3BITA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
447
structure length
447
Chain Sequence
MEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 158
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bitA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bitA02
4U75A 1XGSA 1C23A 5CIKA 4S00A 1WLRA 2V3ZA 3CB6A 3RVAA 2BB7A 4IKUA 2BWVA 4RGZ1 1O0XA 2P99A 3PKEA 4ZNGA 5E2CA 5CDEA 3RORA 1WY2A 3IU8A 2BWWA 1QXWA 2GG7A 3Q6DA 5FCHA 4IU6A 4KM3A 2HOWA 2ZSGA 3OOOA 4PNCA 4IF7A 1QXYA 4FLJA 3FMRA 2GU4A 2GU7A 2BWSA 1M35A 5JI6A 3I7MA 2OAZA 5JFRA 2GG3A 3L24A 2GG9A 2P9AA 2EA2A 3TAVA 4IKRA 4ZWPA 2G6PA 1XNZA 2Q95A 2Q93A 3O5VA 1W2MA 4FO8A 2EVMA 2NQ7A 4U1BA 2BWYA 4U73A 3PKDA 3FM3A 2BHDA 5FCFA 5CDLA 2GG5A 4RZYA 5JHUA 2P98A 2BHCA 1WL6A 1YW8A 3PEBA 1B6AA 4HXXA 4U76A 3BITA 1YVMA 4MATA 2B3HA 4U6CA 1KQ0A 1BOAA 2V3XA 3CB5A 2V3YA 1WKMA 1YW9A 3MX6A 4IECA 4Z7MA 4EGEA 1XGOA 3L7GA 3IG4A 2DFIA 2GG8A 2OKNA 1YW7A 4A6VA 4ZWUA 1B59A 5CNXA 3TB5A 2EVCA 1A16A 4U71A 2ADUA 4IDYA 3FMQA 4ZWOA 2GU6A 4OOKA 1R58A 5CLSA 2IW2A 2NQ6A 1CHMA 1XGNA 2B3LA 2B3KA 4FUKA 4RZZA 4S01A 2GA2A 4FLKA 4IKSA 1WN1A 1WL9A 1KQ9A 3IU7A 2BHBA 3CTZA 4QR8A 4S2TP 1QXZA 2GGBA 2GU5A 3PN9A 3BIQA 2Q92A 2BWXA 2V6CA 3PKBA 1R5HA 1XGMA 2GG0A 4FO7A 2Q96A 4U6ZA 2BN7A 5D6EA 2MATA 5CE6A 1YJ3A 1N51A 2BH3A 4JUQA 4U6EA 1JAWA 1C22A 4U69A 1KP0A 3BIPA 1W7VA 1BN5A 2EVOA 2BHAA 4A6WA 5D6FA 4U6JA 2GG2A 3S6BA 1WBQA 2GGCA 3D27A 4FLLA 2Q8KA 1Y1NA 1C27A 3IL0A 3PKCA 2GZ5A 4FKCA 2EA4A 3MATA 3QOCA 4U70A 1QZYA 3MR1A 1R5GA 5CDVA 1C21A 1C24A 2BWUA 3IU9A 1PV9A 4IKTA 4S2RP 1MATA 2BWTA 4R60A 3PKAA 5E5BA 3OVKA 2GTXA 4IPAA 2Q94A 4B28A 4FLIA 4U6WA 4PV4A
chains in the Genus database with same CATH superfamily
4U75A 1XGSA 1C23A 5CIKA 4S00A 1WLRA 2V3ZA 3CB6A 3RVAA 2BB7A 4IKUA 2BWVA 4RGZ1 1O0XA 2P99A 3PKEA 4ZNGA 5E2CA 5CDEA 3RORA 1WY2A 3IU8A 2BWWA 1QXWA 2GG7A 3Q6DA 5FCHA 4IU6A 4KM3A 2HOWA 2ZSGA 3OOOA 4PNCA 4IF7A 1QXYA 4FLJA 3FMRA 2GU4A 2GU7A 2BWSA 1M35A 5JI6A 3I7MA 2OAZA 5JFRA 2GG3A 3L24A 2GG9A 2P9AA 2EA2A 3TAVA 4IKRA 4ZWPA 2G6PA 1XNZA 2Q95A 2Q93A 3O5VA 1W2MA 4FO8A 2EVMA 2NQ7A 4U1BA 2BWYA 4U73A 3PKDA 3FM3A 2BHDA 5FCFA 5CDLA 2GG5A 4RZYA 5JHUA 2P98A 2BHCA 1WL6A 1YW8A 3PEBA 1B6AA 4HXXA 4U76A 3BITA 1YVMA 4MATA 2B3HA 4U6CA 1KQ0A 1BOAA 2V3XA 3CB5A 2V3YA 1WKMA 1YW9A 3MX6A 4IECA 4Z7MA 4EGEA 1XGOA 3L7GA 3IG4A 2DFIA 2GG8A 2OKNA 1YW7A 4A6VA 4ZWUA 1B59A 5CNXA 3TB5A 2EVCA 1A16A 4U71A 2ADUA 4IDYA 3FMQA 4ZWOA 2GU6A 4OOKA 1R58A 5CLSA 2IW2A 2NQ6A 1CHMA 1XGNA 2B3LA 2B3KA 4FUKA 4RZZA 4S01A 2GA2A 4FLKA 4IKSA 1WN1A 1WL9A 1KQ9A 3IU7A 2BHBA 3CTZA 4QR8A 4S2TP 1QXZA 2GGBA 2GU5A 3PN9A 3BIQA 2Q92A 2BWXA 2V6CA 3PKBA 1R5HA 1XGMA 2GG0A 4FO7A 2Q96A 4U6ZA 2BN7A 5D6EA 2MATA 5CE6A 1YJ3A 1N51A 2BH3A 4JUQA 4U6EA 1JAWA 1C22A 4U69A 1KP0A 3BIPA 1W7VA 1BN5A 2EVOA 2BHAA 4A6WA 5D6FA 4U6JA 2GG2A 3S6BA 1WBQA 2GGCA 3D27A 4FLLA 2Q8KA 1Y1NA 1C27A 3IL0A 3PKCA 2GZ5A 4FKCA 2EA4A 3MATA 3QOCA 4U70A 1QZYA 3MR1A 1R5GA 5CDVA 1C21A 1C24A 2BWUA 3IU9A 1PV9A 4IKTA 4S2RP 1MATA 2BWTA 4R60A 3PKAA 5E5BA 3OVKA 2GTXA 4IPAA 2Q94A 4B28A 4FLIA 4U6WA 4PV4A
chains in the Genus database with same CATH topology
4U75A 1XGSA 1C23A 5CIKA 4S00A 1WLRA 2V3ZA 3CB6A 3RVAA 2BB7A 4IKUA 2BWVA 4RGZ1 1O0XA 2P99A 3PKEA 4ZNGA 5E2CA 5CDEA 3RORA 1WY2A 3IU8A 2BWWA 1QXWA 2GG7A 3Q6DA 5FCHA 4IU6A 4KM3A 2HOWA 2ZSGA 3OOOA 4PNCA 4IF7A 1QXYA 4FLJA 3FMRA 2GU4A 2GU7A 2BWSA 1M35A 5JI6A 3I7MA 2OAZA 5JFRA 2GG3A 3L24A 2GG9A 2P9AA 2EA2A 3TAVA 4IKRA 4ZWPA 2G6PA 1XNZA 2Q95A 2Q93A 3O5VA 1W2MA 4FO8A 2EVMA 2NQ7A 4U1BA 2BWYA 4U73A 3PKDA 3FM3A 2BHDA 5FCFA 5CDLA 2GG5A 4RZYA 5JHUA 2P98A 2BHCA 1WL6A 1YW8A 3PEBA 1B6AA 4HXXA 4U76A 3BITA 1YVMA 4MATA 2B3HA 4U6CA 1KQ0A 1BOAA 2V3XA 3CB5A 2V3YA 1WKMA 1YW9A 3MX6A 4IECA 4Z7MA 4EGEA 1XGOA 3L7GA 3IG4A 2DFIA 2GG8A 2OKNA 1YW7A 4A6VA 4ZWUA 1B59A 5CNXA 3TB5A 2EVCA 1A16A 4U71A 2ADUA 4IDYA 3FMQA 4ZWOA 2GU6A 4OOKA 1R58A 5CLSA 2IW2A 2NQ6A 1CHMA 1XGNA 2B3LA 2B3KA 4FUKA 4RZZA 4S01A 2GA2A 4FLKA 4IKSA 1WN1A 1WL9A 1KQ9A 3IU7A 2BHBA 3CTZA 4QR8A 4S2TP 1QXZA 2GGBA 2GU5A 3PN9A 3BIQA 2Q92A 2BWXA 2V6CA 3PKBA 1R5HA 1XGMA 2GG0A 4FO7A 2Q96A 4U6ZA 2BN7A 5D6EA 2MATA 5CE6A 1YJ3A 1N51A 2BH3A 4JUQA 4U6EA 1JAWA 1C22A 4U69A 1KP0A 3BIPA 1W7VA 1BN5A 2EVOA 2BHAA 4A6WA 5D6FA 4U6JA 2GG2A 3S6BA 1WBQA 2GGCA 3D27A 4FLLA 2Q8KA 1Y1NA 1C27A 3IL0A 3PKCA 2GZ5A 4FKCA 2EA4A 3MATA 3QOCA 4U70A 1QZYA 3MR1A 1R5GA 5CDVA 1C21A 1C24A 2BWUA 3IU9A 1PV9A 4IKTA 4S2RP 1MATA 2BWTA 4R60A 3PKAA 5E5BA 3OVKA 2GTXA 4IPAA 2Q94A 4B28A 4FLIA 4U6WA 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U75 A;  1XGS A;  1C23 A;  5CIK A;  4S00 A;  1WLR A;  2V3Z A;  3CB6 A;  3RVA A;  2BB7 A;  4IKU A;  2BWV A;  4RGZ 1;  1O0X A;  2P99 A;  3PKE A;  4ZNG A;  5E2C A;  5CDE A;  3ROR A;  1WY2 A;  3IU8 A;  2BWW A;  1QXW A;  2GG7 A;  3Q6D A;  5FCH A;  4IU6 A;  4KM3 A;  2HOW A;  2ZSG A;  3OOO A;  4PNC A;  4IF7 A;  1QXY A;  4FLJ A;  3FMR A;  2GU4 A;  2GU7 A;  2BWS A;  1M35 A;  5JI6 A;  3I7M A;  2OAZ A;  5JFR A;  2GG3 A;  3L24 A;  2GG9 A;  2P9A A;  2EA2 A;  3TAV A;  4IKR A;  4ZWP A;  2G6P A;  1XNZ A;  2Q95 A;  2Q93 A;  3O5V A;  1W2M A;  4FO8 A;  2EVM A;  2NQ7 A;  4U1B A;  2BWY A;  4U73 A;  3PKD A;  3FM3 A;  2BHD A;  5FCF A;  5CDL A;  2GG5 A;  4RZY A;  5JHU A;  2P98 A;  2BHC A;  1WL6 A;  1YW8 A;  3PEB A;  1B6A A;  4HXX A;  4U76 A;  3BIT A;  1YVM A;  4MAT A;  2B3H A;  4U6C A;  1KQ0 A;  1BOA A;  2V3X A;  3CB5 A;  2V3Y A;  1WKM A;  1YW9 A;  3MX6 A;  4IEC A;  4Z7M A;  4EGE A;  1XGO A;  3L7G A;  3IG4 A;  2DFI A;  2GG8 A;  2OKN A;  1YW7 A;  4A6V A;  4ZWU A;  1B59 A;  5CNX A;  3TB5 A;  2EVC A;  1A16 A;  4U71 A;  2ADU A;  4IDY A;  3FMQ A;  4ZWO A;  2GU6 A;  4OOK A;  1R58 A;  5CLS A;  2IW2 A;  2NQ6 A;  1CHM A;  1XGN A;  2B3L A;  2B3K A;  4FUK A;  4RZZ A;  4S01 A;  2GA2 A;  4FLK A;  4IKS A;  1WN1 A;  1WL9 A;  1KQ9 A;  3IU7 A;  2BHB A;  3CTZ A;  4QR8 A;  4S2T P;  1QXZ A;  2GGB A;  2GU5 A;  3PN9 A;  3BIQ A;  2Q92 A;  2BWX A;  2V6C A;  3PKB A;  1R5H A;  1XGM A;  2GG0 A;  4FO7 A;  2Q96 A;  4U6Z A;  2BN7 A;  5D6E A;  2MAT A;  5CE6 A;  1YJ3 A;  1N51 A;  2BH3 A;  4JUQ A;  4U6E A;  1JAW A;  1C22 A;  4U69 A;  1KP0 A;  3BIP A;  1W7V A;  1BN5 A;  2EVO A;  2BHA A;  4A6W A;  5D6F A;  4U6J A;  2GG2 A;  3S6B A;  1WBQ A;  2GGC A;  3D27 A;  4FLL A;  2Q8K A;  1Y1N A;  1C27 A;  3IL0 A;  3PKC A;  2GZ5 A;  4FKC A;  2EA4 A;  3MAT A;  3QOC A;  4U70 A;  1QZY A;  3MR1 A;  1R5G A;  5CDV A;  1C21 A;  1C24 A;  2BWU A;  3IU9 A;  1PV9 A;  4IKT A;  4S2R P;  1MAT A;  2BWT A;  4R60 A;  3PKA A;  5E5B A;  3OVK A;  2GTX A;  4IPA A;  2Q94 A;  4B28 A;  4FLI A;  4U6W A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 4U75 A;  1XGS A;  1C23 A;  5CIK A;  4S00 A;  1WLR A;  2V3Z A;  3CB6 A;  3RVA A;  2BB7 A;  4IKU A;  2BWV A;  4RGZ 1;  1O0X A;  2P99 A;  3PKE A;  4ZNG A;  5E2C A;  5CDE A;  3ROR A;  1WY2 A;  3IU8 A;  2BWW A;  1QXW A;  2GG7 A;  3Q6D A;  5FCH A;  4IU6 A;  4KM3 A;  2HOW A;  2ZSG A;  3OOO A;  4PNC A;  4IF7 A;  1QXY A;  4FLJ A;  3FMR A;  2GU4 A;  2GU7 A;  2BWS A;  1M35 A;  5JI6 A;  3I7M A;  2OAZ A;  5JFR A;  2GG3 A;  3L24 A;  2GG9 A;  2P9A A;  2EA2 A;  3TAV A;  4IKR A;  4ZWP A;  2G6P A;  1XNZ A;  2Q95 A;  2Q93 A;  3O5V A;  1W2M A;  4FO8 A;  2EVM A;  2NQ7 A;  4U1B A;  2BWY A;  4U73 A;  3PKD A;  3FM3 A;  2BHD A;  5FCF A;  5CDL A;  2GG5 A;  4RZY A;  5JHU A;  2P98 A;  2BHC A;  1WL6 A;  1YW8 A;  3PEB A;  1B6A A;  4HXX A;  4U76 A;  3BIT A;  1YVM A;  4MAT A;  2B3H A;  4U6C A;  1KQ0 A;  1BOA A;  2V3X A;  3CB5 A;  2V3Y A;  1WKM A;  1YW9 A;  3MX6 A;  4IEC A;  4Z7M A;  4EGE A;  1XGO A;  3L7G A;  3IG4 A;  2DFI A;  2GG8 A;  2OKN A;  1YW7 A;  4A6V A;  4ZWU A;  1B59 A;  5CNX A;  3TB5 A;  2EVC A;  1A16 A;  4U71 A;  2ADU A;  4IDY A;  3FMQ A;  4ZWO A;  2GU6 A;  4OOK A;  1R58 A;  5CLS A;  2IW2 A;  2NQ6 A;  1CHM A;  1XGN A;  2B3L A;  2B3K A;  4FUK A;  4RZZ A;  4S01 A;  2GA2 A;  4FLK A;  4IKS A;  1WN1 A;  1WL9 A;  1KQ9 A;  3IU7 A;  2BHB A;  3CTZ A;  4QR8 A;  4S2T P;  1QXZ A;  2GGB A;  2GU5 A;  3PN9 A;  3BIQ A;  2Q92 A;  2BWX A;  2V6C A;  3PKB A;  1R5H A;  1XGM A;  2GG0 A;  4FO7 A;  2Q96 A;  4U6Z A;  2BN7 A;  5D6E A;  2MAT A;  5CE6 A;  1YJ3 A;  1N51 A;  2BH3 A;  4JUQ A;  4U6E A;  1JAW A;  1C22 A;  4U69 A;  1KP0 A;  3BIP A;  1W7V A;  1BN5 A;  2EVO A;  2BHA A;  4A6W A;  5D6F A;  4U6J A;  2GG2 A;  3S6B A;  1WBQ A;  2GGC A;  3D27 A;  4FLL A;  2Q8K A;  1Y1N A;  1C27 A;  3IL0 A;  3PKC A;  2GZ5 A;  4FKC A;  2EA4 A;  3MAT A;  3QOC A;  4U70 A;  1QZY A;  3MR1 A;  1R5G A;  5CDV A;  1C21 A;  1C24 A;  2BWU A;  3IU9 A;  1PV9 A;  4IKT A;  4S2R P;  1MAT A;  2BWT A;  4R60 A;  3PKA A;  5E5B A;  3OVK A;  2GTX A;  4IPA A;  2Q94 A;  4B28 A;  4FLI A;  4U6W A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 4U75 A;  1XGS A;  1C23 A;  5CIK A;  4S00 A;  1WLR A;  2V3Z A;  3CB6 A;  3RVA A;  2BB7 A;  4IKU A;  2BWV A;  4RGZ 1;  1O0X A;  2P99 A;  3PKE A;  4ZNG A;  5E2C A;  5CDE A;  3ROR A;  1WY2 A;  3IU8 A;  2BWW A;  1QXW A;  2GG7 A;  3Q6D A;  5FCH A;  4IU6 A;  4KM3 A;  2HOW A;  2ZSG A;  3OOO A;  4PNC A;  4IF7 A;  1QXY A;  4FLJ A;  3FMR A;  2GU4 A;  2GU7 A;  2BWS A;  1M35 A;  5JI6 A;  3I7M A;  2OAZ A;  5JFR A;  2GG3 A;  3L24 A;  2GG9 A;  2P9A A;  2EA2 A;  3TAV A;  4IKR A;  4ZWP A;  2G6P A;  1XNZ A;  2Q95 A;  2Q93 A;  3O5V A;  1W2M A;  4FO8 A;  2EVM A;  2NQ7 A;  4U1B A;  2BWY A;  4U73 A;  3PKD A;  3FM3 A;  2BHD A;  5FCF A;  5CDL A;  2GG5 A;  4RZY A;  5JHU A;  2P98 A;  2BHC A;  1WL6 A;  1YW8 A;  3PEB A;  1B6A A;  4HXX A;  4U76 A;  3BIT A;  1YVM A;  4MAT A;  2B3H A;  4U6C A;  1KQ0 A;  1BOA A;  2V3X A;  3CB5 A;  2V3Y A;  1WKM A;  1YW9 A;  3MX6 A;  4IEC A;  4Z7M A;  4EGE A;  1XGO A;  3L7G A;  3IG4 A;  2DFI A;  2GG8 A;  2OKN A;  1YW7 A;  4A6V A;  4ZWU A;  1B59 A;  5CNX A;  3TB5 A;  2EVC A;  1A16 A;  4U71 A;  2ADU A;  4IDY A;  3FMQ A;  4ZWO A;  2GU6 A;  4OOK A;  1R58 A;  5CLS A;  2IW2 A;  2NQ6 A;  1CHM A;  1XGN A;  2B3L A;  2B3K A;  4FUK A;  4RZZ A;  4S01 A;  2GA2 A;  4FLK A;  4IKS A;  1WN1 A;  1WL9 A;  1KQ9 A;  3IU7 A;  2BHB A;  3CTZ A;  4QR8 A;  4S2T P;  1QXZ A;  2GGB A;  2GU5 A;  3PN9 A;  3BIQ A;  2Q92 A;  2BWX A;  2V6C A;  3PKB A;  1R5H A;  1XGM A;  2GG0 A;  4FO7 A;  2Q96 A;  4U6Z A;  2BN7 A;  5D6E A;  2MAT A;  5CE6 A;  1YJ3 A;  1N51 A;  2BH3 A;  4JUQ A;  4U6E A;  1JAW A;  1C22 A;  4U69 A;  1KP0 A;  3BIP A;  1W7V A;  1BN5 A;  2EVO A;  2BHA A;  4A6W A;  5D6F A;  4U6J A;  2GG2 A;  3S6B A;  1WBQ A;  2GGC A;  3D27 A;  4FLL A;  2Q8K A;  1Y1N A;  1C27 A;  3IL0 A;  3PKC A;  2GZ5 A;  4FKC A;  2EA4 A;  3MAT A;  3QOC A;  4U70 A;  1QZY A;  3MR1 A;  1R5G A;  5CDV A;  1C21 A;  1C24 A;  2BWU A;  3IU9 A;  1PV9 A;  4IKT A;  4S2R P;  1MAT A;  2BWT A;  4R60 A;  3PKA A;  5E5B A;  3OVK A;  2GTX A;  4IPA A;  2Q94 A;  4B28 A;  4FLI A;  4U6W A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...