2BWVA 2BHCA 4RZZA 4U70A 4S00A 1B59A 1W2MA 2EA4A 4S2RP 4U1BA 3Q6DA 4U73A 4FUKA 2EVCA 1KQ0A 2OAZA 3PKEA 3OOOA 4ZWPA 3CB6A 2BWWA 5CE6A 2GG7A 4U76A 2V3XA 3PKBA 2ZSGA 3FMQA 4A6WA 2BHDA 2Q96A 4RZYA 2GU5A 4QR8A 1M35A 3IU7A 2GU7A 4R60A 2BWXA 4S01A 2Q94A 1WKMA 3PKAA 3L7GA 3PKCA 5JI6A 2GU6A 2GG0A 2NQ6A 2Q92A 1WY2A 2NQ7A 4U6CA 3BITA 1O0XA 4IPAA 5CNXA 1B6AA 4OOKA 1C24A 1A16A 1BOAA 5FCFA 5E5BA 2BH3A 3CB5A 2GG9A 4U6ZA 5JHUA 4EGEA 1XGMA 4U6WA 2BN7A 2G6PA 2Q95A 3FM3A 5JFRA 5CDEA 2Q93A 3MATA 4FLJA 5D6EA 2BB7A 2GGCA 4FKCA 3BIPA 2EA2A 3PN9A 1C22A 4FLKA 2Q8KA 3IU8A 3S6BA 3IU9A 1KP0A 4IKTA 1YJ3A 1CHMA 3RVAA 1Y1NA 4ZNGA 2BWUA 2BHAA 4FLIA 4HXXA 4U75A 2ADUA 3PEBA 3TAVA 1WN1A 2IW2A 4S2TP 3L24A 2V3ZA 2BWTA 2EVMA 1WBQA 5CIKA 4U71A 2GU4A 1R5GA 2V3YA 1N51A 2P9AA 4IF7A 3I7MA 5FCHA 1R58A 2GGBA 4FO7A 1XGSA 1YW8A 4FLLA 4IECA 4IKRA 3QOCA 4ZWUA 1XNZA 4U69A 2GG3A 3PKDA 4IKUA 2BWSA 2BHBA 5CDVA 1QZYA 3RORA 2B3HA 3CTZA 2EVOA 1QXZA 3IG4A 3O5VA 1W7VA 5CLSA 3TB5A 2P99A 2OKNA 4PV4A 4JUQA 4Z7MA 3OVKA 1BN5A 2BWYA 1YVMA 1YW9A 1JAWA 2B3KA 2DFIA 1PV9A 2GG8A 3MX6A 3IL0A 3FMRA 4KM3A 1XGNA 4RGZ1 1YW7A 4B28A 1QXWA 1XGOA 2B3LA 2HOWA 5CDLA 1R5HA 2GZ5A 3BIQA 1C21A 2P98A 1WLRA 4U6JA 4FO8A 4U6EA 1WL6A 2GG2A 5D6FA 2GG5A 2GTXA 4PNCA 4IU6A 3D27A 1KQ9A 5E2CA 1C23A 1WL9A 2GA2A 4ZWOA 2MATA 2V6CA 1QXYA 1MATA
chains in the Genus database with same CATH topology
1C27A 4IDYA 4IKSA 3MR1A 4MATA 4A6VA 2BWVA 2BHCA 4RZZA 4U70A 4S00A 1B59A 1W2MA 2EA4A 4S2RP 4U1BA 3Q6DA 4U73A 4FUKA 2EVCA 1KQ0A 2OAZA 3PKEA 3OOOA 4ZWPA 3CB6A 2BWWA 5CE6A 2GG7A 4U76A 2V3XA 3PKBA 2ZSGA 3FMQA 4A6WA 2BHDA 2Q96A 4RZYA 2GU5A 4QR8A 1M35A 3IU7A 2GU7A 4R60A 2BWXA 4S01A 2Q94A 1WKMA 3PKAA 3L7GA 3PKCA 5JI6A 2GU6A 2GG0A 2NQ6A 2Q92A 1WY2A 2NQ7A 4U6CA 3BITA 1O0XA 4IPAA 5CNXA 1B6AA 4OOKA 1C24A 1A16A 1BOAA 5FCFA 5E5BA 2BH3A 3CB5A 2GG9A 4U6ZA 5JHUA 4EGEA 1XGMA 4U6WA 2BN7A 2G6PA 2Q95A 3FM3A 5JFRA 5CDEA 2Q93A 3MATA 4FLJA 5D6EA 2BB7A 2GGCA 4FKCA 3BIPA 2EA2A 3PN9A 1C22A 4FLKA 2Q8KA 3IU8A 3S6BA 3IU9A 1KP0A 4IKTA 1YJ3A 1CHMA 3RVAA 1Y1NA 4ZNGA 2BWUA 2BHAA 4FLIA 4HXXA 4U75A 2ADUA 3PEBA 3TAVA 1WN1A 2IW2A 4S2TP 3L24A 2V3ZA 2BWTA 2EVMA 1WBQA 5CIKA 4U71A 2GU4A 1R5GA 2V3YA 1N51A 2P9AA 4IF7A 3I7MA 5FCHA 1R58A 2GGBA 4FO7A 1XGSA 1YW8A 4FLLA 4IECA 4IKRA 3QOCA 4ZWUA 1XNZA 4U69A 2GG3A 3PKDA 4IKUA 2BWSA 2BHBA 5CDVA 1QZYA 3RORA 2B3HA 3CTZA 2EVOA 1QXZA 3IG4A 3O5VA 1W7VA 5CLSA 3TB5A 2P99A 2OKNA 4PV4A 4JUQA 4Z7MA 3OVKA 1BN5A 2BWYA 1YVMA 1YW9A 1JAWA 2B3KA 2DFIA 1PV9A 2GG8A 3MX6A 3IL0A 3FMRA 4KM3A 1XGNA 4RGZ1 1YW7A 4B28A 1QXWA 1XGOA 2B3LA 2HOWA 5CDLA 1R5HA 2GZ5A 3BIQA 1C21A 2P98A 1WLRA 4U6JA 4FO8A 4U6EA 1WL6A 2GG2A 5D6FA 2GG5A 2GTXA 4PNCA 4IU6A 3D27A 1KQ9A 5E2CA 1C23A 1WL9A 2GA2A 4ZWOA 2MATA 2V6CA 1QXYA 1MATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C27 A;  4IDY A;  4IKS A;  3MR1 A;  4MAT A;  4A6V A;  2BWV A;  2BHC A;  4RZZ A;  4U70 A;  4S00 A;  1B59 A;  1W2M A;  2EA4 A;  4S2R P;  4U1B A;  3Q6D A;  4U73 A;  4FUK A;  2EVC A;  1KQ0 A;  2OAZ A;  3PKE A;  3OOO A;  4ZWP A;  3CB6 A;  2BWW A;  5CE6 A;  2GG7 A;  4U76 A;  2V3X A;  3PKB A;  2ZSG A;  3FMQ A;  4A6W A;  2BHD A;  2Q96 A;  4RZY A;  2GU5 A;  4QR8 A;  1M35 A;  3IU7 A;  2GU7 A;  4R60 A;  2BWX A;  4S01 A;  2Q94 A;  1WKM A;  3PKA A;  3L7G A;  3PKC A;  5JI6 A;  2GU6 A;  2GG0 A;  2NQ6 A;  2Q92 A;  1WY2 A;  2NQ7 A;  4U6C A;  3BIT A;  1O0X A;  4IPA A;  5CNX A;  1B6A A;  4OOK A;  1C24 A;  1A16 A;  1BOA A;  5FCF A;  5E5B A;  2BH3 A;  3CB5 A;  2GG9 A;  4U6Z A;  5JHU A;  4EGE A;  1XGM A;  4U6W A;  2BN7 A;  2G6P A;  2Q95 A;  3FM3 A;  5JFR A;  5CDE A;  2Q93 A;  3MAT A;  4FLJ A;  5D6E A;  2BB7 A;  2GGC A;  4FKC A;  3BIP A;  2EA2 A;  3PN9 A;  1C22 A;  4FLK A;  2Q8K A;  3IU8 A;  3S6B A;  3IU9 A;  1KP0 A;  4IKT A;  1YJ3 A;  1CHM A;  3RVA A;  1Y1N A;  4ZNG A;  2BWU A;  2BHA A;  4FLI A;  4HXX A;  4U75 A;  2ADU A;  3PEB A;  3TAV A;  1WN1 A;  2IW2 A;  4S2T P;  3L24 A;  2V3Z A;  2BWT A;  2EVM A;  1WBQ A;  5CIK A;  4U71 A;  2GU4 A;  1R5G A;  2V3Y A;  1N51 A;  2P9A A;  4IF7 A;  3I7M A;  5FCH A;  1R58 A;  2GGB A;  4FO7 A;  1XGS A;  1YW8 A;  4FLL A;  4IEC A;  4IKR A;  3QOC A;  4ZWU A;  1XNZ A;  4U69 A;  2GG3 A;  3PKD A;  4IKU A;  2BWS A;  2BHB A;  5CDV A;  1QZY A;  3ROR A;  2B3H A;  3CTZ A;  2EVO A;  1QXZ A;  3IG4 A;  3O5V A;  1W7V A;  5CLS A;  3TB5 A;  2P99 A;  2OKN A;  4PV4 A;  4JUQ A;  4Z7M A;  3OVK A;  1BN5 A;  2BWY A;  1YVM A;  1YW9 A;  1JAW A;  2B3K A;  2DFI A;  1PV9 A;  2GG8 A;  3MX6 A;  3IL0 A;  3FMR A;  4KM3 A;  1XGN A;  4RGZ 1;  1YW7 A;  4B28 A;  1QXW A;  1XGO A;  2B3L A;  2HOW A;  5CDL A;  1R5H A;  2GZ5 A;  3BIQ A;  1C21 A;  2P98 A;  1WLR A;  4U6J A;  4FO8 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  2GG5 A;  2GTX A;  4PNC A;  4IU6 A;  3D27 A;  1KQ9 A;  5E2C A;  1C23 A;  1WL9 A;  2GA2 A;  4ZWO A;  2MAT A;  2V6C A;  1QXY A;  1MAT A; 
#chains in the Genus database with same CATH topology
 1C27 A;  4IDY A;  4IKS A;  3MR1 A;  4MAT A;  4A6V A;  2BWV A;  2BHC A;  4RZZ A;  4U70 A;  4S00 A;  1B59 A;  1W2M A;  2EA4 A;  4S2R P;  4U1B A;  3Q6D A;  4U73 A;  4FUK A;  2EVC A;  1KQ0 A;  2OAZ A;  3PKE A;  3OOO A;  4ZWP A;  3CB6 A;  2BWW A;  5CE6 A;  2GG7 A;  4U76 A;  2V3X A;  3PKB A;  2ZSG A;  3FMQ A;  4A6W A;  2BHD A;  2Q96 A;  4RZY A;  2GU5 A;  4QR8 A;  1M35 A;  3IU7 A;  2GU7 A;  4R60 A;  2BWX A;  4S01 A;  2Q94 A;  1WKM A;  3PKA A;  3L7G A;  3PKC A;  5JI6 A;  2GU6 A;  2GG0 A;  2NQ6 A;  2Q92 A;  1WY2 A;  2NQ7 A;  4U6C A;  3BIT A;  1O0X A;  4IPA A;  5CNX A;  1B6A A;  4OOK A;  1C24 A;  1A16 A;  1BOA A;  5FCF A;  5E5B A;  2BH3 A;  3CB5 A;  2GG9 A;  4U6Z A;  5JHU A;  4EGE A;  1XGM A;  4U6W A;  2BN7 A;  2G6P A;  2Q95 A;  3FM3 A;  5JFR A;  5CDE A;  2Q93 A;  3MAT A;  4FLJ A;  5D6E A;  2BB7 A;  2GGC A;  4FKC A;  3BIP A;  2EA2 A;  3PN9 A;  1C22 A;  4FLK A;  2Q8K A;  3IU8 A;  3S6B A;  3IU9 A;  1KP0 A;  4IKT A;  1YJ3 A;  1CHM A;  3RVA A;  1Y1N A;  4ZNG A;  2BWU A;  2BHA A;  4FLI A;  4HXX A;  4U75 A;  2ADU A;  3PEB A;  3TAV A;  1WN1 A;  2IW2 A;  4S2T P;  3L24 A;  2V3Z A;  2BWT A;  2EVM A;  1WBQ A;  5CIK A;  4U71 A;  2GU4 A;  1R5G A;  2V3Y A;  1N51 A;  2P9A A;  4IF7 A;  3I7M A;  5FCH A;  1R58 A;  2GGB A;  4FO7 A;  1XGS A;  1YW8 A;  4FLL A;  4IEC A;  4IKR A;  3QOC A;  4ZWU A;  1XNZ A;  4U69 A;  2GG3 A;  3PKD A;  4IKU A;  2BWS A;  2BHB A;  5CDV A;  1QZY A;  3ROR A;  2B3H A;  3CTZ A;  2EVO A;  1QXZ A;  3IG4 A;  3O5V A;  1W7V A;  5CLS A;  3TB5 A;  2P99 A;  2OKN A;  4PV4 A;  4JUQ A;  4Z7M A;  3OVK A;  1BN5 A;  2BWY A;  1YVM A;  1YW9 A;  1JAW A;  2B3K A;  2DFI A;  1PV9 A;  2GG8 A;  3MX6 A;  3IL0 A;  3FMR A;  4KM3 A;  1XGN A;  4RGZ 1;  1YW7 A;  4B28 A;  1QXW A;  1XGO A;  2B3L A;  2HOW A;  5CDL A;  1R5H A;  2GZ5 A;  3BIQ A;  1C21 A;  2P98 A;  1WLR A;  4U6J A;  4FO8 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  2GG5 A;  2GTX A;  4PNC A;  4IU6 A;  3D27 A;  1KQ9 A;  5E2C A;  1C23 A;  1WL9 A;  2GA2 A;  4ZWO A;  2MAT A;  2V6C A;  1QXY A;  1MAT A; 
#chains in the Genus database with same CATH homology
 1C27 A;  4IDY A;  4IKS A;  3MR1 A;  4MAT A;  4A6V A;  2BWV A;  2BHC A;  4RZZ A;  4U70 A;  4S00 A;  1B59 A;  1W2M A;  2EA4 A;  4S2R P;  4U1B A;  3Q6D A;  4U73 A;  4FUK A;  2EVC A;  1KQ0 A;  2OAZ A;  3PKE A;  3OOO A;  4ZWP A;  3CB6 A;  2BWW A;  5CE6 A;  2GG7 A;  4U76 A;  2V3X A;  3PKB A;  2ZSG A;  3FMQ A;  4A6W A;  2BHD A;  2Q96 A;  4RZY A;  2GU5 A;  4QR8 A;  1M35 A;  3IU7 A;  2GU7 A;  4R60 A;  2BWX A;  4S01 A;  2Q94 A;  1WKM A;  3PKA A;  3L7G A;  3PKC A;  5JI6 A;  2GU6 A;  2GG0 A;  2NQ6 A;  2Q92 A;  1WY2 A;  2NQ7 A;  4U6C A;  3BIT A;  1O0X A;  4IPA A;  5CNX A;  1B6A A;  4OOK A;  1C24 A;  1A16 A;  1BOA A;  5FCF A;  5E5B A;  2BH3 A;  3CB5 A;  2GG9 A;  4U6Z A;  5JHU A;  4EGE A;  1XGM A;  4U6W A;  2BN7 A;  2G6P A;  2Q95 A;  3FM3 A;  5JFR A;  5CDE A;  2Q93 A;  3MAT A;  4FLJ A;  5D6E A;  2BB7 A;  2GGC A;  4FKC A;  3BIP A;  2EA2 A;  3PN9 A;  1C22 A;  4FLK A;  2Q8K A;  3IU8 A;  3S6B A;  3IU9 A;  1KP0 A;  4IKT A;  1YJ3 A;  1CHM A;  3RVA A;  1Y1N A;  4ZNG A;  2BWU A;  2BHA A;  4FLI A;  4HXX A;  4U75 A;  2ADU A;  3PEB A;  3TAV A;  1WN1 A;  2IW2 A;  4S2T P;  3L24 A;  2V3Z A;  2BWT A;  2EVM A;  1WBQ A;  5CIK A;  4U71 A;  2GU4 A;  1R5G A;  2V3Y A;  1N51 A;  2P9A A;  4IF7 A;  3I7M A;  5FCH A;  1R58 A;  2GGB A;  4FO7 A;  1XGS A;  1YW8 A;  4FLL A;  4IEC A;  4IKR A;  3QOC A;  4ZWU A;  1XNZ A;  4U69 A;  2GG3 A;  3PKD A;  4IKU A;  2BWS A;  2BHB A;  5CDV A;  1QZY A;  3ROR A;  2B3H A;  3CTZ A;  2EVO A;  1QXZ A;  3IG4 A;  3O5V A;  1W7V A;  5CLS A;  3TB5 A;  2P99 A;  2OKN A;  4PV4 A;  4JUQ A;  4Z7M A;  3OVK A;  1BN5 A;  2BWY A;  1YVM A;  1YW9 A;  1JAW A;  2B3K A;  2DFI A;  1PV9 A;  2GG8 A;  3MX6 A;  3IL0 A;  3FMR A;  4KM3 A;  1XGN A;  4RGZ 1;  1YW7 A;  4B28 A;  1QXW A;  1XGO A;  2B3L A;  2HOW A;  5CDL A;  1R5H A;  2GZ5 A;  3BIQ A;  1C21 A;  2P98 A;  1WLR A;  4U6J A;  4FO8 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  2GG5 A;  2GTX A;  4PNC A;  4IU6 A;  3D27 A;  1KQ9 A;  5E2C A;  1C23 A;  1WL9 A;  2GA2 A;  4ZWO A;  2MAT A;  2V6C A;  1QXY A;  1MAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...