3BITA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
447
structure length
447
Chain Sequence
MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bitA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bitA02
3CB5A 1XGSA 2GGCA 5D6FA 4FUKA 2ADUA 4U69A 2G6PA 3CTZA 2P99A 1WBQA 2GG7A 3IU7A 2GU4A 5CLSA 1XGNA 2IW2A 4KM3A 2GU7A 1WN1A 4IKSA 3RVAA 2GG3A 3TAVA 2BWWA 4U75A 2B3KA 4S01A 3PEBA 4QR8A 4IKUA 2GG2A 5CE6A 4EGEA 3BITA 1QXZA 2GZ5A 1B6AA 4B28A 1QXYA 4IF7A 1CHMA 2P9AA 1N51A 2Q95A 1C22A 4U76A 2V3XA 1PV9A 4A6VA 1O0XA 2BHBA 4MATA 3L7GA 2GGBA 4PNCA 2BWYA 4A6WA 2V6CA 2BWUA 1WLRA 2BWTA 1W2MA 1YW9A 2BWSA 3IU8A 1R5GA 1YVMA 5CIKA 5E2CA 4PV4A 3I7MA 2V3YA 2EVCA 4S2TP 2MATA 2NQ7A 3IL0A 5E5BA 2B3HA 4S2RP 2GG9A 4HXXA 2BWXA 2Q92A 5CDEA 1C21A 2GU6A 3FMQA 3MR1A 2EVOA 2GTXA 1W7VA 3O5VA 2Q93A 5CDLA 1KP0A 5FCFA 2EVMA 1XNZA 2NQ6A 3MATA 4IU6A 1BOAA 2Q96A 2OAZA 2ZSGA 2BHCA 1Y1NA 2GA2A 5CDVA 2OKNA 1WKMA 3IU9A 1R5HA 2BWVA 5JI6A 2GU5A 3BIPA 4RGZ1 4S00A 3FM3A 3FMRA 4U6WA 3L24A 3OOOA 3TB5A 4IECA 1WL9A 1B59A 4FLJA 4U70A 2P98A 2BH3A 1C27A 4RZYA 2EA4A 2Q94A 2DFIA 1QXWA 1WY2A 3OVKA 4U71A 1R58A 4U6ZA 2B3LA 4FO7A 2BHDA 4R60A 2BHAA 4ZNGA 4U6EA 4FLKA 5D6EA 2HOWA 5JFRA 4ZWUA 4U6CA 4U73A 1WL6A 3MX6A 4FLIA 1QZYA 1XGOA 4IPAA 3CB6A 3PKCA 3D27A 3S6BA 2GG0A 4OOKA 2Q8KA 1KQ9A 4FO8A 5JHUA 1XGMA 2BN7A 1M35A 1YW8A 4Z7MA 1C24A 1MATA 1C23A 1YJ3A 5CNXA 3PKEA 2V3ZA 4RZZA 2BB7A 3BIQA 1KQ0A 3PKBA 5FCHA 3QOCA 3RORA 3Q6DA 1A16A 1JAWA 4IKTA 1YW7A 4U1BA 3PN9A 2GG5A 4FKCA 3PKAA 4U6JA 1BN5A 4FLLA 4ZWPA 4IDYA 4IKRA 4JUQA 2GG8A 3PKDA 4ZWOA 2EA2A 3IG4A
chains in the Genus database with same CATH superfamily
3CB5A 1XGSA 2GGCA 5D6FA 4FUKA 2ADUA 4U69A 2G6PA 3CTZA 2P99A 1WBQA 2GG7A 3IU7A 2GU4A 5CLSA 1XGNA 2IW2A 4KM3A 2GU7A 1WN1A 4IKSA 3RVAA 2GG3A 3TAVA 2BWWA 4U75A 2B3KA 4S01A 3PEBA 4QR8A 4IKUA 2GG2A 5CE6A 4EGEA 3BITA 1QXZA 2GZ5A 1B6AA 4B28A 1QXYA 4IF7A 1CHMA 2P9AA 1N51A 2Q95A 1C22A 4U76A 2V3XA 1PV9A 4A6VA 1O0XA 2BHBA 4MATA 3L7GA 2GGBA 4PNCA 2BWYA 4A6WA 2V6CA 2BWUA 1WLRA 2BWTA 1W2MA 1YW9A 2BWSA 3IU8A 1R5GA 1YVMA 5CIKA 5E2CA 4PV4A 3I7MA 2V3YA 2EVCA 4S2TP 2MATA 2NQ7A 3IL0A 5E5BA 2B3HA 4S2RP 2GG9A 4HXXA 2BWXA 2Q92A 5CDEA 1C21A 2GU6A 3FMQA 3MR1A 2EVOA 2GTXA 1W7VA 3O5VA 2Q93A 5CDLA 1KP0A 5FCFA 2EVMA 1XNZA 2NQ6A 3MATA 4IU6A 1BOAA 2Q96A 2OAZA 2ZSGA 2BHCA 1Y1NA 2GA2A 5CDVA 2OKNA 1WKMA 3IU9A 1R5HA 2BWVA 5JI6A 2GU5A 3BIPA 4RGZ1 4S00A 3FM3A 3FMRA 4U6WA 3L24A 3OOOA 3TB5A 4IECA 1WL9A 1B59A 4FLJA 4U70A 2P98A 2BH3A 1C27A 4RZYA 2EA4A 2Q94A 2DFIA 1QXWA 1WY2A 3OVKA 4U71A 1R58A 4U6ZA 2B3LA 4FO7A 2BHDA 4R60A 2BHAA 4ZNGA 4U6EA 4FLKA 5D6EA 2HOWA 5JFRA 4ZWUA 4U6CA 4U73A 1WL6A 3MX6A 4FLIA 1QZYA 1XGOA 4IPAA 3CB6A 3PKCA 3D27A 3S6BA 2GG0A 4OOKA 2Q8KA 1KQ9A 4FO8A 5JHUA 1XGMA 2BN7A 1M35A 1YW8A 4Z7MA 1C24A 1MATA 1C23A 1YJ3A 5CNXA 3PKEA 2V3ZA 4RZZA 2BB7A 3BIQA 1KQ0A 3PKBA 5FCHA 3QOCA 3RORA 3Q6DA 1A16A 1JAWA 4IKTA 1YW7A 4U1BA 3PN9A 2GG5A 4FKCA 3PKAA 4U6JA 1BN5A 4FLLA 4ZWPA 4IDYA 4IKRA 4JUQA 2GG8A 3PKDA 4ZWOA 2EA2A 3IG4A
chains in the Genus database with same CATH topology
3CB5A 1XGSA 2GGCA 5D6FA 4FUKA 2ADUA 4U69A 2G6PA 3CTZA 2P99A 1WBQA 2GG7A 3IU7A 2GU4A 5CLSA 1XGNA 2IW2A 4KM3A 2GU7A 1WN1A 4IKSA 3RVAA 2GG3A 3TAVA 2BWWA 4U75A 2B3KA 4S01A 3PEBA 4QR8A 4IKUA 2GG2A 5CE6A 4EGEA 3BITA 1QXZA 2GZ5A 1B6AA 4B28A 1QXYA 4IF7A 1CHMA 2P9AA 1N51A 2Q95A 1C22A 4U76A 2V3XA 1PV9A 4A6VA 1O0XA 2BHBA 4MATA 3L7GA 2GGBA 4PNCA 2BWYA 4A6WA 2V6CA 2BWUA 1WLRA 2BWTA 1W2MA 1YW9A 2BWSA 3IU8A 1R5GA 1YVMA 5CIKA 5E2CA 4PV4A 3I7MA 2V3YA 2EVCA 4S2TP 2MATA 2NQ7A 3IL0A 5E5BA 2B3HA 4S2RP 2GG9A 4HXXA 2BWXA 2Q92A 5CDEA 1C21A 2GU6A 3FMQA 3MR1A 2EVOA 2GTXA 1W7VA 3O5VA 2Q93A 5CDLA 1KP0A 5FCFA 2EVMA 1XNZA 2NQ6A 3MATA 4IU6A 1BOAA 2Q96A 2OAZA 2ZSGA 2BHCA 1Y1NA 2GA2A 5CDVA 2OKNA 1WKMA 3IU9A 1R5HA 2BWVA 5JI6A 2GU5A 3BIPA 4RGZ1 4S00A 3FM3A 3FMRA 4U6WA 3L24A 3OOOA 3TB5A 4IECA 1WL9A 1B59A 4FLJA 4U70A 2P98A 2BH3A 1C27A 4RZYA 2EA4A 2Q94A 2DFIA 1QXWA 1WY2A 3OVKA 4U71A 1R58A 4U6ZA 2B3LA 4FO7A 2BHDA 4R60A 2BHAA 4ZNGA 4U6EA 4FLKA 5D6EA 2HOWA 5JFRA 4ZWUA 4U6CA 4U73A 1WL6A 3MX6A 4FLIA 1QZYA 1XGOA 4IPAA 3CB6A 3PKCA 3D27A 3S6BA 2GG0A 4OOKA 2Q8KA 1KQ9A 4FO8A 5JHUA 1XGMA 2BN7A 1M35A 1YW8A 4Z7MA 1C24A 1MATA 1C23A 1YJ3A 5CNXA 3PKEA 2V3ZA 4RZZA 2BB7A 3BIQA 1KQ0A 3PKBA 5FCHA 3QOCA 3RORA 3Q6DA 1A16A 1JAWA 4IKTA 1YW7A 4U1BA 3PN9A 2GG5A 4FKCA 3PKAA 4U6JA 1BN5A 4FLLA 4ZWPA 4IDYA 4IKRA 4JUQA 2GG8A 3PKDA 4ZWOA 2EA2A 3IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CB5 A;  1XGS A;  2GGC A;  5D6F A;  4FUK A;  2ADU A;  4U69 A;  2G6P A;  3CTZ A;  2P99 A;  1WBQ A;  2GG7 A;  3IU7 A;  2GU4 A;  5CLS A;  1XGN A;  2IW2 A;  4KM3 A;  2GU7 A;  1WN1 A;  4IKS A;  3RVA A;  2GG3 A;  3TAV A;  2BWW A;  4U75 A;  2B3K A;  4S01 A;  3PEB A;  4QR8 A;  4IKU A;  2GG2 A;  5CE6 A;  4EGE A;  3BIT A;  1QXZ A;  2GZ5 A;  1B6A A;  4B28 A;  1QXY A;  4IF7 A;  1CHM A;  2P9A A;  1N51 A;  2Q95 A;  1C22 A;  4U76 A;  2V3X A;  1PV9 A;  4A6V A;  1O0X A;  2BHB A;  4MAT A;  3L7G A;  2GGB A;  4PNC A;  2BWY A;  4A6W A;  2V6C A;  2BWU A;  1WLR A;  2BWT A;  1W2M A;  1YW9 A;  2BWS A;  3IU8 A;  1R5G A;  1YVM A;  5CIK A;  5E2C A;  4PV4 A;  3I7M A;  2V3Y A;  2EVC A;  4S2T P;  2MAT A;  2NQ7 A;  3IL0 A;  5E5B A;  2B3H A;  4S2R P;  2GG9 A;  4HXX A;  2BWX A;  2Q92 A;  5CDE A;  1C21 A;  2GU6 A;  3FMQ A;  3MR1 A;  2EVO A;  2GTX A;  1W7V A;  3O5V A;  2Q93 A;  5CDL A;  1KP0 A;  5FCF A;  2EVM A;  1XNZ A;  2NQ6 A;  3MAT A;  4IU6 A;  1BOA A;  2Q96 A;  2OAZ A;  2ZSG A;  2BHC A;  1Y1N A;  2GA2 A;  5CDV A;  2OKN A;  1WKM A;  3IU9 A;  1R5H A;  2BWV A;  5JI6 A;  2GU5 A;  3BIP A;  4RGZ 1;  4S00 A;  3FM3 A;  3FMR A;  4U6W A;  3L24 A;  3OOO A;  3TB5 A;  4IEC A;  1WL9 A;  1B59 A;  4FLJ A;  4U70 A;  2P98 A;  2BH3 A;  1C27 A;  4RZY A;  2EA4 A;  2Q94 A;  2DFI A;  1QXW A;  1WY2 A;  3OVK A;  4U71 A;  1R58 A;  4U6Z A;  2B3L A;  4FO7 A;  2BHD A;  4R60 A;  2BHA A;  4ZNG A;  4U6E A;  4FLK A;  5D6E A;  2HOW A;  5JFR A;  4ZWU A;  4U6C A;  4U73 A;  1WL6 A;  3MX6 A;  4FLI A;  1QZY A;  1XGO A;  4IPA A;  3CB6 A;  3PKC A;  3D27 A;  3S6B A;  2GG0 A;  4OOK A;  2Q8K A;  1KQ9 A;  4FO8 A;  5JHU A;  1XGM A;  2BN7 A;  1M35 A;  1YW8 A;  4Z7M A;  1C24 A;  1MAT A;  1C23 A;  1YJ3 A;  5CNX A;  3PKE A;  2V3Z A;  4RZZ A;  2BB7 A;  3BIQ A;  1KQ0 A;  3PKB A;  5FCH A;  3QOC A;  3ROR A;  3Q6D A;  1A16 A;  1JAW A;  4IKT A;  1YW7 A;  4U1B A;  3PN9 A;  2GG5 A;  4FKC A;  3PKA A;  4U6J A;  1BN5 A;  4FLL A;  4ZWP A;  4IDY A;  4IKR A;  4JUQ A;  2GG8 A;  3PKD A;  4ZWO A;  2EA2 A;  3IG4 A; 
#chains in the Genus database with same CATH topology
 3CB5 A;  1XGS A;  2GGC A;  5D6F A;  4FUK A;  2ADU A;  4U69 A;  2G6P A;  3CTZ A;  2P99 A;  1WBQ A;  2GG7 A;  3IU7 A;  2GU4 A;  5CLS A;  1XGN A;  2IW2 A;  4KM3 A;  2GU7 A;  1WN1 A;  4IKS A;  3RVA A;  2GG3 A;  3TAV A;  2BWW A;  4U75 A;  2B3K A;  4S01 A;  3PEB A;  4QR8 A;  4IKU A;  2GG2 A;  5CE6 A;  4EGE A;  3BIT A;  1QXZ A;  2GZ5 A;  1B6A A;  4B28 A;  1QXY A;  4IF7 A;  1CHM A;  2P9A A;  1N51 A;  2Q95 A;  1C22 A;  4U76 A;  2V3X A;  1PV9 A;  4A6V A;  1O0X A;  2BHB A;  4MAT A;  3L7G A;  2GGB A;  4PNC A;  2BWY A;  4A6W A;  2V6C A;  2BWU A;  1WLR A;  2BWT A;  1W2M A;  1YW9 A;  2BWS A;  3IU8 A;  1R5G A;  1YVM A;  5CIK A;  5E2C A;  4PV4 A;  3I7M A;  2V3Y A;  2EVC A;  4S2T P;  2MAT A;  2NQ7 A;  3IL0 A;  5E5B A;  2B3H A;  4S2R P;  2GG9 A;  4HXX A;  2BWX A;  2Q92 A;  5CDE A;  1C21 A;  2GU6 A;  3FMQ A;  3MR1 A;  2EVO A;  2GTX A;  1W7V A;  3O5V A;  2Q93 A;  5CDL A;  1KP0 A;  5FCF A;  2EVM A;  1XNZ A;  2NQ6 A;  3MAT A;  4IU6 A;  1BOA A;  2Q96 A;  2OAZ A;  2ZSG A;  2BHC A;  1Y1N A;  2GA2 A;  5CDV A;  2OKN A;  1WKM A;  3IU9 A;  1R5H A;  2BWV A;  5JI6 A;  2GU5 A;  3BIP A;  4RGZ 1;  4S00 A;  3FM3 A;  3FMR A;  4U6W A;  3L24 A;  3OOO A;  3TB5 A;  4IEC A;  1WL9 A;  1B59 A;  4FLJ A;  4U70 A;  2P98 A;  2BH3 A;  1C27 A;  4RZY A;  2EA4 A;  2Q94 A;  2DFI A;  1QXW A;  1WY2 A;  3OVK A;  4U71 A;  1R58 A;  4U6Z A;  2B3L A;  4FO7 A;  2BHD A;  4R60 A;  2BHA A;  4ZNG A;  4U6E A;  4FLK A;  5D6E A;  2HOW A;  5JFR A;  4ZWU A;  4U6C A;  4U73 A;  1WL6 A;  3MX6 A;  4FLI A;  1QZY A;  1XGO A;  4IPA A;  3CB6 A;  3PKC A;  3D27 A;  3S6B A;  2GG0 A;  4OOK A;  2Q8K A;  1KQ9 A;  4FO8 A;  5JHU A;  1XGM A;  2BN7 A;  1M35 A;  1YW8 A;  4Z7M A;  1C24 A;  1MAT A;  1C23 A;  1YJ3 A;  5CNX A;  3PKE A;  2V3Z A;  4RZZ A;  2BB7 A;  3BIQ A;  1KQ0 A;  3PKB A;  5FCH A;  3QOC A;  3ROR A;  3Q6D A;  1A16 A;  1JAW A;  4IKT A;  1YW7 A;  4U1B A;  3PN9 A;  2GG5 A;  4FKC A;  3PKA A;  4U6J A;  1BN5 A;  4FLL A;  4ZWP A;  4IDY A;  4IKR A;  4JUQ A;  2GG8 A;  3PKD A;  4ZWO A;  2EA2 A;  3IG4 A; 
#chains in the Genus database with same CATH homology
 3CB5 A;  1XGS A;  2GGC A;  5D6F A;  4FUK A;  2ADU A;  4U69 A;  2G6P A;  3CTZ A;  2P99 A;  1WBQ A;  2GG7 A;  3IU7 A;  2GU4 A;  5CLS A;  1XGN A;  2IW2 A;  4KM3 A;  2GU7 A;  1WN1 A;  4IKS A;  3RVA A;  2GG3 A;  3TAV A;  2BWW A;  4U75 A;  2B3K A;  4S01 A;  3PEB A;  4QR8 A;  4IKU A;  2GG2 A;  5CE6 A;  4EGE A;  3BIT A;  1QXZ A;  2GZ5 A;  1B6A A;  4B28 A;  1QXY A;  4IF7 A;  1CHM A;  2P9A A;  1N51 A;  2Q95 A;  1C22 A;  4U76 A;  2V3X A;  1PV9 A;  4A6V A;  1O0X A;  2BHB A;  4MAT A;  3L7G A;  2GGB A;  4PNC A;  2BWY A;  4A6W A;  2V6C A;  2BWU A;  1WLR A;  2BWT A;  1W2M A;  1YW9 A;  2BWS A;  3IU8 A;  1R5G A;  1YVM A;  5CIK A;  5E2C A;  4PV4 A;  3I7M A;  2V3Y A;  2EVC A;  4S2T P;  2MAT A;  2NQ7 A;  3IL0 A;  5E5B A;  2B3H A;  4S2R P;  2GG9 A;  4HXX A;  2BWX A;  2Q92 A;  5CDE A;  1C21 A;  2GU6 A;  3FMQ A;  3MR1 A;  2EVO A;  2GTX A;  1W7V A;  3O5V A;  2Q93 A;  5CDL A;  1KP0 A;  5FCF A;  2EVM A;  1XNZ A;  2NQ6 A;  3MAT A;  4IU6 A;  1BOA A;  2Q96 A;  2OAZ A;  2ZSG A;  2BHC A;  1Y1N A;  2GA2 A;  5CDV A;  2OKN A;  1WKM A;  3IU9 A;  1R5H A;  2BWV A;  5JI6 A;  2GU5 A;  3BIP A;  4RGZ 1;  4S00 A;  3FM3 A;  3FMR A;  4U6W A;  3L24 A;  3OOO A;  3TB5 A;  4IEC A;  1WL9 A;  1B59 A;  4FLJ A;  4U70 A;  2P98 A;  2BH3 A;  1C27 A;  4RZY A;  2EA4 A;  2Q94 A;  2DFI A;  1QXW A;  1WY2 A;  3OVK A;  4U71 A;  1R58 A;  4U6Z A;  2B3L A;  4FO7 A;  2BHD A;  4R60 A;  2BHA A;  4ZNG A;  4U6E A;  4FLK A;  5D6E A;  2HOW A;  5JFR A;  4ZWU A;  4U6C A;  4U73 A;  1WL6 A;  3MX6 A;  4FLI A;  1QZY A;  1XGO A;  4IPA A;  3CB6 A;  3PKC A;  3D27 A;  3S6B A;  2GG0 A;  4OOK A;  2Q8K A;  1KQ9 A;  4FO8 A;  5JHU A;  1XGM A;  2BN7 A;  1M35 A;  1YW8 A;  4Z7M A;  1C24 A;  1MAT A;  1C23 A;  1YJ3 A;  5CNX A;  3PKE A;  2V3Z A;  4RZZ A;  2BB7 A;  3BIQ A;  1KQ0 A;  3PKB A;  5FCH A;  3QOC A;  3ROR A;  3Q6D A;  1A16 A;  1JAW A;  4IKT A;  1YW7 A;  4U1B A;  3PN9 A;  2GG5 A;  4FKC A;  3PKA A;  4U6J A;  1BN5 A;  4FLL A;  4ZWP A;  4IDY A;  4IKR A;  4JUQ A;  2GG8 A;  3PKD A;  4ZWO A;  2EA2 A;  3IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...